F492979
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1321 | 374 | 2642 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100760279|Ga0075430_1007602792 |
| Length | 163 |
| Sequence | MSGRSASLAAVLALPASGGPSADTLDHMYSVTKKIDFCYGHRLLDYDGICKHPHGHNATAEIEVRTGTLDDRNMVCDFSDIKRLVKGWIDRELDHRMILRHDDPLVKPLQQLNEPVFILDSNPTVERIARLIFDRARDEGLPVVKVTVWETPTSFATYQGEPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 219 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 239 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 243 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 246 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 247 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 248 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 254 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 255 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 256 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 257 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 258 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 259 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 336 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 337 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 370 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 371 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 372 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 373 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.92 |
| Metatranscriptomes | 0.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.67 |
| Nodule | 0 |
| Rhizoplane | 2.35 |
| Rhizosphere | 95.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075430_100760279 | 3300006846 | Bacteria | 799 |
| 2 | SwRhRL2b_contig_3023099 | 2162886007 | Unclassified | 839 |
| 3 | JGI24751J29686_10023078 | 3300002459 | Unclassified | 1290 |
| 4 | Ga0065714_10190167 | 3300005288 | Unclassified | 930 |
| 5 | Ga0065704_10260029 | 3300005289 | Unclassified | 968 |
| 6 | Ga0065704_10330377 | 3300005289 | Unclassified | 839 |
| 7 | Ga0065712_10086649 | 3300005290 | Unclassified | 2623 |
| 8 | Ga0065712_10102157 | 3300005290 | Bacteria | 2016 |
| 9 | Ga0065712_10173745 | 3300005290 | Bacteria | 1229 |
| 10 | Ga0065712_10357194 | 3300005290 | Unclassified | 775 |
| 11 | Ga0065712_10494306 | 3300005290 | Bacteria | 653 |
| 12 | Ga0065712_10514004 | 3300005290 | Unclassified | 640 |
| 13 | Ga0065712_10634136 | 3300005290 | Unclassified | 567 |
| 14 | Ga0065715_10004432 | 3300005293 | Unclassified | 3549 |
| 15 | Ga0065715_10010449 | 3300005293 | Unclassified | 2487 |
| 16 | Ga0065715_10011976 | 3300005293 | Bacteria | 2837 |
| 17 | Ga0065715_10044557 | 3300005293 | Bacteria | 1016 |
| 18 | Ga0065715_10178075 | 3300005293 | Unclassified | 1488 |
| 19 | Ga0065715_10181727 | 3300005293 | Bacteria | 1472 |
| 20 | Ga0065715_10234929 | 3300005293 | Bacteria | 1220 |
| 21 | Ga0065715_10394437 | 3300005293 | Bacteria | 890 |
| 22 | Ga0065715_10409966 | 3300005293 | Bacteria | 871 |
| 23 | Ga0065715_10518430 | 3300005293 | Bacteria | 765 |
| 24 | Ga0065715_10540265 | 3300005293 | Unclassified | 733 |
| 25 | Ga0065715_10802421 | 3300005293 | Bacteria | 609 |
| 26 | Ga0065707_10001222 | 3300005295 | Bacteria | 9734 |
| 27 | Ga0065707_10097394 | 3300005295 | Unclassified | 3178 |
| 28 | Ga0065707_10139415 | 3300005295 | Bacteria | 1793 |
| 29 | Ga0065707_10270245 | 3300005295 | Unclassified | 1073 |
| 30 | Ga0065707_10289629 | 3300005295 | Bacteria | 1028 |
| 31 | Ga0065707_10495290 | 3300005295 | Bacteria | 762 |
| 32 | Ga0065707_10598064 | 3300005295 | Bacteria | 692 |
| 33 | Ga0065707_10820934 | 3300005295 | Unclassified | 592 |
| 34 | Ga0065707_10831921 | 3300005295 | Bacteria | 588 |
| 35 | Ga0065707_11140112 | 3300005295 | Bacteria | 507 |
| 36 | Ga0070658_10452761 | 3300005327 | Bacteria | 1106 |
| 37 | Ga0070676_10351772 | 3300005328 | Bacteria | 1013 |
| 38 | Ga0070676_11134892 | 3300005328 | Bacteria | 592 |
| 39 | Ga0070683_101029768 | 3300005329 | Unclassified | 790 |
| 40 | Ga0070683_101219873 | 3300005329 | Bacteria | 723 |
| 41 | Ga0070690_100237884 | 3300005330 | Unclassified | 1283 |
| 42 | Ga0070690_100846487 | 3300005330 | Bacteria | 712 |
| 43 | Ga0070690_101050424 | 3300005330 | Unclassified | 644 |
| 44 | Ga0070670_100005174 | 3300005331 | Bacteria | 10982 |
| 45 | Ga0070670_100110851 | 3300005331 | Unclassified | 2364 |
| 46 | Ga0070670_100362387 | 3300005331 | Unclassified | 1275 |
| 47 | Ga0070670_101012278 | 3300005331 | Bacteria | 756 |
| 48 | Ga0070670_101069563 | 3300005331 | Bacteria | 735 |
| 49 | Ga0070670_101241235 | 3300005331 | Bacteria | 682 |
| 50 | Ga0070670_101884098 | 3300005331 | Bacteria | 551 |
| 51 | Ga0068869_100139914 | 3300005334 | Bacteria | 1868 |
| 52 | Ga0068869_100180058 | 3300005334 | Bacteria | 1657 |
| 53 | Ga0068869_101056352 | 3300005334 | Bacteria | 709 |
| 54 | Ga0070666_10084179 | 3300005335 | Bacteria | 2176 |
| 55 | Ga0070666_10235382 | 3300005335 | Bacteria | 1294 |
| 56 | Ga0070666_10692876 | 3300005335 | Bacteria | 747 |
| 57 | Ga0070666_11071548 | 3300005335 | Unclassified | 599 |
| 58 | Ga0070666_11149221 | 3300005335 | Bacteria | 578 |
| 59 | Ga0070680_100067988 | 3300005336 | Bacteria | 2924 |
| 60 | Ga0070680_100592833 | 3300005336 | Bacteria | 951 |
| 61 | Ga0070682_100795487 | 3300005337 | Bacteria | 768 |
| 62 | Ga0070682_101083481 | 3300005337 | Bacteria | 670 |
| 63 | Ga0068868_100152623 | 3300005338 | Bacteria | 1903 |
| 64 | Ga0068868_100212789 | 3300005338 | Bacteria | 1616 |
| 65 | Ga0068868_100457061 | 3300005338 | Bacteria | 1111 |
| 66 | Ga0068868_100624357 | 3300005338 | Bacteria | 957 |
| 67 | Ga0068868_100844688 | 3300005338 | Bacteria | 829 |
| 68 | Ga0068868_101228066 | 3300005338 | Bacteria | 694 |
| 69 | Ga0070660_100088974 | 3300005339 | Bacteria | 2432 |
| 70 | Ga0070660_101326667 | 3300005339 | Bacteria | 611 |
| 71 | Ga0070689_100023910 | 3300005340 | Bacteria | 4580 |
| 72 | Ga0070689_100029886 | 3300005340 | Unclassified | 4131 |
| 73 | Ga0070689_100054546 | 3300005340 | Bacteria | 3095 |
| 74 | Ga0070689_100111034 | 3300005340 | Bacteria | 2181 |
| 75 | Ga0070689_100224672 | 3300005340 | Bacteria | 1541 |
| 76 | Ga0070689_100334348 | 3300005340 | Bacteria | 1268 |
| 77 | Ga0070689_100763760 | 3300005340 | Unclassified | 848 |
| 78 | Ga0070689_101355183 | 3300005340 | Unclassified | 642 |
| 79 | Ga0070687_100065675 | 3300005343 | Bacteria | 1931 |
| 80 | Ga0070687_100718685 | 3300005343 | Unclassified | 700 |
| 81 | Ga0070661_100422300 | 3300005344 | Bacteria | 1057 |
| 82 | Ga0070661_100664349 | 3300005344 | Bacteria | 847 |
| 83 | Ga0070661_101820716 | 3300005344 | Bacteria | 517 |
| 84 | Ga0070668_100678674 | 3300005347 | Unclassified | 907 |
| 85 | Ga0070668_101193708 | 3300005347 | Unclassified | 689 |
| 86 | Ga0070669_100002308 | 3300005353 | Bacteria | 13809 |
| 87 | Ga0070669_100065135 | 3300005353 | Bacteria | 2685 |
| 88 | Ga0070669_100091616 | 3300005353 | Bacteria | 2280 |
| 89 | Ga0070669_100096980 | 3300005353 | Bacteria | 2219 |
| 90 | Ga0070669_100776668 | 3300005353 | Unclassified | 813 |
| 91 | Ga0070675_100000989 | 3300005354 | Bacteria | 20344 |
| 92 | Ga0070675_100005827 | 3300005354 | Bacteria | 9436 |
| 93 | Ga0070675_100012455 | 3300005354 | Bacteria | 6661 |
| 94 | Ga0070675_100064513 | 3300005354 | Unclassified | 3028 |
| 95 | Ga0070675_100147719 | 3300005354 | Bacteria | 2014 |
| 96 | Ga0070675_100291937 | 3300005354 | Bacteria | 1435 |
| 97 | Ga0070675_100374732 | 3300005354 | Bacteria | 1266 |
| 98 | Ga0070675_100634928 | 3300005354 | Unclassified | 970 |
| 99 | Ga0070675_100776515 | 3300005354 | Bacteria | 875 |
| 100 | Ga0070675_100844622 | 3300005354 | Bacteria | 838 |
| 101 | Ga0070675_101000175 | 3300005354 | Unclassified | 768 |
| 102 | Ga0070675_101510478 | 3300005354 | Bacteria | 620 |
| 103 | Ga0070675_101731233 | 3300005354 | Unclassified | 577 |
| 104 | Ga0070671_100015045 | 3300005355 | Bacteria | 6249 |
| 105 | Ga0070671_100090035 | 3300005355 | Bacteria | 2568 |
| 106 | Ga0070671_100241651 | 3300005355 | Bacteria | 1533 |
| 107 | Ga0070671_100499938 | 3300005355 | Bacteria | 1046 |
| 108 | Ga0070674_100085088 | 3300005356 | Bacteria | 2269 |
| 109 | Ga0070674_100107561 | 3300005356 | Bacteria | 2042 |
| 110 | Ga0070674_100181202 | 3300005356 | Bacteria | 1614 |
| 111 | Ga0070674_100270358 | 3300005356 | Bacteria | 1343 |
| 112 | Ga0070674_100289242 | 3300005356 | Bacteria | 1302 |
| 113 | Ga0070674_100406244 | 3300005356 | Bacteria | 1114 |
| 114 | Ga0070674_100407910 | 3300005356 | Bacteria | 1112 |
| 115 | Ga0070674_100580939 | 3300005356 | Bacteria | 944 |
| 116 | Ga0070674_100919978 | 3300005356 | Bacteria | 763 |
| 117 | Ga0070674_101699624 | 3300005356 | Bacteria | 571 |
| 118 | Ga0070673_100024982 | 3300005364 | Bacteria | 4389 |
| 119 | Ga0070673_100109071 | 3300005364 | Bacteria | 2293 |
| 120 | Ga0070673_100114268 | 3300005364 | Bacteria | 2243 |
| 121 | Ga0070673_100137270 | 3300005364 | Unclassified | 2060 |
| 122 | Ga0070673_100208876 | 3300005364 | Bacteria | 1685 |
| 123 | Ga0070673_100210546 | 3300005364 | Bacteria | 1679 |
| 124 | Ga0070673_100356077 | 3300005364 | Unclassified | 1300 |
| 125 | Ga0070673_100589645 | 3300005364 | Bacteria | 1013 |
| 126 | Ga0070673_100806413 | 3300005364 | Bacteria | 867 |
| 127 | Ga0070673_100836571 | 3300005364 | Unclassified | 851 |
| 128 | Ga0070673_101200973 | 3300005364 | Bacteria | 710 |
| 129 | Ga0070673_101289713 | 3300005364 | Bacteria | 686 |
| 130 | Ga0070688_100013495 | 3300005365 | Bacteria | 4608 |
| 131 | Ga0070688_100020732 | 3300005365 | Bacteria | 3827 |
| 132 | Ga0070688_100408219 | 3300005365 | Unclassified | 1007 |
| 133 | Ga0070688_100582173 | 3300005365 | Unclassified | 854 |
| 134 | Ga0070688_100813149 | 3300005365 | Unclassified | 732 |
| 135 | Ga0070688_101582996 | 3300005365 | Bacteria | 535 |
| 136 | Ga0070659_100077856 | 3300005366 | Bacteria | 2645 |
| 137 | Ga0070659_100231507 | 3300005366 | Bacteria | 1527 |
| 138 | Ga0070667_100034553 | 3300005367 | Bacteria | 4230 |
| 139 | Ga0070667_100745101 | 3300005367 | Bacteria | 908 |
| 140 | Ga0070667_100820297 | 3300005367 | Bacteria | 864 |
| 141 | Ga0070667_100835444 | 3300005367 | Bacteria | 856 |
| 142 | Ga0070703_10483894 | 3300005406 | Bacteria | 554 |
| 143 | Ga0070703_10584150 | 3300005406 | Unclassified | 513 |
| 144 | Ga0070714_100021632 | 3300005435 | Bacteria | 5263 |
| 145 | Ga0070713_100124770 | 3300005436 | Bacteria | 2263 |
| 146 | Ga0070701_10208997 | 3300005438 | Bacteria | 1158 |
| 147 | Ga0070701_10537402 | 3300005438 | Unclassified | 765 |
| 148 | Ga0070701_11042001 | 3300005438 | Unclassified | 573 |
| 149 | Ga0070711_100108440 | 3300005439 | Bacteria | 2034 |
| 150 | Ga0070711_100206434 | 3300005439 | Bacteria | 1519 |
| 151 | Ga0070705_100020570 | 3300005440 | Bacteria | 3496 |
| 152 | Ga0070700_100112623 | 3300005441 | Bacteria | 1812 |
| 153 | Ga0070700_100784535 | 3300005441 | Bacteria | 766 |
| 154 | Ga0070700_101045687 | 3300005441 | Bacteria | 674 |
| 155 | Ga0070700_101973698 | 3300005441 | Bacteria | 506 |
| 156 | Ga0070694_100674030 | 3300005444 | Bacteria | 839 |
| 157 | Ga0070694_100782822 | 3300005444 | Bacteria | 781 |
| 158 | Ga0070694_101759657 | 3300005444 | Unclassified | 528 |
| 159 | Ga0070708_100018085 | 3300005445 | Bacteria | 5896 |
| 160 | Ga0070708_100802331 | 3300005445 | Bacteria | 885 |
| 161 | Ga0070663_101957688 | 3300005455 | Unclassified | 527 |
| 162 | Ga0070678_100204765 | 3300005456 | Unclassified | 1631 |
| 163 | Ga0070678_100325914 | 3300005456 | Unclassified | 1313 |
| 164 | Ga0070662_100193973 | 3300005457 | Bacteria | 1608 |
| 165 | Ga0070662_100280682 | 3300005457 | Bacteria | 1348 |
| 166 | Ga0070662_100371078 | 3300005457 | Bacteria | 1176 |
| 167 | Ga0070681_10054837 | 3300005458 | Bacteria | 3972 |
| 168 | Ga0070681_10114167 | 3300005458 | Bacteria | 2640 |
| 169 | Ga0070681_10308734 | 3300005458 | Bacteria | 1491 |
| 170 | Ga0070681_10749730 | 3300005458 | Bacteria | 893 |
| 171 | Ga0068867_100040587 | 3300005459 | Bacteria | 3398 |
| 172 | Ga0068867_100060208 | 3300005459 | Bacteria | 2816 |
| 173 | Ga0068867_100114688 | 3300005459 | Bacteria | 2074 |
| 174 | Ga0068867_100163456 | 3300005459 | Unclassified | 1757 |
| 175 | Ga0068867_100368043 | 3300005459 | Bacteria | 1204 |
| 176 | Ga0068867_100382297 | 3300005459 | Bacteria | 1183 |
| 177 | Ga0068867_101406895 | 3300005459 | Unclassified | 647 |
| 178 | Ga0070706_100258443 | 3300005467 | Unclassified | 1626 |
| 179 | Ga0070706_101118440 | 3300005467 | Bacteria | 725 |
| 180 | Ga0070707_100092032 | 3300005468 | Bacteria | 2936 |
| 181 | Ga0070707_100100944 | 3300005468 | Bacteria | 2796 |
| 182 | Ga0070698_100042393 | 3300005471 | Bacteria | 4668 |
| 183 | Ga0070698_100134655 | 3300005471 | Bacteria | 2425 |
| 184 | Ga0070698_100234806 | 3300005471 | Bacteria | 1767 |
| 185 | Ga0070698_100363374 | 3300005471 | Bacteria | 1379 |
| 186 | Ga0070698_100418039 | 3300005471 | Bacteria | 1275 |
| 187 | Ga0070698_100492084 | 3300005471 | Bacteria | 1164 |
| 188 | Ga0070698_100600502 | 3300005471 | Bacteria | 1041 |
| 189 | Ga0070698_101092597 | 3300005471 | Unclassified | 746 |
| 190 | Ga0070699_100002960 | 3300005518 | Bacteria | 15094 |
| 191 | Ga0070699_100018806 | 3300005518 | Bacteria | 5934 |
| 192 | Ga0070699_100227465 | 3300005518 | Unclassified | 1663 |
| 193 | Ga0070699_100260506 | 3300005518 | Unclassified | 1551 |
| 194 | Ga0070699_100661335 | 3300005518 | Bacteria | 954 |
| 195 | Ga0070684_100336993 | 3300005535 | Bacteria | 1386 |
| 196 | Ga0070684_100462717 | 3300005535 | Bacteria | 1173 |
| 197 | Ga0070697_101040787 | 3300005536 | Unclassified | 728 |
| 198 | Ga0070697_101152447 | 3300005536 | Bacteria | 690 |
| 199 | Ga0070697_101720945 | 3300005536 | Bacteria | 561 |
| 200 | Ga0068853_100900402 | 3300005539 | Bacteria | 850 |
| 201 | Ga0068853_101063367 | 3300005539 | Bacteria | 780 |
| 202 | Ga0070672_100025684 | 3300005543 | Bacteria | 4373 |
| 203 | Ga0070672_100037361 | 3300005543 | Unclassified | 3705 |
| 204 | Ga0070672_100092239 | 3300005543 | Bacteria | 2445 |
| 205 | Ga0070672_100095550 | 3300005543 | Bacteria | 2403 |
| 206 | Ga0070672_100276065 | 3300005543 | Bacteria | 1420 |
| 207 | Ga0070672_100545919 | 3300005543 | Unclassified | 1006 |
| 208 | Ga0070672_100599232 | 3300005543 | Bacteria | 959 |
| 209 | Ga0070672_101546486 | 3300005543 | Bacteria | 595 |
| 210 | Ga0070686_100086162 | 3300005544 | Bacteria | 2091 |
| 211 | Ga0070686_100090312 | 3300005544 | Bacteria | 2048 |
| 212 | Ga0070686_100747916 | 3300005544 | Bacteria | 784 |
| 213 | Ga0070686_100789193 | 3300005544 | Bacteria | 765 |
| 214 | Ga0070686_101169470 | 3300005544 | Unclassified | 638 |
| 215 | Ga0070686_101579315 | 3300005544 | Bacteria | 555 |
| 216 | Ga0070695_100427358 | 3300005545 | Bacteria | 1010 |
| 217 | Ga0070696_100089585 | 3300005546 | Unclassified | 2188 |
| 218 | Ga0070696_100189590 | 3300005546 | Bacteria | 1530 |
| 219 | Ga0070696_100419816 | 3300005546 | Bacteria | 1050 |
| 220 | Ga0070693_100354425 | 3300005547 | Unclassified | 1005 |
| 221 | Ga0070665_100004603 | 3300005548 | Bacteria | 14428 |
| 222 | Ga0070665_100004694 | 3300005548 | Bacteria | 14263 |
| 223 | Ga0070665_100393299 | 3300005548 | Bacteria | 1394 |
| 224 | Ga0070665_100593501 | 3300005548 | Bacteria | 1121 |
| 225 | Ga0070665_101373825 | 3300005548 | Bacteria | 716 |
| 226 | Ga0070665_101629694 | 3300005548 | Bacteria | 653 |
| 227 | Ga0070704_100048528 | 3300005549 | Bacteria | 2972 |
| 228 | Ga0070704_100106327 | 3300005549 | Bacteria | 2126 |
| 229 | Ga0070704_100112708 | 3300005549 | Unclassified | 2073 |
| 230 | Ga0070704_100188372 | 3300005549 | Bacteria | 1656 |
| 231 | Ga0070704_100532664 | 3300005549 | Bacteria | 1024 |
| 232 | Ga0070704_100645465 | 3300005549 | Bacteria | 934 |
| 233 | Ga0070704_101054910 | 3300005549 | Bacteria | 737 |
| 234 | Ga0070704_101195745 | 3300005549 | Unclassified | 693 |
| 235 | Ga0068855_100317224 | 3300005563 | Bacteria | 1724 |
| 236 | Ga0068855_100417110 | 3300005563 | Unclassified | 1469 |
| 237 | Ga0068855_100548945 | 3300005563 | Bacteria | 1251 |
| 238 | Ga0070664_100093691 | 3300005564 | Bacteria | 2603 |
| 239 | Ga0070664_100190288 | 3300005564 | Unclassified | 1828 |
| 240 | Ga0070664_100327664 | 3300005564 | Bacteria | 1389 |
| 241 | Ga0070664_100376879 | 3300005564 | Bacteria | 1294 |
| 242 | Ga0070664_100922968 | 3300005564 | Bacteria | 819 |
| 243 | Ga0070664_101300558 | 3300005564 | Bacteria | 687 |
| 244 | Ga0070664_101428728 | 3300005564 | Bacteria | 654 |
| 245 | Ga0068857_100120294 | 3300005577 | Unclassified | 2364 |
| 246 | Ga0068857_100273805 | 3300005577 | Unclassified | 1552 |
| 247 | Ga0068857_100282455 | 3300005577 | Bacteria | 1527 |
| 248 | Ga0068854_100045407 | 3300005578 | Bacteria | 3124 |
| 249 | Ga0068854_100315910 | 3300005578 | Bacteria | 1268 |
| 250 | Ga0068854_100608306 | 3300005578 | Unclassified | 934 |
| 251 | Ga0068854_101226582 | 3300005578 | Unclassified | 673 |
| 252 | Ga0068856_100029560 | 3300005614 | Bacteria | 5353 |
| 253 | Ga0068852_100747645 | 3300005616 | Bacteria | 990 |
| 254 | Ga0068859_100006650 | 3300005617 | Bacteria | 11743 |
| 255 | Ga0068859_100010995 | 3300005617 | Bacteria | 9108 |
| 256 | Ga0068859_100016721 | 3300005617 | Bacteria | 7364 |
| 257 | Ga0068859_100033661 | 3300005617 | Bacteria | 5145 |
| 258 | Ga0068859_100040915 | 3300005617 | Unclassified | 4655 |
| 259 | Ga0068859_100262774 | 3300005617 | Unclassified | 1817 |
| 260 | Ga0068859_100353283 | 3300005617 | Bacteria | 1565 |
| 261 | Ga0068859_100660110 | 3300005617 | Bacteria | 1137 |
| 262 | Ga0068859_100872203 | 3300005617 | Unclassified | 985 |
| 263 | Ga0068859_101043061 | 3300005617 | Bacteria | 899 |
| 264 | Ga0068859_101361207 | 3300005617 | Bacteria | 783 |
| 265 | Ga0068864_100006744 | 3300005618 | Bacteria | 9405 |
| 266 | Ga0068864_100037683 | 3300005618 | Unclassified | 4127 |
| 267 | Ga0068864_100068467 | 3300005618 | Unclassified | 3084 |
| 268 | Ga0068864_100217109 | 3300005618 | Bacteria | 1763 |
| 269 | Ga0068864_100296514 | 3300005618 | Bacteria | 1513 |
| 270 | Ga0068864_100722607 | 3300005618 | Bacteria | 974 |
| 271 | Ga0068864_100753627 | 3300005618 | Unclassified | 954 |
| 272 | Ga0068864_100801305 | 3300005618 | Unclassified | 926 |
| 273 | Ga0068864_100966168 | 3300005618 | Bacteria | 844 |
| 274 | Ga0068864_100984181 | 3300005618 | Bacteria | 836 |
| 275 | Ga0068864_101349749 | 3300005618 | Bacteria | 714 |
| 276 | Ga0068864_101373962 | 3300005618 | Bacteria | 708 |
| 277 | Ga0068864_101444811 | 3300005618 | Bacteria | 690 |
| 278 | Ga0068866_10161044 | 3300005718 | Bacteria | 1308 |
| 279 | Ga0068866_10241955 | 3300005718 | Bacteria | 1099 |
| 280 | Ga0068861_100035400 | 3300005719 | Bacteria | 3698 |
| 281 | Ga0068861_100038948 | 3300005719 | Bacteria | 3545 |
| 282 | Ga0068861_100068019 | 3300005719 | Unclassified | 2751 |
| 283 | Ga0068861_100141211 | 3300005719 | Bacteria | 1966 |
| 284 | Ga0068861_100701206 | 3300005719 | Bacteria | 941 |
| 285 | Ga0068870_10122810 | 3300005840 | Bacteria | 1498 |
| 286 | Ga0068870_10167827 | 3300005840 | Bacteria | 1307 |
| 287 | Ga0068863_100100824 | 3300005841 | Bacteria | 2744 |
| 288 | Ga0068863_100129691 | 3300005841 | Bacteria | 2407 |
| 289 | Ga0068863_100386657 | 3300005841 | Bacteria | 1367 |
| 290 | Ga0068863_100504161 | 3300005841 | Unclassified | 1192 |
| 291 | Ga0068863_100805509 | 3300005841 | Bacteria | 937 |
| 292 | Ga0068863_101004048 | 3300005841 | Bacteria | 837 |
| 293 | Ga0068863_101553581 | 3300005841 | Unclassified | 671 |
| 294 | Ga0068863_101597306 | 3300005841 | Unclassified | 661 |
| 295 | Ga0068863_101694883 | 3300005841 | Bacteria | 642 |
| 296 | Ga0068858_100009891 | 3300005842 | Bacteria | 9061 |
| 297 | Ga0068858_100017373 | 3300005842 | Bacteria | 6749 |
| 298 | Ga0068858_100018327 | 3300005842 | Bacteria | 6556 |
| 299 | Ga0068858_100050398 | 3300005842 | Bacteria | 3854 |
| 300 | Ga0068858_100171988 | 3300005842 | Bacteria | 2043 |
| 301 | Ga0068858_100174856 | 3300005842 | Bacteria | 2026 |
| 302 | Ga0068858_100234027 | 3300005842 | Unclassified | 1742 |
| 303 | Ga0068858_100303932 | 3300005842 | Unclassified | 1522 |
| 304 | Ga0068858_100475550 | 3300005842 | Bacteria | 1206 |
| 305 | Ga0068858_100737980 | 3300005842 | Unclassified | 959 |
| 306 | Ga0068858_101111667 | 3300005842 | Bacteria | 776 |
| 307 | Ga0068860_100045085 | 3300005843 | Bacteria | 4204 |
| 308 | Ga0068860_100049311 | 3300005843 | Bacteria | 4010 |
| 309 | Ga0068860_100123829 | 3300005843 | Bacteria | 2478 |
| 310 | Ga0068860_100208993 | 3300005843 | Bacteria | 1893 |
| 311 | Ga0068860_100296913 | 3300005843 | Unclassified | 1582 |
| 312 | Ga0068860_100331209 | 3300005843 | Bacteria | 1495 |
| 313 | Ga0068860_100460644 | 3300005843 | Unclassified | 1265 |
| 314 | Ga0068860_100709335 | 3300005843 | Unclassified | 1016 |
| 315 | Ga0068860_100892177 | 3300005843 | Bacteria | 905 |
| 316 | Ga0068860_101676895 | 3300005843 | Bacteria | 657 |
| 317 | Ga0068862_100031034 | 3300005844 | Bacteria | 4507 |
| 318 | Ga0068862_100130226 | 3300005844 | Unclassified | 2225 |
| 319 | Ga0068862_100197169 | 3300005844 | Bacteria | 1814 |
| 320 | Ga0068862_100270982 | 3300005844 | Unclassified | 1552 |
| 321 | Ga0068862_100348318 | 3300005844 | Bacteria | 1374 |
| 322 | Ga0068862_100361024 | 3300005844 | Unclassified | 1350 |
| 323 | Ga0068862_101026330 | 3300005844 | Bacteria | 817 |
| 324 | Ga0068862_101238439 | 3300005844 | Bacteria | 746 |
| 325 | Ga0068862_102342245 | 3300005844 | Unclassified | 546 |
| 326 | Ga0081455_10073933 | 3300005937 | Bacteria | 2816 |
| 327 | Ga0081455_10143568 | 3300005937 | Bacteria | 1850 |
| 328 | Ga0081455_10935634 | 3300005937 | Bacteria | 538 |
| 329 | Ga0081538_10089024 | 3300005981 | Bacteria | 1604 |
| 330 | Ga0081540_1131278 | 3300005983 | Bacteria | 1022 |
| 331 | Ga0081539_10005511 | 3300005985 | Bacteria | 12854 |
| 332 | Ga0081539_10012425 | 3300005985 | Bacteria | 6564 |
| 333 | Ga0075365_10001292 | 3300006038 | Bacteria | 11157 |
| 334 | Ga0075365_10031345 | 3300006038 | Bacteria | 3410 |
| 335 | Ga0075368_10053118 | 3300006042 | Bacteria | 1612 |
| 336 | Ga0075432_10154764 | 3300006058 | Unclassified | 883 |
| 337 | Ga0075432_10486986 | 3300006058 | Unclassified | 547 |
| 338 | Ga0075362_10002509 | 3300006177 | Bacteria | 6179 |
| 339 | Ga0075367_10077261 | 3300006178 | Unclassified | 2010 |
| 340 | Ga0075366_10030120 | 3300006195 | Bacteria | 3189 |
| 341 | Ga0075366_10622058 | 3300006195 | Unclassified | 670 |
| 342 | Ga0097621_100000311 | 3300006237 | Bacteria | 32935 |
| 343 | Ga0097621_100005974 | 3300006237 | Bacteria | 8607 |
| 344 | Ga0097621_100026008 | 3300006237 | Bacteria | 4586 |
| 345 | Ga0097621_100073417 | 3300006237 | Bacteria | 2832 |
| 346 | Ga0097621_100410502 | 3300006237 | Bacteria | 1214 |
| 347 | Ga0097621_101300904 | 3300006237 | Bacteria | 687 |
| 348 | Ga0075370_10005334 | 3300006353 | Bacteria | 6374 |
| 349 | Ga0068871_100144209 | 3300006358 | Bacteria | 2026 |
| 350 | Ga0068871_100179641 | 3300006358 | Bacteria | 1818 |
| 351 | Ga0068871_100396093 | 3300006358 | Bacteria | 1229 |
| 352 | Ga0068871_101466697 | 3300006358 | Bacteria | 644 |
| 353 | Ga0068871_101679798 | 3300006358 | Unclassified | 602 |
| 354 | Ga0075428_100000005 | 3300006844 | Bacteria | 326130 |
| 355 | Ga0075428_100000851 | 3300006844 | Bacteria | 32103 |
| 356 | Ga0075428_100009166 | 3300006844 | Bacteria | 10979 |
| 357 | Ga0075428_100019035 | 3300006844 | Bacteria | 7593 |
| 358 | Ga0075428_100258352 | 3300006844 | Unclassified | 1876 |
| 359 | Ga0075428_100500413 | 3300006844 | Bacteria | 1300 |
| 360 | Ga0075428_100632487 | 3300006844 | Bacteria | 1142 |
| 361 | Ga0075428_100819988 | 3300006844 | Unclassified | 988 |
| 362 | Ga0075428_101346586 | 3300006844 | Unclassified | 750 |
| 363 | Ga0075428_101909878 | 3300006844 | Unclassified | 617 |
| 364 | Ga0075430_100007631 | 3300006846 | Bacteria | 9138 |
| 365 | Ga0075430_100403309 | 3300006846 | Bacteria | 1129 |
| 366 | Ga0075430_100585307 | 3300006846 | Unclassified | 921 |
| 367 | Ga0075430_100734311 | 3300006846 | Bacteria | 814 |
| 368 | Ga0075431_100010122 | 3300006847 | Bacteria | 9477 |
| 369 | Ga0075431_100045601 | 3300006847 | Bacteria | 4520 |
| 370 | Ga0075431_100279584 | 3300006847 | Bacteria | 1690 |
| 371 | Ga0075431_100825345 | 3300006847 | Bacteria | 899 |
| 372 | Ga0075431_100893755 | 3300006847 | Bacteria | 858 |
| 373 | Ga0075433_10115554 | 3300006852 | Bacteria | 2381 |
| 374 | Ga0075433_10168251 | 3300006852 | Unclassified | 1951 |
| 375 | Ga0075433_10462394 | 3300006852 | Unclassified | 1118 |
| 376 | Ga0075433_10683091 | 3300006852 | Bacteria | 900 |
| 377 | Ga0075433_10898318 | 3300006852 | Bacteria | 773 |
| 378 | Ga0075434_100000100 | 3300006871 | Bacteria | 48123 |
| 379 | Ga0075434_100005346 | 3300006871 | Bacteria | 11683 |
| 380 | Ga0075434_100006986 | 3300006871 | Archaea | 10407 |
| 381 | Ga0075434_100035602 | 3300006871 | Bacteria | 4922 |
| 382 | Ga0075434_100059471 | 3300006871 | Bacteria | 3799 |
| 383 | Ga0075434_100093964 | 3300006871 | Bacteria | 3003 |
| 384 | Ga0075434_100220750 | 3300006871 | Unclassified | 1915 |
| 385 | Ga0075434_100224413 | 3300006871 | Bacteria | 1898 |
| 386 | Ga0075434_100297183 | 3300006871 | Bacteria | 1635 |
| 387 | Ga0075434_100305819 | 3300006871 | Unclassified | 1610 |
| 388 | Ga0075434_100312196 | 3300006871 | Bacteria | 1593 |
| 389 | Ga0075434_100327700 | 3300006871 | Bacteria | 1552 |
| 390 | Ga0075434_100858889 | 3300006871 | Bacteria | 923 |
| 391 | Ga0075429_100041010 | 3300006880 | Bacteria | 4031 |
| 392 | Ga0075429_100066141 | 3300006880 | Unclassified | 3147 |
| 393 | Ga0075429_100124549 | 3300006880 | Bacteria | 2254 |
| 394 | Ga0075429_100648981 | 3300006880 | Bacteria | 925 |
| 395 | Ga0075429_100909848 | 3300006880 | Bacteria | 770 |
| 396 | Ga0068865_100020075 | 3300006881 | Bacteria | 4332 |
| 397 | Ga0068865_100135105 | 3300006881 | Bacteria | 1852 |
| 398 | Ga0068865_100173035 | 3300006881 | Bacteria | 1657 |
| 399 | Ga0068865_100202402 | 3300006881 | Bacteria | 1542 |
| 400 | Ga0068865_100263283 | 3300006881 | Bacteria | 1366 |
| 401 | Ga0068865_100524565 | 3300006881 | Unclassified | 991 |
| 402 | Ga0068865_100697576 | 3300006881 | Unclassified | 867 |
| 403 | Ga0075436_100004798 | 3300006914 | Bacteria | 9285 |
| 404 | Ga0075436_100008051 | 3300006914 | Bacteria | 7216 |
| 405 | Ga0075436_100019171 | 3300006914 | Bacteria | 4686 |
| 406 | Ga0075436_100221564 | 3300006914 | Unclassified | 1342 |
| 407 | Ga0075436_100445405 | 3300006914 | Bacteria | 942 |
| 408 | Ga0075436_100642200 | 3300006914 | Bacteria | 784 |
| 409 | Ga0097620_100006650 | 3300006931 | Bacteria | 11743 |
| 410 | Ga0097620_100010995 | 3300006931 | Bacteria | 9108 |
| 411 | Ga0097620_100016722 | 3300006931 | Bacteria | 7364 |
| 412 | Ga0097620_100033660 | 3300006931 | Bacteria | 5145 |
| 413 | Ga0097620_100040914 | 3300006931 | Unclassified | 4655 |
| 414 | Ga0097620_100262766 | 3300006931 | Unclassified | 1817 |
| 415 | Ga0097620_100353271 | 3300006931 | Bacteria | 1565 |
| 416 | Ga0097620_100649024 | 3300006931 | Bacteria | 1147 |
| 417 | Ga0097620_100660116 | 3300006931 | Bacteria | 1137 |
| 418 | Ga0097620_100872232 | 3300006931 | Unclassified | 985 |
| 419 | Ga0097620_101043080 | 3300006931 | Bacteria | 899 |
| 420 | Ga0097620_101361187 | 3300006931 | Bacteria | 783 |
| 421 | Ga0075435_100000331 | 3300007076 | Bacteria | 29105 |
| 422 | Ga0075435_100030565 | 3300007076 | Bacteria | 4237 |
| 423 | Ga0075435_100048025 | 3300007076 | Bacteria | 3428 |
| 424 | Ga0075435_100049734 | 3300007076 | Bacteria | 3372 |
| 425 | Ga0075435_100069393 | 3300007076 | Bacteria | 2874 |
| 426 | Ga0075435_100475556 | 3300007076 | Unclassified | 1079 |
| 427 | Ga0105240_10011023 | 3300009093 | Bacteria | 12644 |
| 428 | Ga0105240_10017877 | 3300009093 | Bacteria | 9540 |
| 429 | Ga0105240_10319230 | 3300009093 | Bacteria | 1771 |
| 430 | Ga0105240_10441524 | 3300009093 | Bacteria | 1458 |
| 431 | Ga0105240_11684889 | 3300009093 | Bacteria | 662 |
| 432 | Ga0105240_11991655 | 3300009093 | Bacteria | 604 |
| 433 | Ga0111539_10000008 | 3300009094 | Bacteria | 382609 |
| 434 | Ga0111539_10001186 | 3300009094 | Bacteria | 34634 |
| 435 | Ga0111539_10002921 | 3300009094 | Bacteria | 22662 |
| 436 | Ga0111539_10030999 | 3300009094 | Bacteria | 6497 |
| 437 | Ga0111539_10077549 | 3300009094 | Bacteria | 3910 |
| 438 | Ga0111539_10182406 | 3300009094 | Bacteria | 2451 |
| 439 | Ga0111539_10245541 | 3300009094 | Bacteria | 2084 |
| 440 | Ga0111539_10372491 | 3300009094 | Bacteria | 1662 |
| 441 | Ga0111539_10819144 | 3300009094 | Bacteria | 1083 |
| 442 | Ga0111539_12553316 | 3300009094 | Bacteria | 592 |
| 443 | Ga0105245_10132956 | 3300009098 | Unclassified | 2335 |
| 444 | Ga0105245_10542804 | 3300009098 | Unclassified | 1184 |
| 445 | Ga0105245_10611582 | 3300009098 | Unclassified | 1117 |
| 446 | Ga0105245_11193448 | 3300009098 | Bacteria | 809 |
| 447 | Ga0105245_11671785 | 3300009098 | Unclassified | 689 |
| 448 | Ga0105247_10006975 | 3300009101 | Bacteria | 6953 |
| 449 | Ga0105247_10031087 | 3300009101 | Bacteria | 3239 |
| 450 | Ga0105247_11032607 | 3300009101 | Bacteria | 644 |
| 451 | Ga0114129_10000400 | 3300009147 | Bacteria | 50737 |
| 452 | Ga0114129_10000838 | 3300009147 | Bacteria | 39812 |
| 453 | Ga0114129_10001577 | 3300009147 | Bacteria | 30953 |
| 454 | Ga0114129_10004637 | 3300009147 | Bacteria | 19399 |
| 455 | Ga0114129_10020702 | 3300009147 | Bacteria | 9348 |
| 456 | Ga0114129_10020934 | 3300009147 | Bacteria | 9290 |
| 457 | Ga0114129_10065380 | 3300009147 | Bacteria | 5076 |
| 458 | Ga0114129_10105753 | 3300009147 | Bacteria | 3889 |
| 459 | Ga0114129_10275178 | 3300009147 | Bacteria | 2251 |
| 460 | Ga0114129_10378548 | 3300009147 | Bacteria | 1870 |
| 461 | Ga0114129_10680988 | 3300009147 | Bacteria | 1324 |
| 462 | Ga0114129_11981239 | 3300009147 | Bacteria | 705 |
| 463 | Ga0105243_10186707 | 3300009148 | Bacteria | 1807 |
| 464 | Ga0105243_10568824 | 3300009148 | Bacteria | 1086 |
| 465 | Ga0105243_10586285 | 3300009148 | Bacteria | 1071 |
| 466 | Ga0105243_10595911 | 3300009148 | Bacteria | 1063 |
| 467 | Ga0105243_10981246 | 3300009148 | Unclassified | 846 |
| 468 | Ga0105243_11252760 | 3300009148 | Bacteria | 757 |
| 469 | Ga0105241_10494187 | 3300009174 | Unclassified | 1090 |
| 470 | Ga0105242_10001523 | 3300009176 | Bacteria | 18223 |
| 471 | Ga0105242_10055437 | 3300009176 | Bacteria | 3242 |
| 472 | Ga0105242_10630268 | 3300009176 | Bacteria | 1040 |
| 473 | Ga0105242_12003643 | 3300009176 | Unclassified | 621 |
| 474 | Ga0105242_12018753 | 3300009176 | Bacteria | 619 |
| 475 | Ga0105248_10001706 | 3300009177 | Bacteria | 24451 |
| 476 | Ga0105248_10005355 | 3300009177 | Bacteria | 14118 |
| 477 | Ga0105248_10010754 | 3300009177 | Bacteria | 10102 |
| 478 | Ga0105248_10085272 | 3300009177 | Bacteria | 3554 |
| 479 | Ga0105248_10300953 | 3300009177 | Bacteria | 1806 |
| 480 | Ga0105248_10370092 | 3300009177 | Bacteria | 1613 |
| 481 | Ga0105248_10844487 | 3300009177 | Unclassified | 1034 |
| 482 | Ga0105248_10878137 | 3300009177 | Bacteria | 1012 |
| 483 | Ga0105248_11834957 | 3300009177 | Bacteria | 688 |
| 484 | Ga0105248_11972342 | 3300009177 | Unclassified | 663 |
| 485 | Ga0105248_12213345 | 3300009177 | Bacteria | 626 |
| 486 | Ga0105248_12640518 | 3300009177 | Bacteria | 573 |
| 487 | Ga0105237_11314447 | 3300009545 | Bacteria | 729 |
| 488 | Ga0105238_11156678 | 3300009551 | Bacteria | 797 |
| 489 | Ga0105238_11899387 | 3300009551 | Bacteria | 628 |
| 490 | Ga0105238_12891733 | 3300009551 | Bacteria | 516 |
| 491 | Ga0105249_10001419 | 3300009553 | Bacteria | 20973 |
| 492 | Ga0105249_10116965 | 3300009553 | Unclassified | 2528 |
| 493 | Ga0105249_10204794 | 3300009553 | Unclassified | 1933 |
| 494 | Ga0105249_10402101 | 3300009553 | Unclassified | 1400 |
| 495 | Ga0105249_10642906 | 3300009553 | Bacteria | 1118 |
| 496 | Ga0105249_11056935 | 3300009553 | Unclassified | 881 |
| 497 | Ga0105249_11511920 | 3300009553 | Bacteria | 744 |
| 498 | Ga0105249_12249139 | 3300009553 | Unclassified | 618 |
| 499 | Ga0105249_12604252 | 3300009553 | Bacteria | 578 |
| 500 | Ga0105239_11685121 | 3300010375 | Bacteria | 734 |
| 501 | Ga0105246_10263836 | 3300011119 | Unclassified | 1373 |
| 502 | Ga0105246_10819432 | 3300011119 | Unclassified | 827 |
| 503 | Ga0105246_10822871 | 3300011119 | Unclassified | 826 |
| 504 | Ga0105246_12549415 | 3300011119 | Bacteria | 504 |
| 505 | Ga0157374_10294654 | 3300013296 | Bacteria | 1604 |
| 506 | Ga0157374_10584262 | 3300013296 | Bacteria | 1126 |
| 507 | Ga0157374_10936792 | 3300013296 | Bacteria | 884 |
| 508 | Ga0157374_12573799 | 3300013296 | Bacteria | 536 |
| 509 | Ga0157378_10012868 | 3300013297 | Bacteria | 7324 |
| 510 | Ga0157378_10145237 | 3300013297 | Unclassified | 2206 |
| 511 | Ga0157378_10668301 | 3300013297 | Bacteria | 1056 |
| 512 | Ga0157378_11312605 | 3300013297 | Bacteria | 765 |
| 513 | Ga0157378_12014014 | 3300013297 | Unclassified | 627 |
| 514 | Ga0163162_10027728 | 3300013306 | Bacteria | 5602 |
| 515 | Ga0163162_10057953 | 3300013306 | Bacteria | 3901 |
| 516 | Ga0163162_10058381 | 3300013306 | Bacteria | 3887 |
| 517 | Ga0163162_10155868 | 3300013306 | Bacteria | 2404 |
| 518 | Ga0163162_10982924 | 3300013306 | Unclassified | 954 |
| 519 | Ga0163162_12670817 | 3300013306 | Unclassified | 575 |
| 520 | Ga0157372_10406575 | 3300013307 | Bacteria | 1586 |
| 521 | Ga0157372_11219095 | 3300013307 | Bacteria | 869 |
| 522 | Ga0157375_10428795 | 3300013308 | Unclassified | 1488 |
| 523 | Ga0157375_10661649 | 3300013308 | Bacteria | 1200 |
| 524 | Ga0157375_12016338 | 3300013308 | Unclassified | 686 |
| 525 | Ga0163163_10035628 | 3300014325 | Bacteria | 4829 |
| 526 | Ga0163163_10069546 | 3300014325 | Unclassified | 3505 |
| 527 | Ga0163163_10253132 | 3300014325 | Unclassified | 1812 |
| 528 | Ga0163163_10739097 | 3300014325 | Unclassified | 1047 |
| 529 | Ga0163163_11117107 | 3300014325 | Bacteria | 851 |
| 530 | Ga0163163_11265048 | 3300014325 | Bacteria | 800 |
| 531 | Ga0163163_11715530 | 3300014325 | Bacteria | 689 |
| 532 | Ga0163163_11721442 | 3300014325 | Unclassified | 688 |
| 533 | Ga0163163_13032003 | 3300014325 | Unclassified | 524 |
| 534 | Ga0157380_10023337 | 3300014326 | Bacteria | 4665 |
| 535 | Ga0157380_10038456 | 3300014326 | Unclassified | 3715 |
| 536 | Ga0157380_10052758 | 3300014326 | Archaea | 3221 |
| 537 | Ga0157380_10104819 | 3300014326 | Bacteria | 2363 |
| 538 | Ga0157380_10105407 | 3300014326 | Bacteria | 2357 |
| 539 | Ga0157380_10246235 | 3300014326 | Bacteria | 1615 |
| 540 | Ga0157380_10468809 | 3300014326 | Unclassified | 1214 |
| 541 | Ga0157380_10474257 | 3300014326 | Bacteria | 1208 |
| 542 | Ga0157380_11735220 | 3300014326 | Bacteria | 682 |
| 543 | Ga0157380_12225176 | 3300014326 | Bacteria | 612 |
| 544 | Ga0157380_12804311 | 3300014326 | Bacteria | 554 |
| 545 | Ga0157380_13053244 | 3300014326 | Bacteria | 534 |
| 546 | Ga0182008_10385515 | 3300014497 | Unclassified | 750 |
| 547 | Ga0157377_10060159 | 3300014745 | Bacteria | 2168 |
| 548 | Ga0157377_10066967 | 3300014745 | Unclassified | 2066 |
| 549 | Ga0157377_10900272 | 3300014745 | Unclassified | 661 |
| 550 | Ga0157379_10018828 | 3300014968 | Bacteria | 6090 |
| 551 | Ga0157379_10023414 | 3300014968 | Bacteria | 5480 |
| 552 | Ga0157379_10053971 | 3300014968 | Bacteria | 3591 |
| 553 | Ga0157379_10085207 | 3300014968 | Unclassified | 2832 |
| 554 | Ga0157379_10103023 | 3300014968 | Bacteria | 2561 |
| 555 | Ga0157379_10279552 | 3300014968 | Unclassified | 1519 |
| 556 | Ga0157379_10555009 | 3300014968 | Bacteria | 1069 |
| 557 | Ga0157379_12490678 | 3300014968 | Bacteria | 517 |
| 558 | Ga0157376_10035193 | 3300014969 | Bacteria | 4050 |
| 559 | Ga0157376_10093674 | 3300014969 | Bacteria | 2608 |
| 560 | Ga0157376_10101508 | 3300014969 | Bacteria | 2514 |
| 561 | Ga0157376_10110540 | 3300014969 | Bacteria | 2418 |
| 562 | Ga0157376_10144886 | 3300014969 | Bacteria | 2135 |
| 563 | Ga0157376_10155945 | 3300014969 | Bacteria | 2064 |
| 564 | Ga0157376_10491501 | 3300014969 | Unclassified | 1204 |
| 565 | Ga0157376_10524809 | 3300014969 | Bacteria | 1168 |
| 566 | Ga0157376_10841393 | 3300014969 | Bacteria | 932 |
| 567 | Ga0157376_10871128 | 3300014969 | Unclassified | 917 |
| 568 | Ga0213876_10099095 | 3300021384 | Unclassified | 1545 |
| 569 | Ga0207697_10146373 | 3300025315 | Bacteria | 1026 |
| 570 | Ga0207697_10387909 | 3300025315 | Unclassified | 620 |
| 571 | Ga0207656_10307444 | 3300025321 | Unclassified | 785 |
| 572 | Ga0207653_10427078 | 3300025885 | Unclassified | 520 |
| 573 | Ga0207682_10204452 | 3300025893 | Bacteria | 909 |
| 574 | Ga0207682_10241341 | 3300025893 | Bacteria | 840 |
| 575 | Ga0207682_10340431 | 3300025893 | Bacteria | 706 |
| 576 | Ga0207642_10433376 | 3300025899 | Unclassified | 793 |
| 577 | Ga0207710_10018656 | 3300025900 | Bacteria | 2953 |
| 578 | Ga0207688_10139727 | 3300025901 | Unclassified | 1425 |
| 579 | Ga0207688_10165205 | 3300025901 | Bacteria | 1314 |
| 580 | Ga0207680_10074175 | 3300025903 | Bacteria | 2118 |
| 581 | Ga0207680_10219149 | 3300025903 | Bacteria | 1304 |
| 582 | Ga0207685_10473296 | 3300025905 | Bacteria | 655 |
| 583 | Ga0207645_10007032 | 3300025907 | Bacteria | 8012 |
| 584 | Ga0207645_10241598 | 3300025907 | Bacteria | 1193 |
| 585 | Ga0207645_10298403 | 3300025907 | Bacteria | 1072 |
| 586 | Ga0207645_10708997 | 3300025907 | Bacteria | 684 |
| 587 | Ga0207643_10179767 | 3300025908 | Bacteria | 1279 |
| 588 | Ga0207643_10295073 | 3300025908 | Unclassified | 1008 |
| 589 | Ga0207643_10490705 | 3300025908 | Unclassified | 785 |
| 590 | Ga0207705_10366941 | 3300025909 | Bacteria | 1111 |
| 591 | Ga0207684_10578089 | 3300025910 | Bacteria | 960 |
| 592 | Ga0207684_11283825 | 3300025910 | Bacteria | 603 |
| 593 | Ga0207684_11478311 | 3300025910 | Bacteria | 554 |
| 594 | Ga0207707_10101625 | 3300025912 | Bacteria | 2513 |
| 595 | Ga0207707_10342208 | 3300025912 | Unclassified | 1289 |
| 596 | Ga0207707_10744701 | 3300025912 | Unclassified | 820 |
| 597 | Ga0207695_10266631 | 3300025913 | Bacteria | 1609 |
| 598 | Ga0207663_10340881 | 3300025916 | Unclassified | 1132 |
| 599 | Ga0207663_10649457 | 3300025916 | Unclassified | 832 |
| 600 | Ga0207660_10335728 | 3300025917 | Unclassified | 1209 |
| 601 | Ga0207660_10480761 | 3300025917 | Bacteria | 1006 |
| 602 | Ga0207662_10075720 | 3300025918 | Bacteria | 2045 |
| 603 | Ga0207662_10641784 | 3300025918 | Bacteria | 741 |
| 604 | Ga0207657_10054439 | 3300025919 | Bacteria | 3460 |
| 605 | Ga0207657_10487266 | 3300025919 | Bacteria | 966 |
| 606 | Ga0207649_10474500 | 3300025920 | Bacteria | 948 |
| 607 | Ga0207649_10757569 | 3300025920 | Bacteria | 756 |
| 608 | Ga0207649_10945549 | 3300025920 | Unclassified | 677 |
| 609 | Ga0207646_10160673 | 3300025922 | Bacteria | 2027 |
| 610 | Ga0207646_10422637 | 3300025922 | Bacteria | 1203 |
| 611 | Ga0207646_10850615 | 3300025922 | Bacteria | 811 |
| 612 | Ga0207681_10003552 | 3300025923 | Bacteria | 9710 |
| 613 | Ga0207681_10004545 | 3300025923 | Bacteria | 8545 |
| 614 | Ga0207681_10053851 | 3300025923 | Bacteria | 2733 |
| 615 | Ga0207681_10124660 | 3300025923 | Bacteria | 1895 |
| 616 | Ga0207681_10351284 | 3300025923 | Unclassified | 1180 |
| 617 | Ga0207681_10950159 | 3300025923 | Bacteria | 721 |
| 618 | Ga0207681_11210951 | 3300025923 | Unclassified | 634 |
| 619 | Ga0207694_10872727 | 3300025924 | Bacteria | 761 |
| 620 | Ga0207694_11222511 | 3300025924 | Bacteria | 636 |
| 621 | Ga0207650_10010310 | 3300025925 | Bacteria | 6405 |
| 622 | Ga0207650_10106326 | 3300025925 | Unclassified | 2167 |
| 623 | Ga0207650_10266920 | 3300025925 | Unclassified | 1390 |
| 624 | Ga0207650_10358349 | 3300025925 | Bacteria | 1201 |
| 625 | Ga0207650_10525190 | 3300025925 | Unclassified | 991 |
| 626 | Ga0207650_10767857 | 3300025925 | Bacteria | 816 |
| 627 | Ga0207659_10000551 | 3300025926 | Bacteria | 22404 |
| 628 | Ga0207659_10008009 | 3300025926 | Bacteria | 6535 |
| 629 | Ga0207659_10079852 | 3300025926 | Unclassified | 2415 |
| 630 | Ga0207659_10100238 | 3300025926 | Unclassified | 2182 |
| 631 | Ga0207659_10187458 | 3300025926 | Bacteria | 1644 |
| 632 | Ga0207659_10237437 | 3300025926 | Bacteria | 1473 |
| 633 | Ga0207659_10940491 | 3300025926 | Bacteria | 743 |
| 634 | Ga0207659_11107691 | 3300025926 | Bacteria | 681 |
| 635 | Ga0207687_10026547 | 3300025927 | Bacteria | 3879 |
| 636 | Ga0207687_10113674 | 3300025927 | Bacteria | 2014 |
| 637 | Ga0207687_10187553 | 3300025927 | Bacteria | 1607 |
| 638 | Ga0207700_10291075 | 3300025928 | Bacteria | 1408 |
| 639 | Ga0207700_10589832 | 3300025928 | Bacteria | 988 |
| 640 | Ga0207664_10371616 | 3300025929 | Bacteria | 1268 |
| 641 | Ga0207644_10410964 | 3300025931 | Bacteria | 1107 |
| 642 | Ga0207644_10467044 | 3300025931 | Bacteria | 1038 |
| 643 | Ga0207644_11354940 | 3300025931 | Unclassified | 598 |
| 644 | Ga0207690_10117788 | 3300025932 | Bacteria | 1924 |
| 645 | Ga0207690_11112236 | 3300025932 | Unclassified | 659 |
| 646 | Ga0207690_11168056 | 3300025932 | Bacteria | 642 |
| 647 | Ga0207706_10036844 | 3300025933 | Bacteria | 4345 |
| 648 | Ga0207706_10046633 | 3300025933 | Bacteria | 3837 |
| 649 | Ga0207706_10271689 | 3300025933 | Bacteria | 1479 |
| 650 | Ga0207706_10293746 | 3300025933 | Bacteria | 1416 |
| 651 | Ga0207706_10428644 | 3300025933 | Bacteria | 1145 |
| 652 | Ga0207706_10785120 | 3300025933 | Bacteria | 810 |
| 653 | Ga0207686_10003296 | 3300025934 | Bacteria | 8681 |
| 654 | Ga0207686_10778435 | 3300025934 | Bacteria | 766 |
| 655 | Ga0207686_11040519 | 3300025934 | Unclassified | 666 |
| 656 | Ga0207709_11280052 | 3300025935 | Bacteria | 606 |
| 657 | Ga0207670_10020281 | 3300025936 | Bacteria | 4082 |
| 658 | Ga0207670_10135539 | 3300025936 | Unclassified | 1809 |
| 659 | Ga0207670_10234310 | 3300025936 | Bacteria | 1411 |
| 660 | Ga0207670_10295059 | 3300025936 | Bacteria | 1268 |
| 661 | Ga0207670_10324177 | 3300025936 | Bacteria | 1213 |
| 662 | Ga0207669_10175292 | 3300025937 | Bacteria | 1531 |
| 663 | Ga0207669_10364579 | 3300025937 | Bacteria | 1121 |
| 664 | Ga0207669_10609088 | 3300025937 | Bacteria | 888 |
| 665 | Ga0207669_11189429 | 3300025937 | Bacteria | 646 |
| 666 | Ga0207704_10087234 | 3300025938 | Bacteria | 2037 |
| 667 | Ga0207704_10218098 | 3300025938 | Bacteria | 1409 |
| 668 | Ga0207704_10317138 | 3300025938 | Unclassified | 1201 |
| 669 | Ga0207704_10374501 | 3300025938 | Bacteria | 1116 |
| 670 | Ga0207704_10495018 | 3300025938 | Bacteria | 984 |
| 671 | Ga0207704_10519726 | 3300025938 | Bacteria | 962 |
| 672 | Ga0207704_10814577 | 3300025938 | Bacteria | 780 |
| 673 | Ga0207704_11041950 | 3300025938 | Bacteria | 693 |
| 674 | Ga0207704_11888507 | 3300025938 | Unclassified | 514 |
| 675 | Ga0207691_10027293 | 3300025940 | Bacteria | 5354 |
| 676 | Ga0207691_10041509 | 3300025940 | Bacteria | 4246 |
| 677 | Ga0207691_10131759 | 3300025940 | Bacteria | 2207 |
| 678 | Ga0207691_10207072 | 3300025940 | Bacteria | 1705 |
| 679 | Ga0207691_10251096 | 3300025940 | Bacteria | 1527 |
| 680 | Ga0207691_10480300 | 3300025940 | Unclassified | 1056 |
| 681 | Ga0207691_10858991 | 3300025940 | Bacteria | 761 |
| 682 | Ga0207711_10038345 | 3300025941 | Bacteria | 4074 |
| 683 | Ga0207711_10075899 | 3300025941 | Bacteria | 2926 |
| 684 | Ga0207711_10125143 | 3300025941 | Bacteria | 2299 |
| 685 | Ga0207711_10170397 | 3300025941 | Bacteria | 1975 |
| 686 | Ga0207711_10207667 | 3300025941 | Bacteria | 1789 |
| 687 | Ga0207711_10211484 | 3300025941 | Bacteria | 1771 |
| 688 | Ga0207711_10846672 | 3300025941 | Unclassified | 851 |
| 689 | Ga0207711_10883483 | 3300025941 | Bacteria | 831 |
| 690 | Ga0207711_11289367 | 3300025941 | Unclassified | 672 |
| 691 | Ga0207689_10140887 | 3300025942 | Bacteria | 1986 |
| 692 | Ga0207689_10194601 | 3300025942 | Bacteria | 1673 |
| 693 | Ga0207689_10875500 | 3300025942 | Bacteria | 758 |
| 694 | Ga0207661_10495080 | 3300025944 | Bacteria | 1117 |
| 695 | Ga0207661_10766593 | 3300025944 | Bacteria | 888 |
| 696 | Ga0207661_10950984 | 3300025944 | Unclassified | 791 |
| 697 | Ga0207661_11814421 | 3300025944 | Bacteria | 555 |
| 698 | Ga0207679_10008413 | 3300025945 | Bacteria | 6572 |
| 699 | Ga0207679_10042386 | 3300025945 | Bacteria | 3271 |
| 700 | Ga0207679_10103165 | 3300025945 | Bacteria | 2235 |
| 701 | Ga0207679_10329105 | 3300025945 | Bacteria | 1325 |
| 702 | Ga0207679_10861176 | 3300025945 | Unclassified | 828 |
| 703 | Ga0207679_11312183 | 3300025945 | Unclassified | 664 |
| 704 | Ga0207651_10036285 | 3300025960 | Bacteria | 3216 |
| 705 | Ga0207651_10058516 | 3300025960 | Bacteria | 2664 |
| 706 | Ga0207651_10188160 | 3300025960 | Unclassified | 1644 |
| 707 | Ga0207651_10193030 | 3300025960 | Bacteria | 1626 |
| 708 | Ga0207651_10379928 | 3300025960 | Bacteria | 1197 |
| 709 | Ga0207651_10872331 | 3300025960 | Bacteria | 800 |
| 710 | Ga0207651_10877676 | 3300025960 | Bacteria | 798 |
| 711 | Ga0207651_10899924 | 3300025960 | Unclassified | 788 |
| 712 | Ga0207651_10978502 | 3300025960 | Bacteria | 755 |
| 713 | Ga0207651_11679854 | 3300025960 | Unclassified | 572 |
| 714 | Ga0207651_11760642 | 3300025960 | Unclassified | 558 |
| 715 | Ga0207712_10003730 | 3300025961 | Bacteria | 9615 |
| 716 | Ga0207712_10085733 | 3300025961 | Unclassified | 2306 |
| 717 | Ga0207712_10272308 | 3300025961 | Unclassified | 1378 |
| 718 | Ga0207712_11075473 | 3300025961 | Bacteria | 715 |
| 719 | Ga0207712_11488442 | 3300025961 | Bacteria | 606 |
| 720 | Ga0207712_11687605 | 3300025961 | Unclassified | 568 |
| 721 | Ga0207712_11711453 | 3300025961 | Bacteria | 564 |
| 722 | Ga0207712_11816399 | 3300025961 | Unclassified | 546 |
| 723 | Ga0207668_10258915 | 3300025972 | Bacteria | 1417 |
| 724 | Ga0207668_10688105 | 3300025972 | Unclassified | 898 |
| 725 | Ga0207668_10795637 | 3300025972 | Bacteria | 837 |
| 726 | Ga0207668_11149614 | 3300025972 | Bacteria | 697 |
| 727 | Ga0207668_11256914 | 3300025972 | Unclassified | 666 |
| 728 | Ga0207640_10642785 | 3300025981 | Bacteria | 903 |
| 729 | Ga0207640_10728813 | 3300025981 | Bacteria | 853 |
| 730 | Ga0207658_10696665 | 3300025986 | Bacteria | 918 |
| 731 | Ga0207658_10871705 | 3300025986 | Bacteria | 819 |
| 732 | Ga0207677_10234078 | 3300026023 | Bacteria | 1482 |
| 733 | Ga0207677_10253855 | 3300026023 | Unclassified | 1430 |
| 734 | Ga0207677_10346929 | 3300026023 | Bacteria | 1242 |
| 735 | Ga0207677_10381788 | 3300026023 | Bacteria | 1189 |
| 736 | Ga0207677_11044938 | 3300026023 | Bacteria | 742 |
| 737 | Ga0207703_10008188 | 3300026035 | Bacteria | 8259 |
| 738 | Ga0207703_10012180 | 3300026035 | Bacteria | 6704 |
| 739 | Ga0207703_10029210 | 3300026035 | Bacteria | 4349 |
| 740 | Ga0207703_10039807 | 3300026035 | Bacteria | 3759 |
| 741 | Ga0207703_10064474 | 3300026035 | Bacteria | 3007 |
| 742 | Ga0207703_10070888 | 3300026035 | Unclassified | 2877 |
| 743 | Ga0207703_10226609 | 3300026035 | Unclassified | 1674 |
| 744 | Ga0207703_10339023 | 3300026035 | Bacteria | 1381 |
| 745 | Ga0207703_10364113 | 3300026035 | Unclassified | 1334 |
| 746 | Ga0207703_10403481 | 3300026035 | Bacteria | 1269 |
| 747 | Ga0207703_11146254 | 3300026035 | Unclassified | 747 |
| 748 | Ga0207703_11635603 | 3300026035 | Bacteria | 620 |
| 749 | Ga0207708_10045210 | 3300026075 | Unclassified | 3356 |
| 750 | Ga0207708_10129089 | 3300026075 | Bacteria | 1975 |
| 751 | Ga0207708_10305080 | 3300026075 | Bacteria | 1296 |
| 752 | Ga0207708_10483081 | 3300026075 | Bacteria | 1036 |
| 753 | Ga0207708_11441631 | 3300026075 | Unclassified | 604 |
| 754 | Ga0207641_10000870 | 3300026088 | Bacteria | 31696 |
| 755 | Ga0207641_10229650 | 3300026088 | Bacteria | 1724 |
| 756 | Ga0207641_10282738 | 3300026088 | Bacteria | 1561 |
| 757 | Ga0207641_11454561 | 3300026088 | Unclassified | 687 |
| 758 | Ga0207641_11687796 | 3300026088 | Bacteria | 635 |
| 759 | Ga0207641_11998538 | 3300026088 | Unclassified | 581 |
| 760 | Ga0207648_10087220 | 3300026089 | Bacteria | 2723 |
| 761 | Ga0207648_10109062 | 3300026089 | Unclassified | 2430 |
| 762 | Ga0207648_10191408 | 3300026089 | Unclassified | 1813 |
| 763 | Ga0207648_10309995 | 3300026089 | Bacteria | 1417 |
| 764 | Ga0207648_10313854 | 3300026089 | Unclassified | 1408 |
| 765 | Ga0207648_10729605 | 3300026089 | Unclassified | 919 |
| 766 | Ga0207676_10029017 | 3300026095 | Bacteria | 4138 |
| 767 | Ga0207676_10035117 | 3300026095 | Unclassified | 3802 |
| 768 | Ga0207676_10057968 | 3300026095 | Unclassified | 3052 |
| 769 | Ga0207676_10108348 | 3300026095 | Unclassified | 2319 |
| 770 | Ga0207676_10114972 | 3300026095 | Bacteria | 2258 |
| 771 | Ga0207676_10667595 | 3300026095 | Bacteria | 1004 |
| 772 | Ga0207676_10711038 | 3300026095 | Bacteria | 974 |
| 773 | Ga0207676_11091115 | 3300026095 | Bacteria | 789 |
| 774 | Ga0207676_11370384 | 3300026095 | Bacteria | 703 |
| 775 | Ga0207674_10025294 | 3300026116 | Bacteria | 6335 |
| 776 | Ga0207674_10137399 | 3300026116 | Unclassified | 2405 |
| 777 | Ga0207674_10190553 | 3300026116 | Bacteria | 2000 |
| 778 | Ga0207674_10208954 | 3300026116 | Bacteria | 1901 |
| 779 | Ga0207674_10286060 | 3300026116 | Bacteria | 1597 |
| 780 | Ga0207674_10358896 | 3300026116 | Bacteria | 1409 |
| 781 | Ga0207674_10438021 | 3300026116 | Bacteria | 1263 |
| 782 | Ga0207674_12177257 | 3300026116 | Bacteria | 518 |
| 783 | Ga0207675_100013772 | 3300026118 | Archaea | 7544 |
| 784 | Ga0207675_100078355 | 3300026118 | Bacteria | 3096 |
| 785 | Ga0207675_100102740 | 3300026118 | Unclassified | 2693 |
| 786 | Ga0207675_100120091 | 3300026118 | Unclassified | 2486 |
| 787 | Ga0207675_100740624 | 3300026118 | Bacteria | 994 |
| 788 | Ga0207675_101898840 | 3300026118 | Bacteria | 614 |
| 789 | Ga0207683_10174715 | 3300026121 | Bacteria | 1946 |
| 790 | Ga0207683_10675976 | 3300026121 | Bacteria | 957 |
| 791 | Ga0207683_11084622 | 3300026121 | Bacteria | 743 |
| 792 | Ga0207698_10152876 | 3300026142 | Bacteria | 2006 |
| 793 | Ga0209967_1075890 | 3300027364 | Bacteria | 526 |
| 794 | Ga0209996_1073003 | 3300027395 | Unclassified | 534 |
| 795 | Ga0209984_1018079 | 3300027424 | Bacteria | 950 |
| 796 | Ga0209995_1084245 | 3300027471 | Bacteria | 546 |
| 797 | Ga0209982_1052861 | 3300027552 | Bacteria | 656 |
| 798 | Ga0209971_1098282 | 3300027682 | Unclassified | 716 |
| 799 | Ga0209813_10081112 | 3300027866 | Bacteria | 1073 |
| 800 | Ga0209813_10189281 | 3300027866 | Bacteria | 757 |
| 801 | Ga0209974_10202301 | 3300027876 | Bacteria | 734 |
| 802 | Ga0209974_10294721 | 3300027876 | Bacteria | 619 |
| 803 | Ga0207428_10000019 | 3300027907 | Bacteria | 276945 |
| 804 | Ga0207428_10020095 | 3300027907 | Bacteria | 5681 |
| 805 | Ga0207428_10070323 | 3300027907 | Unclassified | 2751 |
| 806 | Ga0207428_10246482 | 3300027907 | Bacteria | 1333 |
| 807 | Ga0207428_11128023 | 3300027907 | Unclassified | 547 |
| 808 | Ga0268266_10004395 | 3300028379 | Bacteria | 13511 |
| 809 | Ga0268266_10592919 | 3300028379 | Unclassified | 1064 |
| 810 | Ga0268266_10596332 | 3300028379 | Bacteria | 1061 |
| 811 | Ga0268266_10706403 | 3300028379 | Bacteria | 972 |
| 812 | Ga0268265_10012711 | 3300028380 | Bacteria | 5713 |
| 813 | Ga0268265_10120408 | 3300028380 | Unclassified | 2161 |
| 814 | Ga0268265_10176317 | 3300028380 | Unclassified | 1832 |
| 815 | Ga0268265_10184182 | 3300028380 | Unclassified | 1797 |
| 816 | Ga0268265_10274191 | 3300028380 | Bacteria | 1506 |
| 817 | Ga0268265_10476611 | 3300028380 | Unclassified | 1171 |
| 818 | Ga0268265_10665384 | 3300028380 | Bacteria | 1002 |
| 819 | Ga0268265_10711773 | 3300028380 | Unclassified | 971 |
| 820 | Ga0268265_10781561 | 3300028380 | Bacteria | 929 |
| 821 | Ga0268265_12112085 | 3300028380 | Bacteria | 570 |
| 822 | Ga0268265_12450852 | 3300028380 | Unclassified | 528 |
| 823 | Ga0268264_10006095 | 3300028381 | Bacteria | 10187 |
| 824 | Ga0268264_10017943 | 3300028381 | Bacteria | 5789 |
| 825 | Ga0268264_10137213 | 3300028381 | Unclassified | 2176 |
| 826 | Ga0268264_10143001 | 3300028381 | Unclassified | 2136 |
| 827 | Ga0268264_10178563 | 3300028381 | Bacteria | 1926 |
| 828 | Ga0268264_10189657 | 3300028381 | Bacteria | 1873 |
| 829 | Ga0268264_10620675 | 3300028381 | Bacteria | 1067 |
| 830 | Ga0268264_10640898 | 3300028381 | Unclassified | 1051 |
| 831 | Ga0268264_10790228 | 3300028381 | Unclassified | 948 |
| 832 | Ga0268264_11321524 | 3300028381 | Bacteria | 731 |
| 833 | Ga0268264_11715637 | 3300028381 | Bacteria | 638 |
| 834 | Ga0265336_10035718 | 3300028666 | Bacteria | 1532 |
| 835 | Ga0265760_10362700 | 3300031090 | Unclassified | 520 |
| 836 | Ga0265332_10120633 | 3300031238 | Bacteria | 1101 |
| 837 | Ga0307408_100065517 | 3300031548 | Bacteria | 2664 |
| 838 | Ga0307408_100179444 | 3300031548 | Bacteria | 1697 |
| 839 | Ga0307408_101092837 | 3300031548 | Bacteria | 739 |
| 840 | Ga0316576_10269286 | 3300031727 | Unclassified | 1277 |
| 841 | Ga0307405_10038358 | 3300031731 | Bacteria | 2887 |
| 842 | Ga0316577_10136076 | 3300031733 | Unclassified | 1383 |
| 843 | Ga0307413_10040136 | 3300031824 | Bacteria | 2729 |
| 844 | Ga0307413_10186322 | 3300031824 | Bacteria | 1485 |
| 845 | Ga0307413_10441683 | 3300031824 | Unclassified | 1030 |
| 846 | Ga0307413_10828484 | 3300031824 | Unclassified | 780 |
| 847 | Ga0307410_10053257 | 3300031852 | Bacteria | 2737 |
| 848 | Ga0307410_10341717 | 3300031852 | Bacteria | 1193 |
| 849 | Ga0307410_10539591 | 3300031852 | Bacteria | 965 |
| 850 | Ga0307406_10018003 | 3300031901 | Bacteria | 4121 |
| 851 | Ga0307406_10337112 | 3300031901 | Bacteria | 1173 |
| 852 | Ga0307407_10066595 | 3300031903 | Bacteria | 2125 |
| 853 | Ga0307407_10211306 | 3300031903 | Bacteria | 1306 |
| 854 | Ga0307407_10425577 | 3300031903 | Bacteria | 958 |
| 855 | Ga0307407_10596183 | 3300031903 | Bacteria | 822 |
| 856 | Ga0307412_10183382 | 3300031911 | Bacteria | 1576 |
| 857 | Ga0307409_100020350 | 3300031995 | Bacteria | 4519 |
| 858 | Ga0307409_100023967 | 3300031995 | Bacteria | 4243 |
| 859 | Ga0307409_100171933 | 3300031995 | Bacteria | 1908 |
| 860 | Ga0307416_100012809 | 3300032002 | Bacteria | 5671 |
| 861 | Ga0307416_100090503 | 3300032002 | Unclassified | 2624 |
| 862 | Ga0307416_100218716 | 3300032002 | Bacteria | 1825 |
| 863 | Ga0307416_100231347 | 3300032002 | Bacteria | 1782 |
| 864 | Ga0307416_100861562 | 3300032002 | Unclassified | 1004 |
| 865 | Ga0307416_101424418 | 3300032002 | Bacteria | 799 |
| 866 | Ga0307414_10024816 | 3300032004 | Bacteria | 3829 |
| 867 | Ga0307414_10369816 | 3300032004 | Bacteria | 1236 |
| 868 | Ga0307411_10005331 | 3300032005 | Bacteria | 6299 |
| 869 | Ga0307411_10046022 | 3300032005 | Bacteria | 2810 |
| 870 | Ga0307411_10132215 | 3300032005 | Bacteria | 1826 |
| 871 | Ga0307411_10660541 | 3300032005 | Bacteria | 906 |
| 872 | Ga0307411_11984734 | 3300032005 | Unclassified | 543 |
| 873 | Ga0307415_100013552 | 3300032126 | Bacteria | 4762 |
| 874 | Ga0307415_100242862 | 3300032126 | Bacteria | 1458 |
| 875 | Ga0307415_101847850 | 3300032126 | Bacteria | 585 |
| 876 | Ga0373926_0018883 | 3300035083 | Bacteria | 2375 |
| 877 | Ga0373929_0023898 | 3300035085 | Bacteria | 1259 |
| 878 | Ga0373944_0087735 | 3300035089 | Bacteria | 1036 |
| 879 | Ga0373952_0091338 | 3300035092 | Unclassified | 791 |
| 880 | Ga0373923_0214700 | 3300035111 | Bacteria | 893 |
| 881 | Ga0373923_0550286 | 3300035111 | Bacteria | 566 |
| 882 | Ga0373923_0552731 | 3300035111 | Bacteria | 564 |
| 883 | Ga0373932_0139623 | 3300035112 | Bacteria | 823 |
| 884 | Ga0373941_0103644 | 3300035115 | Bacteria | 994 |
| 885 | Ga0373945_0141906 | 3300035116 | Unclassified | 969 |
| 886 | Ga0373945_0482240 | 3300035116 | Bacteria | 551 |
| 887 | Ga0373954_0235731 | 3300035118 | Bacteria | 901 |
| 888 | Ga0373954_0523351 | 3300035118 | Bacteria | 588 |
| 889 | Ga0373956_0209873 | 3300035119 | Bacteria | 924 |
| 890 | Ga0373957_0183606 | 3300035120 | Bacteria | 868 |
| 891 | Ga0373960_0351598 | 3300035121 | Unclassified | 559 |
| 892 | Ga0373943_0049040 | 3300035170 | Bacteria | 2071 |
| 893 | Ga0373943_0063416 | 3300035170 | Bacteria | 1853 |
| 894 | Ga0373943_0108379 | 3300035170 | Unclassified | 1461 |
| 895 | Ga0373943_0237443 | 3300035170 | Unclassified | 1020 |
| 896 | Ga0373943_0666238 | 3300035170 | Bacteria | 615 |
| 897 | Ga0373946_0001686 | 3300035171 | Bacteria | 7697 |
| 898 | Ga0373946_0019190 | 3300035171 | Bacteria | 2633 |
| 899 | Ga0373955_0217033 | 3300035172 | Bacteria | 1142 |
| 900 | Ga0373942_0144767 | 3300035207 | Bacteria | 759 |
| 901 | Ga0373962_0030970 | 3300035242 | Bacteria | 1466 |
| 902 | Ga0373924_0022655 | 3300035410 | Bacteria | 2456 |
| 903 | Ga0373924_0249464 | 3300035410 | Bacteria | 786 |
| 904 | Ga0373924_0313492 | 3300035410 | Unclassified | 697 |
| 905 | Ga0373931_0592242 | 3300035691 | Unclassified | 724 |
| 906 | Ga0373931_0883496 | 3300035691 | Bacteria | 600 |
| 907 | Ga0373935_0018765 | 3300035692 | Bacteria | 4213 |
| 908 | Ga0373935_0018774 | 3300035692 | Unclassified | 4212 |
| 909 | Ga0373927_0231473 | 3300035695 | Bacteria | 1214 |
| 910 | Ga0373933_0261070 | 3300035724 | Bacteria | 1117 |
| 911 | Ga0373947_0005679 | 3300035725 | Bacteria | 7278 |
| 912 | Ga0373947_0010429 | 3300035725 | Bacteria | 5332 |
| 913 | Ga0373947_0127166 | 3300035725 | Bacteria | 1624 |
| 914 | Ga0373947_0674237 | 3300035725 | Unclassified | 705 |
| 915 | Ga0373947_1066884 | 3300035725 | Unclassified | 551 |
| 916 | Ga0373937_0663330 | 3300036401 | Bacteria | 989 |
| 917 | Ga0373937_1242274 | 3300036401 | Bacteria | 693 |
| 918 | Ga0316584_0368712 | 3300036712 | Unclassified | 1028 |
| 919 | Ga0373925_0000987 | 3300037068 | Bacteria | 25925 |
| 920 | Ga0373925_0014754 | 3300037068 | Bacteria | 5645 |
| 921 | Ga0373925_0498410 | 3300037068 | Unclassified | 1000 |
| 922 | Ga0373925_0510968 | 3300037068 | Bacteria | 987 |
| 923 | Ga0395905_0241486 | 3300037471 | Bacteria | 1688 |
| 924 | Ga0395901_1129428 | 3300038443 | Bacteria | 753 |
| 925 | Ga0436365_0256694 | 3300039437 | Bacteria | 4105 |
| 926 | Ga0436363_1582334 | 3300039450 | Bacteria | 990 |
| 927 | Ga0439461_0129655 | 3300041410 | Unclassified | 637 |
| 928 | Ga0439461_0234007 | 3300041410 | Unclassified | 505 |
| 929 | Ga0451798_0080327 | 3300041458 | Bacteria | 604 |
| 930 | Ga0451802_0699190 | 3300041460 | Bacteria | 669 |
| 931 | Ga0451802_1975399 | 3300041460 | Unclassified | 630 |
| 932 | Ga0451804_0215498 | 3300041463 | Bacteria | 809 |
| 933 | Ga0451839_1351758 | 3300041496 | Unclassified | 580 |
| 934 | Ga0451845_0825720 | 3300041501 | Unclassified | 528 |
| 935 | Ga0451853_2015740 | 3300041512 | Bacteria | 1080 |
| 936 | Ga0439431_0018699 | 3300041997 | Bacteria | 1642 |
| 937 | Ga0439431_0050025 | 3300041997 | Unclassified | 1082 |
| 938 | Ga0439433_0101915 | 3300041999 | Bacteria | 713 |
| 939 | Ga0439433_0209430 | 3300041999 | Bacteria | 517 |
| 940 | Ga0439433_0213788 | 3300041999 | Unclassified | 512 |
| 941 | Ga0439443_055284 | 3300042003 | Unclassified | 702 |
| 942 | Ga0439445_0025091 | 3300042004 | Unclassified | 1519 |
| 943 | Ga0439449_0118144 | 3300042007 | Bacteria | 984 |
| 944 | Ga0439462_0036802 | 3300042015 | Bacteria | 1303 |
| 945 | Ga0439462_0062800 | 3300042015 | Bacteria | 1006 |
| 946 | Ga0450917_002928 | 3300042120 | Bacteria | 1227 |
| 947 | Ga0439446_0056985 | 3300042156 | Bacteria | 1175 |
| 948 | Ga0439446_0084737 | 3300042156 | Bacteria | 985 |
| 949 | Ga0439446_0339473 | 3300042156 | Unclassified | 533 |
| 950 | Ga0439434_0046095 | 3300042435 | Unclassified | 1346 |
| 951 | Ga0439434_0233509 | 3300042435 | Unclassified | 626 |
| 952 | Ga0439435_0194406 | 3300042436 | Unclassified | 667 |
| 953 | Ga0439435_0298489 | 3300042436 | Bacteria | 551 |
| 954 | Ga0439444_0171278 | 3300042437 | Unclassified | 535 |
| 955 | Ga0439464_0110888 | 3300042439 | Bacteria | 840 |
| 956 | Ga0439464_0121513 | 3300042439 | Unclassified | 805 |
| 957 | Ga0439460_0005471 | 3300042461 | Bacteria | 3117 |
| 958 | Ga0439460_0231045 | 3300042461 | Bacteria | 636 |
| 959 | Ga0439460_0332249 | 3300042461 | Bacteria | 534 |
| 960 | Ga0450916_001470 | 3300042530 | Unclassified | 2366 |
| 961 | Ga0450893_0039750 | 3300042532 | Bacteria | 859 |
| 962 | Ga0451577_1000582 | 3300042876 | Bacteria | 751 |
| 963 | Ga0439440_0273387 | 3300042993 | Unclassified | 520 |
| 964 | Ga0466960_0480519 | 3300044901 | Unclassified | 726 |
| 965 | Ga0451576_1333906 | 3300045051 | Unclassified | 747 |
| 966 | Ga0495592_0098588 | 3300046454 | Unclassified | 2085 |
| 967 | Ga0495629_0205444 | 3300046459 | Bacteria | 1361 |
| 968 | Ga0495651_0361194 | 3300046462 | Bacteria | 957 |
| 969 | Ga0495651_0365980 | 3300046462 | Bacteria | 949 |
| 970 | Ga0495651_0457010 | 3300046462 | Bacteria | 824 |
| 971 | Ga0495653_0168896 | 3300046463 | Bacteria | 1512 |
| 972 | Ga0495580_0034457 | 3300046472 | Unclassified | 3646 |
| 973 | Ga0495580_1004569 | 3300046472 | Unclassified | 532 |
| 974 | Ga0495582_0319076 | 3300046473 | Bacteria | 894 |
| 975 | Ga0495639_0530664 | 3300046475 | Bacteria | 602 |
| 976 | Ga0495639_0653158 | 3300046475 | Unclassified | 542 |
| 977 | Ga0495584_0247788 | 3300046491 | Archaea | 906 |
| 978 | Ga0495594_0631587 | 3300046499 | Unclassified | 607 |
| 979 | Ga0495594_0804413 | 3300046499 | Unclassified | 530 |
| 980 | Ga0495608_0016616 | 3300046511 | Bacteria | 5092 |
| 981 | Ga0495628_0365907 | 3300046516 | Bacteria | 1058 |
| 982 | Ga0495630_0002484 | 3300046517 | Bacteria | 12777 |
| 983 | Ga0495652_0175483 | 3300046529 | Unclassified | 1650 |
| 984 | Ga0495652_0548596 | 3300046529 | Bacteria | 795 |
| 985 | Ga0495640_0101793 | 3300046533 | Unclassified | 1885 |
| 986 | Ga0495640_0118507 | 3300046533 | Unclassified | 1723 |
| 987 | Ga0495640_0490387 | 3300046533 | Unclassified | 748 |
| 988 | Ga0495586_0201270 | 3300046535 | Bacteria | 1129 |
| 989 | Ga0495598_0059750 | 3300046537 | Bacteria | 1173 |
| 990 | Ga0495621_0454660 | 3300046539 | Bacteria | 548 |
| 991 | Ga0495645_0468867 | 3300046543 | Unclassified | 792 |
| 992 | Ga0495667_0117496 | 3300046559 | Bacteria | 1718 |
| 993 | Ga0495667_0486455 | 3300046559 | Bacteria | 774 |
| 994 | Ga0495656_0267217 | 3300046615 | Bacteria | 868 |
| 995 | Ga0495659_0105435 | 3300046664 | Unclassified | 1096 |
| 996 | Ga0495659_0217557 | 3300046664 | Bacteria | 788 |
| 997 | Ga0495659_0373795 | 3300046664 | Bacteria | 612 |
| 998 | Ga0495659_0411475 | 3300046664 | Bacteria | 585 |
| 999 | Ga0495659_0442002 | 3300046664 | Bacteria | 565 |
| 1000 | Ga0495599_0059209 | 3300046678 | Bacteria | 2396 |
| 1001 | Ga0495599_0162573 | 3300046678 | Bacteria | 1379 |
| 1002 | Ga0495599_0320735 | 3300046678 | Bacteria | 933 |
| 1003 | Ga0495658_0420792 | 3300046683 | Unclassified | 852 |
| 1004 | Ga0495669_0011999 | 3300046684 | Bacteria | 3684 |
| 1005 | Ga0495669_0085140 | 3300046684 | Bacteria | 1454 |
| 1006 | Ga0495613_0219048 | 3300046689 | Unclassified | 1336 |
| 1007 | Ga0495670_0410701 | 3300046691 | Unclassified | 732 |
| 1008 | Ga0495600_0167719 | 3300046809 | Unclassified | 1418 |
| 1009 | Ga0495581_0322810 | 3300047315 | Unclassified | 902 |
| 1010 | Ga0495604_0365467 | 3300047317 | Bacteria | 956 |
| 1011 | Ga0495604_0924736 | 3300047317 | Unclassified | 544 |
| 1012 | Ga0495674_0093731 | 3300047319 | Bacteria | 2562 |
| 1013 | Ga0495674_0219556 | 3300047319 | Bacteria | 1572 |
| 1014 | Ga0495674_0893303 | 3300047319 | Unclassified | 686 |
| 1015 | Ga0495674_0999433 | 3300047319 | Unclassified | 641 |
| 1016 | Ga0495677_0238758 | 3300047445 | Bacteria | 710 |
| 1017 | Ga0495684_0000048 | 3300047471 | Bacteria | 89243 |
| 1018 | Ga0495684_0268988 | 3300047471 | Bacteria | 1234 |
| 1019 | Ga0495602_0777211 | 3300048088 | Bacteria | 645 |
| 1020 | Ga0496100_0073606 | 3300048903 | Bacteria | 2287 |
| 1021 | Ga0496100_0885861 | 3300048903 | Unclassified | 701 |
| 1022 | Ga0496102_1067956 | 3300048905 | Bacteria | 727 |
| 1023 | Ga0496102_1205543 | 3300048905 | Unclassified | 676 |
| 1024 | Ga0496104_0024954 | 3300048907 | Bacteria | 5507 |
| 1025 | Ga0496105_0407231 | 3300048908 | Unclassified | 1079 |
| 1026 | Ga0496107_0251586 | 3300048910 | Bacteria | 1315 |
| 1027 | Ga0496107_0876057 | 3300048910 | Unclassified | 655 |
| 1028 | Ga0496107_0887787 | 3300048910 | Bacteria | 650 |
| 1029 | Ga0496108_0061576 | 3300048911 | Bacteria | 3158 |
| 1030 | Ga0496108_0257394 | 3300048911 | Bacteria | 1519 |
| 1031 | Ga0496109_0171044 | 3300048912 | Unclassified | 2038 |
| 1032 | Ga0496110_0593666 | 3300048913 | Bacteria | 1005 |
| 1033 | Ga0496110_0641965 | 3300048913 | Bacteria | 961 |
| 1034 | Ga0496110_1115084 | 3300048913 | Unclassified | 697 |
| 1035 | Ga0496110_1478578 | 3300048913 | Unclassified | 589 |
| 1036 | Ga0496112_0027342 | 3300048915 | Bacteria | 5499 |
| 1037 | Ga0496112_0046895 | 3300048915 | Bacteria | 4239 |
| 1038 | Ga0496112_0383813 | 3300048915 | Bacteria | 1346 |
| 1039 | Ga0496112_0477952 | 3300048915 | Bacteria | 1183 |
| 1040 | Ga0496112_0478462 | 3300048915 | Bacteria | 1182 |
| 1041 | Ga0496112_1553545 | 3300048915 | Unclassified | 575 |
| 1042 | Ga0496113_0008765 | 3300048916 | Bacteria | 6606 |
| 1043 | Ga0496114_0832016 | 3300048917 | Bacteria | 803 |
| 1044 | Ga0496114_0876396 | 3300048917 | Bacteria | 778 |
| 1045 | Ga0496114_1189280 | 3300048917 | Bacteria | 648 |
| 1046 | Ga0496115_0289468 | 3300048918 | Bacteria | 1344 |
| 1047 | Ga0501031_0003807 | 3300049568 | Bacteria | 9701 |
| 1048 | Ga0501031_0037352 | 3300049568 | Bacteria | 3169 |
| 1049 | Ga0501031_0175382 | 3300049568 | Bacteria | 1400 |
| 1050 | Ga0501032_0015305 | 3300049569 | Bacteria | 5415 |
| 1051 | Ga0501032_0026840 | 3300049569 | Bacteria | 3958 |
| 1052 | Ga0501033_0014914 | 3300049570 | Bacteria | 5899 |
| 1053 | Ga0501033_0019113 | 3300049570 | Bacteria | 5181 |
| 1054 | Ga0501033_0028188 | 3300049570 | Bacteria | 4221 |
| 1055 | Ga0501033_0215108 | 3300049570 | Unclassified | 1370 |
| 1056 | Ga0501034_0100181 | 3300049571 | Bacteria | 2891 |
| 1057 | Ga0501034_0110593 | 3300049571 | Bacteria | 2738 |
| 1058 | Ga0501034_0415662 | 3300049571 | Unclassified | 1266 |
| 1059 | Ga0501036_0020812 | 3300049572 | Bacteria | 5509 |
| 1060 | Ga0501036_0046192 | 3300049572 | Bacteria | 3687 |
| 1061 | Ga0501036_0071922 | 3300049572 | Bacteria | 2924 |
| 1062 | Ga0501036_0073131 | 3300049572 | Bacteria | 2898 |
| 1063 | Ga0501036_0123784 | 3300049572 | Bacteria | 2184 |
| 1064 | Ga0501036_0719387 | 3300049572 | Bacteria | 824 |
| 1065 | Ga0501037_0007463 | 3300049573 | Bacteria | 8000 |
| 1066 | Ga0501037_0008213 | 3300049573 | Bacteria | 7652 |
| 1067 | Ga0501038_0004706 | 3300049574 | Bacteria | 12692 |
| 1068 | Ga0501038_0011613 | 3300049574 | Bacteria | 8034 |
| 1069 | Ga0501038_0013478 | 3300049574 | Bacteria | 7452 |
| 1070 | Ga0501038_0031228 | 3300049574 | Unclassified | 4709 |
| 1071 | Ga0501038_0330322 | 3300049574 | Unclassified | 1191 |
| 1072 | Ga0501039_0009583 | 3300049575 | Bacteria | 7382 |
| 1073 | Ga0501039_0017979 | 3300049575 | Bacteria | 5422 |
| 1074 | Ga0501039_0055936 | 3300049575 | Bacteria | 3056 |
| 1075 | Ga0501039_0439728 | 3300049575 | Unclassified | 1024 |
| 1076 | Ga0501040_0036511 | 3300049576 | Bacteria | 3336 |
| 1077 | Ga0501040_0351418 | 3300049576 | Bacteria | 1056 |
| 1078 | Ga0501041_0013709 | 3300049577 | Unclassified | 4808 |
| 1079 | Ga0501041_0063192 | 3300049577 | Bacteria | 2267 |
| 1080 | Ga0501041_0092564 | 3300049577 | Unclassified | 1867 |
| 1081 | Ga0501041_0696768 | 3300049577 | Bacteria | 650 |
| 1082 | Ga0501042_0002722 | 3300049578 | Bacteria | 10899 |
| 1083 | Ga0501042_0004934 | 3300049578 | Bacteria | 8542 |
| 1084 | Ga0501042_0032264 | 3300049578 | Bacteria | 3708 |
| 1085 | Ga0501042_0445274 | 3300049578 | Bacteria | 939 |
| 1086 | Ga0501042_0498041 | 3300049578 | Bacteria | 885 |
| 1087 | Ga0501043_0029061 | 3300049579 | Unclassified | 4341 |
| 1088 | Ga0501043_0064075 | 3300049579 | Bacteria | 2886 |
| 1089 | Ga0501043_0155625 | 3300049579 | Bacteria | 1787 |
| 1090 | Ga0501046_0044784 | 3300049580 | Bacteria | 3518 |
| 1091 | Ga0501046_0068048 | 3300049580 | Bacteria | 2772 |
| 1092 | Ga0501046_0207281 | 3300049580 | Bacteria | 1456 |
| 1093 | Ga0501046_0372282 | 3300049580 | Bacteria | 1035 |
| 1094 | Ga0501047_0026363 | 3300049581 | Bacteria | 5592 |
| 1095 | Ga0501047_0053487 | 3300049581 | Bacteria | 3904 |
| 1096 | Ga0501047_0097646 | 3300049581 | Bacteria | 2815 |
| 1097 | Ga0501048_0005878 | 3300049582 | Bacteria | 9338 |
| 1098 | Ga0501048_0009540 | 3300049582 | Bacteria | 7285 |
| 1099 | Ga0501048_0019807 | 3300049582 | Bacteria | 4933 |
| 1100 | Ga0501048_0069110 | 3300049582 | Bacteria | 2495 |
| 1101 | Ga0501048_0236453 | 3300049582 | Unclassified | 1296 |
| 1102 | Ga0501067_0000913 | 3300049583 | Bacteria | 15884 |
| 1103 | Ga0501067_0008912 | 3300049583 | Bacteria | 5559 |
| 1104 | Ga0501067_0016664 | 3300049583 | Bacteria | 4061 |
| 1105 | Ga0501067_0027089 | 3300049583 | Unclassified | 3176 |
| 1106 | Ga0501067_0031510 | 3300049583 | Bacteria | 2942 |
| 1107 | Ga0501068_0009006 | 3300049584 | Bacteria | 5569 |
| 1108 | Ga0501068_0009599 | 3300049584 | Bacteria | 5418 |
| 1109 | Ga0501068_0110543 | 3300049584 | Bacteria | 1708 |
| 1110 | Ga0501069_0002325 | 3300049585 | Bacteria | 9602 |
| 1111 | Ga0501069_0007210 | 3300049585 | Bacteria | 5827 |
| 1112 | Ga0501069_0012480 | 3300049585 | Bacteria | 4519 |
| 1113 | Ga0501070_0031584 | 3300049586 | Bacteria | 4436 |
| 1114 | Ga0501070_0105916 | 3300049586 | Bacteria | 2324 |
| 1115 | Ga0501071_0004219 | 3300049587 | Bacteria | 9100 |
| 1116 | Ga0501071_0043367 | 3300049587 | Bacteria | 3225 |
| 1117 | Ga0501071_0058525 | 3300049587 | Bacteria | 2787 |
| 1118 | Ga0501071_0066010 | 3300049587 | Bacteria | 2629 |
| 1119 | Ga0501071_0411810 | 3300049587 | Bacteria | 1033 |
| 1120 | Ga0501071_0842986 | 3300049587 | Bacteria | 707 |
| 1121 | Ga0501071_1359995 | 3300049587 | Unclassified | 548 |
| 1122 | Ga0501072_0040803 | 3300049588 | Bacteria | 3645 |
| 1123 | Ga0501072_0043351 | 3300049588 | Bacteria | 3536 |
| 1124 | Ga0501072_0169136 | 3300049588 | Bacteria | 1744 |
| 1125 | Ga0501072_0602206 | 3300049588 | Bacteria | 866 |
| 1126 | Ga0501072_0726123 | 3300049588 | Bacteria | 780 |
| 1127 | Ga0501072_0870443 | 3300049588 | Bacteria | 704 |
| 1128 | Ga0501073_0003470 | 3300049589 | Bacteria | 11833 |
| 1129 | Ga0501073_0004091 | 3300049589 | Bacteria | 10941 |
| 1130 | Ga0501073_0158453 | 3300049589 | Bacteria | 1568 |
| 1131 | Ga0501074_0008374 | 3300049590 | Bacteria | 7495 |
| 1132 | Ga0501074_0009982 | 3300049590 | Bacteria | 6894 |
| 1133 | Ga0501074_0010136 | 3300049590 | Bacteria | 6843 |
| 1134 | Ga0501074_0106226 | 3300049590 | Bacteria | 2010 |
| 1135 | Ga0501075_0005744 | 3300049591 | Bacteria | 8490 |
| 1136 | Ga0501075_0111308 | 3300049591 | Bacteria | 2082 |
| 1137 | Ga0501075_0270584 | 3300049591 | Unclassified | 1295 |
| 1138 | Ga0501075_0774244 | 3300049591 | Bacteria | 730 |
| 1139 | Ga0501075_0797742 | 3300049591 | Bacteria | 719 |
| 1140 | Ga0501075_0808107 | 3300049591 | Unclassified | 713 |
| 1141 | Ga0501075_0849907 | 3300049591 | Bacteria | 694 |
| 1142 | Ga0501075_1003064 | 3300049591 | Unclassified | 634 |
| 1143 | Ga0501076_0003150 | 3300049592 | Bacteria | 11500 |
| 1144 | Ga0501076_0037146 | 3300049592 | Bacteria | 3819 |
| 1145 | Ga0501076_0050071 | 3300049592 | Bacteria | 3304 |
| 1146 | Ga0501076_0111085 | 3300049592 | Bacteria | 2215 |
| 1147 | Ga0501076_0175007 | 3300049592 | Unclassified | 1749 |
| 1148 | Ga0501076_0383554 | 3300049592 | Bacteria | 1155 |
| 1149 | Ga0501076_0704583 | 3300049592 | Bacteria | 833 |
| 1150 | Ga0501077_0021195 | 3300049593 | Unclassified | 4113 |
| 1151 | Ga0501077_0127614 | 3300049593 | Bacteria | 1612 |
| 1152 | Ga0501199_055884 | 3300049650 | Bacteria | 542 |
| 1153 | Ga0501217_147117 | 3300049661 | Bacteria | 702 |
| 1154 | Ga0501233_253769 | 3300049668 | Bacteria | 530 |
| 1155 | Ga0501249_107637 | 3300049679 | Bacteria | 671 |
| 1156 | Ga0501253_121282 | 3300049683 | Bacteria | 634 |
| 1157 | Ga0501079_0003117 | 3300049741 | Bacteria | 12147 |
| 1158 | Ga0501079_0010915 | 3300049741 | Bacteria | 6920 |
| 1159 | Ga0501079_0035593 | 3300049741 | Bacteria | 3833 |
| 1160 | Ga0501079_0111822 | 3300049741 | Bacteria | 2122 |
| 1161 | Ga0501079_0116896 | 3300049741 | Bacteria | 2073 |
| 1162 | Ga0501079_0200728 | 3300049741 | Bacteria | 1558 |
| 1163 | Ga0501080_0043473 | 3300049742 | Bacteria | 4183 |
| 1164 | Ga0501080_0084052 | 3300049742 | Bacteria | 2957 |
| 1165 | Ga0501080_0171178 | 3300049742 | Bacteria | 2003 |
| 1166 | Ga0501080_0595973 | 3300049742 | Bacteria | 981 |
| 1167 | Ga0501080_0611732 | 3300049742 | Bacteria | 966 |
| 1168 | Ga0501080_0872256 | 3300049742 | Bacteria | 786 |
| 1169 | Ga0501080_1135029 | 3300049742 | Unclassified | 674 |
| 1170 | Ga0501081_0004610 | 3300049743 | Bacteria | 8847 |
| 1171 | Ga0501081_0039028 | 3300049743 | Bacteria | 3248 |
| 1172 | Ga0501081_0090871 | 3300049743 | Bacteria | 2147 |
| 1173 | Ga0501081_0242451 | 3300049743 | Unclassified | 1315 |
| 1174 | Ga0501083_0031063 | 3300049744 | Bacteria | 3665 |
| 1175 | Ga0501083_0033495 | 3300049744 | Bacteria | 3517 |
| 1176 | Ga0501083_0037768 | 3300049744 | Bacteria | 3287 |
| 1177 | Ga0501268_019197 | 3300049765 | Bacteria | 1156 |
| 1178 | Ga0501035_0008641 | 3300049822 | Bacteria | 9481 |
| 1179 | Ga0501035_0040104 | 3300049822 | Bacteria | 4233 |
| 1180 | Ga0501035_0220606 | 3300049822 | Bacteria | 1619 |
| 1181 | Ga0501035_0858026 | 3300049822 | Bacteria | 722 |
| 1182 | Ga0501035_1129763 | 3300049822 | Bacteria | 611 |
| 1183 | Ga0501035_1493057 | 3300049822 | Unclassified | 516 |
| 1184 | Ga0501044_0033844 | 3300049823 | Bacteria | 5365 |
| 1185 | Ga0501044_0114079 | 3300049823 | Bacteria | 2708 |
| 1186 | Ga0501045_0004156 | 3300049824 | Bacteria | 10002 |
| 1187 | Ga0501045_0022749 | 3300049824 | Bacteria | 4489 |
| 1188 | Ga0501045_0037079 | 3300049824 | Bacteria | 3543 |
| 1189 | Ga0501045_0192969 | 3300049824 | Bacteria | 1518 |
| 1190 | Ga0501045_0214900 | 3300049824 | Bacteria | 1432 |
| 1191 | Ga0501045_1344758 | 3300049824 | Unclassified | 519 |
| 1192 | nmdc:mga03683_8827_c2 | 3300050489 | Bacteria | 2416 |
| 1193 | nmdc:mga03n38_408520_c1 | 3300050490 | Bacteria | 749 |
| 1194 | nmdc:mga00v17_26303_c1 | 3300050491 | Bacteria | 3390 |
| 1195 | nmdc:mga00v17_4431_c1 | 3300050491 | Bacteria | 7308 |
| 1196 | nmdc:mga0yw44_1297_c1 | 3300050492 | Bacteria | 9870 |
| 1197 | nmdc:mga0yw44_90267_c1 | 3300050492 | Unclassified | 1935 |
| 1198 | nmdc:mga0k408_15920_c1 | 3300050493 | Bacteria | 4165 |
| 1199 | nmdc:mga0k408_31367_c1 | 3300050493 | Bacteria | 3034 |
| 1200 | nmdc:mga06z11_14172_c1 | 3300050494 | Bacteria | 3525 |
| 1201 | nmdc:mga04h51_31508_c1 | 3300050495 | Bacteria | 1676 |
| 1202 | nmdc:mga04h51_96456_c1 | 3300050495 | Bacteria | 1072 |
| 1203 | nmdc:mga07m45_95800_c1 | 3300050496 | Unclassified | 1703 |
| 1204 | nmdc:mga05p37_12328_c1 | 3300050507 | Bacteria | 10210 |
| 1205 | nmdc:mga05p37_141143_c1 | 3300050507 | Bacteria | 2952 |
| 1206 | nmdc:mga05p37_1473_c1 | 3300050507 | Bacteria | 27340 |
| 1207 | nmdc:mga05p37_177523_c1 | 3300050507 | Bacteria | 2594 |
| 1208 | nmdc:mga05p37_180276_c1 | 3300050507 | Bacteria | 2570 |
| 1209 | nmdc:mga05p37_296437_c1 | 3300050507 | Bacteria | 1923 |
| 1210 | nmdc:mga05p37_310585_c1 | 3300050507 | Bacteria | 1869 |
| 1211 | nmdc:mga05p37_41497_c1 | 3300050507 | Bacteria | 5649 |
| 1212 | nmdc:mga05p37_433355_c1 | 3300050507 | Bacteria | 1527 |
| 1213 | nmdc:mga05p37_474_c1 | 3300050507 | Bacteria | 43786 |
| 1214 | nmdc:mga05p37_976055_c1 | 3300050507 | Bacteria | 903 |
| 1215 | nmdc:mga09592_1251576_c1 | 3300050508 | Unclassified | 612 |
| 1216 | nmdc:mga09592_183823_c1 | 3300050508 | Bacteria | 1808 |
| 1217 | nmdc:mga09592_221787_c1 | 3300050508 | Bacteria | 1638 |
| 1218 | nmdc:mga09592_78061_c1 | 3300050508 | Bacteria | 2817 |
| 1219 | nmdc:mga09592_791184_c1 | 3300050508 | Bacteria | 803 |
| 1220 | nmdc:mga0qj67_188519_c1 | 3300050509 | Unclassified | 1676 |
| 1221 | nmdc:mga0qj67_225874_c1 | 3300050509 | Bacteria | 1519 |
| 1222 | nmdc:mga0qj67_474537_c1 | 3300050509 | Bacteria | 1007 |
| 1223 | nmdc:mga0qj67_524775_c1 | 3300050509 | Unclassified | 951 |
| 1224 | nmdc:mga06r32_110235_c1 | 3300050510 | Bacteria | 2707 |
| 1225 | nmdc:mga06r32_222436_c1 | 3300050510 | Bacteria | 1876 |
| 1226 | nmdc:mga06r32_40234_c1 | 3300050510 | Bacteria | 4437 |
| 1227 | nmdc:mga06r32_482739_c1 | 3300050510 | Bacteria | 1217 |
| 1228 | nmdc:mga06r32_53501_c1 | 3300050510 | Bacteria | 3867 |
| 1229 | nmdc:mga08y16_1377442_c1 | 3300050511 | Bacteria | 669 |
| 1230 | nmdc:mga08y16_145338_c1 | 3300050511 | Bacteria | 2465 |
| 1231 | nmdc:mga08y16_161043_c1 | 3300050511 | Unclassified | 2332 |
| 1232 | nmdc:mga08y16_17_c1 | 3300050511 | Bacteria | 382598 |
| 1233 | nmdc:mga08y16_218615_c1 | 3300050511 | Unclassified | 1973 |
| 1234 | nmdc:mga08y16_300436_c1 | 3300050511 | Unclassified | 1655 |
| 1235 | nmdc:mga08y16_30804_c1 | 3300050511 | Bacteria | 5642 |
| 1236 | nmdc:mga08y16_3761_c1 | 3300050511 | Bacteria | 15798 |
| 1237 | nmdc:mga08y16_378900_c1 | 3300050511 | Unclassified | 1450 |
| 1238 | nmdc:mga08y16_513059_c1 | 3300050511 | Bacteria | 1217 |
| 1239 | nmdc:mga08y16_542411_c1 | 3300050511 | Bacteria | 1178 |
| 1240 | nmdc:mga08y16_711726_c1 | 3300050511 | Bacteria | 1003 |
| 1241 | nmdc:mga0n895_1039184_c1 | 3300050512 | Bacteria | 799 |
| 1242 | nmdc:mga0n895_111_c1 | 3300050512 | Bacteria | 48235 |
| 1243 | nmdc:mga0n895_1583074_c1 | 3300050512 | Bacteria | 620 |
| 1244 | nmdc:mga0n895_229247_c1 | 3300050512 | Unclassified | 1886 |
| 1245 | nmdc:mga0n895_28763_c1 | 3300050512 | Bacteria | 5291 |
| 1246 | nmdc:mga0n895_299958_c1 | 3300050512 | Bacteria | 1629 |
| 1247 | nmdc:mga0n895_41387_c1 | 3300050512 | Unclassified | 4479 |
| 1248 | nmdc:mga0n895_459390_c1 | 3300050512 | Bacteria | 1285 |
| 1249 | nmdc:mga0n895_5595_c1 | 3300050512 | Archaea | 10520 |
| 1250 | nmdc:mga0n895_73636_c1 | 3300050512 | Unclassified | 3391 |
| 1251 | nmdc:mga0n895_84135_c1 | 3300050512 | Bacteria | 3174 |
| 1252 | nmdc:mga0n895_95799_c1 | 3300050512 | Bacteria | 2973 |
| 1253 | nmdc:mga0rr50_105542_c1 | 3300050513 | Bacteria | 2222 |
| 1254 | nmdc:mga0rr50_1285137_c1 | 3300050513 | Bacteria | 621 |
| 1255 | nmdc:mga0rr50_128854_c1 | 3300050513 | Bacteria | 2023 |
| 1256 | nmdc:mga0rr50_15435_c1 | 3300050513 | Bacteria | 5043 |
| 1257 | nmdc:mga0rr50_183318_c1 | 3300050513 | Bacteria | 1712 |
| 1258 | nmdc:mga0rr50_187201_c1 | 3300050513 | Bacteria | 1695 |
| 1259 | nmdc:mga0rr50_57621_c1 | 3300050513 | Bacteria | 2907 |
| 1260 | nmdc:mga0rr50_57_c1 | 3300050513 | Bacteria | 67718 |
| 1261 | nmdc:mga0rr50_609002_c1 | 3300050513 | Bacteria | 931 |
| 1262 | nmdc:mga0rr50_647501_c1 | 3300050513 | Bacteria | 902 |
| 1263 | nmdc:mga08x19_10657_c1 | 3300050514 | Bacteria | 5527 |
| 1264 | nmdc:mga08x19_13506_c1 | 3300050514 | Bacteria | 4939 |
| 1265 | nmdc:mga08x19_25756_c1 | 3300050514 | Bacteria | 3667 |
| 1266 | nmdc:mga08x19_33384_c1 | 3300050514 | Bacteria | 3248 |
| 1267 | nmdc:mga08x19_42475_c1 | 3300050514 | Unclassified | 2899 |
| 1268 | nmdc:mga08x19_426_c1 | 3300050514 | Bacteria | 28960 |
| 1269 | nmdc:mga0a205_129173_c1 | 3300050515 | Bacteria | 2427 |
| 1270 | nmdc:mga0a205_1306676_c1 | 3300050515 | Bacteria | 573 |
| 1271 | nmdc:mga0a205_149862_c1 | 3300050515 | Bacteria | 2233 |
| 1272 | nmdc:mga0a205_162596_c1 | 3300050515 | Bacteria | 2128 |
| 1273 | nmdc:mga0a205_179415_c1 | 3300050515 | Bacteria | 2012 |
| 1274 | nmdc:mga0a205_261298_c1 | 3300050515 | Bacteria | 1609 |
| 1275 | nmdc:mga0a205_263098_c1 | 3300050515 | Unclassified | 1602 |
| 1276 | nmdc:mga0a205_412715_c1 | 3300050515 | Bacteria | 1213 |
| 1277 | nmdc:mga0a205_430828_c1 | 3300050515 | Bacteria | 1180 |
| 1278 | nmdc:mga0a205_450033_c1 | 3300050515 | Unclassified | 1148 |
| 1279 | nmdc:mga0a205_46188_c3 | 3300050515 | Bacteria | 1074 |
| 1280 | nmdc:mga0a205_601546_c1 | 3300050515 | Bacteria | 953 |
| 1281 | nmdc:mga0a205_69429_c1 | 3300050515 | Bacteria | 3402 |
| 1282 | Ga0495601_0159044 | 3300053077 | Bacteria | 1476 |
| 1283 | Ga0495601_0243029 | 3300053077 | Bacteria | 1175 |
| 1284 | Ga0495601_0357317 | 3300053077 | Bacteria | 949 |
| 1285 | Ga0495601_1010668 | 3300053077 | Bacteria | 522 |
| 1286 | Ga0495595_0482535 | 3300053084 | Unclassified | 631 |
| 1287 | Ga0495619_0023037 | 3300053085 | Unclassified | 3989 |
| 1288 | Ga0495619_0107533 | 3300053085 | Bacteria | 1903 |
| 1289 | Ga0495619_0174363 | 3300053085 | Bacteria | 1487 |
| 1290 | Ga0495619_0333389 | 3300053085 | Bacteria | 1050 |
| 1291 | Ga0501084_0005241 | 3300054114 | Bacteria | 10612 |
| 1292 | Ga0501084_0007230 | 3300054114 | Bacteria | 9151 |
| 1293 | Ga0501084_0007864 | 3300054114 | Bacteria | 8777 |
| 1294 | Ga0501084_0057513 | 3300054114 | Bacteria | 3254 |
| 1295 | Ga0501084_0172287 | 3300054114 | Bacteria | 1827 |
| 1296 | Ga0501084_0304654 | 3300054114 | Unclassified | 1346 |
| 1297 | Ga0590071_000323 | 3300059421 | Bacteria | 14020 |
| 1298 | Ga0590071_000383 | 3300059421 | Bacteria | 12985 |
| 1299 | Ga0590071_044840 | 3300059421 | Bacteria | 1066 |
| 1300 | Ga0590074_001430 | 3300059423 | Archaea | 3843 |
| 1301 | Ga0590074_002896 | 3300059423 | Bacteria | 2827 |
| 1302 | Ga0590074_051937 | 3300059423 | Bacteria | 751 |
| 1303 | Ga0590075_001130 | 3300059424 | Bacteria | 6804 |
| 1304 | Ga0590075_004204 | 3300059424 | Bacteria | 3408 |
| 1305 | Ga0590075_006947 | 3300059424 | Bacteria | 2683 |
| 1306 | Ga0590077_000447 | 3300059426 | Bacteria | 11582 |
| 1307 | Ga0590077_001312 | 3300059426 | Bacteria | 5889 |
| 1308 | Ga0501082_0002769 | 3300060353 | Bacteria | 15317 |
| 1309 | Ga0501082_0004326 | 3300060353 | Bacteria | 12419 |
| 1310 | Ga0501082_0005821 | 3300060353 | Bacteria | 10703 |
| 1311 | Ga0501082_0058612 | 3300060353 | Bacteria | 3318 |
| 1312 | Ga0501082_0113445 | 3300060353 | Unclassified | 2347 |
| 1313 | Ga0501082_1165767 | 3300060353 | Unclassified | 673 |
| 1314 | Ga0501082_1205394 | 3300060353 | Bacteria | 661 |
| 1315 | Ga0501082_1629906 | 3300060353 | Bacteria | 563 |
| 1316 | Ga0530510_0005346 | 3300061734 | Bacteria | 8881 |
| 1317 | Ga0530510_0007769 | 3300061734 | Bacteria | 7473 |
| 1318 | Ga0530510_0017603 | 3300061734 | Bacteria | 5064 |
| 1319 | Ga0530510_0426343 | 3300061734 | Bacteria | 1001 |
| 1320 | Ga0530510_0494733 | 3300061734 | Unclassified | 927 |
| 1321 | Ga0530510_0626915 | 3300061734 | Bacteria | 818 |
| 1322 | Ga0075430_100760279 | |||
| 1323 | SwRhRL2b_contig_3023099 | |||
| 1324 | JGI24751J29686_10023078 | |||
| 1325 | Ga0065714_10190167 | |||
| 1326 | Ga0065704_10260029 | |||
| 1327 | Ga0065704_10330377 | |||
| 1328 | Ga0065712_10086649 | |||
| 1329 | Ga0065712_10102157 | |||
| 1330 | Ga0065712_10173745 | |||
| 1331 | Ga0065712_10357194 | |||
| 1332 | Ga0065712_10494306 | |||
| 1333 | Ga0065712_10514004 | |||
| 1334 | Ga0065712_10634136 | |||
| 1335 | Ga0065715_10004432 | |||
| 1336 | Ga0065715_10010449 | |||
| 1337 | Ga0065715_10011976 | |||
| 1338 | Ga0065715_10044557 | |||
| 1339 | Ga0065715_10178075 | |||
| 1340 | Ga0065715_10181727 | |||
| 1341 | Ga0065715_10234929 | |||
| 1342 | Ga0065715_10394437 | |||
| 1343 | Ga0065715_10409966 | |||
| 1344 | Ga0065715_10518430 | |||
| 1345 | Ga0065715_10540265 | |||
| 1346 | Ga0065715_10802421 | |||
| 1347 | Ga0065707_10001222 | |||
| 1348 | Ga0065707_10097394 | |||
| 1349 | Ga0065707_10139415 | |||
| 1350 | Ga0065707_10270245 | |||
| 1351 | Ga0065707_10289629 | |||
| 1352 | Ga0065707_10495290 | |||
| 1353 | Ga0065707_10598064 | |||
| 1354 | Ga0065707_10820934 | |||
| 1355 | Ga0065707_10831921 | |||
| 1356 | Ga0065707_11140112 | |||
| 1357 | Ga0070658_10452761 | |||
| 1358 | Ga0070676_10351772 | |||
| 1359 | Ga0070676_11134892 | |||
| 1360 | Ga0070683_101029768 | |||
| 1361 | Ga0070683_101219873 | |||
| 1362 | Ga0070690_100237884 | |||
| 1363 | Ga0070690_100846487 | |||
| 1364 | Ga0070690_101050424 | |||
| 1365 | Ga0070670_100005174 | |||
| 1366 | Ga0070670_100110851 | |||
| 1367 | Ga0070670_100362387 | |||
| 1368 | Ga0070670_101012278 | |||
| 1369 | Ga0070670_101069563 | |||
| 1370 | Ga0070670_101241235 | |||
| 1371 | Ga0070670_101884098 | |||
| 1372 | Ga0068869_100139914 | |||
| 1373 | Ga0068869_100180058 | |||
| 1374 | Ga0068869_101056352 | |||
| 1375 | Ga0070666_10084179 | |||
| 1376 | Ga0070666_10235382 | |||
| 1377 | Ga0070666_10692876 | |||
| 1378 | Ga0070666_11071548 | |||
| 1379 | Ga0070666_11149221 | |||
| 1380 | Ga0070680_100067988 | |||
| 1381 | Ga0070680_100592833 | |||
| 1382 | Ga0070682_100795487 | |||
| 1383 | Ga0070682_101083481 | |||
| 1384 | Ga0068868_100152623 | |||
| 1385 | Ga0068868_100212789 | |||
| 1386 | Ga0068868_100457061 | |||
| 1387 | Ga0068868_100624357 | |||
| 1388 | Ga0068868_100844688 | |||
| 1389 | Ga0068868_101228066 | |||
| 1390 | Ga0070660_100088974 | |||
| 1391 | Ga0070660_101326667 | |||
| 1392 | Ga0070689_100023910 | |||
| 1393 | Ga0070689_100029886 | |||
| 1394 | Ga0070689_100054546 | |||
| 1395 | Ga0070689_100111034 | |||
| 1396 | Ga0070689_100224672 | |||
| 1397 | Ga0070689_100334348 | |||
| 1398 | Ga0070689_100763760 | |||
| 1399 | Ga0070689_101355183 | |||
| 1400 | Ga0070687_100065675 | |||
| 1401 | Ga0070687_100718685 | |||
| 1402 | Ga0070661_100422300 | |||
| 1403 | Ga0070661_100664349 | |||
| 1404 | Ga0070661_101820716 | |||
| 1405 | Ga0070668_100678674 | |||
| 1406 | Ga0070668_101193708 | |||
| 1407 | Ga0070669_100002308 | |||
| 1408 | Ga0070669_100065135 | |||
| 1409 | Ga0070669_100091616 | |||
| 1410 | Ga0070669_100096980 | |||
| 1411 | Ga0070669_100776668 | |||
| 1412 | Ga0070675_100000989 | |||
| 1413 | Ga0070675_100005827 | |||
| 1414 | Ga0070675_100012455 | |||
| 1415 | Ga0070675_100064513 | |||
| 1416 | Ga0070675_100147719 | |||
| 1417 | Ga0070675_100291937 | |||
| 1418 | Ga0070675_100374732 | |||
| 1419 | Ga0070675_100634928 | |||
| 1420 | Ga0070675_100776515 | |||
| 1421 | Ga0070675_100844622 | |||
| 1422 | Ga0070675_101000175 | |||
| 1423 | Ga0070675_101510478 | |||
| 1424 | Ga0070675_101731233 | |||
| 1425 | Ga0070671_100015045 | |||
| 1426 | Ga0070671_100090035 | |||
| 1427 | Ga0070671_100241651 | |||
| 1428 | Ga0070671_100499938 | |||
| 1429 | Ga0070674_100085088 | |||
| 1430 | Ga0070674_100107561 | |||
| 1431 | Ga0070674_100181202 | |||
| 1432 | Ga0070674_100270358 | |||
| 1433 | Ga0070674_100289242 | |||
| 1434 | Ga0070674_100406244 | |||
| 1435 | Ga0070674_100407910 | |||
| 1436 | Ga0070674_100580939 | |||
| 1437 | Ga0070674_100919978 | |||
| 1438 | Ga0070674_101699624 | |||
| 1439 | Ga0070673_100024982 | |||
| 1440 | Ga0070673_100109071 | |||
| 1441 | Ga0070673_100114268 | |||
| 1442 | Ga0070673_100137270 | |||
| 1443 | Ga0070673_100208876 | |||
| 1444 | Ga0070673_100210546 | |||
| 1445 | Ga0070673_100356077 | |||
| 1446 | Ga0070673_100589645 | |||
| 1447 | Ga0070673_100806413 | |||
| 1448 | Ga0070673_100836571 | |||
| 1449 | Ga0070673_101200973 | |||
| 1450 | Ga0070673_101289713 | |||
| 1451 | Ga0070688_100013495 | |||
| 1452 | Ga0070688_100020732 | |||
| 1453 | Ga0070688_100408219 | |||
| 1454 | Ga0070688_100582173 | |||
| 1455 | Ga0070688_100813149 | |||
| 1456 | Ga0070688_101582996 | |||
| 1457 | Ga0070659_100077856 | |||
| 1458 | Ga0070659_100231507 | |||
| 1459 | Ga0070667_100034553 | |||
| 1460 | Ga0070667_100745101 | |||
| 1461 | Ga0070667_100820297 | |||
| 1462 | Ga0070667_100835444 | |||
| 1463 | Ga0070703_10483894 | |||
| 1464 | Ga0070703_10584150 | |||
| 1465 | Ga0070714_100021632 | |||
| 1466 | Ga0070713_100124770 | |||
| 1467 | Ga0070701_10208997 | |||
| 1468 | Ga0070701_10537402 | |||
| 1469 | Ga0070701_11042001 | |||
| 1470 | Ga0070711_100108440 | |||
| 1471 | Ga0070711_100206434 | |||
| 1472 | Ga0070705_100020570 | |||
| 1473 | Ga0070700_100112623 | |||
| 1474 | Ga0070700_100784535 | |||
| 1475 | Ga0070700_101045687 | |||
| 1476 | Ga0070700_101973698 | |||
| 1477 | Ga0070694_100674030 | |||
| 1478 | Ga0070694_100782822 | |||
| 1479 | Ga0070694_101759657 | |||
| 1480 | Ga0070708_100018085 | |||
| 1481 | Ga0070708_100802331 | |||
| 1482 | Ga0070663_101957688 | |||
| 1483 | Ga0070678_100204765 | |||
| 1484 | Ga0070678_100325914 | |||
| 1485 | Ga0070662_100193973 | |||
| 1486 | Ga0070662_100280682 | |||
| 1487 | Ga0070662_100371078 | |||
| 1488 | Ga0070681_10054837 | |||
| 1489 | Ga0070681_10114167 | |||
| 1490 | Ga0070681_10308734 | |||
| 1491 | Ga0070681_10749730 | |||
| 1492 | Ga0068867_100040587 | |||
| 1493 | Ga0068867_100060208 | |||
| 1494 | Ga0068867_100114688 | |||
| 1495 | Ga0068867_100163456 | |||
| 1496 | Ga0068867_100368043 | |||
| 1497 | Ga0068867_100382297 | |||
| 1498 | Ga0068867_101406895 | |||
| 1499 | Ga0070706_100258443 | |||
| 1500 | Ga0070706_101118440 | |||
| 1501 | Ga0070707_100092032 | |||
| 1502 | Ga0070707_100100944 | |||
| 1503 | Ga0070698_100042393 | |||
| 1504 | Ga0070698_100134655 | |||
| 1505 | Ga0070698_100234806 | |||
| 1506 | Ga0070698_100363374 | |||
| 1507 | Ga0070698_100418039 | |||
| 1508 | Ga0070698_100492084 | |||
| 1509 | Ga0070698_100600502 | |||
| 1510 | Ga0070698_101092597 | |||
| 1511 | Ga0070699_100002960 | |||
| 1512 | Ga0070699_100018806 | |||
| 1513 | Ga0070699_100227465 | |||
| 1514 | Ga0070699_100260506 | |||
| 1515 | Ga0070699_100661335 | |||
| 1516 | Ga0070684_100336993 | |||
| 1517 | Ga0070684_100462717 | |||
| 1518 | Ga0070697_101040787 | |||
| 1519 | Ga0070697_101152447 | |||
| 1520 | Ga0070697_101720945 | |||
| 1521 | Ga0068853_100900402 | |||
| 1522 | Ga0068853_101063367 | |||
| 1523 | Ga0070672_100025684 | |||
| 1524 | Ga0070672_100037361 | |||
| 1525 | Ga0070672_100092239 | |||
| 1526 | Ga0070672_100095550 | |||
| 1527 | Ga0070672_100276065 | |||
| 1528 | Ga0070672_100545919 | |||
| 1529 | Ga0070672_100599232 | |||
| 1530 | Ga0070672_101546486 | |||
| 1531 | Ga0070686_100086162 | |||
| 1532 | Ga0070686_100090312 | |||
| 1533 | Ga0070686_100747916 | |||
| 1534 | Ga0070686_100789193 | |||
| 1535 | Ga0070686_101169470 | |||
| 1536 | Ga0070686_101579315 | |||
| 1537 | Ga0070695_100427358 | |||
| 1538 | Ga0070696_100089585 | |||
| 1539 | Ga0070696_100189590 | |||
| 1540 | Ga0070696_100419816 | |||
| 1541 | Ga0070693_100354425 | |||
| 1542 | Ga0070665_100004603 | |||
| 1543 | Ga0070665_100004694 | |||
| 1544 | Ga0070665_100393299 | |||
| 1545 | Ga0070665_100593501 | |||
| 1546 | Ga0070665_101373825 | |||
| 1547 | Ga0070665_101629694 | |||
| 1548 | Ga0070704_100048528 | |||
| 1549 | Ga0070704_100106327 | |||
| 1550 | Ga0070704_100112708 | |||
| 1551 | Ga0070704_100188372 | |||
| 1552 | Ga0070704_100532664 | |||
| 1553 | Ga0070704_100645465 | |||
| 1554 | Ga0070704_101054910 | |||
| 1555 | Ga0070704_101195745 | |||
| 1556 | Ga0068855_100317224 | |||
| 1557 | Ga0068855_100417110 | |||
| 1558 | Ga0068855_100548945 | |||
| 1559 | Ga0070664_100093691 | |||
| 1560 | Ga0070664_100190288 | |||
| 1561 | Ga0070664_100327664 | |||
| 1562 | Ga0070664_100376879 | |||
| 1563 | Ga0070664_100922968 | |||
| 1564 | Ga0070664_101300558 | |||
| 1565 | Ga0070664_101428728 | |||
| 1566 | Ga0068857_100120294 | |||
| 1567 | Ga0068857_100273805 | |||
| 1568 | Ga0068857_100282455 | |||
| 1569 | Ga0068854_100045407 | |||
| 1570 | Ga0068854_100315910 | |||
| 1571 | Ga0068854_100608306 | |||
| 1572 | Ga0068854_101226582 | |||
| 1573 | Ga0068856_100029560 | |||
| 1574 | Ga0068852_100747645 | |||
| 1575 | Ga0068859_100006650 | |||
| 1576 | Ga0068859_100010995 | |||
| 1577 | Ga0068859_100016721 | |||
| 1578 | Ga0068859_100033661 | |||
| 1579 | Ga0068859_100040915 | |||
| 1580 | Ga0068859_100262774 | |||
| 1581 | Ga0068859_100353283 | |||
| 1582 | Ga0068859_100660110 | |||
| 1583 | Ga0068859_100872203 | |||
| 1584 | Ga0068859_101043061 | |||
| 1585 | Ga0068859_101361207 | |||
| 1586 | Ga0068864_100006744 | |||
| 1587 | Ga0068864_100037683 | |||
| 1588 | Ga0068864_100068467 | |||
| 1589 | Ga0068864_100217109 | |||
| 1590 | Ga0068864_100296514 | |||
| 1591 | Ga0068864_100722607 | |||
| 1592 | Ga0068864_100753627 | |||
| 1593 | Ga0068864_100801305 | |||
| 1594 | Ga0068864_100966168 | |||
| 1595 | Ga0068864_100984181 | |||
| 1596 | Ga0068864_101349749 | |||
| 1597 | Ga0068864_101373962 | |||
| 1598 | Ga0068864_101444811 | |||
| 1599 | Ga0068866_10161044 | |||
| 1600 | Ga0068866_10241955 | |||
| 1601 | Ga0068861_100035400 | |||
| 1602 | Ga0068861_100038948 | |||
| 1603 | Ga0068861_100068019 | |||
| 1604 | Ga0068861_100141211 | |||
| 1605 | Ga0068861_100701206 | |||
| 1606 | Ga0068870_10122810 | |||
| 1607 | Ga0068870_10167827 | |||
| 1608 | Ga0068863_100100824 | |||
| 1609 | Ga0068863_100129691 | |||
| 1610 | Ga0068863_100386657 | |||
| 1611 | Ga0068863_100504161 | |||
| 1612 | Ga0068863_100805509 | |||
| 1613 | Ga0068863_101004048 | |||
| 1614 | Ga0068863_101553581 | |||
| 1615 | Ga0068863_101597306 | |||
| 1616 | Ga0068863_101694883 | |||
| 1617 | Ga0068858_100009891 | |||
| 1618 | Ga0068858_100017373 | |||
| 1619 | Ga0068858_100018327 | |||
| 1620 | Ga0068858_100050398 | |||
| 1621 | Ga0068858_100171988 | |||
| 1622 | Ga0068858_100174856 | |||
| 1623 | Ga0068858_100234027 | |||
| 1624 | Ga0068858_100303932 | |||
| 1625 | Ga0068858_100475550 | |||
| 1626 | Ga0068858_100737980 | |||
| 1627 | Ga0068858_101111667 | |||
| 1628 | Ga0068860_100045085 | |||
| 1629 | Ga0068860_100049311 | |||
| 1630 | Ga0068860_100123829 | |||
| 1631 | Ga0068860_100208993 | |||
| 1632 | Ga0068860_100296913 | |||
| 1633 | Ga0068860_100331209 | |||
| 1634 | Ga0068860_100460644 | |||
| 1635 | Ga0068860_100709335 | |||
| 1636 | Ga0068860_100892177 | |||
| 1637 | Ga0068860_101676895 | |||
| 1638 | Ga0068862_100031034 | |||
| 1639 | Ga0068862_100130226 | |||
| 1640 | Ga0068862_100197169 | |||
| 1641 | Ga0068862_100270982 | |||
| 1642 | Ga0068862_100348318 | |||
| 1643 | Ga0068862_100361024 | |||
| 1644 | Ga0068862_101026330 | |||
| 1645 | Ga0068862_101238439 | |||
| 1646 | Ga0068862_102342245 | |||
| 1647 | Ga0081455_10073933 | |||
| 1648 | Ga0081455_10143568 | |||
| 1649 | Ga0081455_10935634 | |||
| 1650 | Ga0081538_10089024 | |||
| 1651 | Ga0081540_1131278 | |||
| 1652 | Ga0081539_10005511 | |||
| 1653 | Ga0081539_10012425 | |||
| 1654 | Ga0075365_10001292 | |||
| 1655 | Ga0075365_10031345 | |||
| 1656 | Ga0075368_10053118 | |||
| 1657 | Ga0075432_10154764 | |||
| 1658 | Ga0075432_10486986 | |||
| 1659 | Ga0075362_10002509 | |||
| 1660 | Ga0075367_10077261 | |||
| 1661 | Ga0075366_10030120 | |||
| 1662 | Ga0075366_10622058 | |||
| 1663 | Ga0097621_100000311 | |||
| 1664 | Ga0097621_100005974 | |||
| 1665 | Ga0097621_100026008 | |||
| 1666 | Ga0097621_100073417 | |||
| 1667 | Ga0097621_100410502 | |||
| 1668 | Ga0097621_101300904 | |||
| 1669 | Ga0075370_10005334 | |||
| 1670 | Ga0068871_100144209 | |||
| 1671 | Ga0068871_100179641 | |||
| 1672 | Ga0068871_100396093 | |||
| 1673 | Ga0068871_101466697 | |||
| 1674 | Ga0068871_101679798 | |||
| 1675 | Ga0075428_100000005 | |||
| 1676 | Ga0075428_100000851 | |||
| 1677 | Ga0075428_100009166 | |||
| 1678 | Ga0075428_100019035 | |||
| 1679 | Ga0075428_100258352 | |||
| 1680 | Ga0075428_100500413 | |||
| 1681 | Ga0075428_100632487 | |||
| 1682 | Ga0075428_100819988 | |||
| 1683 | Ga0075428_101346586 | |||
| 1684 | Ga0075428_101909878 | |||
| 1685 | Ga0075430_100007631 | |||
| 1686 | Ga0075430_100403309 | |||
| 1687 | Ga0075430_100585307 | |||
| 1688 | Ga0075430_100734311 | |||
| 1689 | Ga0075431_100010122 | |||
| 1690 | Ga0075431_100045601 | |||
| 1691 | Ga0075431_100279584 | |||
| 1692 | Ga0075431_100825345 | |||
| 1693 | Ga0075431_100893755 | |||
| 1694 | Ga0075433_10115554 | |||
| 1695 | Ga0075433_10168251 | |||
| 1696 | Ga0075433_10462394 | |||
| 1697 | Ga0075433_10683091 | |||
| 1698 | Ga0075433_10898318 | |||
| 1699 | Ga0075434_100000100 | |||
| 1700 | Ga0075434_100005346 | |||
| 1701 | Ga0075434_100006986 | |||
| 1702 | Ga0075434_100035602 | |||
| 1703 | Ga0075434_100059471 | |||
| 1704 | Ga0075434_100093964 | |||
| 1705 | Ga0075434_100220750 | |||
| 1706 | Ga0075434_100224413 | |||
| 1707 | Ga0075434_100297183 | |||
| 1708 | Ga0075434_100305819 | |||
| 1709 | Ga0075434_100312196 | |||
| 1710 | Ga0075434_100327700 | |||
| 1711 | Ga0075434_100858889 | |||
| 1712 | Ga0075429_100041010 | |||
| 1713 | Ga0075429_100066141 | |||
| 1714 | Ga0075429_100124549 | |||
| 1715 | Ga0075429_100648981 | |||
| 1716 | Ga0075429_100909848 | |||
| 1717 | Ga0068865_100020075 | |||
| 1718 | Ga0068865_100135105 | |||
| 1719 | Ga0068865_100173035 | |||
| 1720 | Ga0068865_100202402 | |||
| 1721 | Ga0068865_100263283 | |||
| 1722 | Ga0068865_100524565 | |||
| 1723 | Ga0068865_100697576 | |||
| 1724 | Ga0075436_100004798 | |||
| 1725 | Ga0075436_100008051 | |||
| 1726 | Ga0075436_100019171 | |||
| 1727 | Ga0075436_100221564 | |||
| 1728 | Ga0075436_100445405 | |||
| 1729 | Ga0075436_100642200 | |||
| 1730 | Ga0097620_100006650 | |||
| 1731 | Ga0097620_100010995 | |||
| 1732 | Ga0097620_100016722 | |||
| 1733 | Ga0097620_100033660 | |||
| 1734 | Ga0097620_100040914 | |||
| 1735 | Ga0097620_100262766 | |||
| 1736 | Ga0097620_100353271 | |||
| 1737 | Ga0097620_100649024 | |||
| 1738 | Ga0097620_100660116 | |||
| 1739 | Ga0097620_100872232 | |||
| 1740 | Ga0097620_101043080 | |||
| 1741 | Ga0097620_101361187 | |||
| 1742 | Ga0075435_100000331 | |||
| 1743 | Ga0075435_100030565 | |||
| 1744 | Ga0075435_100048025 | |||
| 1745 | Ga0075435_100049734 | |||
| 1746 | Ga0075435_100069393 | |||
| 1747 | Ga0075435_100475556 | |||
| 1748 | Ga0105240_10011023 | |||
| 1749 | Ga0105240_10017877 | |||
| 1750 | Ga0105240_10319230 | |||
| 1751 | Ga0105240_10441524 | |||
| 1752 | Ga0105240_11684889 | |||
| 1753 | Ga0105240_11991655 | |||
| 1754 | Ga0111539_10000008 | |||
| 1755 | Ga0111539_10001186 | |||
| 1756 | Ga0111539_10002921 | |||
| 1757 | Ga0111539_10030999 | |||
| 1758 | Ga0111539_10077549 | |||
| 1759 | Ga0111539_10182406 | |||
| 1760 | Ga0111539_10245541 | |||
| 1761 | Ga0111539_10372491 | |||
| 1762 | Ga0111539_10819144 | |||
| 1763 | Ga0111539_12553316 | |||
| 1764 | Ga0105245_10132956 | |||
| 1765 | Ga0105245_10542804 | |||
| 1766 | Ga0105245_10611582 | |||
| 1767 | Ga0105245_11193448 | |||
| 1768 | Ga0105245_11671785 | |||
| 1769 | Ga0105247_10006975 | |||
| 1770 | Ga0105247_10031087 | |||
| 1771 | Ga0105247_11032607 | |||
| 1772 | Ga0114129_10000400 | |||
| 1773 | Ga0114129_10000838 | |||
| 1774 | Ga0114129_10001577 | |||
| 1775 | Ga0114129_10004637 | |||
| 1776 | Ga0114129_10020702 | |||
| 1777 | Ga0114129_10020934 | |||
| 1778 | Ga0114129_10065380 | |||
| 1779 | Ga0114129_10105753 | |||
| 1780 | Ga0114129_10275178 | |||
| 1781 | Ga0114129_10378548 | |||
| 1782 | Ga0114129_10680988 | |||
| 1783 | Ga0114129_11981239 | |||
| 1784 | Ga0105243_10186707 | |||
| 1785 | Ga0105243_10568824 | |||
| 1786 | Ga0105243_10586285 | |||
| 1787 | Ga0105243_10595911 | |||
| 1788 | Ga0105243_10981246 | |||
| 1789 | Ga0105243_11252760 | |||
| 1790 | Ga0105241_10494187 | |||
| 1791 | Ga0105242_10001523 | |||
| 1792 | Ga0105242_10055437 | |||
| 1793 | Ga0105242_10630268 | |||
| 1794 | Ga0105242_12003643 | |||
| 1795 | Ga0105242_12018753 | |||
| 1796 | Ga0105248_10001706 | |||
| 1797 | Ga0105248_10005355 | |||
| 1798 | Ga0105248_10010754 | |||
| 1799 | Ga0105248_10085272 | |||
| 1800 | Ga0105248_10300953 | |||
| 1801 | Ga0105248_10370092 | |||
| 1802 | Ga0105248_10844487 | |||
| 1803 | Ga0105248_10878137 | |||
| 1804 | Ga0105248_11834957 | |||
| 1805 | Ga0105248_11972342 | |||
| 1806 | Ga0105248_12213345 | |||
| 1807 | Ga0105248_12640518 | |||
| 1808 | Ga0105237_11314447 | |||
| 1809 | Ga0105238_11156678 | |||
| 1810 | Ga0105238_11899387 | |||
| 1811 | Ga0105238_12891733 | |||
| 1812 | Ga0105249_10001419 | |||
| 1813 | Ga0105249_10116965 | |||
| 1814 | Ga0105249_10204794 | |||
| 1815 | Ga0105249_10402101 | |||
| 1816 | Ga0105249_10642906 | |||
| 1817 | Ga0105249_11056935 | |||
| 1818 | Ga0105249_11511920 | |||
| 1819 | Ga0105249_12249139 | |||
| 1820 | Ga0105249_12604252 | |||
| 1821 | Ga0105239_11685121 | |||
| 1822 | Ga0105246_10263836 | |||
| 1823 | Ga0105246_10819432 | |||
| 1824 | Ga0105246_10822871 | |||
| 1825 | Ga0105246_12549415 | |||
| 1826 | Ga0157374_10294654 | |||
| 1827 | Ga0157374_10584262 | |||
| 1828 | Ga0157374_10936792 | |||
| 1829 | Ga0157374_12573799 | |||
| 1830 | Ga0157378_10012868 | |||
| 1831 | Ga0157378_10145237 | |||
| 1832 | Ga0157378_10668301 | |||
| 1833 | Ga0157378_11312605 | |||
| 1834 | Ga0157378_12014014 | |||
| 1835 | Ga0163162_10027728 | |||
| 1836 | Ga0163162_10057953 | |||
| 1837 | Ga0163162_10058381 | |||
| 1838 | Ga0163162_10155868 | |||
| 1839 | Ga0163162_10982924 | |||
| 1840 | Ga0163162_12670817 | |||
| 1841 | Ga0157372_10406575 | |||
| 1842 | Ga0157372_11219095 | |||
| 1843 | Ga0157375_10428795 | |||
| 1844 | Ga0157375_10661649 | |||
| 1845 | Ga0157375_12016338 | |||
| 1846 | Ga0163163_10035628 | |||
| 1847 | Ga0163163_10069546 | |||
| 1848 | Ga0163163_10253132 | |||
| 1849 | Ga0163163_10739097 | |||
| 1850 | Ga0163163_11117107 | |||
| 1851 | Ga0163163_11265048 | |||
| 1852 | Ga0163163_11715530 | |||
| 1853 | Ga0163163_11721442 | |||
| 1854 | Ga0163163_13032003 | |||
| 1855 | Ga0157380_10023337 | |||
| 1856 | Ga0157380_10038456 | |||
| 1857 | Ga0157380_10052758 | |||
| 1858 | Ga0157380_10104819 | |||
| 1859 | Ga0157380_10105407 | |||
| 1860 | Ga0157380_10246235 | |||
| 1861 | Ga0157380_10468809 | |||
| 1862 | Ga0157380_10474257 | |||
| 1863 | Ga0157380_11735220 | |||
| 1864 | Ga0157380_12225176 | |||
| 1865 | Ga0157380_12804311 | |||
| 1866 | Ga0157380_13053244 | |||
| 1867 | Ga0182008_10385515 | |||
| 1868 | Ga0157377_10060159 | |||
| 1869 | Ga0157377_10066967 | |||
| 1870 | Ga0157377_10900272 | |||
| 1871 | Ga0157379_10018828 | |||
| 1872 | Ga0157379_10023414 | |||
| 1873 | Ga0157379_10053971 | |||
| 1874 | Ga0157379_10085207 | |||
| 1875 | Ga0157379_10103023 | |||
| 1876 | Ga0157379_10279552 | |||
| 1877 | Ga0157379_10555009 | |||
| 1878 | Ga0157379_12490678 | |||
| 1879 | Ga0157376_10035193 | |||
| 1880 | Ga0157376_10093674 | |||
| 1881 | Ga0157376_10101508 | |||
| 1882 | Ga0157376_10110540 | |||
| 1883 | Ga0157376_10144886 | |||
| 1884 | Ga0157376_10155945 | |||
| 1885 | Ga0157376_10491501 | |||
| 1886 | Ga0157376_10524809 | |||
| 1887 | Ga0157376_10841393 | |||
| 1888 | Ga0157376_10871128 | |||
| 1889 | Ga0213876_10099095 | |||
| 1890 | Ga0207697_10146373 | |||
| 1891 | Ga0207697_10387909 | |||
| 1892 | Ga0207656_10307444 | |||
| 1893 | Ga0207653_10427078 | |||
| 1894 | Ga0207682_10204452 | |||
| 1895 | Ga0207682_10241341 | |||
| 1896 | Ga0207682_10340431 | |||
| 1897 | Ga0207642_10433376 | |||
| 1898 | Ga0207710_10018656 | |||
| 1899 | Ga0207688_10139727 | |||
| 1900 | Ga0207688_10165205 | |||
| 1901 | Ga0207680_10074175 | |||
| 1902 | Ga0207680_10219149 | |||
| 1903 | Ga0207685_10473296 | |||
| 1904 | Ga0207645_10007032 | |||
| 1905 | Ga0207645_10241598 | |||
| 1906 | Ga0207645_10298403 | |||
| 1907 | Ga0207645_10708997 | |||
| 1908 | Ga0207643_10179767 | |||
| 1909 | Ga0207643_10295073 | |||
| 1910 | Ga0207643_10490705 | |||
| 1911 | Ga0207705_10366941 | |||
| 1912 | Ga0207684_10578089 | |||
| 1913 | Ga0207684_11283825 | |||
| 1914 | Ga0207684_11478311 | |||
| 1915 | Ga0207707_10101625 | |||
| 1916 | Ga0207707_10342208 | |||
| 1917 | Ga0207707_10744701 | |||
| 1918 | Ga0207695_10266631 | |||
| 1919 | Ga0207663_10340881 | |||
| 1920 | Ga0207663_10649457 | |||
| 1921 | Ga0207660_10335728 | |||
| 1922 | Ga0207660_10480761 | |||
| 1923 | Ga0207662_10075720 | |||
| 1924 | Ga0207662_10641784 | |||
| 1925 | Ga0207657_10054439 | |||
| 1926 | Ga0207657_10487266 | |||
| 1927 | Ga0207649_10474500 | |||
| 1928 | Ga0207649_10757569 | |||
| 1929 | Ga0207649_10945549 | |||
| 1930 | Ga0207646_10160673 | |||
| 1931 | Ga0207646_10422637 | |||
| 1932 | Ga0207646_10850615 | |||
| 1933 | Ga0207681_10003552 | |||
| 1934 | Ga0207681_10004545 | |||
| 1935 | Ga0207681_10053851 | |||
| 1936 | Ga0207681_10124660 | |||
| 1937 | Ga0207681_10351284 | |||
| 1938 | Ga0207681_10950159 | |||
| 1939 | Ga0207681_11210951 | |||
| 1940 | Ga0207694_10872727 | |||
| 1941 | Ga0207694_11222511 | |||
| 1942 | Ga0207650_10010310 | |||
| 1943 | Ga0207650_10106326 | |||
| 1944 | Ga0207650_10266920 | |||
| 1945 | Ga0207650_10358349 | |||
| 1946 | Ga0207650_10525190 | |||
| 1947 | Ga0207650_10767857 | |||
| 1948 | Ga0207659_10000551 | |||
| 1949 | Ga0207659_10008009 | |||
| 1950 | Ga0207659_10079852 | |||
| 1951 | Ga0207659_10100238 | |||
| 1952 | Ga0207659_10187458 | |||
| 1953 | Ga0207659_10237437 | |||
| 1954 | Ga0207659_10940491 | |||
| 1955 | Ga0207659_11107691 | |||
| 1956 | Ga0207687_10026547 | |||
| 1957 | Ga0207687_10113674 | |||
| 1958 | Ga0207687_10187553 | |||
| 1959 | Ga0207700_10291075 | |||
| 1960 | Ga0207700_10589832 | |||
| 1961 | Ga0207664_10371616 | |||
| 1962 | Ga0207644_10410964 | |||
| 1963 | Ga0207644_10467044 | |||
| 1964 | Ga0207644_11354940 | |||
| 1965 | Ga0207690_10117788 | |||
| 1966 | Ga0207690_11112236 | |||
| 1967 | Ga0207690_11168056 | |||
| 1968 | Ga0207706_10036844 | |||
| 1969 | Ga0207706_10046633 | |||
| 1970 | Ga0207706_10271689 | |||
| 1971 | Ga0207706_10293746 | |||
| 1972 | Ga0207706_10428644 | |||
| 1973 | Ga0207706_10785120 | |||
| 1974 | Ga0207686_10003296 | |||
| 1975 | Ga0207686_10778435 | |||
| 1976 | Ga0207686_11040519 | |||
| 1977 | Ga0207709_11280052 | |||
| 1978 | Ga0207670_10020281 | |||
| 1979 | Ga0207670_10135539 | |||
| 1980 | Ga0207670_10234310 | |||
| 1981 | Ga0207670_10295059 | |||
| 1982 | Ga0207670_10324177 | |||
| 1983 | Ga0207669_10175292 | |||
| 1984 | Ga0207669_10364579 | |||
| 1985 | Ga0207669_10609088 | |||
| 1986 | Ga0207669_11189429 | |||
| 1987 | Ga0207704_10087234 | |||
| 1988 | Ga0207704_10218098 | |||
| 1989 | Ga0207704_10317138 | |||
| 1990 | Ga0207704_10374501 | |||
| 1991 | Ga0207704_10495018 | |||
| 1992 | Ga0207704_10519726 | |||
| 1993 | Ga0207704_10814577 | |||
| 1994 | Ga0207704_11041950 | |||
| 1995 | Ga0207704_11888507 | |||
| 1996 | Ga0207691_10027293 | |||
| 1997 | Ga0207691_10041509 | |||
| 1998 | Ga0207691_10131759 | |||
| 1999 | Ga0207691_10207072 | |||
| 2000 | Ga0207691_10251096 | |||
| 2001 | Ga0207691_10480300 | |||
| 2002 | Ga0207691_10858991 | |||
| 2003 | Ga0207711_10038345 | |||
| 2004 | Ga0207711_10075899 | |||
| 2005 | Ga0207711_10125143 | |||
| 2006 | Ga0207711_10170397 | |||
| 2007 | Ga0207711_10207667 | |||
| 2008 | Ga0207711_10211484 | |||
| 2009 | Ga0207711_10846672 | |||
| 2010 | Ga0207711_10883483 | |||
| 2011 | Ga0207711_11289367 | |||
| 2012 | Ga0207689_10140887 | |||
| 2013 | Ga0207689_10194601 | |||
| 2014 | Ga0207689_10875500 | |||
| 2015 | Ga0207661_10495080 | |||
| 2016 | Ga0207661_10766593 | |||
| 2017 | Ga0207661_10950984 | |||
| 2018 | Ga0207661_11814421 | |||
| 2019 | Ga0207679_10008413 | |||
| 2020 | Ga0207679_10042386 | |||
| 2021 | Ga0207679_10103165 | |||
| 2022 | Ga0207679_10329105 | |||
| 2023 | Ga0207679_10861176 | |||
| 2024 | Ga0207679_11312183 | |||
| 2025 | Ga0207651_10036285 | |||
| 2026 | Ga0207651_10058516 | |||
| 2027 | Ga0207651_10188160 | |||
| 2028 | Ga0207651_10193030 | |||
| 2029 | Ga0207651_10379928 | |||
| 2030 | Ga0207651_10872331 | |||
| 2031 | Ga0207651_10877676 | |||
| 2032 | Ga0207651_10899924 | |||
| 2033 | Ga0207651_10978502 | |||
| 2034 | Ga0207651_11679854 | |||
| 2035 | Ga0207651_11760642 | |||
| 2036 | Ga0207712_10003730 | |||
| 2037 | Ga0207712_10085733 | |||
| 2038 | Ga0207712_10272308 | |||
| 2039 | Ga0207712_11075473 | |||
| 2040 | Ga0207712_11488442 | |||
| 2041 | Ga0207712_11687605 | |||
| 2042 | Ga0207712_11711453 | |||
| 2043 | Ga0207712_11816399 | |||
| 2044 | Ga0207668_10258915 | |||
| 2045 | Ga0207668_10688105 | |||
| 2046 | Ga0207668_10795637 | |||
| 2047 | Ga0207668_11149614 | |||
| 2048 | Ga0207668_11256914 | |||
| 2049 | Ga0207640_10642785 | |||
| 2050 | Ga0207640_10728813 | |||
| 2051 | Ga0207658_10696665 | |||
| 2052 | Ga0207658_10871705 | |||
| 2053 | Ga0207677_10234078 | |||
| 2054 | Ga0207677_10253855 | |||
| 2055 | Ga0207677_10346929 | |||
| 2056 | Ga0207677_10381788 | |||
| 2057 | Ga0207677_11044938 | |||
| 2058 | Ga0207703_10008188 | |||
| 2059 | Ga0207703_10012180 | |||
| 2060 | Ga0207703_10029210 | |||
| 2061 | Ga0207703_10039807 | |||
| 2062 | Ga0207703_10064474 | |||
| 2063 | Ga0207703_10070888 | |||
| 2064 | Ga0207703_10226609 | |||
| 2065 | Ga0207703_10339023 | |||
| 2066 | Ga0207703_10364113 | |||
| 2067 | Ga0207703_10403481 | |||
| 2068 | Ga0207703_11146254 | |||
| 2069 | Ga0207703_11635603 | |||
| 2070 | Ga0207708_10045210 | |||
| 2071 | Ga0207708_10129089 | |||
| 2072 | Ga0207708_10305080 | |||
| 2073 | Ga0207708_10483081 | |||
| 2074 | Ga0207708_11441631 | |||
| 2075 | Ga0207641_10000870 | |||
| 2076 | Ga0207641_10229650 | |||
| 2077 | Ga0207641_10282738 | |||
| 2078 | Ga0207641_11454561 | |||
| 2079 | Ga0207641_11687796 | |||
| 2080 | Ga0207641_11998538 | |||
| 2081 | Ga0207648_10087220 | |||
| 2082 | Ga0207648_10109062 | |||
| 2083 | Ga0207648_10191408 | |||
| 2084 | Ga0207648_10309995 | |||
| 2085 | Ga0207648_10313854 | |||
| 2086 | Ga0207648_10729605 | |||
| 2087 | Ga0207676_10029017 | |||
| 2088 | Ga0207676_10035117 | |||
| 2089 | Ga0207676_10057968 | |||
| 2090 | Ga0207676_10108348 | |||
| 2091 | Ga0207676_10114972 | |||
| 2092 | Ga0207676_10667595 | |||
| 2093 | Ga0207676_10711038 | |||
| 2094 | Ga0207676_11091115 | |||
| 2095 | Ga0207676_11370384 | |||
| 2096 | Ga0207674_10025294 | |||
| 2097 | Ga0207674_10137399 | |||
| 2098 | Ga0207674_10190553 | |||
| 2099 | Ga0207674_10208954 | |||
| 2100 | Ga0207674_10286060 | |||
| 2101 | Ga0207674_10358896 | |||
| 2102 | Ga0207674_10438021 | |||
| 2103 | Ga0207674_12177257 | |||
| 2104 | Ga0207675_100013772 | |||
| 2105 | Ga0207675_100078355 | |||
| 2106 | Ga0207675_100102740 | |||
| 2107 | Ga0207675_100120091 | |||
| 2108 | Ga0207675_100740624 | |||
| 2109 | Ga0207675_101898840 | |||
| 2110 | Ga0207683_10174715 | |||
| 2111 | Ga0207683_10675976 | |||
| 2112 | Ga0207683_11084622 | |||
| 2113 | Ga0207698_10152876 | |||
| 2114 | Ga0209967_1075890 | |||
| 2115 | Ga0209996_1073003 | |||
| 2116 | Ga0209984_1018079 | |||
| 2117 | Ga0209995_1084245 | |||
| 2118 | Ga0209982_1052861 | |||
| 2119 | Ga0209971_1098282 | |||
| 2120 | Ga0209813_10081112 | |||
| 2121 | Ga0209813_10189281 | |||
| 2122 | Ga0209974_10202301 | |||
| 2123 | Ga0209974_10294721 | |||
| 2124 | Ga0207428_10000019 | |||
| 2125 | Ga0207428_10020095 | |||
| 2126 | Ga0207428_10070323 | |||
| 2127 | Ga0207428_10246482 | |||
| 2128 | Ga0207428_11128023 | |||
| 2129 | Ga0268266_10004395 | |||
| 2130 | Ga0268266_10592919 | |||
| 2131 | Ga0268266_10596332 | |||
| 2132 | Ga0268266_10706403 | |||
| 2133 | Ga0268265_10012711 | |||
| 2134 | Ga0268265_10120408 | |||
| 2135 | Ga0268265_10176317 | |||
| 2136 | Ga0268265_10184182 | |||
| 2137 | Ga0268265_10274191 | |||
| 2138 | Ga0268265_10476611 | |||
| 2139 | Ga0268265_10665384 | |||
| 2140 | Ga0268265_10711773 | |||
| 2141 | Ga0268265_10781561 | |||
| 2142 | Ga0268265_12112085 | |||
| 2143 | Ga0268265_12450852 | |||
| 2144 | Ga0268264_10006095 | |||
| 2145 | Ga0268264_10017943 | |||
| 2146 | Ga0268264_10137213 | |||
| 2147 | Ga0268264_10143001 | |||
| 2148 | Ga0268264_10178563 | |||
| 2149 | Ga0268264_10189657 | |||
| 2150 | Ga0268264_10620675 | |||
| 2151 | Ga0268264_10640898 | |||
| 2152 | Ga0268264_10790228 | |||
| 2153 | Ga0268264_11321524 | |||
| 2154 | Ga0268264_11715637 | |||
| 2155 | Ga0265336_10035718 | |||
| 2156 | Ga0265760_10362700 | |||
| 2157 | Ga0265332_10120633 | |||
| 2158 | Ga0307408_100065517 | |||
| 2159 | Ga0307408_100179444 | |||
| 2160 | Ga0307408_101092837 | |||
| 2161 | Ga0316576_10269286 | |||
| 2162 | Ga0307405_10038358 | |||
| 2163 | Ga0316577_10136076 | |||
| 2164 | Ga0307413_10040136 | |||
| 2165 | Ga0307413_10186322 | |||
| 2166 | Ga0307413_10441683 | |||
| 2167 | Ga0307413_10828484 | |||
| 2168 | Ga0307410_10053257 | |||
| 2169 | Ga0307410_10341717 | |||
| 2170 | Ga0307410_10539591 | |||
| 2171 | Ga0307406_10018003 | |||
| 2172 | Ga0307406_10337112 | |||
| 2173 | Ga0307407_10066595 | |||
| 2174 | Ga0307407_10211306 | |||
| 2175 | Ga0307407_10425577 | |||
| 2176 | Ga0307407_10596183 | |||
| 2177 | Ga0307412_10183382 | |||
| 2178 | Ga0307409_100020350 | |||
| 2179 | Ga0307409_100023967 | |||
| 2180 | Ga0307409_100171933 | |||
| 2181 | Ga0307416_100012809 | |||
| 2182 | Ga0307416_100090503 | |||
| 2183 | Ga0307416_100218716 | |||
| 2184 | Ga0307416_100231347 | |||
| 2185 | Ga0307416_100861562 | |||
| 2186 | Ga0307416_101424418 | |||
| 2187 | Ga0307414_10024816 | |||
| 2188 | Ga0307414_10369816 | |||
| 2189 | Ga0307411_10005331 | |||
| 2190 | Ga0307411_10046022 | |||
| 2191 | Ga0307411_10132215 | |||
| 2192 | Ga0307411_10660541 | |||
| 2193 | Ga0307411_11984734 | |||
| 2194 | Ga0307415_100013552 | |||
| 2195 | Ga0307415_100242862 | |||
| 2196 | Ga0307415_101847850 | |||
| 2197 | Ga0373926_0018883 | |||
| 2198 | Ga0373929_0023898 | |||
| 2199 | Ga0373944_0087735 | |||
| 2200 | Ga0373952_0091338 | |||
| 2201 | Ga0373923_0214700 | |||
| 2202 | Ga0373923_0550286 | |||
| 2203 | Ga0373923_0552731 | |||
| 2204 | Ga0373932_0139623 | |||
| 2205 | Ga0373941_0103644 | |||
| 2206 | Ga0373945_0141906 | |||
| 2207 | Ga0373945_0482240 | |||
| 2208 | Ga0373954_0235731 | |||
| 2209 | Ga0373954_0523351 | |||
| 2210 | Ga0373956_0209873 | |||
| 2211 | Ga0373957_0183606 | |||
| 2212 | Ga0373960_0351598 | |||
| 2213 | Ga0373943_0049040 | |||
| 2214 | Ga0373943_0063416 | |||
| 2215 | Ga0373943_0108379 | |||
| 2216 | Ga0373943_0237443 | |||
| 2217 | Ga0373943_0666238 | |||
| 2218 | Ga0373946_0001686 | |||
| 2219 | Ga0373946_0019190 | |||
| 2220 | Ga0373955_0217033 | |||
| 2221 | Ga0373942_0144767 | |||
| 2222 | Ga0373962_0030970 | |||
| 2223 | Ga0373924_0022655 | |||
| 2224 | Ga0373924_0249464 | |||
| 2225 | Ga0373924_0313492 | |||
| 2226 | Ga0373931_0592242 | |||
| 2227 | Ga0373931_0883496 | |||
| 2228 | Ga0373935_0018765 | |||
| 2229 | Ga0373935_0018774 | |||
| 2230 | Ga0373927_0231473 | |||
| 2231 | Ga0373933_0261070 | |||
| 2232 | Ga0373947_0005679 | |||
| 2233 | Ga0373947_0010429 | |||
| 2234 | Ga0373947_0127166 | |||
| 2235 | Ga0373947_0674237 | |||
| 2236 | Ga0373947_1066884 | |||
| 2237 | Ga0373937_0663330 | |||
| 2238 | Ga0373937_1242274 | |||
| 2239 | Ga0316584_0368712 | |||
| 2240 | Ga0373925_0000987 | |||
| 2241 | Ga0373925_0014754 | |||
| 2242 | Ga0373925_0498410 | |||
| 2243 | Ga0373925_0510968 | |||
| 2244 | Ga0395905_0241486 | |||
| 2245 | Ga0395901_1129428 | |||
| 2246 | Ga0436365_0256694 | |||
| 2247 | Ga0436363_1582334 | |||
| 2248 | Ga0439461_0129655 | |||
| 2249 | Ga0439461_0234007 | |||
| 2250 | Ga0451798_0080327 | |||
| 2251 | Ga0451802_0699190 | |||
| 2252 | Ga0451802_1975399 | |||
| 2253 | Ga0451804_0215498 | |||
| 2254 | Ga0451839_1351758 | |||
| 2255 | Ga0451845_0825720 | |||
| 2256 | Ga0451853_2015740 | |||
| 2257 | Ga0439431_0018699 | |||
| 2258 | Ga0439431_0050025 | |||
| 2259 | Ga0439433_0101915 | |||
| 2260 | Ga0439433_0209430 | |||
| 2261 | Ga0439433_0213788 | |||
| 2262 | Ga0439443_055284 | |||
| 2263 | Ga0439445_0025091 | |||
| 2264 | Ga0439449_0118144 | |||
| 2265 | Ga0439462_0036802 | |||
| 2266 | Ga0439462_0062800 | |||
| 2267 | Ga0450917_002928 | |||
| 2268 | Ga0439446_0056985 | |||
| 2269 | Ga0439446_0084737 | |||
| 2270 | Ga0439446_0339473 | |||
| 2271 | Ga0439434_0046095 | |||
| 2272 | Ga0439434_0233509 | |||
| 2273 | Ga0439435_0194406 | |||
| 2274 | Ga0439435_0298489 | |||
| 2275 | Ga0439444_0171278 | |||
| 2276 | Ga0439464_0110888 | |||
| 2277 | Ga0439464_0121513 | |||
| 2278 | Ga0439460_0005471 | |||
| 2279 | Ga0439460_0231045 | |||
| 2280 | Ga0439460_0332249 | |||
| 2281 | Ga0450916_001470 | |||
| 2282 | Ga0450893_0039750 | |||
| 2283 | Ga0451577_1000582 | |||
| 2284 | Ga0439440_0273387 | |||
| 2285 | Ga0466960_0480519 | |||
| 2286 | Ga0451576_1333906 | |||
| 2287 | Ga0495592_0098588 | |||
| 2288 | Ga0495629_0205444 | |||
| 2289 | Ga0495651_0361194 | |||
| 2290 | Ga0495651_0365980 | |||
| 2291 | Ga0495651_0457010 | |||
| 2292 | Ga0495653_0168896 | |||
| 2293 | Ga0495580_0034457 | |||
| 2294 | Ga0495580_1004569 | |||
| 2295 | Ga0495582_0319076 | |||
| 2296 | Ga0495639_0530664 | |||
| 2297 | Ga0495639_0653158 | |||
| 2298 | Ga0495584_0247788 | |||
| 2299 | Ga0495594_0631587 | |||
| 2300 | Ga0495594_0804413 | |||
| 2301 | Ga0495608_0016616 | |||
| 2302 | Ga0495628_0365907 | |||
| 2303 | Ga0495630_0002484 | |||
| 2304 | Ga0495652_0175483 | |||
| 2305 | Ga0495652_0548596 | |||
| 2306 | Ga0495640_0101793 | |||
| 2307 | Ga0495640_0118507 | |||
| 2308 | Ga0495640_0490387 | |||
| 2309 | Ga0495586_0201270 | |||
| 2310 | Ga0495598_0059750 | |||
| 2311 | Ga0495621_0454660 | |||
| 2312 | Ga0495645_0468867 | |||
| 2313 | Ga0495667_0117496 | |||
| 2314 | Ga0495667_0486455 | |||
| 2315 | Ga0495656_0267217 | |||
| 2316 | Ga0495659_0105435 | |||
| 2317 | Ga0495659_0217557 | |||
| 2318 | Ga0495659_0373795 | |||
| 2319 | Ga0495659_0411475 | |||
| 2320 | Ga0495659_0442002 | |||
| 2321 | Ga0495599_0059209 | |||
| 2322 | Ga0495599_0162573 | |||
| 2323 | Ga0495599_0320735 | |||
| 2324 | Ga0495658_0420792 | |||
| 2325 | Ga0495669_0011999 | |||
| 2326 | Ga0495669_0085140 | |||
| 2327 | Ga0495613_0219048 | |||
| 2328 | Ga0495670_0410701 | |||
| 2329 | Ga0495600_0167719 | |||
| 2330 | Ga0495581_0322810 | |||
| 2331 | Ga0495604_0365467 | |||
| 2332 | Ga0495604_0924736 | |||
| 2333 | Ga0495674_0093731 | |||
| 2334 | Ga0495674_0219556 | |||
| 2335 | Ga0495674_0893303 | |||
| 2336 | Ga0495674_0999433 | |||
| 2337 | Ga0495677_0238758 | |||
| 2338 | Ga0495684_0000048 | |||
| 2339 | Ga0495684_0268988 | |||
| 2340 | Ga0495602_0777211 | |||
| 2341 | Ga0496100_0073606 | |||
| 2342 | Ga0496100_0885861 | |||
| 2343 | Ga0496102_1067956 | |||
| 2344 | Ga0496102_1205543 | |||
| 2345 | Ga0496104_0024954 | |||
| 2346 | Ga0496105_0407231 | |||
| 2347 | Ga0496107_0251586 | |||
| 2348 | Ga0496107_0876057 | |||
| 2349 | Ga0496107_0887787 | |||
| 2350 | Ga0496108_0061576 | |||
| 2351 | Ga0496108_0257394 | |||
| 2352 | Ga0496109_0171044 | |||
| 2353 | Ga0496110_0593666 | |||
| 2354 | Ga0496110_0641965 | |||
| 2355 | Ga0496110_1115084 | |||
| 2356 | Ga0496110_1478578 | |||
| 2357 | Ga0496112_0027342 | |||
| 2358 | Ga0496112_0046895 | |||
| 2359 | Ga0496112_0383813 | |||
| 2360 | Ga0496112_0477952 | |||
| 2361 | Ga0496112_0478462 | |||
| 2362 | Ga0496112_1553545 | |||
| 2363 | Ga0496113_0008765 | |||
| 2364 | Ga0496114_0832016 | |||
| 2365 | Ga0496114_0876396 | |||
| 2366 | Ga0496114_1189280 | |||
| 2367 | Ga0496115_0289468 | |||
| 2368 | Ga0501031_0003807 | |||
| 2369 | Ga0501031_0037352 | |||
| 2370 | Ga0501031_0175382 | |||
| 2371 | Ga0501032_0015305 | |||
| 2372 | Ga0501032_0026840 | |||
| 2373 | Ga0501033_0014914 | |||
| 2374 | Ga0501033_0019113 | |||
| 2375 | Ga0501033_0028188 | |||
| 2376 | Ga0501033_0215108 | |||
| 2377 | Ga0501034_0100181 | |||
| 2378 | Ga0501034_0110593 | |||
| 2379 | Ga0501034_0415662 | |||
| 2380 | Ga0501036_0020812 | |||
| 2381 | Ga0501036_0046192 | |||
| 2382 | Ga0501036_0071922 | |||
| 2383 | Ga0501036_0073131 | |||
| 2384 | Ga0501036_0123784 | |||
| 2385 | Ga0501036_0719387 | |||
| 2386 | Ga0501037_0007463 | |||
| 2387 | Ga0501037_0008213 | |||
| 2388 | Ga0501038_0004706 | |||
| 2389 | Ga0501038_0011613 | |||
| 2390 | Ga0501038_0013478 | |||
| 2391 | Ga0501038_0031228 | |||
| 2392 | Ga0501038_0330322 | |||
| 2393 | Ga0501039_0009583 | |||
| 2394 | Ga0501039_0017979 | |||
| 2395 | Ga0501039_0055936 | |||
| 2396 | Ga0501039_0439728 | |||
| 2397 | Ga0501040_0036511 | |||
| 2398 | Ga0501040_0351418 | |||
| 2399 | Ga0501041_0013709 | |||
| 2400 | Ga0501041_0063192 | |||
| 2401 | Ga0501041_0092564 | |||
| 2402 | Ga0501041_0696768 | |||
| 2403 | Ga0501042_0002722 | |||
| 2404 | Ga0501042_0004934 | |||
| 2405 | Ga0501042_0032264 | |||
| 2406 | Ga0501042_0445274 | |||
| 2407 | Ga0501042_0498041 | |||
| 2408 | Ga0501043_0029061 | |||
| 2409 | Ga0501043_0064075 | |||
| 2410 | Ga0501043_0155625 | |||
| 2411 | Ga0501046_0044784 | |||
| 2412 | Ga0501046_0068048 | |||
| 2413 | Ga0501046_0207281 | |||
| 2414 | Ga0501046_0372282 | |||
| 2415 | Ga0501047_0026363 | |||
| 2416 | Ga0501047_0053487 | |||
| 2417 | Ga0501047_0097646 | |||
| 2418 | Ga0501048_0005878 | |||
| 2419 | Ga0501048_0009540 | |||
| 2420 | Ga0501048_0019807 | |||
| 2421 | Ga0501048_0069110 | |||
| 2422 | Ga0501048_0236453 | |||
| 2423 | Ga0501067_0000913 | |||
| 2424 | Ga0501067_0008912 | |||
| 2425 | Ga0501067_0016664 | |||
| 2426 | Ga0501067_0027089 | |||
| 2427 | Ga0501067_0031510 | |||
| 2428 | Ga0501068_0009006 | |||
| 2429 | Ga0501068_0009599 | |||
| 2430 | Ga0501068_0110543 | |||
| 2431 | Ga0501069_0002325 | |||
| 2432 | Ga0501069_0007210 | |||
| 2433 | Ga0501069_0012480 | |||
| 2434 | Ga0501070_0031584 | |||
| 2435 | Ga0501070_0105916 | |||
| 2436 | Ga0501071_0004219 | |||
| 2437 | Ga0501071_0043367 | |||
| 2438 | Ga0501071_0058525 | |||
| 2439 | Ga0501071_0066010 | |||
| 2440 | Ga0501071_0411810 | |||
| 2441 | Ga0501071_0842986 | |||
| 2442 | Ga0501071_1359995 | |||
| 2443 | Ga0501072_0040803 | |||
| 2444 | Ga0501072_0043351 | |||
| 2445 | Ga0501072_0169136 | |||
| 2446 | Ga0501072_0602206 | |||
| 2447 | Ga0501072_0726123 | |||
| 2448 | Ga0501072_0870443 | |||
| 2449 | Ga0501073_0003470 | |||
| 2450 | Ga0501073_0004091 | |||
| 2451 | Ga0501073_0158453 | |||
| 2452 | Ga0501074_0008374 | |||
| 2453 | Ga0501074_0009982 | |||
| 2454 | Ga0501074_0010136 | |||
| 2455 | Ga0501074_0106226 | |||
| 2456 | Ga0501075_0005744 | |||
| 2457 | Ga0501075_0111308 | |||
| 2458 | Ga0501075_0270584 | |||
| 2459 | Ga0501075_0774244 | |||
| 2460 | Ga0501075_0797742 | |||
| 2461 | Ga0501075_0808107 | |||
| 2462 | Ga0501075_0849907 | |||
| 2463 | Ga0501075_1003064 | |||
| 2464 | Ga0501076_0003150 | |||
| 2465 | Ga0501076_0037146 | |||
| 2466 | Ga0501076_0050071 | |||
| 2467 | Ga0501076_0111085 | |||
| 2468 | Ga0501076_0175007 | |||
| 2469 | Ga0501076_0383554 | |||
| 2470 | Ga0501076_0704583 | |||
| 2471 | Ga0501077_0021195 | |||
| 2472 | Ga0501077_0127614 | |||
| 2473 | Ga0501199_055884 | |||
| 2474 | Ga0501217_147117 | |||
| 2475 | Ga0501233_253769 | |||
| 2476 | Ga0501249_107637 | |||
| 2477 | Ga0501253_121282 | |||
| 2478 | Ga0501079_0003117 | |||
| 2479 | Ga0501079_0010915 | |||
| 2480 | Ga0501079_0035593 | |||
| 2481 | Ga0501079_0111822 | |||
| 2482 | Ga0501079_0116896 | |||
| 2483 | Ga0501079_0200728 | |||
| 2484 | Ga0501080_0043473 | |||
| 2485 | Ga0501080_0084052 | |||
| 2486 | Ga0501080_0171178 | |||
| 2487 | Ga0501080_0595973 | |||
| 2488 | Ga0501080_0611732 | |||
| 2489 | Ga0501080_0872256 | |||
| 2490 | Ga0501080_1135029 | |||
| 2491 | Ga0501081_0004610 | |||
| 2492 | Ga0501081_0039028 | |||
| 2493 | Ga0501081_0090871 | |||
| 2494 | Ga0501081_0242451 | |||
| 2495 | Ga0501083_0031063 | |||
| 2496 | Ga0501083_0033495 | |||
| 2497 | Ga0501083_0037768 | |||
| 2498 | Ga0501268_019197 | |||
| 2499 | Ga0501035_0008641 | |||
| 2500 | Ga0501035_0040104 | |||
| 2501 | Ga0501035_0220606 | |||
| 2502 | Ga0501035_0858026 | |||
| 2503 | Ga0501035_1129763 | |||
| 2504 | Ga0501035_1493057 | |||
| 2505 | Ga0501044_0033844 | |||
| 2506 | Ga0501044_0114079 | |||
| 2507 | Ga0501045_0004156 | |||
| 2508 | Ga0501045_0022749 | |||
| 2509 | Ga0501045_0037079 | |||
| 2510 | Ga0501045_0192969 | |||
| 2511 | Ga0501045_0214900 | |||
| 2512 | Ga0501045_1344758 | |||
| 2513 | nmdc:mga03683_8827_c2 | |||
| 2514 | nmdc:mga03n38_408520_c1 | |||
| 2515 | nmdc:mga00v17_26303_c1 | |||
| 2516 | nmdc:mga00v17_4431_c1 | |||
| 2517 | nmdc:mga0yw44_1297_c1 | |||
| 2518 | nmdc:mga0yw44_90267_c1 | |||
| 2519 | nmdc:mga0k408_15920_c1 | |||
| 2520 | nmdc:mga0k408_31367_c1 | |||
| 2521 | nmdc:mga06z11_14172_c1 | |||
| 2522 | nmdc:mga04h51_31508_c1 | |||
| 2523 | nmdc:mga04h51_96456_c1 | |||
| 2524 | nmdc:mga07m45_95800_c1 | |||
| 2525 | nmdc:mga05p37_12328_c1 | |||
| 2526 | nmdc:mga05p37_141143_c1 | |||
| 2527 | nmdc:mga05p37_1473_c1 | |||
| 2528 | nmdc:mga05p37_177523_c1 | |||
| 2529 | nmdc:mga05p37_180276_c1 | |||
| 2530 | nmdc:mga05p37_296437_c1 | |||
| 2531 | nmdc:mga05p37_310585_c1 | |||
| 2532 | nmdc:mga05p37_41497_c1 | |||
| 2533 | nmdc:mga05p37_433355_c1 | |||
| 2534 | nmdc:mga05p37_474_c1 | |||
| 2535 | nmdc:mga05p37_976055_c1 | |||
| 2536 | nmdc:mga09592_1251576_c1 | |||
| 2537 | nmdc:mga09592_183823_c1 | |||
| 2538 | nmdc:mga09592_221787_c1 | |||
| 2539 | nmdc:mga09592_78061_c1 | |||
| 2540 | nmdc:mga09592_791184_c1 | |||
| 2541 | nmdc:mga0qj67_188519_c1 | |||
| 2542 | nmdc:mga0qj67_225874_c1 | |||
| 2543 | nmdc:mga0qj67_474537_c1 | |||
| 2544 | nmdc:mga0qj67_524775_c1 | |||
| 2545 | nmdc:mga06r32_110235_c1 | |||
| 2546 | nmdc:mga06r32_222436_c1 | |||
| 2547 | nmdc:mga06r32_40234_c1 | |||
| 2548 | nmdc:mga06r32_482739_c1 | |||
| 2549 | nmdc:mga06r32_53501_c1 | |||
| 2550 | nmdc:mga08y16_1377442_c1 | |||
| 2551 | nmdc:mga08y16_145338_c1 | |||
| 2552 | nmdc:mga08y16_161043_c1 | |||
| 2553 | nmdc:mga08y16_17_c1 | |||
| 2554 | nmdc:mga08y16_218615_c1 | |||
| 2555 | nmdc:mga08y16_300436_c1 | |||
| 2556 | nmdc:mga08y16_30804_c1 | |||
| 2557 | nmdc:mga08y16_3761_c1 | |||
| 2558 | nmdc:mga08y16_378900_c1 | |||
| 2559 | nmdc:mga08y16_513059_c1 | |||
| 2560 | nmdc:mga08y16_542411_c1 | |||
| 2561 | nmdc:mga08y16_711726_c1 | |||
| 2562 | nmdc:mga0n895_1039184_c1 | |||
| 2563 | nmdc:mga0n895_111_c1 | |||
| 2564 | nmdc:mga0n895_1583074_c1 | |||
| 2565 | nmdc:mga0n895_229247_c1 | |||
| 2566 | nmdc:mga0n895_28763_c1 | |||
| 2567 | nmdc:mga0n895_299958_c1 | |||
| 2568 | nmdc:mga0n895_41387_c1 | |||
| 2569 | nmdc:mga0n895_459390_c1 | |||
| 2570 | nmdc:mga0n895_5595_c1 | |||
| 2571 | nmdc:mga0n895_73636_c1 | |||
| 2572 | nmdc:mga0n895_84135_c1 | |||
| 2573 | nmdc:mga0n895_95799_c1 | |||
| 2574 | nmdc:mga0rr50_105542_c1 | |||
| 2575 | nmdc:mga0rr50_1285137_c1 | |||
| 2576 | nmdc:mga0rr50_128854_c1 | |||
| 2577 | nmdc:mga0rr50_15435_c1 | |||
| 2578 | nmdc:mga0rr50_183318_c1 | |||
| 2579 | nmdc:mga0rr50_187201_c1 | |||
| 2580 | nmdc:mga0rr50_57621_c1 | |||
| 2581 | nmdc:mga0rr50_57_c1 | |||
| 2582 | nmdc:mga0rr50_609002_c1 | |||
| 2583 | nmdc:mga0rr50_647501_c1 | |||
| 2584 | nmdc:mga08x19_10657_c1 | |||
| 2585 | nmdc:mga08x19_13506_c1 | |||
| 2586 | nmdc:mga08x19_25756_c1 | |||
| 2587 | nmdc:mga08x19_33384_c1 | |||
| 2588 | nmdc:mga08x19_42475_c1 | |||
| 2589 | nmdc:mga08x19_426_c1 | |||
| 2590 | nmdc:mga0a205_129173_c1 | |||
| 2591 | nmdc:mga0a205_1306676_c1 | |||
| 2592 | nmdc:mga0a205_149862_c1 | |||
| 2593 | nmdc:mga0a205_162596_c1 | |||
| 2594 | nmdc:mga0a205_179415_c1 | |||
| 2595 | nmdc:mga0a205_261298_c1 | |||
| 2596 | nmdc:mga0a205_263098_c1 | |||
| 2597 | nmdc:mga0a205_412715_c1 | |||
| 2598 | nmdc:mga0a205_430828_c1 | |||
| 2599 | nmdc:mga0a205_450033_c1 | |||
| 2600 | nmdc:mga0a205_46188_c3 | |||
| 2601 | nmdc:mga0a205_601546_c1 | |||
| 2602 | nmdc:mga0a205_69429_c1 | |||
| 2603 | Ga0495601_0159044 | |||
| 2604 | Ga0495601_0243029 | |||
| 2605 | Ga0495601_0357317 | |||
| 2606 | Ga0495601_1010668 | |||
| 2607 | Ga0495595_0482535 | |||
| 2608 | Ga0495619_0023037 | |||
| 2609 | Ga0495619_0107533 | |||
| 2610 | Ga0495619_0174363 | |||
| 2611 | Ga0495619_0333389 | |||
| 2612 | Ga0501084_0005241 | |||
| 2613 | Ga0501084_0007230 | |||
| 2614 | Ga0501084_0007864 | |||
| 2615 | Ga0501084_0057513 | |||
| 2616 | Ga0501084_0172287 | |||
| 2617 | Ga0501084_0304654 | |||
| 2618 | Ga0590071_000323 | |||
| 2619 | Ga0590071_000383 | |||
| 2620 | Ga0590071_044840 | |||
| 2621 | Ga0590074_001430 | |||
| 2622 | Ga0590074_002896 | |||
| 2623 | Ga0590074_051937 | |||
| 2624 | Ga0590075_001130 | |||
| 2625 | Ga0590075_004204 | |||
| 2626 | Ga0590075_006947 | |||
| 2627 | Ga0590077_000447 | |||
| 2628 | Ga0590077_001312 | |||
| 2629 | Ga0501082_0002769 | |||
| 2630 | Ga0501082_0004326 | |||
| 2631 | Ga0501082_0005821 | |||
| 2632 | Ga0501082_0058612 | |||
| 2633 | Ga0501082_0113445 | |||
| 2634 | Ga0501082_1165767 | |||
| 2635 | Ga0501082_1205394 | |||
| 2636 | Ga0501082_1629906 | |||
| 2637 | Ga0530510_0005346 | |||
| 2638 | Ga0530510_0007769 | |||
| 2639 | Ga0530510_0017603 | |||
| 2640 | Ga0530510_0426343 | |||
| 2641 | Ga0530510_0494733 | |||
| 2642 | Ga0530510_0626915 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dtt-assembly2.cif.gz_F | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.8002 | 2 | 132 |
| 2dtt-assembly2.cif.gz_F | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.7722 | 2 | 132 |
| 4ntm-assembly1.cif.gz_A | qued soaked with sepiapterin (selenomethionine substituted protein) | 0.7544 | 2 | 133 |
| 7v0f-assembly1.cif.gz_B | structure of 6-carboxy-5,6,7,8-tetrahydropterin synthase paralog qued2 from acinetobacter baumannii | 0.7465 | 1 | 133 |
| 4ntm-assembly1.cif.gz_C | qued soaked with sepiapterin (selenomethionine substituted protein) | 0.7398 | 1 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dttD00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.7294 | 2 | 132 | 3.30.479.10 |
| 3jygD00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.7045 | 2 | 134 | 3.30.479.10 |
| 2dttD00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.7034 | 2 | 132 | 3.30.479.10 |
| af_P53981_1_224_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.6955 | 63 | 93 | 3.90.180.10 |
| 3jygD00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.6951 | 2 | 134 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4Z8V8-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9731 | 60 | 134 |
GO:0070497
|
| AF-A0A831RCF6-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9226 | 59 | 134 |
|
| AF-A0A7V1QAU0-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9181 | 30 | 134 |
GO:0016829
GO:0046872 |
| AF-A0A2W1B2R7-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9106 | 35 | 134 |
GO:0046872
GO:0070497 |
| AF-A0A7C4Z8V8-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9026 | 60 | 134 |
GO:0070497
|