F492990

General Info

Members Datasets Scaffolds Average Seq Length
1322 375 2644 98

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10796608|Ga0105242_107966082
Length 120
Sequence VHASQVILAPIVSEKSYAASVRGSYTFRVHPDAHKTQIRQAVEELFEVKVTRVNVIKVQSKPKRRGLFRGTRPGWKKAVVQLRAGDTIEIFEGAQIYCPCAGSSRRAPAAATCRCPTSPR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
139 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
140 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
141 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
142 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
143 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
144 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
145 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
146 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
147 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
148 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
218 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
219 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
231 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
232 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
262 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
263 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
266 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
267 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
347 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
366 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
367 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
370 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 1.59
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10796608 3300009176 Bacteria 935
2 ARcpr5yngRDRAFT_c002193 3300000043 Bacteria 2052
3 ARSoilOldRDRAFT_c001271 3300000044 Bacteria 2388
4 ARCol0yngRDRAFT_1006257 3300000652 Bacteria 855
5 JGI24746J21847_1019833 3300001977 Unclassified 946
6 JGI24746J21847_1032839 3300001977 Bacteria 716
7 JGI24747J21853_1017587 3300001978 Unclassified 762
8 JGI24743J22301_10002688 3300001991 Bacteria 2719
9 JGI24745J21846_1003433 3300002073 Bacteria 1657
10 JGI24748J21848_1014638 3300002074 Bacteria 931
11 JGI24738J21930_10024157 3300002075 Unclassified 1251
12 JGI24749J21850_1032000 3300002076 Unclassified 757
13 JGI24744J21845_10034617 3300002077 Bacteria 957
14 JGI24034J26672_10032208 3300002239 Bacteria 858
15 JGI24742J22300_10038875 3300002244 Bacteria 845
16 JGI24742J22300_10094405 3300002244 Unclassified 574
17 JGI25406J46586_10052208 3300003203 Bacteria 1363
18 JGI25407J50210_10046114 3300003373 Bacteria 1110
19 JGI25407J50210_10162107 3300003373 Bacteria 551
20 JGI25407J50210_10163917 3300003373 Bacteria 548
21 JGI25407J50210_10173795 3300003373 Bacteria 531
22 JGI25404J52841_10077625 3300003659 Bacteria 694
23 JGI25405J52794_10051634 3300003911 Bacteria 882
24 JGI25405J52794_10067261 3300003911 Bacteria 779
25 Ga0058863_11803168 3300004799 Bacteria 903
26 Ga0058863_11847184 3300004799 Bacteria 521
27 Ga0058861_11857066 3300004800 Bacteria 600
28 Ga0058860_12111299 3300004801 Bacteria 562
29 Ga0058862_12576965 3300004803 Bacteria 802
30 Ga0065712_10761830 3300005290 Bacteria 525
31 Ga0070658_10338143 3300005327 Bacteria 1287
32 Ga0070658_10471734 3300005327 Bacteria 1082
33 Ga0070658_10755162 3300005327 Bacteria 844
34 Ga0070658_11002223 3300005327 Bacteria 726
35 Ga0070676_10111060 3300005328 Bacteria 1707
36 Ga0070676_10162187 3300005328 Bacteria 1440
37 Ga0070676_10317199 3300005328 Bacteria 1062
38 Ga0070683_100040915 3300005329 Bacteria 4262
39 Ga0070683_100048587 3300005329 Bacteria 3923
40 Ga0070683_100052862 3300005329 Bacteria 3764
41 Ga0070683_100073949 3300005329 Bacteria 3182
42 Ga0070683_100083711 3300005329 Bacteria 2988
43 Ga0070683_100095159 3300005329 Bacteria 2800
44 Ga0070683_100124380 3300005329 Bacteria 2437
45 Ga0070683_100150245 3300005329 Bacteria 2208
46 Ga0070683_100160411 3300005329 Bacteria 2133
47 Ga0070683_100211490 3300005329 Bacteria 1842
48 Ga0070683_100215027 3300005329 Bacteria 1827
49 Ga0070683_100237222 3300005329 Bacteria 1734
50 Ga0070683_100339785 3300005329 Bacteria 1430
51 Ga0070683_100414687 3300005329 Bacteria 1284
52 Ga0070683_100547342 3300005329 Bacteria 1106
53 Ga0070683_100697187 3300005329 Bacteria 972
54 Ga0070683_100961623 3300005329 Bacteria 820
55 Ga0070683_101608715 3300005329 Bacteria 625
56 Ga0070690_100187345 3300005330 Bacteria 1433
57 Ga0070690_101214059 3300005330 Bacteria 602
58 Ga0070690_101275973 3300005330 Bacteria 588
59 Ga0070690_101368001 3300005330 Bacteria 569
60 Ga0070670_101124851 3300005331 Bacteria 716
61 Ga0070677_10110877 3300005333 Bacteria 1224
62 Ga0068869_100096752 3300005334 Bacteria 2229
63 Ga0068869_100210538 3300005334 Bacteria 1537
64 Ga0068869_100610926 3300005334 Bacteria 922
65 Ga0068869_100722528 3300005334 Bacteria 851
66 Ga0068869_101223944 3300005334 Bacteria 660
67 Ga0068869_101410726 3300005334 Bacteria 617
68 Ga0070666_10095510 3300005335 Bacteria 2046
69 Ga0070666_10245177 3300005335 Bacteria 1267
70 Ga0070666_11003415 3300005335 Bacteria 619
71 Ga0070666_11486220 3300005335 Bacteria 507
72 Ga0070680_100037493 3300005336 Bacteria 3917
73 Ga0070680_100040374 3300005336 Bacteria 3778
74 Ga0070680_100052241 3300005336 Bacteria 3336
75 Ga0070680_100062879 3300005336 Bacteria 3040
76 Ga0070680_100082971 3300005336 Bacteria 2647
77 Ga0070680_100104181 3300005336 Bacteria 2357
78 Ga0070680_100307064 3300005336 Bacteria 1345
79 Ga0070680_100314757 3300005336 Bacteria 1328
80 Ga0070680_100480035 3300005336 Bacteria 1062
81 Ga0070680_100607620 3300005336 Bacteria 939
82 Ga0070680_100669331 3300005336 Bacteria 892
83 Ga0070680_101227071 3300005336 Bacteria 649
84 Ga0070682_100023242 3300005337 Bacteria 3680
85 Ga0070682_100024543 3300005337 Bacteria 3589
86 Ga0070682_100050306 3300005337 Bacteria 2601
87 Ga0070682_100061757 3300005337 Bacteria 2372
88 Ga0070682_100205027 3300005337 Bacteria 1393
89 Ga0070682_100337880 3300005337 Bacteria 1118
90 Ga0070682_100890487 3300005337 Bacteria 730
91 Ga0070682_101301371 3300005337 Bacteria 617
92 Ga0068868_100020690 3300005338 Bacteria 4949
93 Ga0068868_100132660 3300005338 Bacteria 2039
94 Ga0068868_100204793 3300005338 Bacteria 1646
95 Ga0068868_100221410 3300005338 Bacteria 1584
96 Ga0068868_100381634 3300005338 Bacteria 1213
97 Ga0068868_100403804 3300005338 Bacteria 1180
98 Ga0068868_100576107 3300005338 Bacteria 995
99 Ga0068868_100615583 3300005338 Bacteria 963
100 Ga0068868_100636158 3300005338 Bacteria 948
101 Ga0068868_100992494 3300005338 Bacteria 768
102 Ga0068868_101159921 3300005338 Bacteria 713
103 Ga0068868_101959346 3300005338 Bacteria 555
104 Ga0070660_100019891 3300005339 Bacteria 4925
105 Ga0070660_100030868 3300005339 Bacteria 4021
106 Ga0070660_100053710 3300005339 Bacteria 3108
107 Ga0070660_100061092 3300005339 Bacteria 2925
108 Ga0070660_100075848 3300005339 Bacteria 2633
109 Ga0070660_100093346 3300005339 Bacteria 2376
110 Ga0070660_100102442 3300005339 Bacteria 2269
111 Ga0070660_100111951 3300005339 Bacteria 2172
112 Ga0070660_100469627 3300005339 Bacteria 1045
113 Ga0070660_100491955 3300005339 Bacteria 1020
114 Ga0070660_100511450 3300005339 Bacteria 999
115 Ga0070660_100539554 3300005339 Bacteria 972
116 Ga0070660_100649005 3300005339 Bacteria 884
117 Ga0070660_100832672 3300005339 Bacteria 777
118 Ga0070660_100876146 3300005339 Bacteria 756
119 Ga0070660_100878257 3300005339 Bacteria 755
120 Ga0070660_101686143 3300005339 Bacteria 540
121 Ga0070689_100149525 3300005340 Bacteria 1883
122 Ga0070689_100150835 3300005340 Bacteria 1874
123 Ga0070689_100879152 3300005340 Bacteria 792
124 Ga0070691_10042499 3300005341 Bacteria 2151
125 Ga0070691_10160493 3300005341 Bacteria 1158
126 Ga0070691_10212776 3300005341 Bacteria 1021
127 Ga0070691_10714737 3300005341 Bacteria 603
128 Ga0070687_100100199 3300005343 Bacteria 1620
129 Ga0070687_100132113 3300005343 Bacteria 1442
130 Ga0070687_100430243 3300005343 Bacteria 873
131 Ga0070661_100036270 3300005344 Bacteria 3584
132 Ga0070661_100087407 3300005344 Bacteria 2305
133 Ga0070661_100316748 3300005344 Bacteria 1217
134 Ga0070661_100326876 3300005344 Bacteria 1199
135 Ga0070661_100401730 3300005344 Bacteria 1083
136 Ga0070661_100460829 3300005344 Bacteria 1012
137 Ga0070661_100785089 3300005344 Bacteria 781
138 Ga0070661_100826212 3300005344 Bacteria 761
139 Ga0070661_101135922 3300005344 Bacteria 652
140 Ga0070692_10063167 3300005345 Bacteria 1956
141 Ga0070692_10111824 3300005345 Bacteria 1512
142 Ga0070692_10295645 3300005345 Bacteria 987
143 Ga0070692_10369317 3300005345 Bacteria 897
144 Ga0070692_10603469 3300005345 Bacteria 726
145 Ga0070668_100044085 3300005347 Bacteria 3421
146 Ga0070668_100120284 3300005347 Bacteria 2098
147 Ga0070668_100156277 3300005347 Bacteria 1848
148 Ga0070668_100421446 3300005347 Bacteria 1143
149 Ga0070668_101833698 3300005347 Bacteria 558
150 Ga0070669_100062879 3300005353 Bacteria 2730
151 Ga0070669_100079494 3300005353 Bacteria 2439
152 Ga0070669_101652847 3300005353 Bacteria 558
153 Ga0070675_100036205 3300005354 Bacteria 4014
154 Ga0070675_100104618 3300005354 Bacteria 2388
155 Ga0070675_100316617 3300005354 Bacteria 1378
156 Ga0070675_100530456 3300005354 Bacteria 1063
157 Ga0070671_100089289 3300005355 Bacteria 2580
158 Ga0070671_100321328 3300005355 Bacteria 1319
159 Ga0070671_100561760 3300005355 Bacteria 984
160 Ga0070671_100973704 3300005355 Bacteria 743
161 Ga0070674_100003700 3300005356 Bacteria 8616
162 Ga0070674_100010676 3300005356 Bacteria 5564
163 Ga0070674_100015299 3300005356 Bacteria 4788
164 Ga0070674_100020953 3300005356 Bacteria 4188
165 Ga0070674_100112998 3300005356 Bacteria 1997
166 Ga0070674_100153586 3300005356 Bacteria 1739
167 Ga0070674_100252850 3300005356 Bacteria 1385
168 Ga0070674_100733475 3300005356 Bacteria 847
169 Ga0070674_102031494 3300005356 Bacteria 524
170 Ga0070673_100102161 3300005364 Bacteria 2363
171 Ga0070673_100145007 3300005364 Bacteria 2006
172 Ga0070673_100266712 3300005364 Bacteria 1497
173 Ga0070673_100357282 3300005364 Bacteria 1298
174 Ga0070673_100444856 3300005364 Bacteria 1165
175 Ga0070673_100638553 3300005364 Bacteria 974
176 Ga0070688_100045366 3300005365 Bacteria 2715
177 Ga0070688_100095030 3300005365 Bacteria 1955
178 Ga0070688_100124221 3300005365 Bacteria 1733
179 Ga0070688_101146922 3300005365 Bacteria 623
180 Ga0070659_100064189 3300005366 Bacteria 2906
181 Ga0070659_100070396 3300005366 Bacteria 2778
182 Ga0070659_100071570 3300005366 Bacteria 2757
183 Ga0070659_100074674 3300005366 Bacteria 2701
184 Ga0070659_100117232 3300005366 Bacteria 2153
185 Ga0070659_100140446 3300005366 Bacteria 1966
186 Ga0070659_100157166 3300005366 Bacteria 1857
187 Ga0070659_100157675 3300005366 Bacteria 1854
188 Ga0070659_100270134 3300005366 Bacteria 1413
189 Ga0070659_100296329 3300005366 Bacteria 1348
190 Ga0070659_100300027 3300005366 Bacteria 1339
191 Ga0070659_100579157 3300005366 Bacteria 963
192 Ga0070659_100629791 3300005366 Bacteria 923
193 Ga0070659_100671205 3300005366 Bacteria 895
194 Ga0070659_100713665 3300005366 Bacteria 868
195 Ga0070659_101118401 3300005366 Bacteria 695
196 Ga0070659_101253311 3300005366 Bacteria 657
197 Ga0070659_101479622 3300005366 Bacteria 605
198 Ga0070667_100091729 3300005367 Bacteria 2612
199 Ga0070667_101086570 3300005367 Bacteria 748
200 Ga0070667_101693932 3300005367 Bacteria 595
201 Ga0070703_10201196 3300005406 Bacteria 782
202 Ga0070703_10221245 3300005406 Bacteria 754
203 Ga0070703_10317544 3300005406 Bacteria 655
204 Ga0070703_10495774 3300005406 Unclassified 549
205 Ga0070709_10141509 3300005434 Bacteria 1653
206 Ga0070709_10224959 3300005434 Bacteria 1340
207 Ga0070709_10287210 3300005434 Bacteria 1197
208 Ga0070709_10611862 3300005434 Bacteria 840
209 Ga0070709_10664286 3300005434 Bacteria 808
210 Ga0070714_100104764 3300005435 Bacteria 2496
211 Ga0070714_100418816 3300005435 Bacteria 1268
212 Ga0070714_100536607 3300005435 Bacteria 1119
213 Ga0070714_100776785 3300005435 Unclassified 927
214 Ga0070714_101020073 3300005435 Bacteria 805
215 Ga0070714_101086536 3300005435 Unclassified 779
216 Ga0070714_101807620 3300005435 Bacteria 597
217 Ga0070713_100072911 3300005436 Bacteria 2905
218 Ga0070713_100142445 3300005436 Bacteria 2125
219 Ga0070713_100251033 3300005436 Bacteria 1613
220 Ga0070713_100702178 3300005436 Bacteria 966
221 Ga0070713_101024195 3300005436 Bacteria 797
222 Ga0070713_101184173 3300005436 Unclassified 739
223 Ga0070713_101874948 3300005436 Bacteria 582
224 Ga0070710_10007399 3300005437 Bacteria 5315
225 Ga0070710_10625809 3300005437 Bacteria 752
226 Ga0070710_10645416 3300005437 Bacteria 741
227 Ga0070710_10653011 3300005437 Bacteria 738
228 Ga0070710_10660856 3300005437 Bacteria 734
229 Ga0070701_10002177 3300005438 Bacteria 7466
230 Ga0070701_10048125 3300005438 Bacteria 2199
231 Ga0070701_10195406 3300005438 Bacteria 1193
232 Ga0070701_10231671 3300005438 Bacteria 1107
233 Ga0070701_10266972 3300005438 Bacteria 1039
234 Ga0070701_10370319 3300005438 Bacteria 900
235 Ga0070701_10523256 3300005438 Bacteria 774
236 Ga0070711_100043851 3300005439 Bacteria 3032
237 Ga0070711_100119143 3300005439 Bacteria 1949
238 Ga0070711_100668723 3300005439 Bacteria 872
239 Ga0070711_101093470 3300005439 Bacteria 687
240 Ga0070711_101220988 3300005439 Bacteria 651
241 Ga0070711_102053446 3300005439 Unclassified 503
242 Ga0070705_100069513 3300005440 Bacteria 2123
243 Ga0070705_100299426 3300005440 Bacteria 1152
244 Ga0070705_100587569 3300005440 Bacteria 859
245 Ga0070705_100720620 3300005440 Bacteria 786
246 Ga0070705_100790079 3300005440 Unclassified 754
247 Ga0070705_101291411 3300005440 Bacteria 605
248 Ga0070705_101320753 3300005440 Bacteria 599
249 Ga0070700_100019191 3300005441 Bacteria 3943
250 Ga0070700_100053571 3300005441 Bacteria 2518
251 Ga0070700_100165240 3300005441 Bacteria 1528
252 Ga0070700_100188872 3300005441 Bacteria 1439
253 Ga0070700_100274106 3300005441 Bacteria 1220
254 Ga0070700_100584152 3300005441 Bacteria 873
255 Ga0070700_101005102 3300005441 Bacteria 686
256 Ga0070694_100025639 3300005444 Bacteria 3814
257 Ga0070694_100031801 3300005444 Bacteria 3461
258 Ga0070694_100048697 3300005444 Bacteria 2851
259 Ga0070694_100052816 3300005444 Bacteria 2748
260 Ga0070694_100748150 3300005444 Bacteria 798
261 Ga0070694_101092761 3300005444 Bacteria 665
262 Ga0070694_101269523 3300005444 Bacteria 619
263 Ga0070708_101178917 3300005445 Bacteria 717
264 Ga0070663_100009685 3300005455 Bacteria 5976
265 Ga0070663_100152016 3300005455 Bacteria 1776
266 Ga0070663_100255403 3300005455 Bacteria 1388
267 Ga0070663_100687198 3300005455 Bacteria 869
268 Ga0070663_101487798 3300005455 Bacteria 602
269 Ga0070663_102055301 3300005455 Unclassified 515
270 Ga0070678_100007082 3300005456 Bacteria 6631
271 Ga0070678_100022177 3300005456 Bacteria 4201
272 Ga0070678_100072914 3300005456 Bacteria 2575
273 Ga0070678_100170026 3300005456 Bacteria 1774
274 Ga0070678_100265872 3300005456 Bacteria 1444
275 Ga0070678_100296133 3300005456 Bacteria 1373
276 Ga0070678_100511779 3300005456 Bacteria 1061
277 Ga0070678_100736558 3300005456 Bacteria 891
278 Ga0070678_101590394 3300005456 Bacteria 613
279 Ga0070678_101792259 3300005456 Bacteria 579
280 Ga0070662_100021923 3300005457 Bacteria 4365
281 Ga0070662_100051470 3300005457 Bacteria 2975
282 Ga0070662_100112326 3300005457 Bacteria 2077
283 Ga0070662_100249287 3300005457 Bacteria 1427
284 Ga0070662_100274769 3300005457 Bacteria 1361
285 Ga0070662_100305042 3300005457 Bacteria 1294
286 Ga0070662_100391461 3300005457 Bacteria 1145
287 Ga0070662_101003427 3300005457 Bacteria 715
288 Ga0070662_101110170 3300005457 Bacteria 679
289 Ga0070662_101118455 3300005457 Bacteria 676
290 Ga0070681_10063242 3300005458 Bacteria 3673
291 Ga0070681_10068530 3300005458 Bacteria 3514
292 Ga0070681_10088261 3300005458 Bacteria 3053
293 Ga0070681_10113536 3300005458 Bacteria 2648
294 Ga0070681_10155241 3300005458 Bacteria 2214
295 Ga0070681_10183030 3300005458 Bacteria 2016
296 Ga0070681_10183510 3300005458 Bacteria 2013
297 Ga0070681_10253352 3300005458 Bacteria 1672
298 Ga0070681_10416957 3300005458 Bacteria 1254
299 Ga0070681_10492706 3300005458 Bacteria 1139
300 Ga0070681_10547588 3300005458 Bacteria 1071
301 Ga0070681_10612293 3300005458 Bacteria 1003
302 Ga0070681_10616256 3300005458 Bacteria 1000
303 Ga0070681_10913203 3300005458 Bacteria 797
304 Ga0070681_11774531 3300005458 Bacteria 544
305 Ga0068867_100002654 3300005459 Bacteria 12622
306 Ga0068867_100022422 3300005459 Bacteria 4515
307 Ga0068867_100309535 3300005459 Bacteria 1305
308 Ga0068867_100339400 3300005459 Bacteria 1250
309 Ga0068867_100427405 3300005459 Bacteria 1123
310 Ga0068867_100519057 3300005459 Bacteria 1027
311 Ga0068867_100567970 3300005459 Bacteria 985
312 Ga0068867_100671251 3300005459 Bacteria 911
313 Ga0068867_100741521 3300005459 Bacteria 871
314 Ga0068867_101070332 3300005459 Bacteria 735
315 Ga0068867_101116454 3300005459 Bacteria 720
316 Ga0068867_101264784 3300005459 Bacteria 680
317 Ga0068867_101814628 3300005459 Bacteria 574
318 Ga0070685_10024319 3300005466 Bacteria 3325
319 Ga0070685_10050137 3300005466 Bacteria 2411
320 Ga0070685_10465517 3300005466 Bacteria 888
321 Ga0070706_100004600 3300005467 Bacteria 13242
322 Ga0070706_100041219 3300005467 Bacteria 4262
323 Ga0070706_100295467 3300005467 Bacteria 1512
324 Ga0070706_100617582 3300005467 Bacteria 1007
325 Ga0070706_101501355 3300005467 Bacteria 616
326 Ga0070707_100435300 3300005468 Bacteria 1272
327 Ga0070707_101411634 3300005468 Bacteria 663
328 Ga0070698_100037357 3300005471 Bacteria 5008
329 Ga0070698_100170942 3300005471 Bacteria 2114
330 Ga0070698_100232054 3300005471 Bacteria 1779
331 Ga0070699_100103674 3300005518 Bacteria 2494
332 Ga0070699_100604609 3300005518 Bacteria 1000
333 Ga0070699_100823518 3300005518 Bacteria 850
334 Ga0070699_100863291 3300005518 Bacteria 829
335 Ga0070699_100965803 3300005518 Bacteria 781
336 Ga0070699_101073184 3300005518 Bacteria 739
337 Ga0070679_100011272 3300005530 Bacteria 8523
338 Ga0070679_100044973 3300005530 Bacteria 4399
339 Ga0070679_100066883 3300005530 Bacteria 3583
340 Ga0070679_100091020 3300005530 Bacteria 3038
341 Ga0070679_100114573 3300005530 Bacteria 2681
342 Ga0070679_100126367 3300005530 Bacteria 2539
343 Ga0070679_100161324 3300005530 Bacteria 2216
344 Ga0070679_100220524 3300005530 Bacteria 1857
345 Ga0070679_100416842 3300005530 Bacteria 1288
346 Ga0070679_100418965 3300005530 Bacteria 1284
347 Ga0070679_100428620 3300005530 Bacteria 1268
348 Ga0070679_100703013 3300005530 Bacteria 954
349 Ga0070679_100866601 3300005530 Bacteria 846
350 Ga0070679_101148353 3300005530 Bacteria 722
351 Ga0070679_101399829 3300005530 Bacteria 645
352 Ga0070679_101611503 3300005530 Bacteria 597
353 Ga0070684_100036224 3300005535 Bacteria 4227
354 Ga0070684_100043943 3300005535 Bacteria 3861
355 Ga0070684_100044476 3300005535 Bacteria 3841
356 Ga0070684_100070239 3300005535 Bacteria 3081
357 Ga0070684_100077352 3300005535 Bacteria 2938
358 Ga0070684_100088097 3300005535 Bacteria 2757
359 Ga0070684_100088491 3300005535 Bacteria 2751
360 Ga0070684_100097314 3300005535 Bacteria 2624
361 Ga0070684_100209067 3300005535 Bacteria 1778
362 Ga0070684_100312732 3300005535 Bacteria 1442
363 Ga0070684_100462517 3300005535 Bacteria 1173
364 Ga0070684_100589886 3300005535 Bacteria 1033
365 Ga0070684_100655024 3300005535 Bacteria 978
366 Ga0070684_100708416 3300005535 Bacteria 939
367 Ga0070684_100777434 3300005535 Bacteria 894
368 Ga0070684_101709525 3300005535 Bacteria 594
369 Ga0070697_100535072 3300005536 Bacteria 1027
370 Ga0070697_100751910 3300005536 Bacteria 861
371 Ga0068853_100099099 3300005539 Bacteria 2574
372 Ga0068853_100184222 3300005539 Bacteria 1894
373 Ga0068853_100255782 3300005539 Bacteria 1608
374 Ga0068853_100414514 3300005539 Bacteria 1262
375 Ga0068853_100530322 3300005539 Bacteria 1114
376 Ga0068853_101265885 3300005539 Bacteria 713
377 Ga0068853_101662993 3300005539 Bacteria 619
378 Ga0068853_101866281 3300005539 Bacteria 583
379 Ga0070672_100006485 3300005543 Bacteria 7865
380 Ga0070672_100054169 3300005543 Bacteria 3139
381 Ga0070672_100400397 3300005543 Bacteria 1176
382 Ga0070672_100741585 3300005543 Bacteria 861
383 Ga0070686_100001859 3300005544 Bacteria 11768
384 Ga0070686_100012471 3300005544 Bacteria 4844
385 Ga0070686_100016355 3300005544 Bacteria 4314
386 Ga0070686_100158467 3300005544 Bacteria 1592
387 Ga0070686_100195049 3300005544 Bacteria 1448
388 Ga0070686_100719772 3300005544 Bacteria 798
389 Ga0070686_100742350 3300005544 Bacteria 787
390 Ga0070686_100785042 3300005544 Bacteria 767
391 Ga0070686_100997393 3300005544 Bacteria 687
392 Ga0070686_101045498 3300005544 Bacteria 672
393 Ga0070686_101826670 3300005544 Bacteria 518
394 Ga0070695_100032064 3300005545 Bacteria 3283
395 Ga0070695_100083819 3300005545 Bacteria 2113
396 Ga0070695_100087285 3300005545 Bacteria 2075
397 Ga0070695_100509844 3300005545 Bacteria 932
398 Ga0070695_100904915 3300005545 Bacteria 713
399 Ga0070695_100929604 3300005545 Bacteria 704
400 Ga0070696_100055733 3300005546 Bacteria 2756
401 Ga0070696_100063206 3300005546 Bacteria 2593
402 Ga0070696_100068365 3300005546 Bacteria 2494
403 Ga0070696_100070010 3300005546 Bacteria 2466
404 Ga0070696_100081357 3300005546 Bacteria 2295
405 Ga0070696_100511858 3300005546 Bacteria 956
406 Ga0070696_100608655 3300005546 Bacteria 882
407 Ga0070696_100716924 3300005546 Bacteria 817
408 Ga0070696_101096994 3300005546 Bacteria 669
409 Ga0070696_101302188 3300005546 Bacteria 617
410 Ga0070696_101496286 3300005546 Bacteria 578
411 Ga0070693_100026397 3300005547 Bacteria 3135
412 Ga0070693_100034385 3300005547 Bacteria 2804
413 Ga0070693_100156273 3300005547 Bacteria 1449
414 Ga0070693_100304996 3300005547 Bacteria 1075
415 Ga0070693_100385528 3300005547 Bacteria 968
416 Ga0070693_100539026 3300005547 Bacteria 834
417 Ga0070693_100640598 3300005547 Bacteria 772
418 Ga0070693_100772967 3300005547 Bacteria 710
419 Ga0070665_100211019 3300005548 Bacteria 1942
420 Ga0070665_101151783 3300005548 Bacteria 787
421 Ga0070665_101529205 3300005548 Bacteria 676
422 Ga0070665_101818063 3300005548 Bacteria 616
423 Ga0070704_100112866 3300005549 Bacteria 2071
424 Ga0070704_100133857 3300005549 Bacteria 1925
425 Ga0070704_100139268 3300005549 Bacteria 1892
426 Ga0070704_100778127 3300005549 Bacteria 854
427 Ga0070704_101497349 3300005549 Bacteria 621
428 Ga0070704_101872393 3300005549 Bacteria 556
429 Ga0068855_100073919 3300005563 Bacteria 3959
430 Ga0068855_100106021 3300005563 Bacteria 3231
431 Ga0068855_100138502 3300005563 Bacteria 2775
432 Ga0068855_100169561 3300005563 Bacteria 2472
433 Ga0068855_100184130 3300005563 Bacteria 2360
434 Ga0068855_100212793 3300005563 Bacteria 2171
435 Ga0068855_100228145 3300005563 Bacteria 2086
436 Ga0068855_100664946 3300005563 Bacteria 1117
437 Ga0068855_100764021 3300005563 Bacteria 1030
438 Ga0068855_100861236 3300005563 Bacteria 959
439 Ga0068855_101102795 3300005563 Bacteria 830
440 Ga0068855_101447328 3300005563 Bacteria 707
441 Ga0068855_101713102 3300005563 Bacteria 641
442 Ga0070664_100044141 3300005564 Bacteria 3764
443 Ga0070664_100052955 3300005564 Bacteria 3439
444 Ga0070664_100242696 3300005564 Bacteria 1617
445 Ga0070664_100328655 3300005564 Bacteria 1387
446 Ga0070664_100544405 3300005564 Bacteria 1073
447 Ga0070664_100546719 3300005564 Bacteria 1071
448 Ga0070664_100691678 3300005564 Bacteria 950
449 Ga0070664_100792658 3300005564 Bacteria 886
450 Ga0070664_100830745 3300005564 Bacteria 864
451 Ga0070664_100887271 3300005564 Bacteria 836
452 Ga0070664_100941043 3300005564 Bacteria 811
453 Ga0070664_101043574 3300005564 Bacteria 769
454 Ga0070664_101708368 3300005564 Bacteria 597
455 Ga0068857_100060498 3300005577 Bacteria 3364
456 Ga0068857_100096347 3300005577 Bacteria 2651
457 Ga0068857_100497736 3300005577 Bacteria 1143
458 Ga0068857_100597874 3300005577 Bacteria 1043
459 Ga0068857_101410226 3300005577 Bacteria 678
460 Ga0068857_102288622 3300005577 Bacteria 530
461 Ga0068857_102457877 3300005577 Bacteria 511
462 Ga0068854_100146685 3300005578 Bacteria 1816
463 Ga0068854_100169994 3300005578 Bacteria 1695
464 Ga0068854_100195318 3300005578 Bacteria 1588
465 Ga0068854_100280399 3300005578 Bacteria 1341
466 Ga0068854_100390926 3300005578 Bacteria 1148
467 Ga0068854_100476282 3300005578 Bacteria 1047
468 Ga0068854_100507326 3300005578 Bacteria 1017
469 Ga0068854_101078629 3300005578 Bacteria 715
470 Ga0068854_101110590 3300005578 Bacteria 705
471 Ga0068854_101263061 3300005578 Bacteria 663
472 Ga0068854_101978748 3300005578 Bacteria 537
473 Ga0068856_100061747 3300005614 Bacteria 3702
474 Ga0068856_100087875 3300005614 Bacteria 3091
475 Ga0068856_100094373 3300005614 Bacteria 2978
476 Ga0068856_100209275 3300005614 Bacteria 1965
477 Ga0068856_100237918 3300005614 Bacteria 1836
478 Ga0068856_100287090 3300005614 Bacteria 1662
479 Ga0068856_100387845 3300005614 Bacteria 1416
480 Ga0068856_100480470 3300005614 Bacteria 1263
481 Ga0068856_100665562 3300005614 Bacteria 1062
482 Ga0068856_100889360 3300005614 Bacteria 909
483 Ga0068856_101255515 3300005614 Bacteria 757
484 Ga0068856_101501025 3300005614 Bacteria 688
485 Ga0068856_102033088 3300005614 Bacteria 585
486 Ga0070702_100082965 3300005615 Bacteria 1924
487 Ga0070702_100143119 3300005615 Bacteria 1525
488 Ga0070702_100144878 3300005615 Bacteria 1517
489 Ga0070702_100332808 3300005615 Bacteria 1062
490 Ga0070702_100334155 3300005615 Bacteria 1061
491 Ga0070702_100380407 3300005615 Bacteria 1003
492 Ga0070702_100385815 3300005615 Bacteria 997
493 Ga0070702_100573335 3300005615 Bacteria 842
494 Ga0070702_100761786 3300005615 Bacteria 744
495 Ga0070702_101033083 3300005615 Bacteria 653
496 Ga0070702_101125796 3300005615 Bacteria 629
497 Ga0068852_100053060 3300005616 Bacteria 3488
498 Ga0068852_100113321 3300005616 Bacteria 2469
499 Ga0068852_100181089 3300005616 Bacteria 1981
500 Ga0068852_100247728 3300005616 Bacteria 1706
501 Ga0068852_100324653 3300005616 Bacteria 1496
502 Ga0068852_100347456 3300005616 Bacteria 1447
503 Ga0068852_101082105 3300005616 Bacteria 822
504 Ga0068852_101179084 3300005616 Bacteria 787
505 Ga0068859_100077473 3300005617 Bacteria 3365
506 Ga0068859_100271290 3300005617 Bacteria 1789
507 Ga0068859_100485416 3300005617 Bacteria 1331
508 Ga0068859_100495376 3300005617 Bacteria 1317
509 Ga0068859_100619529 3300005617 Bacteria 1175
510 Ga0068859_102745498 3300005617 Bacteria 541
511 Ga0068864_100102135 3300005618 Bacteria 2544
512 Ga0068864_100137812 3300005618 Bacteria 2198
513 Ga0068864_100486071 3300005618 Bacteria 1186
514 Ga0068864_101462757 3300005618 Unclassified 686
515 Ga0068864_101467204 3300005618 Bacteria 685
516 Ga0068864_101781613 3300005618 Bacteria 621
517 Ga0068864_101823675 3300005618 Bacteria 614
518 Ga0068864_102125864 3300005618 Bacteria 568
519 Ga0068866_10022254 3300005718 Bacteria 2931
520 Ga0068866_10081263 3300005718 Bacteria 1740
521 Ga0068866_10304227 3300005718 Bacteria 997
522 Ga0068866_10620078 3300005718 Bacteria 733
523 Ga0068866_11036248 3300005718 Bacteria 585
524 Ga0068861_100118072 3300005719 Bacteria 2136
525 Ga0068861_100136067 3300005719 Bacteria 1999
526 Ga0068861_100145472 3300005719 Bacteria 1939
527 Ga0068861_100145924 3300005719 Bacteria 1936
528 Ga0068861_100180269 3300005719 Bacteria 1758
529 Ga0068861_100967261 3300005719 Bacteria 811
530 Ga0068861_101148082 3300005719 Bacteria 749
531 Ga0068861_101456398 3300005719 Bacteria 671
532 Ga0068861_101459012 3300005719 Bacteria 670
533 Ga0068861_101762686 3300005719 Bacteria 613
534 Ga0068851_10090101 3300005834 Bacteria 1613
535 Ga0068851_10179907 3300005834 Bacteria 1171
536 Ga0068851_10513628 3300005834 Bacteria 720
537 Ga0068851_10641178 3300005834 Bacteria 649
538 Ga0068870_10719370 3300005840 Bacteria 690
539 Ga0068870_10885480 3300005840 Bacteria 629
540 Ga0068870_11466360 3300005840 Bacteria 501
541 Ga0068863_100879253 3300005841 Bacteria 896
542 Ga0068863_101221212 3300005841 Bacteria 758
543 Ga0068858_100088305 3300005842 Bacteria 2884
544 Ga0068858_100521439 3300005842 Bacteria 1149
545 Ga0068858_100693359 3300005842 Bacteria 991
546 Ga0068858_100813676 3300005842 Bacteria 912
547 Ga0068858_101096059 3300005842 Bacteria 782
548 Ga0068858_101207192 3300005842 Bacteria 744
549 Ga0068860_100187152 3300005843 Bacteria 2002
550 Ga0068860_100245679 3300005843 Bacteria 1741
551 Ga0068860_100328163 3300005843 Bacteria 1503
552 Ga0068860_100520013 3300005843 Bacteria 1190
553 Ga0068860_100638781 3300005843 Bacteria 1072
554 Ga0068860_101256660 3300005843 Bacteria 761
555 Ga0068862_100071539 3300005844 Bacteria 2994
556 Ga0068862_100380863 3300005844 Bacteria 1316
557 Ga0068862_102188522 3300005844 Unclassified 564
558 Ga0068862_102232865 3300005844 Bacteria 559
559 Ga0081455_10037522 3300005937 Bacteria 4302
560 Ga0081455_10079337 3300005937 Bacteria 2696
561 Ga0081455_10095855 3300005937 Bacteria 2394
562 Ga0081455_10175235 3300005937 Bacteria 1629
563 Ga0081455_10401262 3300005937 Bacteria 951
564 Ga0081455_10636450 3300005937 Bacteria 689
565 Ga0081538_10004299 3300005981 Bacteria 13168
566 Ga0081538_10012860 3300005981 Bacteria 6676
567 Ga0081538_10016324 3300005981 Bacteria 5699
568 Ga0081538_10054517 3300005981 Bacteria 2364
569 Ga0081538_10055855 3300005981 Bacteria 2320
570 Ga0081538_10059984 3300005981 Bacteria 2193
571 Ga0081538_10068544 3300005981 Bacteria 1972
572 Ga0081538_10082618 3300005981 Bacteria 1702
573 Ga0081538_10091265 3300005981 Bacteria 1573
574 Ga0081538_10137396 3300005981 Bacteria 1135
575 Ga0081538_10259123 3300005981 Bacteria 658
576 Ga0081538_10270483 3300005981 Bacteria 636
577 Ga0081538_10342311 3300005981 Bacteria 542
578 Ga0081540_1003884 3300005983 Bacteria 11644
579 Ga0081540_1026371 3300005983 Bacteria 3318
580 Ga0081539_10000433 3300005985 Bacteria 89118
581 Ga0081539_10018498 3300005985 Bacteria 4831
582 Ga0081539_10088849 3300005985 Bacteria 1602
583 Ga0081539_10204302 3300005985 Bacteria 910
584 Ga0081539_10416794 3300005985 Bacteria 557
585 Ga0070717_10104039 3300006028 Bacteria 2414
586 Ga0070717_10435316 3300006028 Bacteria 1180
587 Ga0070717_10773935 3300006028 Bacteria 873
588 Ga0070717_11786901 3300006028 Bacteria 556
589 Ga0075365_10011270 3300006038 Bacteria 5252
590 Ga0075365_10226382 3300006038 Bacteria 1312
591 Ga0075365_10816327 3300006038 Bacteria 658
592 Ga0075365_11080873 3300006038 Bacteria 565
593 Ga0075368_10173339 3300006042 Bacteria 907
594 Ga0075364_10061279 3300006051 Bacteria 2467
595 Ga0075364_11148451 3300006051 Bacteria 527
596 Ga0075432_10053096 3300006058 Bacteria 1432
597 Ga0075432_10089076 3300006058 Bacteria 1128
598 Ga0075432_10333064 3300006058 Bacteria 639
599 Ga0075432_10605048 3300006058 Bacteria 502
600 Ga0070715_10172070 3300006163 Bacteria 1079
601 Ga0070716_100038369 3300006173 Bacteria 2652
602 Ga0070712_100075712 3300006175 Bacteria 2421
603 Ga0070712_100080357 3300006175 Bacteria 2360
604 Ga0070712_100410478 3300006175 Bacteria 1120
605 Ga0070712_100537387 3300006175 Bacteria 984
606 Ga0070712_101366850 3300006175 Bacteria 618
607 Ga0070712_101430045 3300006175 Bacteria 604
608 Ga0075367_10016016 3300006178 Bacteria 4088
609 Ga0097621_100128402 3300006237 Bacteria 2155
610 Ga0097621_100208967 3300006237 Bacteria 1697
611 Ga0097621_100231985 3300006237 Bacteria 1611
612 Ga0097621_100527350 3300006237 Bacteria 1073
613 Ga0097621_100589651 3300006237 Bacteria 1015
614 Ga0097621_100958380 3300006237 Unclassified 799
615 Ga0097621_101289299 3300006237 Bacteria 690
616 Ga0097621_101476258 3300006237 Bacteria 645
617 Ga0068871_100011473 3300006358 Bacteria 6500
618 Ga0068871_100105148 3300006358 Bacteria 2368
619 Ga0068871_100157991 3300006358 Bacteria 1937
620 Ga0068871_100229346 3300006358 Bacteria 1611
621 Ga0068871_100321069 3300006358 Bacteria 1363
622 Ga0068871_100998551 3300006358 Bacteria 779
623 Ga0068871_101179864 3300006358 Bacteria 718
624 Ga0068871_101233782 3300006358 Bacteria 702
625 Ga0075428_100006916 3300006844 Bacteria 12599
626 Ga0075428_100057351 3300006844 Bacteria 4264
627 Ga0075428_100093707 3300006844 Bacteria 3274
628 Ga0075428_100189399 3300006844 Bacteria 2225
629 Ga0075428_101915091 3300006844 Bacteria 616
630 Ga0075430_100145437 3300006846 Bacteria 1974
631 Ga0075430_100243650 3300006846 Bacteria 1490
632 Ga0075431_100044647 3300006847 Bacteria 4570
633 Ga0075431_100504210 3300006847 Bacteria 1201
634 Ga0075431_101478834 3300006847 Bacteria 638
635 Ga0075431_101804976 3300006847 Bacteria 568
636 Ga0075433_10060962 3300006852 Bacteria 3305
637 Ga0075433_10309230 3300006852 Bacteria 1399
638 Ga0075433_10489117 3300006852 Bacteria 1083
639 Ga0075433_10801951 3300006852 Bacteria 823
640 Ga0075433_10955828 3300006852 Bacteria 747
641 Ga0075433_11507444 3300006852 Bacteria 581
642 Ga0075434_100004118 3300006871 Bacteria 13045
643 Ga0075434_100253864 3300006871 Bacteria 1777
644 Ga0075434_100365841 3300006871 Bacteria 1463
645 Ga0075434_100707534 3300006871 Bacteria 1025
646 Ga0075434_100752075 3300006871 Bacteria 992
647 Ga0075434_101272718 3300006871 Bacteria 747
648 Ga0075434_101511292 3300006871 Bacteria 681
649 Ga0075434_102247103 3300006871 Unclassified 549
650 Ga0075429_100042592 3300006880 Bacteria 3951
651 Ga0075429_100367063 3300006880 Bacteria 1260
652 Ga0075429_100930186 3300006880 Bacteria 761
653 Ga0075429_101523344 3300006880 Bacteria 582
654 Ga0068865_100004970 3300006881 Bacteria 8041
655 Ga0068865_100008462 3300006881 Bacteria 6360
656 Ga0068865_100035906 3300006881 Bacteria 3337
657 Ga0068865_100074432 3300006881 Bacteria 2418
658 Ga0068865_100108694 3300006881 Bacteria 2042
659 Ga0068865_100279309 3300006881 Bacteria 1329
660 Ga0068865_100487467 3300006881 Bacteria 1026
661 Ga0068865_100629757 3300006881 Bacteria 909
662 Ga0068865_100876164 3300006881 Bacteria 779
663 Ga0068865_100909555 3300006881 Bacteria 766
664 Ga0068865_101726689 3300006881 Bacteria 565
665 Ga0068865_101881844 3300006881 Bacteria 542
666 Ga0075436_100027242 3300006914 Bacteria 3934
667 Ga0075436_100720612 3300006914 Bacteria 740
668 Ga0097620_100077474 3300006931 Bacteria 3365
669 Ga0097620_100271308 3300006931 Bacteria 1789
670 Ga0097620_100485398 3300006931 Bacteria 1331
671 Ga0097620_100495394 3300006931 Bacteria 1317
672 Ga0097620_100619595 3300006931 Bacteria 1175
673 Ga0097620_102745386 3300006931 Bacteria 541
674 Ga0075435_100023442 3300007076 Bacteria 4775
675 Ga0075435_100529553 3300007076 Bacteria 1020
676 Ga0075435_100667363 3300007076 Bacteria 903
677 Ga0105244_10154083 3300009036 Bacteria 1100
678 Ga0105240_10171319 3300009093 Bacteria 2571
679 Ga0105240_10338285 3300009093 Bacteria 1710
680 Ga0105240_10388949 3300009093 Bacteria 1573
681 Ga0105240_10726438 3300009093 Bacteria 1082
682 Ga0105240_10846992 3300009093 Bacteria 987
683 Ga0105240_10895192 3300009093 Bacteria 955
684 Ga0105240_11396438 3300009093 Unclassified 736
685 Ga0105240_11765891 3300009093 Bacteria 645
686 Ga0105240_12083086 3300009093 Bacteria 589
687 Ga0111539_10008690 3300009094 Bacteria 12890
688 Ga0111539_10077145 3300009094 Bacteria 3922
689 Ga0111539_10138766 3300009094 Bacteria 2847
690 Ga0111539_10222221 3300009094 Bacteria 2200
691 Ga0111539_10288697 3300009094 Bacteria 1909
692 Ga0111539_10358540 3300009094 Bacteria 1697
693 Ga0111539_10477944 3300009094 Bacteria 1451
694 Ga0111539_10510115 3300009094 Bacteria 1401
695 Ga0111539_11356171 3300009094 Bacteria 825
696 Ga0111539_12064828 3300009094 Bacteria 661
697 Ga0111539_12127387 3300009094 Bacteria 651
698 Ga0111539_12213992 3300009094 Bacteria 638
699 Ga0111539_12587065 3300009094 Bacteria 588
700 Ga0105245_10011302 3300009098 Bacteria 7774
701 Ga0105245_10041827 3300009098 Bacteria 4086
702 Ga0105245_10053657 3300009098 Bacteria 3618
703 Ga0105245_10057735 3300009098 Bacteria 3492
704 Ga0105245_10099339 3300009098 Bacteria 2690
705 Ga0105245_10147094 3300009098 Bacteria 2224
706 Ga0105245_10165618 3300009098 Bacteria 2101
707 Ga0105245_10205435 3300009098 Bacteria 1893
708 Ga0105245_10207575 3300009098 Bacteria 1884
709 Ga0105245_10309528 3300009098 Bacteria 1553
710 Ga0105245_10316582 3300009098 Bacteria 1536
711 Ga0105245_10410203 3300009098 Bacteria 1356
712 Ga0105245_10436578 3300009098 Bacteria 1315
713 Ga0105245_10522983 3300009098 Bacteria 1205
714 Ga0105245_10552116 3300009098 Bacteria 1174
715 Ga0105245_11030890 3300009098 Bacteria 868
716 Ga0105245_11039774 3300009098 Bacteria 864
717 Ga0105245_11176466 3300009098 Bacteria 814
718 Ga0105245_11220485 3300009098 Bacteria 800
719 Ga0105245_11504905 3300009098 Bacteria 724
720 Ga0105245_11859435 3300009098 Bacteria 655
721 Ga0105245_12371615 3300009098 Bacteria 584
722 Ga0105245_12443499 3300009098 Bacteria 576
723 Ga0105245_12479095 3300009098 Bacteria 572
724 Ga0105247_10034107 3300009101 Bacteria 3100
725 Ga0105247_10061048 3300009101 Bacteria 2337
726 Ga0105247_10397388 3300009101 Bacteria 981
727 Ga0105247_10427392 3300009101 Bacteria 950
728 Ga0105247_10819272 3300009101 Bacteria 712
729 Ga0114129_10063872 3300009147 Bacteria 5138
730 Ga0114129_10111444 3300009147 Bacteria 3776
731 Ga0114129_10239881 3300009147 Bacteria 2437
732 Ga0114129_10342315 3300009147 Bacteria 1983
733 Ga0114129_10467558 3300009147 Bacteria 1652
734 Ga0114129_10500192 3300009147 Bacteria 1588
735 Ga0114129_10582546 3300009147 Bacteria 1452
736 Ga0114129_10897135 3300009147 Bacteria 1123
737 Ga0114129_11097458 3300009147 Bacteria 996
738 Ga0114129_11352524 3300009147 Bacteria 881
739 Ga0114129_11541353 3300009147 Bacteria 815
740 Ga0114129_12206885 3300009147 Bacteria 662
741 Ga0114129_12409073 3300009147 Bacteria 630
742 Ga0114129_13107133 3300009147 Bacteria 543
743 Ga0105243_10003056 3300009148 Bacteria 13794
744 Ga0105243_10026201 3300009148 Bacteria 4463
745 Ga0105243_10080355 3300009148 Bacteria 2659
746 Ga0105243_10200695 3300009148 Bacteria 1749
747 Ga0105243_10262578 3300009148 Bacteria 1547
748 Ga0105243_10357152 3300009148 Bacteria 1344
749 Ga0105243_10409437 3300009148 Bacteria 1262
750 Ga0105243_10428111 3300009148 Bacteria 1236
751 Ga0105243_10538815 3300009148 Bacteria 1113
752 Ga0105243_10616624 3300009148 Bacteria 1047
753 Ga0105243_10663590 3300009148 Bacteria 1012
754 Ga0105243_10741680 3300009148 Bacteria 962
755 Ga0105243_10851277 3300009148 Bacteria 903
756 Ga0105243_10857287 3300009148 Bacteria 900
757 Ga0105243_10929394 3300009148 Bacteria 867
758 Ga0105243_10939016 3300009148 Bacteria 863
759 Ga0105243_11164702 3300009148 Bacteria 782
760 Ga0105243_12220099 3300009148 Bacteria 586
761 Ga0105241_10002714 3300009174 Bacteria 13257
762 Ga0105241_10098159 3300009174 Bacteria 2324
763 Ga0105241_10225366 3300009174 Bacteria 1578
764 Ga0105241_10426997 3300009174 Bacteria 1168
765 Ga0105241_10571877 3300009174 Bacteria 1017
766 Ga0105241_10775628 3300009174 Bacteria 881
767 Ga0105241_10808068 3300009174 Bacteria 864
768 Ga0105241_10988617 3300009174 Bacteria 786
769 Ga0105241_12007514 3300009174 Bacteria 569
770 Ga0105242_10093276 3300009176 Bacteria 2538
771 Ga0105242_10093833 3300009176 Bacteria 2531
772 Ga0105242_10155215 3300009176 Bacteria 1999
773 Ga0105242_10340554 3300009176 Bacteria 1382
774 Ga0105242_10395608 3300009176 Bacteria 1288
775 Ga0105242_10509043 3300009176 Bacteria 1146
776 Ga0105242_10545112 3300009176 Bacteria 1111
777 Ga0105242_10777607 3300009176 Bacteria 945
778 Ga0105242_10902156 3300009176 Bacteria 884
779 Ga0105242_11129413 3300009176 Bacteria 799
780 Ga0105242_11381760 3300009176 Bacteria 731
781 Ga0105242_11591925 3300009176 Bacteria 687
782 Ga0105242_11688838 3300009176 Bacteria 669
783 Ga0105242_11853254 3300009176 Bacteria 643
784 Ga0105242_12903826 3300009176 Unclassified 530
785 Ga0105248_10143113 3300009177 Bacteria 2698
786 Ga0105248_10304028 3300009177 Bacteria 1796
787 Ga0105248_10426121 3300009177 Bacteria 1494
788 Ga0105248_10864792 3300009177 Bacteria 1021
789 Ga0105248_11772207 3300009177 Bacteria 700
790 Ga0105248_12160463 3300009177 Bacteria 633
791 Ga0105237_10064717 3300009545 Bacteria 3652
792 Ga0105237_10211769 3300009545 Bacteria 1938
793 Ga0105237_10339508 3300009545 Bacteria 1507
794 Ga0105237_10375091 3300009545 Bacteria 1427
795 Ga0105237_11019175 3300009545 Bacteria 835
796 Ga0105237_11619935 3300009545 Bacteria 654
797 Ga0105237_11991636 3300009545 Bacteria 589
798 Ga0105237_12058804 3300009545 Bacteria 580
799 Ga0105238_10112480 3300009551 Bacteria 2702
800 Ga0105238_10131720 3300009551 Bacteria 2479
801 Ga0105238_10457516 3300009551 Bacteria 1274
802 Ga0105238_10585333 3300009551 Bacteria 1123
803 Ga0105238_10694491 3300009551 Bacteria 1029
804 Ga0105238_11221709 3300009551 Bacteria 776
805 Ga0105238_11382895 3300009551 Bacteria 731
806 Ga0105238_11411312 3300009551 Bacteria 724
807 Ga0105238_11503123 3300009551 Bacteria 702
808 Ga0105238_11632267 3300009551 Bacteria 675
809 Ga0105238_12556503 3300009551 Bacteria 547
810 Ga0105249_10025487 3300009553 Bacteria 5324
811 Ga0105249_10043113 3300009553 Bacteria 4104
812 Ga0105249_10084750 3300009553 Bacteria 2952
813 Ga0105249_10085189 3300009553 Bacteria 2944
814 Ga0105249_10255890 3300009553 Bacteria 1738
815 Ga0105249_10391565 3300009553 Bacteria 1418
816 Ga0105249_10406147 3300009553 Bacteria 1393
817 Ga0105249_10548179 3300009553 Bacteria 1207
818 Ga0105249_10762306 3300009553 Bacteria 1030
819 Ga0105249_11803311 3300009553 Bacteria 684
820 Ga0105239_10002930 3300010375 Bacteria 21309
821 Ga0105239_10104152 3300010375 Bacteria 3142
822 Ga0105239_10182933 3300010375 Bacteria 2345
823 Ga0105239_10275481 3300010375 Bacteria 1893
824 Ga0105239_10297492 3300010375 Bacteria 1817
825 Ga0105239_10340143 3300010375 Bacteria 1693
826 Ga0105239_10444331 3300010375 Bacteria 1471
827 Ga0105239_10454293 3300010375 Bacteria 1454
828 Ga0105239_10533474 3300010375 Bacteria 1336
829 Ga0105239_10557925 3300010375 Bacteria 1305
830 Ga0105239_10698769 3300010375 Bacteria 1159
831 Ga0105239_10734450 3300010375 Bacteria 1130
832 Ga0105239_11092981 3300010375 Bacteria 918
833 Ga0105239_11143337 3300010375 Bacteria 897
834 Ga0105239_11270950 3300010375 Bacteria 849
835 Ga0105239_11328009 3300010375 Bacteria 830
836 Ga0105239_11474538 3300010375 Bacteria 786
837 Ga0105239_12163789 3300010375 Bacteria 647
838 Ga0105246_10025832 3300011119 Bacteria 3830
839 Ga0105246_10083022 3300011119 Bacteria 2288
840 Ga0105246_10225008 3300011119 Bacteria 1473
841 Ga0105246_10452134 3300011119 Bacteria 1080
842 Ga0105246_10638200 3300011119 Bacteria 925
843 Ga0105246_10790447 3300011119 Bacteria 841
844 Ga0105246_11065225 3300011119 Bacteria 736
845 Ga0105246_11434901 3300011119 Bacteria 645
846 Ga0105246_12132345 3300011119 Bacteria 544
847 Ga0157340_1002552 3300012473 Bacteria 937
848 Ga0157317_1026661 3300012475 Bacteria 544
849 Ga0157329_1016550 3300012491 Bacteria 649
850 Ga0157335_1002600 3300012492 Bacteria 1100
851 Ga0157341_1021465 3300012494 Bacteria 639
852 Ga0157323_1040712 3300012495 Bacteria 532
853 Ga0157313_1017789 3300012503 Bacteria 693
854 Ga0157324_1002996 3300012506 Bacteria 1075
855 Ga0157324_1004961 3300012506 Bacteria 942
856 Ga0157324_1031667 3300012506 Bacteria 603
857 Ga0157324_1048810 3300012506 Unclassified 544
858 Ga0157342_1009106 3300012507 Bacteria 993
859 Ga0157316_1067785 3300012510 Bacteria 532
860 Ga0157338_1007774 3300012515 Bacteria 1024
861 Ga0157338_1020785 3300012515 Bacteria 763
862 Ga0157373_10838968 3300013100 Bacteria 679
863 Ga0157373_11070896 3300013100 Bacteria 604
864 Ga0157371_10184507 3300013102 Bacteria 1493
865 Ga0157371_10190601 3300013102 Bacteria 1468
866 Ga0157371_10909746 3300013102 Bacteria 668
867 Ga0157371_10935769 3300013102 Bacteria 658
868 Ga0157371_11038428 3300013102 Bacteria 626
869 Ga0157371_11386712 3300013102 Bacteria 546
870 Ga0157370_10057577 3300013104 Bacteria 3695
871 Ga0157370_10293751 3300013104 Bacteria 1501
872 Ga0157370_10294518 3300013104 Bacteria 1499
873 Ga0157370_10365677 3300013104 Bacteria 1329
874 Ga0157370_10787817 3300013104 Bacteria 865
875 Ga0157370_11014341 3300013104 Bacteria 751
876 Ga0157370_12102213 3300013104 Bacteria 506
877 Ga0157369_10053800 3300013105 Bacteria 4349
878 Ga0157369_10267436 3300013105 Bacteria 1782
879 Ga0157369_10326902 3300013105 Bacteria 1593
880 Ga0157369_10617565 3300013105 Bacteria 1119
881 Ga0157369_10621481 3300013105 Bacteria 1115
882 Ga0157369_11994635 3300013105 Bacteria 589
883 Ga0157369_12517765 3300013105 Unclassified 521
884 Ga0157374_10122498 3300013296 Bacteria 2511
885 Ga0157374_10178409 3300013296 Bacteria 2074
886 Ga0157374_10262594 3300013296 Bacteria 1701
887 Ga0157374_10419780 3300013296 Bacteria 1336
888 Ga0157374_10523321 3300013296 Bacteria 1192
889 Ga0157374_10702831 3300013296 Bacteria 1024
890 Ga0157374_10880539 3300013296 Bacteria 913
891 Ga0157374_11007903 3300013296 Bacteria 852
892 Ga0157374_11207920 3300013296 Bacteria 777
893 Ga0157374_12580071 3300013296 Bacteria 536
894 Ga0157378_10043462 3300013297 Bacteria 3990
895 Ga0157378_10194433 3300013297 Bacteria 1915
896 Ga0157378_10632887 3300013297 Bacteria 1084
897 Ga0157378_10961640 3300013297 Bacteria 887
898 Ga0157378_11986699 3300013297 Bacteria 631
899 Ga0157378_12034587 3300013297 Bacteria 624
900 Ga0157378_12221438 3300013297 Bacteria 600
901 Ga0157378_12335337 3300013297 Bacteria 586
902 Ga0157378_12996414 3300013297 Bacteria 524
903 Ga0163162_10001805 3300013306 Bacteria 20095
904 Ga0163162_10124415 3300013306 Bacteria 2684
905 Ga0163162_10290701 3300013306 Bacteria 1766
906 Ga0163162_10383122 3300013306 Bacteria 1539
907 Ga0163162_10403918 3300013306 Bacteria 1499
908 Ga0163162_10476682 3300013306 Bacteria 1379
909 Ga0163162_10491007 3300013306 Bacteria 1359
910 Ga0163162_10669331 3300013306 Bacteria 1161
911 Ga0163162_11137114 3300013306 Bacteria 885
912 Ga0163162_11809424 3300013306 Bacteria 698
913 Ga0157372_10104802 3300013307 Bacteria 3234
914 Ga0157372_10162754 3300013307 Bacteria 2579
915 Ga0157372_10210951 3300013307 Bacteria 2251
916 Ga0157372_10242915 3300013307 Bacteria 2089
917 Ga0157372_10289616 3300013307 Bacteria 1904
918 Ga0157372_10634614 3300013307 Bacteria 1244
919 Ga0157372_10740006 3300013307 Bacteria 1143
920 Ga0157372_10786325 3300013307 Bacteria 1106
921 Ga0157372_10861155 3300013307 Bacteria 1052
922 Ga0157372_11307810 3300013307 Bacteria 837
923 Ga0157372_11570146 3300013307 Bacteria 758
924 Ga0157375_10060387 3300013308 Bacteria 3759
925 Ga0157375_10117655 3300013308 Bacteria 2763
926 Ga0157375_10226193 3300013308 Bacteria 2030
927 Ga0157375_10238870 3300013308 Bacteria 1976
928 Ga0157375_10446893 3300013308 Bacteria 1458
929 Ga0157375_10562887 3300013308 Bacteria 1301
930 Ga0157375_10661838 3300013308 Bacteria 1200
931 Ga0157375_10668759 3300013308 Bacteria 1194
932 Ga0157375_10801014 3300013308 Bacteria 1091
933 Ga0157375_11212645 3300013308 Bacteria 885
934 Ga0157375_12834651 3300013308 Bacteria 579
935 Ga0157375_13538208 3300013308 Bacteria 520
936 Ga0163163_10066834 3300014325 Bacteria 3572
937 Ga0163163_10101176 3300014325 Bacteria 2904
938 Ga0163163_10127995 3300014325 Bacteria 2578
939 Ga0163163_10213566 3300014325 Bacteria 1978
940 Ga0163163_10512050 3300014325 Bacteria 1262
941 Ga0163163_10606150 3300014325 Bacteria 1158
942 Ga0163163_10987011 3300014325 Bacteria 905
943 Ga0163163_12447495 3300014325 Bacteria 580
944 Ga0157380_10066392 3300014326 Bacteria 2901
945 Ga0157380_10101400 3300014326 Bacteria 2398
946 Ga0157380_10102157 3300014326 Bacteria 2390
947 Ga0157380_10155592 3300014326 Bacteria 1981
948 Ga0157380_10177933 3300014326 Bacteria 1866
949 Ga0157380_10646206 3300014326 Bacteria 1054
950 Ga0157380_10880764 3300014326 Bacteria 920
951 Ga0157380_11281898 3300014326 Bacteria 779
952 Ga0157380_13100117 3300014326 Bacteria 530
953 Ga0157380_13122876 3300014326 Bacteria 528
954 Ga0157380_13465445 3300014326 Bacteria 505
955 Ga0182008_10156962 3300014497 Bacteria 1143
956 Ga0182008_10713631 3300014497 Bacteria 574
957 Ga0157377_10083169 3300014745 Bacteria 1875
958 Ga0157377_10145634 3300014745 Bacteria 1460
959 Ga0157377_10230575 3300014745 Bacteria 1190
960 Ga0157377_10246712 3300014745 Bacteria 1155
961 Ga0157377_10562789 3300014745 Bacteria 807
962 Ga0157377_10741345 3300014745 Bacteria 718
963 Ga0157377_10868945 3300014745 Bacteria 671
964 Ga0157379_10037051 3300014968 Bacteria 4348
965 Ga0157379_10108459 3300014968 Bacteria 2493
966 Ga0157379_10287319 3300014968 Bacteria 1497
967 Ga0157379_10319919 3300014968 Bacteria 1416
968 Ga0157379_10488784 3300014968 Bacteria 1140
969 Ga0157379_11237081 3300014968 Bacteria 719
970 Ga0157379_12065847 3300014968 Unclassified 564
971 Ga0157376_10089480 3300014969 Bacteria 2662
972 Ga0157376_10090295 3300014969 Bacteria 2651
973 Ga0157376_10100646 3300014969 Bacteria 2524
974 Ga0157376_10105943 3300014969 Bacteria 2466
975 Ga0157376_10232333 3300014969 Bacteria 1714
976 Ga0157376_11218287 3300014969 Bacteria 781
977 Ga0157376_11522588 3300014969 Bacteria 702
978 Ga0182006_1254272 3300015261 Bacteria 577
979 Ga0182007_10109673 3300015262 Bacteria 917
980 Ga0163161_10527628 3300017792 Bacteria 965
981 Ga0163161_10796543 3300017792 Bacteria 794
982 Ga0197907_10154402 3300020069 Bacteria 519
983 Ga0206356_11907781 3300020070 Bacteria 620
984 Ga0206351_10348351 3300020077 Bacteria 753
985 Ga0206353_10991685 3300020082 Bacteria 850
986 Ga0224712_10179155 3300022467 Bacteria 954
987 Ga0207692_10155319 3300025898 Bacteria 1314
988 Ga0207692_10203451 3300025898 Bacteria 1165
989 Ga0207642_10182305 3300025899 Bacteria 1145
990 Ga0207642_10333280 3300025899 Bacteria 890
991 Ga0207688_10466544 3300025901 Bacteria 788
992 Ga0207680_11193403 3300025903 Unclassified 543
993 Ga0207685_10208442 3300025905 Bacteria 923
994 Ga0207699_11018537 3300025906 Unclassified 612
995 Ga0207654_10772905 3300025911 Bacteria 693
996 Ga0207707_10211443 3300025912 Bacteria 1689
997 Ga0207695_10041220 3300025913 Bacteria 4942
998 Ga0207693_10143582 3300025915 Bacteria 1877
999 Ga0207693_10379361 3300025915 Bacteria 1106
1000 Ga0207693_10379362 3300025915 Bacteria 1106
1001 Ga0207663_10020411 3300025916 Bacteria 3751
1002 Ga0207663_10241772 3300025916 Bacteria 1324
1003 Ga0207660_10342749 3300025917 Bacteria 1196
1004 Ga0207660_10537359 3300025917 Bacteria 950
1005 Ga0207660_11579420 3300025917 Bacteria 529
1006 Ga0207657_10367501 3300025919 Bacteria 1133
1007 Ga0207652_10469761 3300025921 Bacteria 1133
1008 Ga0207646_10511850 3300025922 Bacteria 1081
1009 Ga0207681_10203471 3300025923 Bacteria 1522
1010 Ga0207694_11755602 3300025924 Bacteria 522
1011 Ga0207687_10199209 3300025927 Bacteria 1564
1012 Ga0207700_10583684 3300025928 Bacteria 994
1013 Ga0207664_10025646 3300025929 Bacteria 4444
1014 Ga0207664_10233520 3300025929 Bacteria 1599
1015 Ga0207644_10652818 3300025931 Bacteria 876
1016 Ga0207690_10244176 3300025932 Bacteria 1384
1017 Ga0207690_10621688 3300025932 Bacteria 883
1018 Ga0207690_11853483 3300025932 Bacteria 503
1019 Ga0207706_10810015 3300025933 Bacteria 795
1020 Ga0207686_11333340 3300025934 Bacteria 590
1021 Ga0207709_10319971 3300025935 Bacteria 1161
1022 Ga0207709_10514297 3300025935 Bacteria 936
1023 Ga0207669_10005898 3300025937 Bacteria 5544
1024 Ga0207704_10703976 3300025938 Bacteria 836
1025 Ga0207704_10808882 3300025938 Bacteria 783
1026 Ga0207704_11031348 3300025938 Bacteria 697
1027 Ga0207704_11344170 3300025938 Bacteria 611
1028 Ga0207704_11709943 3300025938 Bacteria 541
1029 Ga0207665_10016840 3300025939 Bacteria 4801
1030 Ga0207689_11345232 3300025942 Bacteria 599
1031 Ga0207679_10031597 3300025945 Bacteria 3707
1032 Ga0207668_10173476 3300025972 Bacteria 1693
1033 Ga0207668_10253804 3300025972 Bacteria 1430
1034 Ga0207640_10264213 3300025981 Bacteria 1343
1035 Ga0207640_10590170 3300025981 Bacteria 939
1036 Ga0207658_10598183 3300025986 Bacteria 991
1037 Ga0207658_12048623 3300025986 Bacteria 520
1038 Ga0207677_10168016 3300026023 Bacteria 1712
1039 Ga0207677_10205508 3300026023 Bacteria 1569
1040 Ga0207677_10639670 3300026023 Bacteria 938
1041 Ga0207703_11418037 3300026035 Bacteria 668
1042 Ga0207678_10078973 3300026067 Bacteria 2818
1043 Ga0207678_10168023 3300026067 Bacteria 1873
1044 Ga0207678_11153645 3300026067 Bacteria 686
1045 Ga0207708_10224638 3300026075 Bacteria 1506
1046 Ga0207708_10443669 3300026075 Bacteria 1080
1047 Ga0207708_11794184 3300026075 Bacteria 538
1048 Ga0207702_10322201 3300026078 Bacteria 1472
1049 Ga0207648_10066179 3300026089 Bacteria 3151
1050 Ga0207648_10139051 3300026089 Bacteria 2140
1051 Ga0207648_10621451 3300026089 Bacteria 997
1052 Ga0207648_11388621 3300026089 Bacteria 660
1053 Ga0207676_12155660 3300026095 Bacteria 556
1054 Ga0207675_100257516 3300026118 Bacteria 1690
1055 Ga0207675_101336587 3300026118 Bacteria 737
1056 Ga0207683_10079226 3300026121 Bacteria 2912
1057 Ga0207683_10547567 3300026121 Bacteria 1070
1058 Ga0207428_10060548 3300027907 Bacteria 2999
1059 Ga0207428_10259160 3300027907 Bacteria 1295
1060 Ga0268265_10773576 3300028380 Bacteria 934
1061 Ga0268265_10807345 3300028380 Bacteria 915
1062 Ga0268265_10953358 3300028380 Unclassified 845
1063 Ga0268264_10276093 3300028381 Bacteria 1572
1064 Ga0265334_10000050 3300028573 Bacteria 88877
1065 Ga0265318_10133017 3300028577 Bacteria 914
1066 Ga0265322_10063858 3300028654 Bacteria 1044
1067 Ga0265336_10037312 3300028666 Bacteria 1494
1068 Ga0265338_10024739 3300028800 Bacteria 6122
1069 Ga0265324_10002295 3300029957 Bacteria 9946
1070 Ga0265340_10417792 3300031247 Bacteria 591
1071 Ga0265327_10374190 3300031251 Bacteria 620
1072 Ga0307408_100481520 3300031548 Bacteria 1083
1073 Ga0307408_100806974 3300031548 Bacteria 852
1074 Ga0265314_10123690 3300031711 Bacteria 1624
1075 Ga0307405_10633020 3300031731 Bacteria 877
1076 Ga0307413_10305080 3300031824 Bacteria 1209
1077 Ga0307413_10410402 3300031824 Bacteria 1064
1078 Ga0307410_10106215 3300031852 Bacteria 2023
1079 Ga0307410_10437707 3300031852 Bacteria 1064
1080 Ga0307410_10784266 3300031852 Bacteria 809
1081 Ga0326468_10003387 3300031889 Bacteria 1349
1082 Ga0307406_10307781 3300031901 Bacteria 1220
1083 Ga0307406_10824977 3300031901 Bacteria 784
1084 Ga0307406_12023110 3300031901 Unclassified 515
1085 Ga0307407_10153487 3300031903 Bacteria 1499
1086 Ga0307412_10241581 3300031911 Bacteria 1397
1087 Ga0307409_100453464 3300031995 Bacteria 1238
1088 Ga0307409_100606487 3300031995 Bacteria 1082
1089 Ga0307409_100738083 3300031995 Bacteria 987
1090 Ga0307409_101351328 3300031995 Bacteria 738
1091 Ga0307409_101576061 3300031995 Bacteria 685
1092 Ga0307409_101796094 3300031995 Bacteria 642
1093 Ga0307409_102168318 3300031995 Bacteria 585
1094 Ga0307416_100331584 3300032002 Bacteria 1529
1095 Ga0307416_101142731 3300032002 Bacteria 884
1096 Ga0307416_102436568 3300032002 Bacteria 622
1097 Ga0307416_103222342 3300032002 Bacteria 546
1098 Ga0307414_10193754 3300032004 Bacteria 1647
1099 Ga0307414_10438516 3300032004 Bacteria 1143
1100 Ga0307414_10507784 3300032004 Bacteria 1068
1101 Ga0307414_10966702 3300032004 Bacteria 783
1102 Ga0307411_10510565 3300032005 Bacteria 1018
1103 Ga0307411_10562258 3300032005 Bacteria 975
1104 Ga0307415_100342589 3300032126 Bacteria 1255
1105 Ga0373959_0027480 3300034820 Bacteria 1131
1106 Ga0373928_0112076 3300035084 Bacteria 723
1107 Ga0373929_0025362 3300035085 Bacteria 1231
1108 Ga0373940_0005360 3300035088 Bacteria 2773
1109 Ga0373944_0011698 3300035089 Bacteria 2407
1110 Ga0373949_0082024 3300035090 Bacteria 861
1111 Ga0373951_0017080 3300035091 Bacteria 1640
1112 Ga0373936_0465316 3300035113 Bacteria 586
1113 Ga0373939_0026730 3300035114 Bacteria 1629
1114 Ga0373941_0065040 3300035115 Bacteria 1196
1115 Ga0373945_0002691 3300035116 Bacteria 5575
1116 Ga0373960_0090509 3300035121 Bacteria 977
1117 Ga0373942_0008751 3300035207 Bacteria 2365
1118 Ga0373961_0041971 3300035241 Bacteria 1324
1119 Ga0373962_0003487 3300035242 Bacteria 3779
1120 Ga0373962_0168043 3300035242 Bacteria 727
1121 Ga0373931_0120740 3300035691 Bacteria 1497
1122 Ga0373935_0546677 3300035692 Bacteria 844
1123 Ga0373927_0640465 3300035695 Bacteria 703
1124 Ga0373947_0012219 3300035725 Bacteria 4916
1125 Ga0373925_0007567 3300037068 Bacteria 7913
1126 Ga0395901_1175675 3300038443 Bacteria 734
1127 Ga0395901_1723709 3300038443 Unclassified 577
1128 Ga0451802_1785521 3300041460 Bacteria 741
1129 Ga0451837_0668580 3300041494 Bacteria 630
1130 Ga0451849_0628487 3300041505 Bacteria 734
1131 Ga0451849_1207563 3300041505 Bacteria 632
1132 Ga0451855_0225682 3300041511 Bacteria 723
1133 Ga0451853_3206294 3300041512 Bacteria 1218
1134 Ga0451853_3671869 3300041512 Bacteria 785
1135 Ga0439450_019469 3300042008 Bacteria 1438
1136 Ga0439463_011539 3300042016 Bacteria 2169
1137 Ga0450905_037928 3300042142 Bacteria 759
1138 Ga0466972_0075035 3300044658 Bacteria 1612
1139 Ga0466966_0148096 3300044684 Bacteria 1433
1140 Ga0466963_0140817 3300044694 Bacteria 1671
1141 Ga0466964_0866953 3300044706 Bacteria 514
1142 Ga0466971_0289682 3300044719 Bacteria 785
1143 Ga0466971_0388348 3300044719 Bacteria 679
1144 Ga0466968_0043063 3300044735 Bacteria 1910
1145 Ga0466968_0455915 3300044735 Bacteria 633
1146 Ga0466957_0813431 3300044842 Bacteria 664
1147 Ga0466960_0742979 3300044901 Bacteria 591
1148 Ga0466960_0838110 3300044901 Bacteria 558
1149 Ga0466959_0295710 3300045049 Bacteria 1109
1150 Ga0466967_0130775 3300045976 Bacteria 2330
1151 Ga0466967_0131585 3300045976 Bacteria 2323
1152 Ga0466967_0972964 3300045976 Bacteria 845
1153 Ga0466967_2230655 3300045976 Bacteria 543
1154 Ga0495603_0002969 3300046455 Bacteria 10030
1155 Ga0495641_0004863 3300046461 Bacteria 9328
1156 Ga0495580_0071374 3300046472 Bacteria 2426
1157 Ga0495582_0052512 3300046473 Bacteria 2248
1158 Ga0495594_0007678 3300046499 Bacteria 5548
1159 Ga0495596_0075433 3300046500 Bacteria 1310
1160 Ga0495596_0187310 3300046500 Bacteria 805
1161 Ga0495630_0000610 3300046517 Bacteria 25880
1162 Ga0495666_0017867 3300046526 Bacteria 3532
1163 Ga0495586_0404338 3300046535 Bacteria 786
1164 Ga0495645_0000159 3300046543 Bacteria 46648
1165 Ga0495668_0440399 3300046616 Bacteria 717
1166 Ga0495588_0000207 3300046674 Bacteria 57642
1167 Ga0495657_0000027 3300046675 Bacteria 131421
1168 Ga0495646_0357733 3300046680 Bacteria 764
1169 Ga0495647_0023726 3300046681 Bacteria 2227
1170 Ga0495658_0266396 3300046683 Bacteria 1079
1171 Ga0495658_0940994 3300046683 Bacteria 552
1172 Ga0495581_0220030 3300047315 Bacteria 1110
1173 Ga0495604_0000218 3300047317 Bacteria 52385
1174 Ga0495674_1471835 3300047319 Bacteria 505
1175 Ga0495676_0001213 3300047321 Bacteria 22072
1176 Ga0495684_0704227 3300047471 Bacteria 669
1177 Ga0496100_0180214 3300048903 Bacteria 1527
1178 Ga0496100_1043050 3300048903 Bacteria 644
1179 Ga0496101_0285968 3300048904 Bacteria 1289
1180 Ga0496101_0724618 3300048904 Bacteria 785
1181 Ga0496103_0067124 3300048906 Bacteria 2239
1182 Ga0496104_0060161 3300048907 Bacteria 3598
1183 Ga0496105_0018803 3300048908 Bacteria 5563
1184 Ga0496106_0115595 3300048909 Bacteria 2092
1185 Ga0496107_0214484 3300048910 Bacteria 1431
1186 Ga0496108_0590191 3300048911 Bacteria 968
1187 Ga0496108_1290287 3300048911 Bacteria 614
1188 Ga0496109_0508911 3300048912 Bacteria 1137
1189 Ga0496110_0866982 3300048913 Bacteria 808
1190 Ga0496112_0728860 3300048915 Bacteria 918
1191 Ga0496113_0713023 3300048916 Bacteria 800
1192 Ga0496114_0045540 3300048917 Bacteria 3644
1193 Ga0496114_0563062 3300048917 Bacteria 1006
1194 Ga0496114_1343913 3300048917 Bacteria 602
1195 Ga0496115_0238344 3300048918 Bacteria 1499
1196 Ga0496115_0362141 3300048918 Bacteria 1181
1197 Ga0496121_0004571 3300048924 Bacteria 18454
1198 Ga0496124_0090370 3300048927 Bacteria 2498
1199 Ga0501306_054459 3300049127 Bacteria 648
1200 Ga0501311_024664 3300049527 Bacteria 839
1201 Ga0501316_029739 3300049532 Bacteria 726
1202 Ga0501317_047385 3300049533 Bacteria 674
1203 Ga0501318_065871 3300049534 Bacteria 564
1204 Ga0501324_004324 3300049540 Bacteria 1127
1205 Ga0501031_0009868 3300049568 Bacteria 6215
1206 Ga0501031_0116394 3300049568 Bacteria 1746
1207 Ga0501032_0001419 3300049569 Bacteria 19025
1208 Ga0501032_0293188 3300049569 Bacteria 1052
1209 Ga0501033_0004084 3300049570 Bacteria 11779
1210 Ga0501034_0040256 3300049571 Bacteria 4730
1211 Ga0501034_0504155 3300049571 Bacteria 1124
1212 Ga0501034_0647281 3300049571 Bacteria 959
1213 Ga0501034_1424368 3300049571 Bacteria 568
1214 Ga0501036_0020928 3300049572 Bacteria 5493
1215 Ga0501036_0093293 3300049572 Bacteria 2543
1216 Ga0501036_0948691 3300049572 Bacteria 705
1217 Ga0501036_1208153 3300049572 Bacteria 616
1218 Ga0501037_0001774 3300049573 Bacteria 15668
1219 Ga0501037_0475138 3300049573 Bacteria 850
1220 Ga0501038_0029168 3300049574 Bacteria 4892
1221 Ga0501038_0143700 3300049574 Bacteria 1950
1222 Ga0501039_0009138 3300049575 Bacteria 7550
1223 Ga0501039_0034651 3300049575 Bacteria 3895
1224 Ga0501039_0393479 3300049575 Bacteria 1088
1225 Ga0501040_0159506 3300049576 Bacteria 1594
1226 Ga0501042_0008906 3300049578 Bacteria 6657
1227 Ga0501042_0079604 3300049578 Bacteria 2348
1228 Ga0501043_0006463 3300049579 Bacteria 9410
1229 Ga0501046_0014582 3300049580 Bacteria 6623
1230 Ga0501046_0067313 3300049580 Bacteria 2789
1231 Ga0501046_0320585 3300049580 Bacteria 1129
1232 Ga0501046_0550818 3300049580 Bacteria 822
1233 Ga0501047_0014422 3300049581 Bacteria 7514
1234 Ga0501048_0006374 3300049582 Bacteria 8968
1235 Ga0501048_1055168 3300049582 Bacteria 584
1236 Ga0501067_0001987 3300049583 Bacteria 11253
1237 Ga0501067_0556720 3300049583 Bacteria 642
1238 Ga0501068_0011636 3300049584 Bacteria 4971
1239 Ga0501068_0928492 3300049584 Bacteria 573
1240 Ga0501069_0001887 3300049585 Bacteria 10466
1241 Ga0501069_0153197 3300049585 Bacteria 1325
1242 Ga0501069_1038993 3300049585 Bacteria 501
1243 Ga0501070_0012789 3300049586 Bacteria 7074
1244 Ga0501070_0179684 3300049586 Bacteria 1742
1245 Ga0501070_0363821 3300049586 Bacteria 1173
1246 Ga0501071_0047834 3300049587 Bacteria 3073
1247 Ga0501071_0126857 3300049587 Bacteria 1894
1248 Ga0501071_0423540 3300049587 Bacteria 1017
1249 Ga0501071_0556446 3300049587 Bacteria 881
1250 Ga0501072_0050501 3300049588 Bacteria 3275
1251 Ga0501072_0053643 3300049588 Bacteria 3175
1252 Ga0501072_0172401 3300049588 Bacteria 1726
1253 Ga0501072_0670943 3300049588 Bacteria 815
1254 Ga0501073_0014497 3300049589 Bacteria 5727
1255 Ga0501073_0776045 3300049589 Bacteria 661
1256 Ga0501074_0005143 3300049590 Bacteria 9401
1257 Ga0501074_1157843 3300049590 Bacteria 543
1258 Ga0501075_0168542 3300049591 Bacteria 1670
1259 Ga0501075_0483561 3300049591 Bacteria 944
1260 Ga0501076_0063287 3300049592 Bacteria 2947
1261 Ga0501076_0107762 3300049592 Bacteria 2250
1262 Ga0501076_0335541 3300049592 Bacteria 1240
1263 Ga0501076_0858300 3300049592 Bacteria 749
1264 Ga0501076_1081364 3300049592 Bacteria 660
1265 Ga0501076_1321954 3300049592 Bacteria 593
1266 Ga0501077_0254387 3300049593 Bacteria 1117
1267 Ga0501077_0571453 3300049593 Bacteria 726
1268 Ga0501209_139259 3300049656 Bacteria 727
1269 Ga0501227_150624 3300049665 Bacteria 642
1270 Ga0501079_0021216 3300049741 Bacteria 4967
1271 Ga0501079_0058738 3300049741 Bacteria 2968
1272 Ga0501079_0206721 3300049741 Bacteria 1533
1273 Ga0501079_0454819 3300049741 Bacteria 1005
1274 Ga0501079_1303775 3300049741 Bacteria 572
1275 Ga0501080_0035304 3300049742 Bacteria 4666
1276 Ga0501081_0424017 3300049743 Bacteria 987
1277 Ga0501081_0466941 3300049743 Bacteria 938
1278 Ga0501083_0038461 3300049744 Bacteria 3252
1279 Ga0501083_0490003 3300049744 Bacteria 800
1280 Ga0501035_0004680 3300049822 Bacteria 12986
1281 Ga0501044_0046900 3300049823 Bacteria 4471
1282 Ga0501044_0105348 3300049823 Bacteria 2833
1283 Ga0501045_0061128 3300049824 Bacteria 2763
1284 Ga0501045_0170034 3300049824 Bacteria 1623
1285 Ga0501045_0275382 3300049824 Bacteria 1253
1286 Ga0501045_0401170 3300049824 Bacteria 1020
1287 nmdc:mga05p37_1173981_c1 3300050507 Bacteria 796
1288 nmdc:mga05p37_140990_c1 3300050507 Bacteria 2953
1289 nmdc:mga05p37_655985_c1 3300050507 Bacteria 1174
1290 nmdc:mga09592_232806_c1 3300050508 Bacteria 1596
1291 nmdc:mga09592_257040_c1 3300050508 Bacteria 1514
1292 nmdc:mga09592_568502_c1 3300050508 Bacteria 973
1293 nmdc:mga0qj67_1574985_c1 3300050509 Bacteria 504
1294 nmdc:mga0qj67_186845_c1 3300050509 Bacteria 1683
1295 nmdc:mga0qj67_325037_c1 3300050509 Bacteria 1245
1296 nmdc:mga0qj67_79691_c1 3300050509 Bacteria 2623
1297 nmdc:mga06r32_518183_c1 3300050510 Bacteria 1168
1298 nmdc:mga08y16_105243_c1 3300050511 Bacteria 2938
1299 nmdc:mga08y16_1705062_c1 3300050511 Bacteria 585
1300 nmdc:mga0n895_2119345_c1 3300050512 Bacteria 518
1301 nmdc:mga0rr50_251144_c1 3300050513 Bacteria 1469
1302 nmdc:mga08x19_485004_c1 3300050514 Bacteria 872
1303 nmdc:mga0a205_480427_c1 3300050515 Bacteria 1101
1304 Ga0495612_0000369 3300053078 Bacteria 18070
1305 Ga0495655_0016495 3300053083 Bacteria 1592
1306 Ga0495655_0113619 3300053083 Bacteria 817
1307 Ga0495655_0154065 3300053083 Bacteria 725
1308 Ga0500614_010984 3300053123 Bacteria 1952
1309 Ga0500616_0006301 3300053153 Bacteria 7797
1310 Ga0501084_0070292 3300054114 Bacteria 2931
1311 Ga0501084_0172483 3300054114 Bacteria 1826
1312 Ga0501084_0389012 3300054114 Bacteria 1178
1313 Ga0590075_031312 3300059424 Bacteria 1349
1314 Ga0587066_136132 3300059490 Bacteria 595
1315 Ga0587070_087302 3300059491 Bacteria 695
1316 Ga0587082_157456 3300059504 Bacteria 542
1317 Ga0587101_033148 3300059623 Bacteria 816
1318 Ga0501082_0004513 3300060353 Bacteria 12157
1319 Ga0501082_0417222 3300060353 Bacteria 1172
1320 Ga0501082_0836005 3300060353 Bacteria 805
1321 Ga0530510_0083464 3300061734 Bacteria 2326
1322 Ga0530510_0160256 3300061734 Bacteria 1664
1323 Ga0105242_10796608
1324 ARcpr5yngRDRAFT_c002193
1325 ARSoilOldRDRAFT_c001271
1326 ARCol0yngRDRAFT_1006257
1327 JGI24746J21847_1019833
1328 JGI24746J21847_1032839
1329 JGI24747J21853_1017587
1330 JGI24743J22301_10002688
1331 JGI24745J21846_1003433
1332 JGI24748J21848_1014638
1333 JGI24738J21930_10024157
1334 JGI24749J21850_1032000
1335 JGI24744J21845_10034617
1336 JGI24034J26672_10032208
1337 JGI24742J22300_10038875
1338 JGI24742J22300_10094405
1339 JGI25406J46586_10052208
1340 JGI25407J50210_10046114
1341 JGI25407J50210_10162107
1342 JGI25407J50210_10163917
1343 JGI25407J50210_10173795
1344 JGI25404J52841_10077625
1345 JGI25405J52794_10051634
1346 JGI25405J52794_10067261
1347 Ga0058863_11803168
1348 Ga0058863_11847184
1349 Ga0058861_11857066
1350 Ga0058860_12111299
1351 Ga0058862_12576965
1352 Ga0065712_10761830
1353 Ga0070658_10338143
1354 Ga0070658_10471734
1355 Ga0070658_10755162
1356 Ga0070658_11002223
1357 Ga0070676_10111060
1358 Ga0070676_10162187
1359 Ga0070676_10317199
1360 Ga0070683_100040915
1361 Ga0070683_100048587
1362 Ga0070683_100052862
1363 Ga0070683_100073949
1364 Ga0070683_100083711
1365 Ga0070683_100095159
1366 Ga0070683_100124380
1367 Ga0070683_100150245
1368 Ga0070683_100160411
1369 Ga0070683_100211490
1370 Ga0070683_100215027
1371 Ga0070683_100237222
1372 Ga0070683_100339785
1373 Ga0070683_100414687
1374 Ga0070683_100547342
1375 Ga0070683_100697187
1376 Ga0070683_100961623
1377 Ga0070683_101608715
1378 Ga0070690_100187345
1379 Ga0070690_101214059
1380 Ga0070690_101275973
1381 Ga0070690_101368001
1382 Ga0070670_101124851
1383 Ga0070677_10110877
1384 Ga0068869_100096752
1385 Ga0068869_100210538
1386 Ga0068869_100610926
1387 Ga0068869_100722528
1388 Ga0068869_101223944
1389 Ga0068869_101410726
1390 Ga0070666_10095510
1391 Ga0070666_10245177
1392 Ga0070666_11003415
1393 Ga0070666_11486220
1394 Ga0070680_100037493
1395 Ga0070680_100040374
1396 Ga0070680_100052241
1397 Ga0070680_100062879
1398 Ga0070680_100082971
1399 Ga0070680_100104181
1400 Ga0070680_100307064
1401 Ga0070680_100314757
1402 Ga0070680_100480035
1403 Ga0070680_100607620
1404 Ga0070680_100669331
1405 Ga0070680_101227071
1406 Ga0070682_100023242
1407 Ga0070682_100024543
1408 Ga0070682_100050306
1409 Ga0070682_100061757
1410 Ga0070682_100205027
1411 Ga0070682_100337880
1412 Ga0070682_100890487
1413 Ga0070682_101301371
1414 Ga0068868_100020690
1415 Ga0068868_100132660
1416 Ga0068868_100204793
1417 Ga0068868_100221410
1418 Ga0068868_100381634
1419 Ga0068868_100403804
1420 Ga0068868_100576107
1421 Ga0068868_100615583
1422 Ga0068868_100636158
1423 Ga0068868_100992494
1424 Ga0068868_101159921
1425 Ga0068868_101959346
1426 Ga0070660_100019891
1427 Ga0070660_100030868
1428 Ga0070660_100053710
1429 Ga0070660_100061092
1430 Ga0070660_100075848
1431 Ga0070660_100093346
1432 Ga0070660_100102442
1433 Ga0070660_100111951
1434 Ga0070660_100469627
1435 Ga0070660_100491955
1436 Ga0070660_100511450
1437 Ga0070660_100539554
1438 Ga0070660_100649005
1439 Ga0070660_100832672
1440 Ga0070660_100876146
1441 Ga0070660_100878257
1442 Ga0070660_101686143
1443 Ga0070689_100149525
1444 Ga0070689_100150835
1445 Ga0070689_100879152
1446 Ga0070691_10042499
1447 Ga0070691_10160493
1448 Ga0070691_10212776
1449 Ga0070691_10714737
1450 Ga0070687_100100199
1451 Ga0070687_100132113
1452 Ga0070687_100430243
1453 Ga0070661_100036270
1454 Ga0070661_100087407
1455 Ga0070661_100316748
1456 Ga0070661_100326876
1457 Ga0070661_100401730
1458 Ga0070661_100460829
1459 Ga0070661_100785089
1460 Ga0070661_100826212
1461 Ga0070661_101135922
1462 Ga0070692_10063167
1463 Ga0070692_10111824
1464 Ga0070692_10295645
1465 Ga0070692_10369317
1466 Ga0070692_10603469
1467 Ga0070668_100044085
1468 Ga0070668_100120284
1469 Ga0070668_100156277
1470 Ga0070668_100421446
1471 Ga0070668_101833698
1472 Ga0070669_100062879
1473 Ga0070669_100079494
1474 Ga0070669_101652847
1475 Ga0070675_100036205
1476 Ga0070675_100104618
1477 Ga0070675_100316617
1478 Ga0070675_100530456
1479 Ga0070671_100089289
1480 Ga0070671_100321328
1481 Ga0070671_100561760
1482 Ga0070671_100973704
1483 Ga0070674_100003700
1484 Ga0070674_100010676
1485 Ga0070674_100015299
1486 Ga0070674_100020953
1487 Ga0070674_100112998
1488 Ga0070674_100153586
1489 Ga0070674_100252850
1490 Ga0070674_100733475
1491 Ga0070674_102031494
1492 Ga0070673_100102161
1493 Ga0070673_100145007
1494 Ga0070673_100266712
1495 Ga0070673_100357282
1496 Ga0070673_100444856
1497 Ga0070673_100638553
1498 Ga0070688_100045366
1499 Ga0070688_100095030
1500 Ga0070688_100124221
1501 Ga0070688_101146922
1502 Ga0070659_100064189
1503 Ga0070659_100070396
1504 Ga0070659_100071570
1505 Ga0070659_100074674
1506 Ga0070659_100117232
1507 Ga0070659_100140446
1508 Ga0070659_100157166
1509 Ga0070659_100157675
1510 Ga0070659_100270134
1511 Ga0070659_100296329
1512 Ga0070659_100300027
1513 Ga0070659_100579157
1514 Ga0070659_100629791
1515 Ga0070659_100671205
1516 Ga0070659_100713665
1517 Ga0070659_101118401
1518 Ga0070659_101253311
1519 Ga0070659_101479622
1520 Ga0070667_100091729
1521 Ga0070667_101086570
1522 Ga0070667_101693932
1523 Ga0070703_10201196
1524 Ga0070703_10221245
1525 Ga0070703_10317544
1526 Ga0070703_10495774
1527 Ga0070709_10141509
1528 Ga0070709_10224959
1529 Ga0070709_10287210
1530 Ga0070709_10611862
1531 Ga0070709_10664286
1532 Ga0070714_100104764
1533 Ga0070714_100418816
1534 Ga0070714_100536607
1535 Ga0070714_100776785
1536 Ga0070714_101020073
1537 Ga0070714_101086536
1538 Ga0070714_101807620
1539 Ga0070713_100072911
1540 Ga0070713_100142445
1541 Ga0070713_100251033
1542 Ga0070713_100702178
1543 Ga0070713_101024195
1544 Ga0070713_101184173
1545 Ga0070713_101874948
1546 Ga0070710_10007399
1547 Ga0070710_10625809
1548 Ga0070710_10645416
1549 Ga0070710_10653011
1550 Ga0070710_10660856
1551 Ga0070701_10002177
1552 Ga0070701_10048125
1553 Ga0070701_10195406
1554 Ga0070701_10231671
1555 Ga0070701_10266972
1556 Ga0070701_10370319
1557 Ga0070701_10523256
1558 Ga0070711_100043851
1559 Ga0070711_100119143
1560 Ga0070711_100668723
1561 Ga0070711_101093470
1562 Ga0070711_101220988
1563 Ga0070711_102053446
1564 Ga0070705_100069513
1565 Ga0070705_100299426
1566 Ga0070705_100587569
1567 Ga0070705_100720620
1568 Ga0070705_100790079
1569 Ga0070705_101291411
1570 Ga0070705_101320753
1571 Ga0070700_100019191
1572 Ga0070700_100053571
1573 Ga0070700_100165240
1574 Ga0070700_100188872
1575 Ga0070700_100274106
1576 Ga0070700_100584152
1577 Ga0070700_101005102
1578 Ga0070694_100025639
1579 Ga0070694_100031801
1580 Ga0070694_100048697
1581 Ga0070694_100052816
1582 Ga0070694_100748150
1583 Ga0070694_101092761
1584 Ga0070694_101269523
1585 Ga0070708_101178917
1586 Ga0070663_100009685
1587 Ga0070663_100152016
1588 Ga0070663_100255403
1589 Ga0070663_100687198
1590 Ga0070663_101487798
1591 Ga0070663_102055301
1592 Ga0070678_100007082
1593 Ga0070678_100022177
1594 Ga0070678_100072914
1595 Ga0070678_100170026
1596 Ga0070678_100265872
1597 Ga0070678_100296133
1598 Ga0070678_100511779
1599 Ga0070678_100736558
1600 Ga0070678_101590394
1601 Ga0070678_101792259
1602 Ga0070662_100021923
1603 Ga0070662_100051470
1604 Ga0070662_100112326
1605 Ga0070662_100249287
1606 Ga0070662_100274769
1607 Ga0070662_100305042
1608 Ga0070662_100391461
1609 Ga0070662_101003427
1610 Ga0070662_101110170
1611 Ga0070662_101118455
1612 Ga0070681_10063242
1613 Ga0070681_10068530
1614 Ga0070681_10088261
1615 Ga0070681_10113536
1616 Ga0070681_10155241
1617 Ga0070681_10183030
1618 Ga0070681_10183510
1619 Ga0070681_10253352
1620 Ga0070681_10416957
1621 Ga0070681_10492706
1622 Ga0070681_10547588
1623 Ga0070681_10612293
1624 Ga0070681_10616256
1625 Ga0070681_10913203
1626 Ga0070681_11774531
1627 Ga0068867_100002654
1628 Ga0068867_100022422
1629 Ga0068867_100309535
1630 Ga0068867_100339400
1631 Ga0068867_100427405
1632 Ga0068867_100519057
1633 Ga0068867_100567970
1634 Ga0068867_100671251
1635 Ga0068867_100741521
1636 Ga0068867_101070332
1637 Ga0068867_101116454
1638 Ga0068867_101264784
1639 Ga0068867_101814628
1640 Ga0070685_10024319
1641 Ga0070685_10050137
1642 Ga0070685_10465517
1643 Ga0070706_100004600
1644 Ga0070706_100041219
1645 Ga0070706_100295467
1646 Ga0070706_100617582
1647 Ga0070706_101501355
1648 Ga0070707_100435300
1649 Ga0070707_101411634
1650 Ga0070698_100037357
1651 Ga0070698_100170942
1652 Ga0070698_100232054
1653 Ga0070699_100103674
1654 Ga0070699_100604609
1655 Ga0070699_100823518
1656 Ga0070699_100863291
1657 Ga0070699_100965803
1658 Ga0070699_101073184
1659 Ga0070679_100011272
1660 Ga0070679_100044973
1661 Ga0070679_100066883
1662 Ga0070679_100091020
1663 Ga0070679_100114573
1664 Ga0070679_100126367
1665 Ga0070679_100161324
1666 Ga0070679_100220524
1667 Ga0070679_100416842
1668 Ga0070679_100418965
1669 Ga0070679_100428620
1670 Ga0070679_100703013
1671 Ga0070679_100866601
1672 Ga0070679_101148353
1673 Ga0070679_101399829
1674 Ga0070679_101611503
1675 Ga0070684_100036224
1676 Ga0070684_100043943
1677 Ga0070684_100044476
1678 Ga0070684_100070239
1679 Ga0070684_100077352
1680 Ga0070684_100088097
1681 Ga0070684_100088491
1682 Ga0070684_100097314
1683 Ga0070684_100209067
1684 Ga0070684_100312732
1685 Ga0070684_100462517
1686 Ga0070684_100589886
1687 Ga0070684_100655024
1688 Ga0070684_100708416
1689 Ga0070684_100777434
1690 Ga0070684_101709525
1691 Ga0070697_100535072
1692 Ga0070697_100751910
1693 Ga0068853_100099099
1694 Ga0068853_100184222
1695 Ga0068853_100255782
1696 Ga0068853_100414514
1697 Ga0068853_100530322
1698 Ga0068853_101265885
1699 Ga0068853_101662993
1700 Ga0068853_101866281
1701 Ga0070672_100006485
1702 Ga0070672_100054169
1703 Ga0070672_100400397
1704 Ga0070672_100741585
1705 Ga0070686_100001859
1706 Ga0070686_100012471
1707 Ga0070686_100016355
1708 Ga0070686_100158467
1709 Ga0070686_100195049
1710 Ga0070686_100719772
1711 Ga0070686_100742350
1712 Ga0070686_100785042
1713 Ga0070686_100997393
1714 Ga0070686_101045498
1715 Ga0070686_101826670
1716 Ga0070695_100032064
1717 Ga0070695_100083819
1718 Ga0070695_100087285
1719 Ga0070695_100509844
1720 Ga0070695_100904915
1721 Ga0070695_100929604
1722 Ga0070696_100055733
1723 Ga0070696_100063206
1724 Ga0070696_100068365
1725 Ga0070696_100070010
1726 Ga0070696_100081357
1727 Ga0070696_100511858
1728 Ga0070696_100608655
1729 Ga0070696_100716924
1730 Ga0070696_101096994
1731 Ga0070696_101302188
1732 Ga0070696_101496286
1733 Ga0070693_100026397
1734 Ga0070693_100034385
1735 Ga0070693_100156273
1736 Ga0070693_100304996
1737 Ga0070693_100385528
1738 Ga0070693_100539026
1739 Ga0070693_100640598
1740 Ga0070693_100772967
1741 Ga0070665_100211019
1742 Ga0070665_101151783
1743 Ga0070665_101529205
1744 Ga0070665_101818063
1745 Ga0070704_100112866
1746 Ga0070704_100133857
1747 Ga0070704_100139268
1748 Ga0070704_100778127
1749 Ga0070704_101497349
1750 Ga0070704_101872393
1751 Ga0068855_100073919
1752 Ga0068855_100106021
1753 Ga0068855_100138502
1754 Ga0068855_100169561
1755 Ga0068855_100184130
1756 Ga0068855_100212793
1757 Ga0068855_100228145
1758 Ga0068855_100664946
1759 Ga0068855_100764021
1760 Ga0068855_100861236
1761 Ga0068855_101102795
1762 Ga0068855_101447328
1763 Ga0068855_101713102
1764 Ga0070664_100044141
1765 Ga0070664_100052955
1766 Ga0070664_100242696
1767 Ga0070664_100328655
1768 Ga0070664_100544405
1769 Ga0070664_100546719
1770 Ga0070664_100691678
1771 Ga0070664_100792658
1772 Ga0070664_100830745
1773 Ga0070664_100887271
1774 Ga0070664_100941043
1775 Ga0070664_101043574
1776 Ga0070664_101708368
1777 Ga0068857_100060498
1778 Ga0068857_100096347
1779 Ga0068857_100497736
1780 Ga0068857_100597874
1781 Ga0068857_101410226
1782 Ga0068857_102288622
1783 Ga0068857_102457877
1784 Ga0068854_100146685
1785 Ga0068854_100169994
1786 Ga0068854_100195318
1787 Ga0068854_100280399
1788 Ga0068854_100390926
1789 Ga0068854_100476282
1790 Ga0068854_100507326
1791 Ga0068854_101078629
1792 Ga0068854_101110590
1793 Ga0068854_101263061
1794 Ga0068854_101978748
1795 Ga0068856_100061747
1796 Ga0068856_100087875
1797 Ga0068856_100094373
1798 Ga0068856_100209275
1799 Ga0068856_100237918
1800 Ga0068856_100287090
1801 Ga0068856_100387845
1802 Ga0068856_100480470
1803 Ga0068856_100665562
1804 Ga0068856_100889360
1805 Ga0068856_101255515
1806 Ga0068856_101501025
1807 Ga0068856_102033088
1808 Ga0070702_100082965
1809 Ga0070702_100143119
1810 Ga0070702_100144878
1811 Ga0070702_100332808
1812 Ga0070702_100334155
1813 Ga0070702_100380407
1814 Ga0070702_100385815
1815 Ga0070702_100573335
1816 Ga0070702_100761786
1817 Ga0070702_101033083
1818 Ga0070702_101125796
1819 Ga0068852_100053060
1820 Ga0068852_100113321
1821 Ga0068852_100181089
1822 Ga0068852_100247728
1823 Ga0068852_100324653
1824 Ga0068852_100347456
1825 Ga0068852_101082105
1826 Ga0068852_101179084
1827 Ga0068859_100077473
1828 Ga0068859_100271290
1829 Ga0068859_100485416
1830 Ga0068859_100495376
1831 Ga0068859_100619529
1832 Ga0068859_102745498
1833 Ga0068864_100102135
1834 Ga0068864_100137812
1835 Ga0068864_100486071
1836 Ga0068864_101462757
1837 Ga0068864_101467204
1838 Ga0068864_101781613
1839 Ga0068864_101823675
1840 Ga0068864_102125864
1841 Ga0068866_10022254
1842 Ga0068866_10081263
1843 Ga0068866_10304227
1844 Ga0068866_10620078
1845 Ga0068866_11036248
1846 Ga0068861_100118072
1847 Ga0068861_100136067
1848 Ga0068861_100145472
1849 Ga0068861_100145924
1850 Ga0068861_100180269
1851 Ga0068861_100967261
1852 Ga0068861_101148082
1853 Ga0068861_101456398
1854 Ga0068861_101459012
1855 Ga0068861_101762686
1856 Ga0068851_10090101
1857 Ga0068851_10179907
1858 Ga0068851_10513628
1859 Ga0068851_10641178
1860 Ga0068870_10719370
1861 Ga0068870_10885480
1862 Ga0068870_11466360
1863 Ga0068863_100879253
1864 Ga0068863_101221212
1865 Ga0068858_100088305
1866 Ga0068858_100521439
1867 Ga0068858_100693359
1868 Ga0068858_100813676
1869 Ga0068858_101096059
1870 Ga0068858_101207192
1871 Ga0068860_100187152
1872 Ga0068860_100245679
1873 Ga0068860_100328163
1874 Ga0068860_100520013
1875 Ga0068860_100638781
1876 Ga0068860_101256660
1877 Ga0068862_100071539
1878 Ga0068862_100380863
1879 Ga0068862_102188522
1880 Ga0068862_102232865
1881 Ga0081455_10037522
1882 Ga0081455_10079337
1883 Ga0081455_10095855
1884 Ga0081455_10175235
1885 Ga0081455_10401262
1886 Ga0081455_10636450
1887 Ga0081538_10004299
1888 Ga0081538_10012860
1889 Ga0081538_10016324
1890 Ga0081538_10054517
1891 Ga0081538_10055855
1892 Ga0081538_10059984
1893 Ga0081538_10068544
1894 Ga0081538_10082618
1895 Ga0081538_10091265
1896 Ga0081538_10137396
1897 Ga0081538_10259123
1898 Ga0081538_10270483
1899 Ga0081538_10342311
1900 Ga0081540_1003884
1901 Ga0081540_1026371
1902 Ga0081539_10000433
1903 Ga0081539_10018498
1904 Ga0081539_10088849
1905 Ga0081539_10204302
1906 Ga0081539_10416794
1907 Ga0070717_10104039
1908 Ga0070717_10435316
1909 Ga0070717_10773935
1910 Ga0070717_11786901
1911 Ga0075365_10011270
1912 Ga0075365_10226382
1913 Ga0075365_10816327
1914 Ga0075365_11080873
1915 Ga0075368_10173339
1916 Ga0075364_10061279
1917 Ga0075364_11148451
1918 Ga0075432_10053096
1919 Ga0075432_10089076
1920 Ga0075432_10333064
1921 Ga0075432_10605048
1922 Ga0070715_10172070
1923 Ga0070716_100038369
1924 Ga0070712_100075712
1925 Ga0070712_100080357
1926 Ga0070712_100410478
1927 Ga0070712_100537387
1928 Ga0070712_101366850
1929 Ga0070712_101430045
1930 Ga0075367_10016016
1931 Ga0097621_100128402
1932 Ga0097621_100208967
1933 Ga0097621_100231985
1934 Ga0097621_100527350
1935 Ga0097621_100589651
1936 Ga0097621_100958380
1937 Ga0097621_101289299
1938 Ga0097621_101476258
1939 Ga0068871_100011473
1940 Ga0068871_100105148
1941 Ga0068871_100157991
1942 Ga0068871_100229346
1943 Ga0068871_100321069
1944 Ga0068871_100998551
1945 Ga0068871_101179864
1946 Ga0068871_101233782
1947 Ga0075428_100006916
1948 Ga0075428_100057351
1949 Ga0075428_100093707
1950 Ga0075428_100189399
1951 Ga0075428_101915091
1952 Ga0075430_100145437
1953 Ga0075430_100243650
1954 Ga0075431_100044647
1955 Ga0075431_100504210
1956 Ga0075431_101478834
1957 Ga0075431_101804976
1958 Ga0075433_10060962
1959 Ga0075433_10309230
1960 Ga0075433_10489117
1961 Ga0075433_10801951
1962 Ga0075433_10955828
1963 Ga0075433_11507444
1964 Ga0075434_100004118
1965 Ga0075434_100253864
1966 Ga0075434_100365841
1967 Ga0075434_100707534
1968 Ga0075434_100752075
1969 Ga0075434_101272718
1970 Ga0075434_101511292
1971 Ga0075434_102247103
1972 Ga0075429_100042592
1973 Ga0075429_100367063
1974 Ga0075429_100930186
1975 Ga0075429_101523344
1976 Ga0068865_100004970
1977 Ga0068865_100008462
1978 Ga0068865_100035906
1979 Ga0068865_100074432
1980 Ga0068865_100108694
1981 Ga0068865_100279309
1982 Ga0068865_100487467
1983 Ga0068865_100629757
1984 Ga0068865_100876164
1985 Ga0068865_100909555
1986 Ga0068865_101726689
1987 Ga0068865_101881844
1988 Ga0075436_100027242
1989 Ga0075436_100720612
1990 Ga0097620_100077474
1991 Ga0097620_100271308
1992 Ga0097620_100485398
1993 Ga0097620_100495394
1994 Ga0097620_100619595
1995 Ga0097620_102745386
1996 Ga0075435_100023442
1997 Ga0075435_100529553
1998 Ga0075435_100667363
1999 Ga0105244_10154083
2000 Ga0105240_10171319
2001 Ga0105240_10338285
2002 Ga0105240_10388949
2003 Ga0105240_10726438
2004 Ga0105240_10846992
2005 Ga0105240_10895192
2006 Ga0105240_11396438
2007 Ga0105240_11765891
2008 Ga0105240_12083086
2009 Ga0111539_10008690
2010 Ga0111539_10077145
2011 Ga0111539_10138766
2012 Ga0111539_10222221
2013 Ga0111539_10288697
2014 Ga0111539_10358540
2015 Ga0111539_10477944
2016 Ga0111539_10510115
2017 Ga0111539_11356171
2018 Ga0111539_12064828
2019 Ga0111539_12127387
2020 Ga0111539_12213992
2021 Ga0111539_12587065
2022 Ga0105245_10011302
2023 Ga0105245_10041827
2024 Ga0105245_10053657
2025 Ga0105245_10057735
2026 Ga0105245_10099339
2027 Ga0105245_10147094
2028 Ga0105245_10165618
2029 Ga0105245_10205435
2030 Ga0105245_10207575
2031 Ga0105245_10309528
2032 Ga0105245_10316582
2033 Ga0105245_10410203
2034 Ga0105245_10436578
2035 Ga0105245_10522983
2036 Ga0105245_10552116
2037 Ga0105245_11030890
2038 Ga0105245_11039774
2039 Ga0105245_11176466
2040 Ga0105245_11220485
2041 Ga0105245_11504905
2042 Ga0105245_11859435
2043 Ga0105245_12371615
2044 Ga0105245_12443499
2045 Ga0105245_12479095
2046 Ga0105247_10034107
2047 Ga0105247_10061048
2048 Ga0105247_10397388
2049 Ga0105247_10427392
2050 Ga0105247_10819272
2051 Ga0114129_10063872
2052 Ga0114129_10111444
2053 Ga0114129_10239881
2054 Ga0114129_10342315
2055 Ga0114129_10467558
2056 Ga0114129_10500192
2057 Ga0114129_10582546
2058 Ga0114129_10897135
2059 Ga0114129_11097458
2060 Ga0114129_11352524
2061 Ga0114129_11541353
2062 Ga0114129_12206885
2063 Ga0114129_12409073
2064 Ga0114129_13107133
2065 Ga0105243_10003056
2066 Ga0105243_10026201
2067 Ga0105243_10080355
2068 Ga0105243_10200695
2069 Ga0105243_10262578
2070 Ga0105243_10357152
2071 Ga0105243_10409437
2072 Ga0105243_10428111
2073 Ga0105243_10538815
2074 Ga0105243_10616624
2075 Ga0105243_10663590
2076 Ga0105243_10741680
2077 Ga0105243_10851277
2078 Ga0105243_10857287
2079 Ga0105243_10929394
2080 Ga0105243_10939016
2081 Ga0105243_11164702
2082 Ga0105243_12220099
2083 Ga0105241_10002714
2084 Ga0105241_10098159
2085 Ga0105241_10225366
2086 Ga0105241_10426997
2087 Ga0105241_10571877
2088 Ga0105241_10775628
2089 Ga0105241_10808068
2090 Ga0105241_10988617
2091 Ga0105241_12007514
2092 Ga0105242_10093276
2093 Ga0105242_10093833
2094 Ga0105242_10155215
2095 Ga0105242_10340554
2096 Ga0105242_10395608
2097 Ga0105242_10509043
2098 Ga0105242_10545112
2099 Ga0105242_10777607
2100 Ga0105242_10902156
2101 Ga0105242_11129413
2102 Ga0105242_11381760
2103 Ga0105242_11591925
2104 Ga0105242_11688838
2105 Ga0105242_11853254
2106 Ga0105242_12903826
2107 Ga0105248_10143113
2108 Ga0105248_10304028
2109 Ga0105248_10426121
2110 Ga0105248_10864792
2111 Ga0105248_11772207
2112 Ga0105248_12160463
2113 Ga0105237_10064717
2114 Ga0105237_10211769
2115 Ga0105237_10339508
2116 Ga0105237_10375091
2117 Ga0105237_11019175
2118 Ga0105237_11619935
2119 Ga0105237_11991636
2120 Ga0105237_12058804
2121 Ga0105238_10112480
2122 Ga0105238_10131720
2123 Ga0105238_10457516
2124 Ga0105238_10585333
2125 Ga0105238_10694491
2126 Ga0105238_11221709
2127 Ga0105238_11382895
2128 Ga0105238_11411312
2129 Ga0105238_11503123
2130 Ga0105238_11632267
2131 Ga0105238_12556503
2132 Ga0105249_10025487
2133 Ga0105249_10043113
2134 Ga0105249_10084750
2135 Ga0105249_10085189
2136 Ga0105249_10255890
2137 Ga0105249_10391565
2138 Ga0105249_10406147
2139 Ga0105249_10548179
2140 Ga0105249_10762306
2141 Ga0105249_11803311
2142 Ga0105239_10002930
2143 Ga0105239_10104152
2144 Ga0105239_10182933
2145 Ga0105239_10275481
2146 Ga0105239_10297492
2147 Ga0105239_10340143
2148 Ga0105239_10444331
2149 Ga0105239_10454293
2150 Ga0105239_10533474
2151 Ga0105239_10557925
2152 Ga0105239_10698769
2153 Ga0105239_10734450
2154 Ga0105239_11092981
2155 Ga0105239_11143337
2156 Ga0105239_11270950
2157 Ga0105239_11328009
2158 Ga0105239_11474538
2159 Ga0105239_12163789
2160 Ga0105246_10025832
2161 Ga0105246_10083022
2162 Ga0105246_10225008
2163 Ga0105246_10452134
2164 Ga0105246_10638200
2165 Ga0105246_10790447
2166 Ga0105246_11065225
2167 Ga0105246_11434901
2168 Ga0105246_12132345
2169 Ga0157340_1002552
2170 Ga0157317_1026661
2171 Ga0157329_1016550
2172 Ga0157335_1002600
2173 Ga0157341_1021465
2174 Ga0157323_1040712
2175 Ga0157313_1017789
2176 Ga0157324_1002996
2177 Ga0157324_1004961
2178 Ga0157324_1031667
2179 Ga0157324_1048810
2180 Ga0157342_1009106
2181 Ga0157316_1067785
2182 Ga0157338_1007774
2183 Ga0157338_1020785
2184 Ga0157373_10838968
2185 Ga0157373_11070896
2186 Ga0157371_10184507
2187 Ga0157371_10190601
2188 Ga0157371_10909746
2189 Ga0157371_10935769
2190 Ga0157371_11038428
2191 Ga0157371_11386712
2192 Ga0157370_10057577
2193 Ga0157370_10293751
2194 Ga0157370_10294518
2195 Ga0157370_10365677
2196 Ga0157370_10787817
2197 Ga0157370_11014341
2198 Ga0157370_12102213
2199 Ga0157369_10053800
2200 Ga0157369_10267436
2201 Ga0157369_10326902
2202 Ga0157369_10617565
2203 Ga0157369_10621481
2204 Ga0157369_11994635
2205 Ga0157369_12517765
2206 Ga0157374_10122498
2207 Ga0157374_10178409
2208 Ga0157374_10262594
2209 Ga0157374_10419780
2210 Ga0157374_10523321
2211 Ga0157374_10702831
2212 Ga0157374_10880539
2213 Ga0157374_11007903
2214 Ga0157374_11207920
2215 Ga0157374_12580071
2216 Ga0157378_10043462
2217 Ga0157378_10194433
2218 Ga0157378_10632887
2219 Ga0157378_10961640
2220 Ga0157378_11986699
2221 Ga0157378_12034587
2222 Ga0157378_12221438
2223 Ga0157378_12335337
2224 Ga0157378_12996414
2225 Ga0163162_10001805
2226 Ga0163162_10124415
2227 Ga0163162_10290701
2228 Ga0163162_10383122
2229 Ga0163162_10403918
2230 Ga0163162_10476682
2231 Ga0163162_10491007
2232 Ga0163162_10669331
2233 Ga0163162_11137114
2234 Ga0163162_11809424
2235 Ga0157372_10104802
2236 Ga0157372_10162754
2237 Ga0157372_10210951
2238 Ga0157372_10242915
2239 Ga0157372_10289616
2240 Ga0157372_10634614
2241 Ga0157372_10740006
2242 Ga0157372_10786325
2243 Ga0157372_10861155
2244 Ga0157372_11307810
2245 Ga0157372_11570146
2246 Ga0157375_10060387
2247 Ga0157375_10117655
2248 Ga0157375_10226193
2249 Ga0157375_10238870
2250 Ga0157375_10446893
2251 Ga0157375_10562887
2252 Ga0157375_10661838
2253 Ga0157375_10668759
2254 Ga0157375_10801014
2255 Ga0157375_11212645
2256 Ga0157375_12834651
2257 Ga0157375_13538208
2258 Ga0163163_10066834
2259 Ga0163163_10101176
2260 Ga0163163_10127995
2261 Ga0163163_10213566
2262 Ga0163163_10512050
2263 Ga0163163_10606150
2264 Ga0163163_10987011
2265 Ga0163163_12447495
2266 Ga0157380_10066392
2267 Ga0157380_10101400
2268 Ga0157380_10102157
2269 Ga0157380_10155592
2270 Ga0157380_10177933
2271 Ga0157380_10646206
2272 Ga0157380_10880764
2273 Ga0157380_11281898
2274 Ga0157380_13100117
2275 Ga0157380_13122876
2276 Ga0157380_13465445
2277 Ga0182008_10156962
2278 Ga0182008_10713631
2279 Ga0157377_10083169
2280 Ga0157377_10145634
2281 Ga0157377_10230575
2282 Ga0157377_10246712
2283 Ga0157377_10562789
2284 Ga0157377_10741345
2285 Ga0157377_10868945
2286 Ga0157379_10037051
2287 Ga0157379_10108459
2288 Ga0157379_10287319
2289 Ga0157379_10319919
2290 Ga0157379_10488784
2291 Ga0157379_11237081
2292 Ga0157379_12065847
2293 Ga0157376_10089480
2294 Ga0157376_10090295
2295 Ga0157376_10100646
2296 Ga0157376_10105943
2297 Ga0157376_10232333
2298 Ga0157376_11218287
2299 Ga0157376_11522588
2300 Ga0182006_1254272
2301 Ga0182007_10109673
2302 Ga0163161_10527628
2303 Ga0163161_10796543
2304 Ga0197907_10154402
2305 Ga0206356_11907781
2306 Ga0206351_10348351
2307 Ga0206353_10991685
2308 Ga0224712_10179155
2309 Ga0207692_10155319
2310 Ga0207692_10203451
2311 Ga0207642_10182305
2312 Ga0207642_10333280
2313 Ga0207688_10466544
2314 Ga0207680_11193403
2315 Ga0207685_10208442
2316 Ga0207699_11018537
2317 Ga0207654_10772905
2318 Ga0207707_10211443
2319 Ga0207695_10041220
2320 Ga0207693_10143582
2321 Ga0207693_10379361
2322 Ga0207693_10379362
2323 Ga0207663_10020411
2324 Ga0207663_10241772
2325 Ga0207660_10342749
2326 Ga0207660_10537359
2327 Ga0207660_11579420
2328 Ga0207657_10367501
2329 Ga0207652_10469761
2330 Ga0207646_10511850
2331 Ga0207681_10203471
2332 Ga0207694_11755602
2333 Ga0207687_10199209
2334 Ga0207700_10583684
2335 Ga0207664_10025646
2336 Ga0207664_10233520
2337 Ga0207644_10652818
2338 Ga0207690_10244176
2339 Ga0207690_10621688
2340 Ga0207690_11853483
2341 Ga0207706_10810015
2342 Ga0207686_11333340
2343 Ga0207709_10319971
2344 Ga0207709_10514297
2345 Ga0207669_10005898
2346 Ga0207704_10703976
2347 Ga0207704_10808882
2348 Ga0207704_11031348
2349 Ga0207704_11344170
2350 Ga0207704_11709943
2351 Ga0207665_10016840
2352 Ga0207689_11345232
2353 Ga0207679_10031597
2354 Ga0207668_10173476
2355 Ga0207668_10253804
2356 Ga0207640_10264213
2357 Ga0207640_10590170
2358 Ga0207658_10598183
2359 Ga0207658_12048623
2360 Ga0207677_10168016
2361 Ga0207677_10205508
2362 Ga0207677_10639670
2363 Ga0207703_11418037
2364 Ga0207678_10078973
2365 Ga0207678_10168023
2366 Ga0207678_11153645
2367 Ga0207708_10224638
2368 Ga0207708_10443669
2369 Ga0207708_11794184
2370 Ga0207702_10322201
2371 Ga0207648_10066179
2372 Ga0207648_10139051
2373 Ga0207648_10621451
2374 Ga0207648_11388621
2375 Ga0207676_12155660
2376 Ga0207675_100257516
2377 Ga0207675_101336587
2378 Ga0207683_10079226
2379 Ga0207683_10547567
2380 Ga0207428_10060548
2381 Ga0207428_10259160
2382 Ga0268265_10773576
2383 Ga0268265_10807345
2384 Ga0268265_10953358
2385 Ga0268264_10276093
2386 Ga0265334_10000050
2387 Ga0265318_10133017
2388 Ga0265322_10063858
2389 Ga0265336_10037312
2390 Ga0265338_10024739
2391 Ga0265324_10002295
2392 Ga0265340_10417792
2393 Ga0265327_10374190
2394 Ga0307408_100481520
2395 Ga0307408_100806974
2396 Ga0265314_10123690
2397 Ga0307405_10633020
2398 Ga0307413_10305080
2399 Ga0307413_10410402
2400 Ga0307410_10106215
2401 Ga0307410_10437707
2402 Ga0307410_10784266
2403 Ga0326468_10003387
2404 Ga0307406_10307781
2405 Ga0307406_10824977
2406 Ga0307406_12023110
2407 Ga0307407_10153487
2408 Ga0307412_10241581
2409 Ga0307409_100453464
2410 Ga0307409_100606487
2411 Ga0307409_100738083
2412 Ga0307409_101351328
2413 Ga0307409_101576061
2414 Ga0307409_101796094
2415 Ga0307409_102168318
2416 Ga0307416_100331584
2417 Ga0307416_101142731
2418 Ga0307416_102436568
2419 Ga0307416_103222342
2420 Ga0307414_10193754
2421 Ga0307414_10438516
2422 Ga0307414_10507784
2423 Ga0307414_10966702
2424 Ga0307411_10510565
2425 Ga0307411_10562258
2426 Ga0307415_100342589
2427 Ga0373959_0027480
2428 Ga0373928_0112076
2429 Ga0373929_0025362
2430 Ga0373940_0005360
2431 Ga0373944_0011698
2432 Ga0373949_0082024
2433 Ga0373951_0017080
2434 Ga0373936_0465316
2435 Ga0373939_0026730
2436 Ga0373941_0065040
2437 Ga0373945_0002691
2438 Ga0373960_0090509
2439 Ga0373942_0008751
2440 Ga0373961_0041971
2441 Ga0373962_0003487
2442 Ga0373962_0168043
2443 Ga0373931_0120740
2444 Ga0373935_0546677
2445 Ga0373927_0640465
2446 Ga0373947_0012219
2447 Ga0373925_0007567
2448 Ga0395901_1175675
2449 Ga0395901_1723709
2450 Ga0451802_1785521
2451 Ga0451837_0668580
2452 Ga0451849_0628487
2453 Ga0451849_1207563
2454 Ga0451855_0225682
2455 Ga0451853_3206294
2456 Ga0451853_3671869
2457 Ga0439450_019469
2458 Ga0439463_011539
2459 Ga0450905_037928
2460 Ga0466972_0075035
2461 Ga0466966_0148096
2462 Ga0466963_0140817
2463 Ga0466964_0866953
2464 Ga0466971_0289682
2465 Ga0466971_0388348
2466 Ga0466968_0043063
2467 Ga0466968_0455915
2468 Ga0466957_0813431
2469 Ga0466960_0742979
2470 Ga0466960_0838110
2471 Ga0466959_0295710
2472 Ga0466967_0130775
2473 Ga0466967_0131585
2474 Ga0466967_0972964
2475 Ga0466967_2230655
2476 Ga0495603_0002969
2477 Ga0495641_0004863
2478 Ga0495580_0071374
2479 Ga0495582_0052512
2480 Ga0495594_0007678
2481 Ga0495596_0075433
2482 Ga0495596_0187310
2483 Ga0495630_0000610
2484 Ga0495666_0017867
2485 Ga0495586_0404338
2486 Ga0495645_0000159
2487 Ga0495668_0440399
2488 Ga0495588_0000207
2489 Ga0495657_0000027
2490 Ga0495646_0357733
2491 Ga0495647_0023726
2492 Ga0495658_0266396
2493 Ga0495658_0940994
2494 Ga0495581_0220030
2495 Ga0495604_0000218
2496 Ga0495674_1471835
2497 Ga0495676_0001213
2498 Ga0495684_0704227
2499 Ga0496100_0180214
2500 Ga0496100_1043050
2501 Ga0496101_0285968
2502 Ga0496101_0724618
2503 Ga0496103_0067124
2504 Ga0496104_0060161
2505 Ga0496105_0018803
2506 Ga0496106_0115595
2507 Ga0496107_0214484
2508 Ga0496108_0590191
2509 Ga0496108_1290287
2510 Ga0496109_0508911
2511 Ga0496110_0866982
2512 Ga0496112_0728860
2513 Ga0496113_0713023
2514 Ga0496114_0045540
2515 Ga0496114_0563062
2516 Ga0496114_1343913
2517 Ga0496115_0238344
2518 Ga0496115_0362141
2519 Ga0496121_0004571
2520 Ga0496124_0090370
2521 Ga0501306_054459
2522 Ga0501311_024664
2523 Ga0501316_029739
2524 Ga0501317_047385
2525 Ga0501318_065871
2526 Ga0501324_004324
2527 Ga0501031_0009868
2528 Ga0501031_0116394
2529 Ga0501032_0001419
2530 Ga0501032_0293188
2531 Ga0501033_0004084
2532 Ga0501034_0040256
2533 Ga0501034_0504155
2534 Ga0501034_0647281
2535 Ga0501034_1424368
2536 Ga0501036_0020928
2537 Ga0501036_0093293
2538 Ga0501036_0948691
2539 Ga0501036_1208153
2540 Ga0501037_0001774
2541 Ga0501037_0475138
2542 Ga0501038_0029168
2543 Ga0501038_0143700
2544 Ga0501039_0009138
2545 Ga0501039_0034651
2546 Ga0501039_0393479
2547 Ga0501040_0159506
2548 Ga0501042_0008906
2549 Ga0501042_0079604
2550 Ga0501043_0006463
2551 Ga0501046_0014582
2552 Ga0501046_0067313
2553 Ga0501046_0320585
2554 Ga0501046_0550818
2555 Ga0501047_0014422
2556 Ga0501048_0006374
2557 Ga0501048_1055168
2558 Ga0501067_0001987
2559 Ga0501067_0556720
2560 Ga0501068_0011636
2561 Ga0501068_0928492
2562 Ga0501069_0001887
2563 Ga0501069_0153197
2564 Ga0501069_1038993
2565 Ga0501070_0012789
2566 Ga0501070_0179684
2567 Ga0501070_0363821
2568 Ga0501071_0047834
2569 Ga0501071_0126857
2570 Ga0501071_0423540
2571 Ga0501071_0556446
2572 Ga0501072_0050501
2573 Ga0501072_0053643
2574 Ga0501072_0172401
2575 Ga0501072_0670943
2576 Ga0501073_0014497
2577 Ga0501073_0776045
2578 Ga0501074_0005143
2579 Ga0501074_1157843
2580 Ga0501075_0168542
2581 Ga0501075_0483561
2582 Ga0501076_0063287
2583 Ga0501076_0107762
2584 Ga0501076_0335541
2585 Ga0501076_0858300
2586 Ga0501076_1081364
2587 Ga0501076_1321954
2588 Ga0501077_0254387
2589 Ga0501077_0571453
2590 Ga0501209_139259
2591 Ga0501227_150624
2592 Ga0501079_0021216
2593 Ga0501079_0058738
2594 Ga0501079_0206721
2595 Ga0501079_0454819
2596 Ga0501079_1303775
2597 Ga0501080_0035304
2598 Ga0501081_0424017
2599 Ga0501081_0466941
2600 Ga0501083_0038461
2601 Ga0501083_0490003
2602 Ga0501035_0004680
2603 Ga0501044_0046900
2604 Ga0501044_0105348
2605 Ga0501045_0061128
2606 Ga0501045_0170034
2607 Ga0501045_0275382
2608 Ga0501045_0401170
2609 nmdc:mga05p37_1173981_c1
2610 nmdc:mga05p37_140990_c1
2611 nmdc:mga05p37_655985_c1
2612 nmdc:mga09592_232806_c1
2613 nmdc:mga09592_257040_c1
2614 nmdc:mga09592_568502_c1
2615 nmdc:mga0qj67_1574985_c1
2616 nmdc:mga0qj67_186845_c1
2617 nmdc:mga0qj67_325037_c1
2618 nmdc:mga0qj67_79691_c1
2619 nmdc:mga06r32_518183_c1
2620 nmdc:mga08y16_105243_c1
2621 nmdc:mga08y16_1705062_c1
2622 nmdc:mga0n895_2119345_c1
2623 nmdc:mga0rr50_251144_c1
2624 nmdc:mga08x19_485004_c1
2625 nmdc:mga0a205_480427_c1
2626 Ga0495612_0000369
2627 Ga0495655_0016495
2628 Ga0495655_0113619
2629 Ga0495655_0154065
2630 Ga0500614_010984
2631 Ga0500616_0006301
2632 Ga0501084_0070292
2633 Ga0501084_0172483
2634 Ga0501084_0389012
2635 Ga0590075_031312
2636 Ga0587066_136132
2637 Ga0587070_087302
2638 Ga0587082_157456
2639 Ga0587101_033148
2640 Ga0501082_0004513
2641 Ga0501082_0417222
2642 Ga0501082_0836005
2643 Ga0530510_0083464
2644 Ga0530510_0160256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

5

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9695 5 87
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9659 5 88
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9626 6 86
6tnn-assembly1.cif.gz_m mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna 0.9597 3 88
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.9582 6 90
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.953 5 89 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9104 6 90 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9019 5 89 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8996 5 96 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8994 6 90 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1G2LBI1-F1-model_v4 Large ribosomal subunit protein uL23 0.9971 9 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2LQR1-F1-model_v4 Large ribosomal subunit protein uL23 0.9952 8 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2RQ99-F1-model_v4 Large ribosomal subunit protein uL23 0.994 8 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G0PPB3-F1-model_v4 50S ribosomal protein L23 0.9936 8 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V5X0N2-F1-model_v4 Large ribosomal subunit protein uL23 0.9931 6 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map