F492975

General Info

Members Datasets Scaffolds Average Seq Length
1320 643 1150 151

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0346758|Ga0501075_0346758_322_825
Length 167
Sequence MRDFRSQGEPRRNMTLPEDIYSQRILELAAAIPRTARLAAPEATATAHSKLCGSTVTIDLAMEGDVVTDYGQSVKACLLGQSSASVMGREIVGSTAAELREVGSAMRKMLKEQGPAPGGKWGDLAVLEPVRDYKARHASTLLVFDAVEDAIGQIEAKREATAAEADA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
16 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
17 2738541293 Rhizobium sp. GV031 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
32 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
33 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
34 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
37 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
38 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
39 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
40 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
41 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
42 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
43 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
44 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
45 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
46 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
47 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
48 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
49 2851182111 Bosea sp. Tri-44 Isolate Nodule
50 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
51 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
52 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
53 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
54 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
55 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
56 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
57 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
58 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
59 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
60 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
61 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
62 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
63 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
64 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
65 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
66 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
67 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
68 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
69 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
70 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
71 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
72 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
73 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
74 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
75 2922368715
76 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
77 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
78 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
79 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
80 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
81 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
82 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
83 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
84 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
85 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
86 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
87 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
88 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
89 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
90 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
91 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
92 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
93 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
94 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
95 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
96 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
97 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
98 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
99 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
100 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
101 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
102 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
103 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
104 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
105 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
106 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
107 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
108 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
109 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
110 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
111 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
112 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
113 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
114 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
115 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
116 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
117 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
118 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
119 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
120 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
121 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
122 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
123 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
124 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
125 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
126 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
127 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
128 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
129 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
130 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
131 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
132 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
133 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
134 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
135 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
136 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
137 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
138 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
139 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
140 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
141 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
142 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
143 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
144 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
145 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
148 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
149 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
150 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
151 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
152 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
153 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
154 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
155 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
156 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
157 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
158 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
159 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
160 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
161 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
162 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
163 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
164 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
165 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
166 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
167 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
168 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
169 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
170 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
171 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
172 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
173 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
174 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
175 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
176 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
177 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
178 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
179 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
180 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
181 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
182 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
183 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
184 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
185 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
186 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
187 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
188 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
189 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
190 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
191 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
192 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
195 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
196 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
197 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
198 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
199 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
200 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
201 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
202 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
203 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
204 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
205 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
206 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
207 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
208 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
209 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
210 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
211 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
212 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
213 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
214 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
215 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
216 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
217 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
218 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
219 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
220 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
221 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
222 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
223 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
224 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
225 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
226 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
227 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
229 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
230 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
231 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
232 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
233 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
234 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
236 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
237 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
238 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
239 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
242 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
243 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
244 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
245 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
246 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
247 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
248 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
249 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
250 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
251 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
252 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
253 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
254 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
255 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
256 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
257 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
258 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
259 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
260 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
261 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
262 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
263 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
264 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
265 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
266 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
267 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
268 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
269 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
274 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
275 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
278 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
280 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
282 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
336 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
337 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
338 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
339 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
345 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
346 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
347 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
348 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
349 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
350 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
351 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
352 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
353 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
354 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
355 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
356 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
357 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
358 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
359 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
360 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
361 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
362 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
363 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
364 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
365 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
366 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
367 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
368 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
369 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
370 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
371 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
372 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
373 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
374 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
375 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
376 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
377 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
378 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
379 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
380 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
381 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
382 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
383 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
384 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
385 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
386 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
387 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
388 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
389 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
390 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
391 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
392 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
393 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
394 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
395 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
396 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
397 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
398 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
399 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
400 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
401 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
402 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
403 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
404 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
405 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
406 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
407 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
408 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
409 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
410 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
411 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
412 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
413 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
414 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
415 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
416 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
417 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
418 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
419 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
420 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
421 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
422 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
423 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
424 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
425 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
426 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
427 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
428 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
429 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
430 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
431 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
432 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
435 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
436 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
437 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
438 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
439 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
440 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
441 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
442 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
443 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
444 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
445 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
446 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
447 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
448 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
449 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
450 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
451 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
452 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
453 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
454 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
455 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
456 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
457 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
458 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
459 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
460 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
461 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
462 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
463 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
464 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
465 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
466 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
467 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
468 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
469 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
470 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
471 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
472 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
473 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
474 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
475 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
476 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
477 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
478 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
479 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
480 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
481 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
482 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
483 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
484 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
485 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
486 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
487 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
488 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
489 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
490 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
491 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
492 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
493 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
494 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
495 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
496 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
497 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
498 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
499 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
500 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
501 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
502 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
503 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
504 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
505 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
506 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
522 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
523 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
524 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
525 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
526 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
530 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
531 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
532 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
533 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
534 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
535 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
536 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
538 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
539 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
540 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
541 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
542 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
543 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
544 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
545 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
546 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
547 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
548 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
549 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
550 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
551 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
552 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
553 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
554 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
555 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
556 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
557 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
558 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
559 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
560 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
561 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
562 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
563 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
564 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
565 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
566 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
567 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
568 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
569 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
570 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
571 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
572 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
573 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
574 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
575 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
576 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
577 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
578 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
579 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
580 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
581 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
582 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
583 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
584 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
585 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
586 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
587 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
588 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
589 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
590 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
591 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
592 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
593 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
594 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
595 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
596 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
597 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
598 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
599 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
600 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
601 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
602 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
603 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
604 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
605 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
606 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
607 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
608 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
611 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
612 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
613 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
614 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
615 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
616 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
617 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
618 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
619 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
620 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
621 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
622 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
623 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
624 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
625 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
626 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
627 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
628 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
629 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
630 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
631 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
632 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
633 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
634 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
635 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
636 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
637 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
638 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
639 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
640 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
641 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
642 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
643 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.81
Metatranscriptomes 0.38
Isolates 12.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 10.61
Rhizoplane 6.29
Rhizosphere 62.88
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007408 3300001979 Bacteria 4463
2 JGI24739J22299_10005870 3300001989 Bacteria 4648
3 JGI24737J22298_10005148 3300001990 Bacteria 4526
4 JGI24737J22298_10126031 3300001990 Bacteria 756
5 JGI24735J21928_10153149 3300002067 Bacteria 666
6 JGI24738J21930_10132361 3300002075 Bacteria 547
7 JGI25165J46597_1007108 3300003214 Bacteria 1897
8 JGI25165J46597_1017932 3300003214 Bacteria 939
9 JGI25153J46596_10001336 3300003215 Bacteria 14751
10 JGI25153J46596_10006825 3300003215 Bacteria 5713
11 JGI25153J46596_10017942 3300003215 Bacteria 2767
12 JGI25153J46596_10065045 3300003215 Bacteria 971
13 JGI25404J52841_10009065 3300003659 Bacteria 2127
14 Ga0055539_1009871 3300003752 Bacteria 1183
15 Ga0055542_1015350 3300003762 Bacteria 1233
16 Ga0055529_1011705 3300003763 Bacteria 1128
17 Ga0055526_1030273 3300003771 Bacteria 1583
18 Ga0055531_10009682 3300003794 Bacteria 4900
19 Ga0055543_1004709 3300004625 Bacteria 3645
20 Ga0065165_1002378 3300005262 Bacteria 16217
21 Ga0065165_1007503 3300005262 Bacteria 5343
22 Ga0065165_1009915 3300005262 Bacteria 4197
23 Ga0070676_11289330 3300005328 Bacteria 557
24 Ga0070683_100778079 3300005329 Bacteria 917
25 Ga0070670_100669903 3300005331 Bacteria 932
26 Ga0068869_100219139 3300005334 Bacteria 1507
27 Ga0068869_100603209 3300005334 Bacteria 928
28 Ga0070666_10904511 3300005335 Bacteria 653
29 Ga0070680_100018149 3300005336 Bacteria 5558
30 Ga0070680_100548580 3300005336 Bacteria 991
31 Ga0070680_100962359 3300005336 Bacteria 737
32 Ga0070682_100028973 3300005337 Bacteria 3333
33 Ga0070682_100182311 3300005337 Bacteria 1468
34 Ga0070682_100476317 3300005337 Bacteria 962
35 Ga0070682_100591696 3300005337 Bacteria 875
36 Ga0068868_101554255 3300005338 Bacteria 621
37 Ga0070660_100007944 3300005339 Bacteria 7406
38 Ga0070660_100109160 3300005339 Bacteria 2200
39 Ga0070660_100459735 3300005339 Bacteria 1057
40 Ga0070689_100383115 3300005340 Bacteria 1185
41 Ga0070661_100905959 3300005344 Bacteria 728
42 Ga0070668_100267653 3300005347 Bacteria 1423
43 Ga0070668_100382218 3300005347 Bacteria 1198
44 Ga0070669_100369060 3300005353 Bacteria 1169
45 Ga0070671_100093201 3300005355 Bacteria 2524
46 Ga0070671_100386344 3300005355 Bacteria 1197
47 Ga0070671_100401212 3300005355 Bacteria 1173
48 Ga0070674_100485667 3300005356 Bacteria 1026
49 Ga0070688_100196942 3300005365 Bacteria 1407
50 Ga0070688_100271878 3300005365 Bacteria 1214
51 Ga0070688_100282441 3300005365 Bacteria 1193
52 Ga0070659_100233720 3300005366 Bacteria 1519
53 Ga0070709_10001049 3300005434 Bacteria 15239
54 Ga0070709_10007480 3300005434 Bacteria 5989
55 Ga0070709_10179542 3300005434 Bacteria 1485
56 Ga0070714_100001503 3300005435 Bacteria 16962
57 Ga0070714_101192030 3300005435 Bacteria 743
58 Ga0070713_100009241 3300005436 Bacteria 7041
59 Ga0070713_100014047 3300005436 Bacteria 5929
60 Ga0070713_100258218 3300005436 Bacteria 1591
61 Ga0070713_100288429 3300005436 Bacteria 1507
62 Ga0070713_100708890 3300005436 Bacteria 961
63 Ga0070713_100854847 3300005436 Bacteria 874
64 Ga0070710_10012865 3300005437 Bacteria 4170
65 Ga0070710_10024990 3300005437 Bacteria 3158
66 Ga0070710_10035049 3300005437 Bacteria 2734
67 Ga0070710_10040600 3300005437 Bacteria 2565
68 Ga0070711_100003503 3300005439 Bacteria 9151
69 Ga0070711_100005982 3300005439 Bacteria 7304
70 Ga0070711_100062200 3300005439 Bacteria 2601
71 Ga0070711_100387889 3300005439 Bacteria 1131
72 Ga0070705_100290476 3300005440 Bacteria 1167
73 Ga0070700_100827428 3300005441 Bacteria 748
74 Ga0070700_101168434 3300005441 Bacteria 641
75 Ga0070663_100066976 3300005455 Bacteria 2603
76 Ga0070663_100128105 3300005455 Bacteria 1924
77 Ga0070663_100813350 3300005455 Bacteria 802
78 Ga0070678_100127431 3300005456 Bacteria 2017
79 Ga0070678_100173943 3300005456 Bacteria 1756
80 Ga0070678_100372199 3300005456 Bacteria 1234
81 Ga0070678_101131972 3300005456 Bacteria 724
82 Ga0070662_100085799 3300005457 Bacteria 2353
83 Ga0070681_10002115 3300005458 Bacteria 18042
84 Ga0070681_10035146 3300005458 Bacteria 5034
85 Ga0070681_10414575 3300005458 Bacteria 1259
86 Ga0070681_10578438 3300005458 Bacteria 1037
87 Ga0070681_10916849 3300005458 Bacteria 795
88 Ga0068867_100328963 3300005459 Bacteria 1268
89 Ga0068867_101645434 3300005459 Bacteria 601
90 Ga0070685_10576194 3300005466 Bacteria 807
91 Ga0070679_100054054 3300005530 Bacteria 3997
92 Ga0070679_100077530 3300005530 Bacteria 3312
93 Ga0070679_100106756 3300005530 Bacteria 2786
94 Ga0070684_100076765 3300005535 Bacteria 2949
95 Ga0070684_100087521 3300005535 Bacteria 2766
96 Ga0070684_100364981 3300005535 Bacteria 1329
97 Ga0070684_100513144 3300005535 Bacteria 1111
98 Ga0070697_100057741 3300005536 Bacteria 3157
99 Ga0070697_100728346 3300005536 Bacteria 876
100 Ga0068853_100005334 3300005539 Bacteria 10065
101 Ga0068853_100040711 3300005539 Bacteria 3966
102 Ga0068853_100062602 3300005539 Bacteria 3220
103 Ga0068853_100333664 3300005539 Bacteria 1408
104 Ga0068853_100350830 3300005539 Bacteria 1372
105 Ga0068853_100478174 3300005539 Bacteria 1174
106 Ga0068853_100583638 3300005539 Unclassified 1061
107 Ga0070672_100181742 3300005543 Bacteria 1753
108 Ga0070686_100265387 3300005544 Bacteria 1260
109 Ga0070696_100845924 3300005546 Unclassified 756
110 Ga0070693_100077815 3300005547 Bacteria 1970
111 Ga0070693_100160649 3300005547 Bacteria 1431
112 Ga0070665_100032740 3300005548 Bacteria 5230
113 Ga0070665_100155913 3300005548 Bacteria 2285
114 Ga0070665_100288465 3300005548 Bacteria 1643
115 Ga0070665_100525949 3300005548 Bacteria 1194
116 Ga0070665_100568505 3300005548 Bacteria 1146
117 Ga0070665_100780239 3300005548 Bacteria 969
118 Ga0070665_101525214 3300005548 Bacteria 677
119 Ga0068855_100212992 3300005563 Bacteria 2170
120 Ga0068855_100286486 3300005563 Bacteria 1827
121 Ga0068855_100745625 3300005563 Bacteria 1045
122 Ga0068855_100810069 3300005563 Bacteria 995
123 Ga0068855_101690327 3300005563 Bacteria 646
124 Ga0068857_100064893 3300005577 Bacteria 3246
125 Ga0068857_100350521 3300005577 Bacteria 1367
126 Ga0068857_100753740 3300005577 Bacteria 927
127 Ga0068854_100013144 3300005578 Bacteria 5426
128 Ga0068854_100080974 3300005578 Bacteria 2397
129 Ga0068854_100180476 3300005578 Bacteria 1649
130 Ga0068854_100775218 3300005578 Bacteria 834
131 Ga0068854_101055113 3300005578 Bacteria 722
132 Ga0068854_101431811 3300005578 Bacteria 626
133 Ga0068856_100124718 3300005614 Bacteria 2578
134 Ga0068856_100233961 3300005614 Bacteria 1853
135 Ga0068856_100915358 3300005614 Bacteria 896
136 Ga0068856_101093097 3300005614 Bacteria 815
137 Ga0070702_100040026 3300005615 Bacteria 2619
138 Ga0070702_100277620 3300005615 Bacteria 1149
139 Ga0068852_100049727 3300005616 Bacteria 3588
140 Ga0068852_100167350 3300005616 Bacteria 2058
141 Ga0068852_100366915 3300005616 Bacteria 1410
142 Ga0068852_101559146 3300005616 Bacteria 683
143 Ga0068864_100422577 3300005618 Bacteria 1270
144 Ga0068866_10276860 3300005718 Bacteria 1038
145 Ga0068866_10380781 3300005718 Bacteria 905
146 Ga0068861_100767877 3300005719 Bacteria 902
147 Ga0068851_10006013 3300005834 Bacteria 5531
148 Ga0068851_10167003 3300005834 Bacteria 1212
149 Ga0068851_10189203 3300005834 Bacteria 1144
150 Ga0068863_100867183 3300005841 Bacteria 902
151 Ga0068858_100039039 3300005842 Bacteria 4404
152 Ga0068858_100152965 3300005842 Bacteria 2170
153 Ga0068858_100202919 3300005842 Bacteria 1875
154 Ga0068858_100379908 3300005842 Bacteria 1356
155 Ga0068858_100478075 3300005842 Bacteria 1202
156 Ga0068860_100000113 3300005843 Bacteria 130939
157 Ga0068860_100371183 3300005843 Bacteria 1411
158 Ga0081455_10002285 3300005937 Bacteria 22872
159 Ga0081455_10007249 3300005937 Bacteria 11706
160 Ga0081538_10031309 3300005981 Bacteria 3590
161 Ga0081538_10042515 3300005981 Bacteria 2866
162 Ga0081540_1003440 3300005983 Bacteria 12500
163 Ga0081540_1004142 3300005983 Bacteria 11183
164 Ga0081540_1248391 3300005983 Bacteria 622
165 Ga0070717_10002312 3300006028 Bacteria 13387
166 Ga0070717_10042970 3300006028 Bacteria 3687
167 Ga0070717_10198890 3300006028 Bacteria 1755
168 Ga0070717_11464143 3300006028 Bacteria 620
169 Ga0075365_10023032 3300006038 Bacteria 3912
170 Ga0075365_10156057 3300006038 Bacteria 1589
171 Ga0075368_10011707 3300006042 Bacteria 3196
172 Ga0075363_100020528 3300006048 Bacteria 3315
173 Ga0075363_100052001 3300006048 Bacteria 2186
174 Ga0075363_100105410 3300006048 Bacteria 1563
175 Ga0075363_100155764 3300006048 Bacteria 1291
176 Ga0075364_10060911 3300006051 Bacteria 2475
177 Ga0075364_10295567 3300006051 Bacteria 1102
178 Ga0070715_10000192 3300006163 Bacteria 14303
179 Ga0070715_10488284 3300006163 Bacteria 703
180 Ga0070716_100063087 3300006173 Bacteria 2150
181 Ga0070712_100004044 3300006175 Bacteria 9002
182 Ga0070712_100008540 3300006175 Bacteria 6442
183 Ga0075362_10018122 3300006177 Bacteria 2909
184 Ga0075362_10115582 3300006177 Bacteria 1266
185 Ga0075367_10016109 3300006178 Bacteria 4077
186 Ga0075367_10120197 3300006178 Bacteria 1618
187 Ga0075367_10230656 3300006178 Bacteria 1159
188 Ga0075367_10338816 3300006178 Bacteria 948
189 Ga0075367_10506098 3300006178 Bacteria 766
190 Ga0075369_10052877 3300006186 Bacteria 1761
191 Ga0075369_10214425 3300006186 Bacteria 890
192 Ga0075366_10124194 3300006195 Bacteria 1556
193 Ga0075366_10407868 3300006195 Bacteria 836
194 Ga0097621_101721795 3300006237 Bacteria 597
195 Ga0075370_10008196 3300006353 Bacteria 5363
196 Ga0075370_10022481 3300006353 Bacteria 3463
197 Ga0075370_10023253 3300006353 Bacteria 3412
198 Ga0075370_10485829 3300006353 Bacteria 745
199 Ga0075431_101407414 3300006847 Bacteria 657
200 Ga0075429_100433848 3300006880 Bacteria 1151
201 Ga0068865_100320808 3300006881 Bacteria 1246
202 Ga0097620_100032736 3300006931 Bacteria 5222
203 Ga0099825_1017767 3300006941 Bacteria 5721
204 Ga0099823_1073607 3300006944 Bacteria 1460
205 Ga0099794_10031429 3300007265 Bacteria 2485
206 Ga0099794_10056118 3300007265 Bacteria 1905
207 Ga0099794_10089519 3300007265 Bacteria 1526
208 Ga0105251_10515109 3300009011 Bacteria 560
209 Ga0105250_10053022 3300009092 Bacteria 1627
210 Ga0105240_10001503 3300009093 Bacteria 39730
211 Ga0105240_10012039 3300009093 Bacteria 11991
212 Ga0105240_10014484 3300009093 Bacteria 10766
213 Ga0105240_10016530 3300009093 Bacteria 9987
214 Ga0105240_10031749 3300009093 Bacteria 6844
215 Ga0105240_10453740 3300009093 Bacteria 1434
216 Ga0105240_11198258 3300009093 Bacteria 804
217 Ga0111539_10671213 3300009094 Bacteria 1207
218 Ga0111539_10985186 3300009094 Bacteria 980
219 Ga0105245_10027787 3300009098 Bacteria 4985
220 Ga0105245_10453074 3300009098 Bacteria 1292
221 Ga0105245_10542760 3300009098 Bacteria 1184
222 Ga0105247_10008420 3300009101 Bacteria 6284
223 Ga0105247_10012893 3300009101 Bacteria 5015
224 Ga0105247_10066343 3300009101 Bacteria 2247
225 Ga0105247_10226155 3300009101 Bacteria 1269
226 Ga0105247_10395620 3300009101 Bacteria 983
227 Ga0105247_10455678 3300009101 Bacteria 923
228 Ga0105243_10089736 3300009148 Bacteria 2528
229 Ga0105243_10130020 3300009148 Bacteria 2135
230 Ga0105243_10957536 3300009148 Bacteria 856
231 Ga0105243_11794713 3300009148 Bacteria 644
232 Ga0105241_10016431 3300009174 Bacteria 5428
233 Ga0105241_10053195 3300009174 Bacteria 3095
234 Ga0105241_10116647 3300009174 Bacteria 2144
235 Ga0105241_10148004 3300009174 Bacteria 1918
236 Ga0105241_10876436 3300009174 Bacteria 832
237 Ga0105241_11537246 3300009174 Bacteria 642
238 Ga0105241_11595263 3300009174 Bacteria 631
239 Ga0105241_11672279 3300009174 Bacteria 618
240 Ga0105248_10164028 3300009177 Bacteria 2505
241 Ga0105248_10570502 3300009177 Bacteria 1277
242 Ga0105248_10770470 3300009177 Bacteria 1086
243 Ga0105237_10000992 3300009545 Bacteria 38167
244 Ga0105237_10027416 3300009545 Bacteria 5816
245 Ga0105237_10037499 3300009545 Bacteria 4899
246 Ga0105237_10088594 3300009545 Bacteria 3084
247 Ga0105237_10202266 3300009545 Bacteria 1986
248 Ga0105237_10210675 3300009545 Bacteria 1943
249 Ga0105237_10652715 3300009545 Bacteria 1059
250 Ga0105237_10697830 3300009545 Bacteria 1021
251 Ga0105237_11468357 3300009545 Bacteria 688
252 Ga0105237_11623165 3300009545 Bacteria 654
253 Ga0105238_10006181 3300009551 Bacteria 11892
254 Ga0105238_10008586 3300009551 Bacteria 10220
255 Ga0105238_10021503 3300009551 Bacteria 6571
256 Ga0105238_10223374 3300009551 Bacteria 1860
257 Ga0105238_10286069 3300009551 Bacteria 1631
258 Ga0105238_10437442 3300009551 Bacteria 1304
259 Ga0105238_10571380 3300009551 Bacteria 1136
260 Ga0105249_10380494 3300009553 Bacteria 1437
261 Ga0105249_10556539 3300009553 Bacteria 1198
262 Ga0105249_11796859 3300009553 Bacteria 686
263 Ga0099796_10021669 3300010159 Bacteria 1982
264 Ga0105239_10008381 3300010375 Bacteria 11777
265 Ga0105239_10040184 3300010375 Bacteria 5125
266 Ga0105239_10085316 3300010375 Bacteria 3480
267 Ga0105239_10109518 3300010375 Bacteria 3061
268 Ga0105239_10148096 3300010375 Bacteria 2619
269 Ga0105239_10281988 3300010375 Bacteria 1870
270 Ga0105239_10454113 3300010375 Bacteria 1454
271 Ga0105239_10471752 3300010375 Bacteria 1425
272 Ga0105239_11283959 3300010375 Bacteria 844
273 Ga0105239_11509577 3300010375 Bacteria 776
274 Ga0105239_11514191 3300010375 Bacteria 775
275 Ga0105239_11986258 3300010375 Bacteria 675
276 Ga0105246_10087956 3300011119 Bacteria 2231
277 Ga0105246_10106277 3300011119 Bacteria 2053
278 Ga0157322_1011308 3300012490 Bacteria 734
279 Ga0157313_1022216 3300012503 Bacteria 657
280 Ga0157373_10485336 3300013100 Bacteria 892
281 Ga0157371_10082815 3300013102 Bacteria 2271
282 Ga0157370_10039353 3300013104 Bacteria 4569
283 Ga0157370_10049664 3300013104 Bacteria 4015
284 Ga0157370_10159756 3300013104 Bacteria 2097
285 Ga0157370_10171349 3300013104 Bacteria 2018
286 Ga0157370_10192821 3300013104 Bacteria 1891
287 Ga0157369_10069789 3300013105 Bacteria 3775
288 Ga0157369_10103369 3300013105 Bacteria 3035
289 Ga0157374_10035499 3300013296 Bacteria 4561
290 Ga0157374_10329366 3300013296 Bacteria 1515
291 Ga0157374_10704225 3300013296 Bacteria 1023
292 Ga0157374_11506452 3300013296 Bacteria 696
293 Ga0157374_11584631 3300013296 Bacteria 679
294 Ga0157378_10070096 3300013297 Bacteria 3147
295 Ga0157378_13074177 3300013297 Bacteria 518
296 Ga0163162_10512952 3300013306 Bacteria 1329
297 Ga0163162_12005991 3300013306 Bacteria 663
298 Ga0157372_10548140 3300013307 Bacteria 1348
299 Ga0157372_11478125 3300013307 Bacteria 783
300 Ga0157372_11647710 3300013307 Bacteria 738
301 Ga0157375_10039817 3300013308 Bacteria 4526
302 Ga0157375_10298608 3300013308 Bacteria 1774
303 Ga0157375_12424288 3300013308 Bacteria 626
304 Ga0163163_10105138 3300014325 Bacteria 2848
305 Ga0163163_10177924 3300014325 Bacteria 2174
306 Ga0163163_10410562 3300014325 Bacteria 1413
307 Ga0163163_10456111 3300014325 Bacteria 1339
308 Ga0163163_10786430 3300014325 Bacteria 1015
309 Ga0163163_11154795 3300014325 Bacteria 837
310 Ga0157380_10009856 3300014326 Bacteria 6858
311 Ga0157380_10434396 3300014326 Bacteria 1256
312 Ga0157380_11074853 3300014326 Bacteria 842
313 Ga0157379_10003171 3300014968 Bacteria 13922
314 Ga0157379_10071516 3300014968 Bacteria 3103
315 Ga0157379_10208848 3300014968 Bacteria 1767
316 Ga0157379_11020154 3300014968 Bacteria 789
317 Ga0157376_10332550 3300014969 Bacteria 1448
318 Ga0157376_10446629 3300014969 Bacteria 1260
319 Ga0157376_11981697 3300014969 Bacteria 620
320 Ga0206356_11465087 3300020070 Bacteria 1152
321 Ga0214544_1000006 3300021320 Bacteria 380728
322 Ga0214542_1000002 3300021321 Bacteria 720798
323 Ga0214545_1000002 3300021324 Bacteria 727485
324 Ga0214543_1000017 3300021327 Bacteria 290109
325 Ga0213876_10001877 3300021384 Bacteria 12635
326 Ga0213876_10009781 3300021384 Bacteria 5160
327 Ga0213876_10048574 3300021384 Bacteria 2242
328 Ga0213876_10199567 3300021384 Bacteria 1063
329 Ga0213876_10214428 3300021384 Bacteria 1024
330 Ga0213875_10000861 3300021388 Bacteria 22412
331 Ga0224712_10042995 3300022467 Bacteria 1715
332 Ga0209563_101649 3300025230 Bacteria 5737
333 Ga0209026_1046629 3300025250 Bacteria 622
334 Ga0209677_101107 3300025253 Bacteria 12660
335 Ga0209148_1002189 3300025254 Bacteria 7220
336 Ga0209129_1028842 3300025258 Bacteria 940
337 Ga0209233_1033160 3300025261 Bacteria 1187
338 Ga0209455_1002740 3300025272 Bacteria 6614
339 Ga0209673_1016891 3300025273 Bacteria 2711
340 Ga0207673_1007965 3300025290 Bacteria 1336
341 Ga0209564_1005255 3300025295 Bacteria 7475
342 Ga0209564_1006163 3300025295 Bacteria 6569
343 Ga0209758_1000065 3300025297 Bacteria 306288
344 Ga0209758_1000189 3300025297 Bacteria 138296
345 Ga0209758_1000827 3300025297 Bacteria 43314
346 Ga0209758_1029926 3300025297 Bacteria 2264
347 Ga0209758_1143917 3300025297 Bacteria 614
348 Ga0209256_1008826 3300025299 Bacteria 4562
349 Ga0207426_1001072 3300025302 Bacteria 25708
350 Ga0207426_1010712 3300025302 Bacteria 3542
351 Ga0207426_1034300 3300025302 Bacteria 1629
352 Ga0209257_1000880 3300025304 Bacteria 42421
353 Ga0209257_1011496 3300025304 Bacteria 4254
354 Ga0209257_1078112 3300025304 Bacteria 856
355 Ga0207697_10058042 3300025315 Bacteria 1607
356 Ga0207656_10006242 3300025321 Bacteria 4270
357 Ga0207656_10184685 3300025321 Bacteria 1002
358 Ga0207692_10000798 3300025898 Bacteria 11222
359 Ga0207692_10001866 3300025898 Bacteria 8006
360 Ga0207692_10039773 3300025898 Bacteria 2317
361 Ga0207692_10566667 3300025898 Bacteria 727
362 Ga0207710_10012085 3300025900 Bacteria 3629
363 Ga0207710_10021204 3300025900 Bacteria 2782
364 Ga0207710_10038686 3300025900 Bacteria 2110
365 Ga0207688_10059877 3300025901 Bacteria 2144
366 Ga0207680_10060356 3300025903 Bacteria 2308
367 Ga0207680_10526427 3300025903 Bacteria 843
368 Ga0207647_10005034 3300025904 Bacteria 9740
369 Ga0207647_10005547 3300025904 Bacteria 9237
370 Ga0207685_10017711 3300025905 Bacteria 2311
371 Ga0207685_10087116 3300025905 Bacteria 1306
372 Ga0207699_10001678 3300025906 Bacteria 10478
373 Ga0207699_10031117 3300025906 Bacteria 2993
374 Ga0207645_10035572 3300025907 Bacteria 3198
375 Ga0207705_10028471 3300025909 Bacteria 3983
376 Ga0207654_10047186 3300025911 Bacteria 2460
377 Ga0207654_10306940 3300025911 Bacteria 1081
378 Ga0207654_10507518 3300025911 Bacteria 852
379 Ga0207654_10958445 3300025911 Bacteria 621
380 Ga0207707_10002655 3300025912 Bacteria 15989
381 Ga0207707_10016927 3300025912 Bacteria 6350
382 Ga0207695_10000159 3300025913 Bacteria 201367
383 Ga0207695_10035634 3300025913 Bacteria 5392
384 Ga0207695_10233374 3300025913 Bacteria 1743
385 Ga0207695_10286538 3300025913 Bacteria 1540
386 Ga0207695_10692486 3300025913 Bacteria 900
387 Ga0207671_10003280 3300025914 Bacteria 16284
388 Ga0207671_10028648 3300025914 Bacteria 4160
389 Ga0207671_10028952 3300025914 Bacteria 4138
390 Ga0207671_10122859 3300025914 Bacteria 1986
391 Ga0207671_10162011 3300025914 Bacteria 1733
392 Ga0207671_10256131 3300025914 Bacteria 1376
393 Ga0207671_10576829 3300025914 Bacteria 897
394 Ga0207671_10659772 3300025914 Bacteria 833
395 Ga0207693_10001679 3300025915 Bacteria 19500
396 Ga0207693_10004666 3300025915 Bacteria 11549
397 Ga0207693_10021981 3300025915 Bacteria 5071
398 Ga0207663_10000672 3300025916 Bacteria 15122
399 Ga0207663_10124262 3300025916 Bacteria 1772
400 Ga0207663_10435653 3300025916 Bacteria 1009
401 Ga0207663_10636806 3300025916 Bacteria 840
402 Ga0207660_10028715 3300025917 Bacteria 3807
403 Ga0207660_10243663 3300025917 Bacteria 1417
404 Ga0207660_10305830 3300025917 Bacteria 1267
405 Ga0207657_10004801 3300025919 Bacteria 14253
406 Ga0207657_10104815 3300025919 Bacteria 2342
407 Ga0207657_10147172 3300025919 Bacteria 1921
408 Ga0207657_10178343 3300025919 Bacteria 1718
409 Ga0207652_10002660 3300025921 Bacteria 14994
410 Ga0207652_10009472 3300025921 Bacteria 7830
411 Ga0207652_10085230 3300025921 Bacteria 2769
412 Ga0207681_10112482 3300025923 Bacteria 1983
413 Ga0207694_10021788 3300025924 Bacteria 4857
414 Ga0207694_10093293 3300025924 Bacteria 2378
415 Ga0207694_10798524 3300025924 Bacteria 797
416 Ga0207694_11633823 3300025924 Bacteria 543
417 Ga0207700_10008661 3300025928 Bacteria 6317
418 Ga0207700_10027097 3300025928 Bacteria 4008
419 Ga0207700_10152741 3300025928 Bacteria 1909
420 Ga0207700_10165011 3300025928 Bacteria 1842
421 Ga0207700_10179479 3300025928 Bacteria 1772
422 Ga0207700_10329667 3300025928 Bacteria 1325
423 Ga0207700_10521898 3300025928 Bacteria 1052
424 Ga0207664_10012380 3300025929 Bacteria 6096
425 Ga0207644_10109590 3300025931 Bacteria 2086
426 Ga0207644_10644089 3300025931 Bacteria 882
427 Ga0207644_11332323 3300025931 Bacteria 603
428 Ga0207690_10429900 3300025932 Bacteria 1058
429 Ga0207690_10490573 3300025932 Bacteria 992
430 Ga0207690_11114985 3300025932 Bacteria 658
431 Ga0207706_10042861 3300025933 Bacteria 4010
432 Ga0207706_10163653 3300025933 Bacteria 1955
433 Ga0207709_10272671 3300025935 Bacteria 1246
434 Ga0207670_10519532 3300025936 Bacteria 969
435 Ga0207669_10029042 3300025937 Bacteria 3052
436 Ga0207669_10248924 3300025937 Bacteria 1322
437 Ga0207669_10839533 3300025937 Bacteria 764
438 Ga0207704_10122749 3300025938 Bacteria 1782
439 Ga0207704_10479932 3300025938 Bacteria 998
440 Ga0207665_10000700 3300025939 Bacteria 22712
441 Ga0207665_10465973 3300025939 Bacteria 972
442 Ga0207665_10857639 3300025939 Bacteria 719
443 Ga0207711_10115930 3300025941 Bacteria 2387
444 Ga0207711_10453437 3300025941 Bacteria 1194
445 Ga0207711_10480020 3300025941 Bacteria 1158
446 Ga0207689_10072067 3300025942 Bacteria 2838
447 Ga0207689_10338223 3300025942 Bacteria 1250
448 Ga0207689_10678558 3300025942 Bacteria 868
449 Ga0207661_10000755 3300025944 Bacteria 21031
450 Ga0207667_10003903 3300025949 Bacteria 18339
451 Ga0207667_10005344 3300025949 Bacteria 15656
452 Ga0207667_10047821 3300025949 Bacteria 4526
453 Ga0207667_10050442 3300025949 Bacteria 4390
454 Ga0207667_10195106 3300025949 Bacteria 2077
455 Ga0207667_10425834 3300025949 Bacteria 1350
456 Ga0207667_11077373 3300025949 Bacteria 788
457 Ga0207667_11147246 3300025949 Bacteria 759
458 Ga0207712_10626335 3300025961 Bacteria 933
459 Ga0207668_10529148 3300025972 Bacteria 1018
460 Ga0207640_10007468 3300025981 Bacteria 6038
461 Ga0207640_10011464 3300025981 Bacteria 5023
462 Ga0207640_10059077 3300025981 Bacteria 2529
463 Ga0207640_10231667 3300025981 Bacteria 1421
464 Ga0207640_10642756 3300025981 Bacteria 903
465 Ga0207640_10903903 3300025981 Bacteria 771
466 Ga0207640_11201870 3300025981 Bacteria 674
467 Ga0207658_10038482 3300025986 Bacteria 3446
468 Ga0207658_11673137 3300025986 Bacteria 581
469 Ga0207703_10212197 3300026035 Bacteria 1727
470 Ga0207703_10586752 3300026035 Bacteria 1053
471 Ga0207703_10614912 3300026035 Bacteria 1029
472 Ga0207639_10005552 3300026041 Bacteria 8529
473 Ga0207639_10120573 3300026041 Bacteria 2154
474 Ga0207639_10403732 3300026041 Bacteria 1231
475 Ga0207639_10408576 3300026041 Bacteria 1225
476 Ga0207678_10016512 3300026067 Bacteria 6482
477 Ga0207678_10026683 3300026067 Bacteria 5039
478 Ga0207678_10068837 3300026067 Bacteria 3036
479 Ga0207678_10571857 3300026067 Bacteria 989
480 Ga0207678_10883321 3300026067 Bacteria 790
481 Ga0207708_10170684 3300026075 Bacteria 1722
482 Ga0207702_10038781 3300026078 Bacteria 3990
483 Ga0207702_10284656 3300026078 Bacteria 1564
484 Ga0207702_10596321 3300026078 Bacteria 1084
485 Ga0207641_10530953 3300026088 Bacteria 1145
486 Ga0207641_10993315 3300026088 Bacteria 836
487 Ga0207648_10066931 3300026089 Bacteria 3133
488 Ga0207676_10206133 3300026095 Bacteria 1741
489 Ga0207676_10631639 3300026095 Bacteria 1032
490 Ga0207676_11021251 3300026095 Bacteria 815
491 Ga0207674_10007442 3300026116 Bacteria 12762
492 Ga0207674_10037502 3300026116 Bacteria 5040
493 Ga0207674_10203175 3300026116 Bacteria 1931
494 Ga0207674_11192107 3300026116 Bacteria 731
495 Ga0207675_100298166 3300026118 Bacteria 1570
496 Ga0207675_101774510 3300026118 Bacteria 636
497 Ga0207683_10153255 3300026121 Bacteria 2081
498 Ga0207683_10170578 3300026121 Bacteria 1970
499 Ga0207683_10291320 3300026121 Bacteria 1493
500 Ga0207698_10075603 3300026142 Bacteria 2693
501 Ga0207698_10079194 3300026142 Bacteria 2642
502 Ga0207698_10319500 3300026142 Bacteria 1453
503 Ga0207698_10350996 3300026142 Bacteria 1393
504 Ga0209389_1000239 3300027296 Bacteria 35712
505 Ga0209389_1000690 3300027296 Bacteria 21019
506 Ga0209589_1007787 3300027357 Bacteria 17039
507 Ga0209489_100030 3300027361 Bacteria 185999
508 Ga0209489_114919 3300027361 Bacteria 5112
509 Ga0209700_100031 3300027363 Bacteria 207349
510 Ga0209179_1088166 3300027512 Bacteria 687
511 Ga0209588_1019963 3300027671 Bacteria 2096
512 Ga0209588_1037246 3300027671 Bacteria 1565
513 Ga0209588_1042228 3300027671 Bacteria 1473
514 Ga0268266_10023098 3300028379 Bacteria 5293
515 Ga0268266_10030787 3300028379 Bacteria 4557
516 Ga0268266_10233953 3300028379 Bacteria 1693
517 Ga0268266_10270068 3300028379 Bacteria 1578
518 Ga0268266_10296513 3300028379 Bacteria 1507
519 Ga0268266_10533691 3300028379 Bacteria 1123
520 Ga0268266_10601395 3300028379 Bacteria 1056
521 Ga0268265_11213129 3300028380 Bacteria 752
522 Ga0268264_10000035 3300028381 Bacteria 398196
523 Ga0307517_10213233 3300028786 Bacteria 1186
524 Ga0307515_10355834 3300028794 Bacteria 1108
525 Ga0307512_10263719 3300030522 Bacteria 843
526 Ga0265325_10390633 3300031241 Bacteria 610
527 Ga0265339_10030751 3300031249 Bacteria 3038
528 Ga0307408_100327901 3300031548 Bacteria 1292
529 Ga0307508_10000021 3300031616 Bacteria 183823
530 Ga0307508_10049567 3300031616 Bacteria 3740
531 Ga0307508_10064014 3300031616 Bacteria 3243
532 Ga0316579_10323998 3300031691 Bacteria 745
533 Ga0307413_10399379 3300031824 Bacteria 1076
534 Ga0307410_10094642 3300031852 Bacteria 2128
535 Ga0307407_10499689 3300031903 Bacteria 891
536 Ga0307510_10004554 3300033180 Bacteria 16321
537 Ga0307510_10050493 3300033180 Bacteria 4411
538 Ga0307510_10170185 3300033180 Bacteria 1759
539 Ga0373926_0035223 3300035083 Bacteria 1775
540 Ga0373944_0102069 3300035089 Bacteria 970
541 Ga0373923_0089414 3300035111 Bacteria 1345
542 Ga0373923_0295524 3300035111 Bacteria 766
543 Ga0373936_0009414 3300035113 Bacteria 3683
544 Ga0373936_0021916 3300035113 Bacteria 2487
545 Ga0373936_0054989 3300035113 Bacteria 1615
546 Ga0373936_0122921 3300035113 Bacteria 1110
547 Ga0373936_0150457 3300035113 Bacteria 1009
548 Ga0373954_0175369 3300035118 Bacteria 1051
549 Ga0373954_0567197 3300035118 Bacteria 563
550 Ga0373943_0239776 3300035170 Bacteria 1016
551 Ga0373943_0353506 3300035170 Bacteria 842
552 Ga0373946_0115373 3300035171 Bacteria 1220
553 Ga0316574_0003983 3300035398 Bacteria 7691
554 Ga0373935_0032938 3300035692 Bacteria 3223
555 Ga0373935_0042994 3300035692 Bacteria 2842
556 Ga0373927_0001314 3300035695 Bacteria 18769
557 Ga0373927_0016642 3300035695 Bacteria 4851
558 Ga0373927_0105328 3300035695 Bacteria 1836
559 Ga0373927_0517242 3300035695 Bacteria 789
560 Ga0373933_0001657 3300035724 Bacteria 12952
561 Ga0373947_0032609 3300035725 Bacteria 3071
562 Ga0373947_0043194 3300035725 Bacteria 2692
563 Ga0373947_0096218 3300035725 Bacteria 1853
564 Ga0373937_0291711 3300036401 Bacteria 1541
565 Ga0373937_0580910 3300036401 Bacteria 1064
566 Ga0373937_1093704 3300036401 Bacteria 746
567 Ga0310112_022182 3300036458 Bacteria 888
568 Ga0373925_0009010 3300037068 Bacteria 7267
569 Ga0373925_0089000 3300037068 Bacteria 2358
570 Ga0373925_0459540 3300037068 Bacteria 1043
571 Ga0395899_0136972 3300037312 Bacteria 1745
572 Ga0395899_0314745 3300037312 Bacteria 1056
573 Ga0395899_0838407 3300037312 Bacteria 565
574 Ga0395900_0002922 3300037418 Bacteria 18612
575 Ga0395900_0086928 3300037418 Bacteria 3213
576 Ga0395900_0132417 3300037418 Bacteria 2555
577 Ga0395898_0089582 3300037466 Bacteria 2961
578 Ga0395898_0111784 3300037466 Bacteria 2618
579 Ga0395898_0117507 3300037466 Bacteria 2548
580 Ga0395898_0234317 3300037466 Bacteria 1751
581 Ga0395905_0008568 3300037471 Bacteria 10082
582 Ga0395905_0349329 3300037471 Bacteria 1371
583 Ga0395905_0459564 3300037471 Bacteria 1171
584 Ga0436364_0722239 3300037853 Bacteria 6801
585 Ga0395901_0161914 3300038443 Bacteria 2350
586 Ga0395901_0990892 3300038443 Bacteria 817
587 Ga0400485_18562 3300038735 Bacteria 1200
588 Ga0436365_0396709 3300039437 Bacteria 84982
589 Ga0436365_0397559 3300039437 Bacteria 11175
590 Ga0436365_0658425 3300039437 Bacteria 1177
591 Ga0436365_0712770 3300039437 Bacteria 2536
592 Ga0436365_1704593 3300039437 Bacteria 2629
593 Ga0436365_1801845 3300039437 Bacteria 832
594 Ga0436365_1891429 3300039437 Bacteria 2040
595 Ga0436361_0940412 3300039447 Bacteria 5076
596 Ga0436363_0282582 3300039450 Bacteria 712
597 Ga0436363_0874061 3300039450 Bacteria 2000
598 Ga0436363_1445334 3300039450 Bacteria 13114
599 Ga0436363_1561684 3300039450 Bacteria 1190
600 Ga0436362_1010515 3300039453 Bacteria 5111
601 Ga0436362_1295787 3300039453 Bacteria 2077
602 Ga0451789_0121782 3300041443 Bacteria 1162
603 Ga0451795_0381612 3300041456 Bacteria 561
604 Ga0451835_0222244 3300041492 Bacteria 556
605 Ga0451839_0641073 3300041496 Bacteria 671
606 Ga0451841_1338321 3300041498 Bacteria 1172
607 Ga0451843_1523113 3300041509 Bacteria 900
608 Ga0451853_4040531 3300041512 Bacteria 1214
609 Ga0439448_0191032 3300042005 Bacteria 717
610 Ga0466972_0129894 3300044658 Bacteria 1186
611 Ga0466972_0139446 3300044658 Bacteria 1141
612 Ga0466965_0077020 3300044683 Bacteria 1683
613 Ga0466966_0000521 3300044684 Bacteria 24509
614 Ga0466966_0041436 3300044684 Bacteria 2959
615 Ga0466966_0874786 3300044684 Bacteria 542
616 Ga0466961_0000366 3300044693 Bacteria 29235
617 Ga0466963_0004594 3300044694 Bacteria 8038
618 Ga0466963_0037426 3300044694 Bacteria 3168
619 Ga0466963_0090700 3300044694 Bacteria 2081
620 Ga0466963_0315589 3300044694 Bacteria 1100
621 Ga0466971_0077492 3300044719 Bacteria 1513
622 Ga0466968_0004579 3300044735 Bacteria 5172
623 Ga0466970_0121485 3300044765 Bacteria 1431
624 Ga0466957_0037493 3300044842 Bacteria 2919
625 Ga0466957_0263354 3300044842 Bacteria 1149
626 Ga0466957_0269357 3300044842 Bacteria 1137
627 Ga0466960_0007406 3300044901 Bacteria 4457
628 Ga0466960_0089529 3300044901 Bacteria 1566
629 Ga0466960_0095256 3300044901 Bacteria 1524
630 Ga0466960_0199971 3300044901 Bacteria 1091
631 Ga0466959_0002745 3300045049 Bacteria 11338
632 Ga0466967_0047144 3300045976 Bacteria 3756
633 Ga0466967_0047422 3300045976 Bacteria 3745
634 Ga0466967_0221409 3300045976 Bacteria 1798
635 Ga0466967_0348932 3300045976 Bacteria 1432
636 Ga0495592_0122341 3300046454 Bacteria 1829
637 Ga0495592_0470201 3300046454 Bacteria 785
638 Ga0495603_0000101 3300046455 Bacteria 40111
639 Ga0495603_0151972 3300046455 Bacteria 1344
640 Ga0495603_0184270 3300046455 Bacteria 1208
641 Ga0495590_0052445 3300046457 Bacteria 1425
642 Ga0495629_0002313 3300046459 Bacteria 14675
643 Ga0495629_0040426 3300046459 Bacteria 3280
644 Ga0495629_0198898 3300046459 Bacteria 1386
645 Ga0495638_0039683 3300046460 Bacteria 2987
646 Ga0495641_0008274 3300046461 Bacteria 6362
647 Ga0495641_0041537 3300046461 Bacteria 2136
648 Ga0495651_0271890 3300046462 Bacteria 1148
649 Ga0495653_0073351 3300046463 Bacteria 2554
650 Ga0495653_0545348 3300046463 Bacteria 718
651 Ga0495650_0100364 3300046471 Bacteria 1088
652 Ga0495580_0000825 3300046472 Bacteria 26887
653 Ga0495580_0085055 3300046472 Bacteria 2203
654 Ga0495582_0000567 3300046473 Bacteria 20465
655 Ga0495582_0165820 3300046473 Bacteria 1257
656 Ga0495582_0322383 3300046473 Bacteria 889
657 Ga0495605_0080479 3300046474 Bacteria 1525
658 Ga0495605_0134196 3300046474 Bacteria 1114
659 Ga0495639_0005952 3300046475 Bacteria 5246
660 Ga0495639_0288498 3300046475 Bacteria 817
661 Ga0495662_0159561 3300046476 Bacteria 1111
662 Ga0495664_0010508 3300046477 Bacteria 5194
663 Ga0495664_0012345 3300046477 Bacteria 4837
664 Ga0495664_0177913 3300046477 Bacteria 1290
665 Ga0495664_0356689 3300046477 Bacteria 880
666 Ga0495664_0393443 3300046477 Bacteria 832
667 Ga0495584_0123278 3300046491 Bacteria 1313
668 Ga0495584_0295169 3300046491 Bacteria 823
669 Ga0495594_0000023 3300046499 Bacteria 70363
670 Ga0495594_0005644 3300046499 Bacteria 6435
671 Ga0495607_0185056 3300046501 Bacteria 1042
672 Ga0495607_0358055 3300046501 Bacteria 672
673 Ga0495606_0072551 3300046507 Bacteria 2162
674 Ga0495606_0116087 3300046507 Bacteria 1608
675 Ga0495606_0188096 3300046507 Bacteria 1185
676 Ga0495608_0304897 3300046511 Bacteria 985
677 Ga0495608_0603768 3300046511 Bacteria 658
678 Ga0495610_0038221 3300046512 Bacteria 2438
679 Ga0495610_0055240 3300046512 Bacteria 1915
680 Ga0495616_0400790 3300046513 Bacteria 564
681 Ga0495620_0167890 3300046515 Bacteria 851
682 Ga0495620_0313412 3300046515 Bacteria 596
683 Ga0495628_0033673 3300046516 Bacteria 4127
684 Ga0495628_0852568 3300046516 Bacteria 635
685 Ga0495628_0977645 3300046516 Bacteria 583
686 Ga0495630_0626510 3300046517 Bacteria 824
687 Ga0495631_0049011 3300046518 Bacteria 1851
688 Ga0495643_0090510 3300046522 Bacteria 1579
689 Ga0495643_0189186 3300046522 Bacteria 995
690 Ga0495643_0269994 3300046522 Bacteria 786
691 Ga0495648_0002079 3300046524 Bacteria 18947
692 Ga0495648_0004572 3300046524 Bacteria 11787
693 Ga0495648_0039173 3300046524 Bacteria 3019
694 Ga0495666_0022190 3300046526 Bacteria 3143
695 Ga0495652_0037254 3300046529 Bacteria 4220
696 Ga0495652_0120252 3300046529 Bacteria 2096
697 Ga0495665_0007540 3300046531 Bacteria 5890
698 Ga0495665_0051214 3300046531 Bacteria 2187
699 Ga0495665_0051943 3300046531 Bacteria 2170
700 Ga0495665_0443546 3300046531 Bacteria 656
701 Ga0495640_0039904 3300046533 Bacteria 3291
702 Ga0495640_0505508 3300046533 Bacteria 735
703 Ga0495640_0585540 3300046533 Bacteria 675
704 Ga0495586_0379665 3300046535 Bacteria 813
705 Ga0495587_0004094 3300046536 Bacteria 9650
706 Ga0495598_0227310 3300046537 Bacteria 683
707 Ga0495609_0033230 3300046538 Bacteria 2342
708 Ga0495609_0132198 3300046538 Bacteria 1068
709 Ga0495597_0298355 3300046542 Bacteria 625
710 Ga0495645_0028858 3300046543 Bacteria 4032
711 Ga0495622_0001800 3300046557 Bacteria 10567
712 Ga0495622_0026565 3300046557 Bacteria 2702
713 Ga0495622_0182664 3300046557 Bacteria 940
714 Ga0495667_0187515 3300046559 Bacteria 1326
715 Ga0495667_0273924 3300046559 Bacteria 1072
716 Ga0495667_0652315 3300046559 Bacteria 654
717 Ga0495656_0255011 3300046615 Bacteria 887
718 Ga0495668_0048247 3300046616 Bacteria 2363
719 Ga0495668_0136803 3300046616 Bacteria 1341
720 Ga0495668_0210384 3300046616 Bacteria 1065
721 Ga0495634_0001188 3300046642 Bacteria 24100
722 Ga0495634_0019165 3300046642 Bacteria 4863
723 Ga0495634_0110244 3300046642 Bacteria 1770
724 Ga0495611_0108056 3300046648 Bacteria 1294
725 Ga0495611_0179006 3300046648 Bacteria 991
726 Ga0495611_0458921 3300046648 Bacteria 580
727 Ga0495625_0029775 3300046660 Bacteria 4080
728 Ga0495625_0072992 3300046660 Bacteria 2406
729 Ga0495635_0002199 3300046663 Bacteria 13260
730 Ga0495635_0116416 3300046663 Bacteria 1824
731 Ga0495635_0162458 3300046663 Bacteria 1520
732 Ga0495661_0071787 3300046665 Bacteria 2022
733 Ga0495588_0001677 3300046674 Bacteria 9437
734 Ga0495588_0362169 3300046674 Bacteria 762
735 Ga0495657_0011029 3300046675 Bacteria 6776
736 Ga0495657_0157896 3300046675 Bacteria 1404
737 Ga0495599_0020333 3300046678 Bacteria 4134
738 Ga0495599_0112377 3300046678 Bacteria 1696
739 Ga0495623_0275545 3300046679 Bacteria 938
740 Ga0495623_0485744 3300046679 Bacteria 654
741 Ga0495623_0555467 3300046679 Bacteria 601
742 Ga0495623_0737871 3300046679 Bacteria 502
743 Ga0495646_0039825 3300046680 Bacteria 2896
744 Ga0495646_0132636 3300046680 Bacteria 1401
745 Ga0495647_0001896 3300046681 Bacteria 6509
746 Ga0495647_0556716 3300046681 Bacteria 536
747 Ga0495658_0014307 3300046683 Bacteria 4052
748 Ga0495658_0199940 3300046683 Bacteria 1245
749 Ga0495613_0000209 3300046689 Bacteria 57674
750 Ga0495613_0074319 3300046689 Bacteria 2475
751 Ga0495613_0093058 3300046689 Bacteria 2182
752 Ga0495613_0127022 3300046689 Bacteria 1828
753 Ga0495624_0021125 3300046690 Bacteria 4322
754 Ga0495624_0057274 3300046690 Bacteria 2450
755 Ga0495624_0157983 3300046690 Bacteria 1385
756 Ga0495671_0052466 3300046692 Bacteria 2027
757 Ga0495649_0032184 3300046694 Bacteria 2890
758 Ga0495649_0368687 3300046694 Bacteria 724
759 Ga0495589_0102933 3300046794 Bacteria 1381
760 Ga0495600_0012798 3300046809 Bacteria 5255
761 Ga0495600_0459810 3300046809 Bacteria 786
762 Ga0495660_0213481 3300046810 Bacteria 914
763 Ga0495581_0000567 3300047315 Bacteria 19221
764 Ga0495581_0003931 3300047315 Bacteria 8555
765 Ga0495581_0051284 3300047315 Bacteria 2383
766 Ga0495581_0206547 3300047315 Bacteria 1149
767 Ga0495604_0002274 3300047317 Bacteria 15383
768 Ga0495604_0043562 3300047317 Bacteria 3512
769 Ga0495604_0646201 3300047317 Bacteria 675
770 Ga0495674_0313960 3300047319 Bacteria 1278
771 Ga0495672_0076176 3300047320 Bacteria 1884
772 Ga0495672_0215594 3300047320 Bacteria 951
773 Ga0495676_0112890 3300047321 Bacteria 1990
774 Ga0495676_0161119 3300047321 Bacteria 1587
775 Ga0495680_0001595 3300047322 Bacteria 24172
776 Ga0495680_0473584 3300047322 Bacteria 854
777 Ga0495683_0215273 3300047323 Bacteria 859
778 Ga0495687_017339 3300047443 Bacteria 3596
779 Ga0495687_063407 3300047443 Bacteria 1513
780 Ga0495675_0017231 3300047444 Bacteria 4577
781 Ga0495677_0184590 3300047445 Bacteria 809
782 Ga0495673_0021326 3300047469 Bacteria 3202
783 Ga0495673_0058341 3300047469 Bacteria 1664
784 Ga0495673_0134074 3300047469 Bacteria 971
785 Ga0495684_0100756 3300047471 Bacteria 2184
786 Ga0495684_0102475 3300047471 Bacteria 2163
787 Ga0495593_0011735 3300047673 Bacteria 5025
788 Ga0495593_0013868 3300047673 Bacteria 4590
789 Ga0495593_0047886 3300047673 Bacteria 2273
790 Ga0495593_0079851 3300047673 Bacteria 1693
791 Ga0495602_0037408 3300048088 Bacteria 4505
792 Ga0495602_0273637 3300048088 Bacteria 1247
793 Ga0495614_0006480 3300048089 Bacteria 5252
794 Ga0496100_0278677 3300048903 Bacteria 1246
795 Ga0496101_0096933 3300048904 Bacteria 2201
796 Ga0496101_0185444 3300048904 Bacteria 1604
797 Ga0496101_0327599 3300048904 Bacteria 1202
798 Ga0496101_0560289 3300048904 Bacteria 903
799 Ga0496102_0012642 3300048905 Bacteria 7310
800 Ga0496102_0083006 3300048905 Bacteria 2956
801 Ga0496102_0124843 3300048905 Bacteria 2405
802 Ga0496102_0197915 3300048905 Bacteria 1894
803 Ga0496102_0267429 3300048905 Bacteria 1612
804 Ga0496102_0270149 3300048905 Bacteria 1603
805 Ga0496102_0292351 3300048905 Bacteria 1536
806 Ga0496102_0374778 3300048905 Bacteria 1339
807 Ga0496102_0673079 3300048905 Bacteria 958
808 Ga0496102_1017614 3300048905 Bacteria 749
809 Ga0496103_0038684 3300048906 Bacteria 2928
810 Ga0496103_0052051 3300048906 Bacteria 2536
811 Ga0496103_0085727 3300048906 Bacteria 1985
812 Ga0496103_0111335 3300048906 Bacteria 1739
813 Ga0496104_0020012 3300048907 Bacteria 6129
814 Ga0496104_0035023 3300048907 Bacteria 4686
815 Ga0496104_0058432 3300048907 Bacteria 3651
816 Ga0496104_0059878 3300048907 Bacteria 3606
817 Ga0496104_0154652 3300048907 Bacteria 2201
818 Ga0496104_0182233 3300048907 Bacteria 2010
819 Ga0496104_0307686 3300048907 Bacteria 1497
820 Ga0496104_1336276 3300048907 Bacteria 620
821 Ga0496105_0014239 3300048908 Bacteria 6328
822 Ga0496105_0201571 3300048908 Bacteria 1624
823 Ga0496105_0283738 3300048908 Bacteria 1335
824 Ga0496105_0492459 3300048908 Bacteria 963
825 Ga0496106_0000501 3300048909 Bacteria 27744
826 Ga0496106_0004380 3300048909 Bacteria 10485
827 Ga0496106_0076818 3300048909 Bacteria 2560
828 Ga0496106_0091610 3300048909 Bacteria 2347
829 Ga0496106_0251014 3300048909 Bacteria 1414
830 Ga0496107_0006040 3300048910 Bacteria 8308
831 Ga0496107_0008103 3300048910 Bacteria 7260
832 Ga0496107_0068556 3300048910 Bacteria 2574
833 Ga0496107_0194019 3300048910 Bacteria 1509
834 Ga0496107_0838959 3300048910 Bacteria 672
835 Ga0496108_0024615 3300048911 Bacteria 4957
836 Ga0496108_0072191 3300048911 Bacteria 2913
837 Ga0496108_0204531 3300048911 Bacteria 1713
838 Ga0496108_0339498 3300048911 Bacteria 1310
839 Ga0496108_0738291 3300048911 Bacteria 852
840 Ga0496109_0000607 3300048912 Bacteria 29944
841 Ga0496109_0027545 3300048912 Bacteria 5075
842 Ga0496109_0039020 3300048912 Bacteria 4297
843 Ga0496109_0067975 3300048912 Bacteria 3265
844 Ga0496109_0304897 3300048912 Bacteria 1502
845 Ga0496109_0493161 3300048912 Bacteria 1156
846 Ga0496109_0625003 3300048912 Bacteria 1014
847 Ga0496109_0989925 3300048912 Bacteria 778
848 Ga0496110_0040514 3300048913 Bacteria 4059
849 Ga0496110_0060742 3300048913 Bacteria 3334
850 Ga0496110_0145032 3300048913 Bacteria 2147
851 Ga0496110_0174904 3300048913 Bacteria 1948
852 Ga0496110_0181218 3300048913 Bacteria 1913
853 Ga0496111_0076985 3300048914 Bacteria 2432
854 Ga0496111_0078080 3300048914 Bacteria 2414
855 Ga0496111_0166319 3300048914 Bacteria 1638
856 Ga0496111_0497553 3300048914 Bacteria 897
857 Ga0496112_0007967 3300048915 Bacteria 9447
858 Ga0496112_0011676 3300048915 Bacteria 8036
859 Ga0496112_0025348 3300048915 Bacteria 5695
860 Ga0496112_0065599 3300048915 Bacteria 3583
861 Ga0496112_0075320 3300048915 Bacteria 3338
862 Ga0496112_0117718 3300048915 Bacteria 2627
863 Ga0496113_0016846 3300048916 Bacteria 5058
864 Ga0496113_0052873 3300048916 Bacteria 3035
865 Ga0496113_0079460 3300048916 Bacteria 2511
866 Ga0496113_0217859 3300048916 Bacteria 1521
867 Ga0496113_0811150 3300048916 Bacteria 743
868 Ga0496114_0003436 3300048917 Bacteria 12148
869 Ga0496114_0083854 3300048917 Bacteria 2697
870 Ga0496114_0529359 3300048917 Bacteria 1042
871 Ga0496115_0001779 3300048918 Bacteria 15419
872 Ga0496115_0038929 3300048918 Bacteria 3776
873 Ga0496115_0049091 3300048918 Bacteria 3377
874 Ga0496115_0184723 3300048918 Bacteria 1723
875 Ga0496116_0062801 3300048919 Bacteria 2397
876 Ga0496117_0128756 3300048920 Bacteria 1539
877 Ga0496117_0210526 3300048920 Bacteria 1090
878 Ga0496118_0021216 3300048921 Bacteria 5727
879 Ga0496118_0062071 3300048921 Bacteria 2762
880 Ga0496118_0471192 3300048921 Bacteria 632
881 Ga0496119_0026902 3300048922 Bacteria 3973
882 Ga0496120_0029823 3300048923 Bacteria 3325
883 Ga0496121_0000330 3300048924 Bacteria 98687
884 Ga0496121_0026502 3300048924 Bacteria 5460
885 Ga0496121_0089878 3300048924 Bacteria 2403
886 Ga0496121_0100440 3300048924 Bacteria 2233
887 Ga0496121_0311134 3300048924 Bacteria 1065
888 Ga0496121_0431633 3300048924 Bacteria 854
889 Ga0496122_0267490 3300048925 Bacteria 944
890 Ga0496123_0124220 3300048926 Bacteria 1444
891 Ga0496124_0104798 3300048927 Bacteria 2286
892 Ga0496124_0285506 3300048927 Bacteria 1201
893 Ga0496125_0000092 3300048928 Bacteria 211050
894 Ga0496125_0216754 3300048928 Bacteria 1237
895 Ga0496126_0024368 3300048929 Bacteria 5843
896 Ga0496126_0040306 3300048929 Bacteria 4330
897 Ga0496126_0086989 3300048929 Bacteria 2754
898 Ga0496126_0297425 3300048929 Bacteria 1333
899 Ga0496126_0316341 3300048929 Bacteria 1284
900 Ga0496126_0380561 3300048929 Bacteria 1149
901 Ga0495682_0049957 3300049460 Bacteria 1523
902 Ga0495682_0058061 3300049460 Bacteria 1400
903 Ga0501031_0013113 3300049568 Bacteria 5406
904 Ga0501031_0032687 3300049568 Bacteria 3392
905 Ga0501031_0185882 3300049568 Bacteria 1357
906 Ga0501031_0472556 3300049568 Bacteria 809
907 Ga0501032_0004449 3300049569 Bacteria 10567
908 Ga0501032_0091399 3300049569 Bacteria 2019
909 Ga0501032_0321513 3300049569 Bacteria 998
910 Ga0501033_0001618 3300049570 Bacteria 19786
911 Ga0501033_0063484 3300049570 Bacteria 2718
912 Ga0501033_0112705 3300049570 Bacteria 1978
913 Ga0501033_0623703 3300049570 Bacteria 738
914 Ga0501033_0824038 3300049570 Bacteria 626
915 Ga0501034_0000061 3300049571 Bacteria 195178
916 Ga0501034_0022650 3300049571 Bacteria 6400
917 Ga0501034_0481310 3300049571 Bacteria 1156
918 Ga0501036_0000054 3300049572 Bacteria 74190
919 Ga0501036_0053501 3300049572 Bacteria 3418
920 Ga0501036_0092271 3300049572 Bacteria 2558
921 Ga0501036_0874088 3300049572 Bacteria 738
922 Ga0501036_0950107 3300049572 Bacteria 704
923 Ga0501037_0000093 3300049573 Bacteria 83246
924 Ga0501037_0007172 3300049573 Bacteria 8144
925 Ga0501037_0046285 3300049573 Bacteria 3191
926 Ga0501037_0294875 3300049573 Bacteria 1127
927 Ga0501038_0000066 3300049574 Bacteria 86216
928 Ga0501038_0004223 3300049574 Bacteria 13348
929 Ga0501038_0172058 3300049574 Bacteria 1752
930 Ga0501038_0415028 3300049574 Bacteria 1039
931 Ga0501039_0008477 3300049575 Bacteria 7837
932 Ga0501039_0019038 3300049575 Bacteria 5267
933 Ga0501039_0354623 3300049575 Bacteria 1152
934 Ga0501039_0824020 3300049575 Bacteria 723
935 Ga0501039_1393036 3300049575 Unclassified 540
936 Ga0501040_0020029 3300049576 Bacteria 4455
937 Ga0501040_0068930 3300049576 Bacteria 2439
938 Ga0501040_0131152 3300049576 Bacteria 1762
939 Ga0501041_0032146 3300049577 Bacteria 3171
940 Ga0501041_0085869 3300049577 Bacteria 1941
941 Ga0501042_0166663 3300049578 Bacteria 1589
942 Ga0501042_0205634 3300049578 Bacteria 1420
943 Ga0501042_0286335 3300049578 Bacteria 1190
944 Ga0501043_0000325 3300049579 Bacteria 43003
945 Ga0501043_0008239 3300049579 Bacteria 8214
946 Ga0501043_0243711 3300049579 Bacteria 1386
947 Ga0501046_0005977 3300049580 Bacteria 10832
948 Ga0501046_0062747 3300049580 Bacteria 2903
949 Ga0501046_0083668 3300049580 Bacteria 2462
950 Ga0501046_0091643 3300049580 Bacteria 2337
951 Ga0501047_0000621 3300049581 Bacteria 37465
952 Ga0501047_0170642 3300049581 Bacteria 2044
953 Ga0501048_0001552 3300049582 Bacteria 17450
954 Ga0501048_0058522 3300049582 Bacteria 2731
955 Ga0501067_0000118 3300049583 Bacteria 44933
956 Ga0501068_0000133 3300049584 Bacteria 33616
957 Ga0501069_0053678 3300049585 Bacteria 2244
958 Ga0501070_0002284 3300049586 Bacteria 16847
959 Ga0501070_0039742 3300049586 Bacteria 3923
960 Ga0501070_0055812 3300049586 Bacteria 3274
961 Ga0501070_0337718 3300049586 Bacteria 1224
962 Ga0501070_0414481 3300049586 Bacteria 1088
963 Ga0501070_0430836 3300049586 Bacteria 1064
964 Ga0501071_0024526 3300049587 Bacteria 4219
965 Ga0501071_0051416 3300049587 Bacteria 2969
966 Ga0501072_0014489 3300049588 Bacteria 6043
967 Ga0501072_0055713 3300049588 Bacteria 3115
968 Ga0501072_0176281 3300049588 Bacteria 1705
969 Ga0501072_0552318 3300049588 Bacteria 909
970 Ga0501072_0620804 3300049588 Bacteria 852
971 Ga0501073_0002382 3300049589 Bacteria 14070
972 Ga0501073_0101499 3300049589 Bacteria 1998
973 Ga0501073_0104843 3300049589 Bacteria 1962
974 Ga0501073_0204924 3300049589 Bacteria 1363
975 Ga0501074_0001116 3300049590 Bacteria 17526
976 Ga0501074_0032636 3300049590 Bacteria 3771
977 Ga0501074_0082760 3300049590 Bacteria 2301
978 Ga0501074_0144381 3300049590 Bacteria 1702
979 Ga0501074_0678180 3300049590 Bacteria 728
980 Ga0501075_0019174 3300049591 Bacteria 4960
981 Ga0501075_0346758 3300049591 Bacteria 1132
982 Ga0501076_0037829 3300049592 Bacteria 3786
983 Ga0501076_0159682 3300049592 Bacteria 1836
984 Ga0501076_1048934 3300049592 Bacteria 671
985 Ga0501077_0019658 3300049593 Bacteria 4272
986 Ga0501077_0255377 3300049593 Bacteria 1115
987 Ga0501079_0001682 3300049741 Bacteria 15732
988 Ga0501079_0005574 3300049741 Bacteria 9395
989 Ga0501079_0282495 3300049741 Bacteria 1298
990 Ga0501080_0001100 3300049742 Bacteria 22276
991 Ga0501080_0041070 3300049742 Bacteria 4312
992 Ga0501080_0055664 3300049742 Bacteria 3684
993 Ga0501080_0128269 3300049742 Bacteria 2348
994 Ga0501080_0263073 3300049742 Bacteria 1571
995 Ga0501080_0358259 3300049742 Bacteria 1316
996 Ga0501081_0007723 3300049743 Bacteria 6973
997 Ga0501081_0025704 3300049743 Bacteria 3964
998 Ga0501081_0428896 3300049743 Bacteria 981
999 Ga0501083_0000331 3300049744 Bacteria 29941
1000 Ga0501083_0109353 3300049744 Bacteria 1818
1001 Ga0501083_0139323 3300049744 Bacteria 1589
1002 Ga0501083_0401067 3300049744 Bacteria 892
1003 Ga0501035_0000099 3300049822 Bacteria 108224
1004 Ga0501035_0039707 3300049822 Bacteria 4258
1005 Ga0501035_0065996 3300049822 Bacteria 3212
1006 Ga0501035_0214243 3300049822 Bacteria 1647
1007 Ga0501035_0333208 3300049822 Bacteria 1273
1008 Ga0501035_0407459 3300049822 Bacteria 1130
1009 Ga0501044_0000367 3300049823 Bacteria 56521
1010 Ga0501044_0018546 3300049823 Bacteria 7456
1011 Ga0501044_0154101 3300049823 Bacteria 2278
1012 Ga0501044_0324969 3300049823 Bacteria 1462
1013 Ga0501045_0023312 3300049824 Bacteria 4437
1014 Ga0501045_0055451 3300049824 Bacteria 2898
1015 Ga0501045_0088929 3300049824 Bacteria 2281
1016 nmdc:mga03683_143257_c1 3300050489 Bacteria 1075
1017 nmdc:mga03n38_42619_c1 3300050490 Bacteria 1985
1018 nmdc:mga03n38_477446_c1 3300050490 Bacteria 697
1019 nmdc:mga03n38_92246_c1 3300050490 Bacteria 1444
1020 nmdc:mga00v17_43495_c1 3300050491 Bacteria 2705
1021 nmdc:mga00v17_45090_c1 3300050491 Bacteria 2662
1022 nmdc:mga0yw44_103621_c1 3300050492 Bacteria 1815
1023 nmdc:mga0yw44_139125_c1 3300050492 Bacteria 1577
1024 nmdc:mga0yw44_361482_c1 3300050492 Bacteria 978
1025 nmdc:mga0yw44_574553_c1 3300050492 Bacteria 766
1026 nmdc:mga0yw44_617652_c1 3300050492 Bacteria 737
1027 nmdc:mga0yw44_77229_c1 3300050492 Bacteria 2080
1028 nmdc:mga0k408_265081_c1 3300050493 Bacteria 1026
1029 nmdc:mga0k408_279571_c1 3300050493 Bacteria 996
1030 nmdc:mga0k408_66493_c1 3300050493 Bacteria 2100
1031 nmdc:mga0k408_99872_c1 3300050493 Bacteria 1710
1032 nmdc:mga06z11_271591_c1 3300050494 Bacteria 1003
1033 nmdc:mga06z11_67849_c1 3300050494 Bacteria 1879
1034 nmdc:mga07m45_258218_c1 3300050496 Bacteria 1014
1035 nmdc:mga07m45_268193_c1 3300050496 Bacteria 993
1036 nmdc:mga07m45_415448_c1 3300050496 Bacteria 781
1037 nmdc:mga07m45_4525_c1 3300050496 Bacteria 6809
1038 nmdc:mga07m45_89974_c1 3300050496 Bacteria 1758
1039 nmdc:mga09592_280849_c1 3300050508 Bacteria 1444
1040 nmdc:mga0a205_1008445_c1 3300050515 Bacteria 679
1041 Ga0495601_0169277 3300053077 Bacteria 1428
1042 Ga0495612_0026231 3300053078 Bacteria 2342
1043 Ga0495612_0114142 3300053078 Bacteria 1158
1044 Ga0495612_0118165 3300053078 Bacteria 1139
1045 Ga0500610_0096060 3300053079 Bacteria 1537
1046 Ga0500635_0017606 3300053080 Bacteria 2144
1047 Ga0495655_0003985 3300053083 Bacteria 2488
1048 Ga0495655_0200339 3300053083 Bacteria 652
1049 Ga0495595_0049648 3300053084 Bacteria 1941
1050 Ga0495595_0107863 3300053084 Bacteria 1348
1051 Ga0495619_0002921 3300053085 Bacteria 11107
1052 Ga0495619_0036177 3300053085 Bacteria 3214
1053 Ga0495619_0102780 3300053085 Bacteria 1946
1054 Ga0500578_0081750 3300053086 Bacteria 2054
1055 Ga0500643_000040 3300053087 Bacteria 168108
1056 Ga0500644_0082590 3300053088 Bacteria 1185
1057 Ga0500646_0077478 3300053090 Bacteria 1008
1058 Ga0500647_0105909 3300053091 Bacteria 1340
1059 Ga0500647_0353335 3300053091 Bacteria 611
1060 Ga0500651_0109234 3300053093 Bacteria 1689
1061 Ga0500651_0302201 3300053093 Bacteria 918
1062 Ga0500566_0000020 3300053094 Bacteria 83462
1063 Ga0500566_0000230 3300053094 Bacteria 29930
1064 Ga0500566_0013088 3300053094 Bacteria 4890
1065 Ga0500566_0106566 3300053094 Bacteria 1529
1066 Ga0500566_0149124 3300053094 Bacteria 1232
1067 Ga0500640_000021 3300053095 Bacteria 23372
1068 Ga0500640_052451 3300053095 Bacteria 1781
1069 Ga0500650_0158756 3300053098 Bacteria 1043
1070 Ga0500554_014125 3300053102 Bacteria 2053
1071 Ga0500554_053556 3300053102 Bacteria 1276
1072 Ga0500555_002003 3300053103 Bacteria 6011
1073 Ga0500556_0033670 3300053104 Bacteria 1758
1074 Ga0500557_000063 3300053105 Bacteria 43744
1075 Ga0500562_006379 3300053108 Bacteria 2974
1076 Ga0500562_006548 3300053108 Bacteria 2934
1077 Ga0500569_035310 3300053109 Bacteria 1432
1078 Ga0500572_000068 3300053111 Bacteria 32485
1079 Ga0500572_228047 3300053111 Bacteria 608
1080 Ga0500591_041240 3300053115 Bacteria 2195
1081 Ga0500592_004040 3300053116 Bacteria 2341
1082 Ga0500595_000468 3300053119 Bacteria 24982
1083 Ga0500595_000947 3300053119 Bacteria 16362
1084 Ga0500595_002807 3300053119 Bacteria 8379
1085 Ga0500595_009612 3300053119 Bacteria 3895
1086 Ga0500595_040173 3300053119 Bacteria 1510
1087 Ga0500607_068350 3300053121 Bacteria 1838
1088 Ga0500608_018296 3300053122 Bacteria 3194
1089 Ga0500608_088864 3300053122 Bacteria 1447
1090 Ga0500614_000051 3300053123 Bacteria 24948
1091 Ga0500614_013030 3300053123 Bacteria 1821
1092 Ga0500618_034285 3300053125 Bacteria 1181
1093 Ga0500618_112380 3300053125 Bacteria 615
1094 Ga0500621_208198 3300053126 Bacteria 687
1095 Ga0500626_067080 3300053128 Bacteria 1600
1096 Ga0500642_0001840 3300053130 Bacteria 6124
1097 Ga0500652_137450 3300053131 Bacteria 1018
1098 Ga0500655_022750 3300053133 Bacteria 1181
1099 Ga0500658_0044794 3300053134 Bacteria 1786
1100 Ga0500559_0002983 3300053136 Bacteria 8485
1101 Ga0500559_0202559 3300053136 Bacteria 936
1102 Ga0500564_007088 3300053138 Bacteria 4730
1103 Ga0500568_0003017 3300053139 Bacteria 9628
1104 Ga0500568_0005161 3300053139 Bacteria 6809
1105 Ga0500585_072775 3300053144 Bacteria 1241
1106 Ga0500590_239433 3300053148 Bacteria 731
1107 Ga0500603_001419 3300053150 Bacteria 5474
1108 Ga0500603_001515 3300053150 Bacteria 5282
1109 Ga0500616_0016770 3300053153 Bacteria 4163
1110 Ga0500619_057718 3300053154 Bacteria 1270
1111 Ga0500620_010151 3300053155 Bacteria 2464
1112 Ga0500627_0054792 3300053158 Bacteria 1745
1113 Ga0500627_0080236 3300053158 Bacteria 1454
1114 Ga0500627_0421085 3300053158 Bacteria 566
1115 Ga0500630_016613 3300053159 Bacteria 3623
1116 Ga0500633_0044024 3300053160 Bacteria 1513
1117 Ga0500638_063082 3300053162 Bacteria 1778
1118 Ga0500638_216071 3300053162 Bacteria 799
1119 Ga0500638_286593 3300053162 Bacteria 643
1120 Ga0500639_000646 3300053163 Bacteria 17487
1121 Ga0500636_0000120 3300053177 Bacteria 41238
1122 Ga0500636_0088066 3300053177 Bacteria 1781
1123 Ga0500636_0197695 3300053177 Bacteria 1066
1124 Ga0500637_0011077 3300053178 Bacteria 4645
1125 Ga0500611_006610 3300053727 Bacteria 1698
1126 Ga0500625_000384 3300053729 Bacteria 11384
1127 Ga0500609_000334 3300053731 Bacteria 6983
1128 Ga0500596_001023 3300053735 Bacteria 5605
1129 Ga0500599_000648 3300053736 Bacteria 3728
1130 Ga0500601_000586 3300053737 Bacteria 5199
1131 Ga0501084_0020657 3300054114 Bacteria 5492
1132 Ga0501084_0037603 3300054114 Bacteria 4045
1133 Ga0501084_0042351 3300054114 Bacteria 3809
1134 Ga0501084_0060211 3300054114 Bacteria 3179
1135 Ga0501084_0351727 3300054114 Unclassified 1245
1136 Ga0501084_0530879 3300054114 Bacteria 995
1137 Ga0500661_001956 3300055283 Bacteria 3887
1138 Ga0500661_009211 3300055283 Bacteria 1811
1139 Ga0500661_022759 3300055283 Bacteria 1110
1140 Ga0587090_040835 3300059510 Bacteria 816
1141 Ga0587078_058819 3300059646 Bacteria 578
1142 Ga0501082_0009862 3300060353 Bacteria 8229
1143 Ga0501082_0060808 3300060353 Bacteria 3252
1144 Ga0501082_0105358 3300060353 Bacteria 2439
1145 Ga0501082_0188884 3300060353 Bacteria 1792
1146 Ga0501082_0273997 3300060353 Bacteria 1469
1147 Ga0466962_0190039 3300061719 Bacteria 1002
1148 Ga0466962_0376500 3300061719 Bacteria 709
1149 Ga0530510_0022872 3300061734 Bacteria 4454
1150 Ga0530510_0190487 3300061734 Bacteria 1522

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0990892 Ga0395901_0990892_35_436 131
2 3300049744 Ga0501083_0109353 Ga0501083_0109353_1389_1799 132
3 3300014325 Ga0163163_10786430 Ga0163163_107864302 134
4 3300025911 Ga0207654_10507518 Ga0207654_105075181 135
5 3300053108 Ga0500562_006379 Ga0500562_006379_2382_2849 135
6 3300014326 Ga0157380_10009856 Ga0157380_100098567 136
7 3300026067 Ga0207678_10883321 Ga0207678_108833212 136
8 3300025932 Ga0207690_10490573 Ga0207690_104905732 139
9 3300046531 Ga0495665_0051943 Ga0495665_0051943_1438_1866 139
10 3300046679 Ga0495623_0485744 Ga0495623_0485744_218_643 139
11 3300049588 Ga0501072_0176281 Ga0501072_0176281_899_1348 141
12 3300049742 Ga0501080_0263073 Ga0501080_0263073_240_689 141
13 3300049744 Ga0501083_0139323 Ga0501083_0139323_554_1003 141
14 3300060353 Ga0501082_0188884 Ga0501082_0188884_994_1443 141
15 3300005578 Ga0068854_100013144 Ga0068854_1000131446 142
16 3300025981 Ga0207640_10007468 Ga0207640_100074687 142
17 3300026041 Ga0207639_10005552 Ga0207639_100055523 142
18 3300005458 Ga0070681_10414575 Ga0070681_104145752 143
19 3300005535 Ga0070684_100087521 Ga0070684_1000875213 143
20 3300025944 Ga0207661_10000755 Ga0207661_1000075516 143
21 iso_pu_bacteria 2738541293 2738799044 143
22 3300014325 Ga0163163_10456111 Ga0163163_104561111 144
23 3300049575 Ga0501039_1393036 Ga0501039_1393036_55_525 144
24 3300021384 Ga0213876_10009781 Ga0213876_100097812 145
25 3300021388 Ga0213875_10000861 Ga0213875_100008613 145
26 3300037853 Ga0436364_0722239 Ga0436364_0722239_6064_6546 145
27 3300039437 Ga0436365_0397559 Ga0436365_0397559_6278_6760 145
28 3300039453 Ga0436362_1010515 Ga0436362_1010515_3344_3826 145
29 iso_pu_bacteria 2513237101 2513696032 145
30 iso_pu_bacteria 2721755755 2723846267 145
31 iso_pu_bacteria 2842509118 2842510330 145
32 iso_pu_bacteria 2851182111 2851187065 145
33 iso_pu_bacteria 2874604998 2874610768 145
34 iso_pu_bacteria 2922361189 2922362070 145
35 iso_pu_bacteria 2922386360 2922388162 145
36 iso_pu_bacteria 3003930520 3003933356 145
37 iso_pu_bacteria 8006964411 8006964642 145
38 iso_pu_bacteria 8006994254 8006999936 145
39 iso_pu_bacteria 8019668869 8019673242 145
40 iso_pu_bacteria 8019678201 8019682886 145
41 iso_pu_bacteria 8057529695 8057535321 145
42 3300005355 Ga0070671_100401212 Ga0070671_1004012123 146
43 3300005530 Ga0070679_100106756 Ga0070679_1001067563 146
44 3300005548 Ga0070665_100525949 Ga0070665_1005259492 146
45 3300005548 Ga0070665_100780239 Ga0070665_1007802391 146
46 3300006177 Ga0075362_10115582 Ga0075362_101155822 146
47 3300006178 Ga0075367_10120197 Ga0075367_101201972 146
48 3300006186 Ga0075369_10214425 Ga0075369_102144251 146
49 3300006237 Ga0097621_101721795 Ga0097621_1017217952 146
50 3300009092 Ga0105250_10053022 Ga0105250_100530221 146
51 3300009093 Ga0105240_10453740 Ga0105240_104537402 146
52 3300010375 Ga0105239_11986258 Ga0105239_119862581 146
53 3300012490 Ga0157322_1011308 Ga0157322_10113081 146
54 3300013296 Ga0157374_11584631 Ga0157374_115846311 146
55 3300013308 Ga0157375_10298608 Ga0157375_102986082 146
56 3300014325 Ga0163163_10177924 Ga0163163_101779244 146
57 3300014325 Ga0163163_11154795 Ga0163163_111547951 146
58 3300014968 Ga0157379_10208848 Ga0157379_102088481 146
59 3300014969 Ga0157376_11981697 Ga0157376_119816971 146
60 3300025913 Ga0207695_10692486 Ga0207695_106924861 146
61 3300025921 Ga0207652_10085230 Ga0207652_100852304 146
62 3300025931 Ga0207644_11332323 Ga0207644_113323231 146
63 3300025932 Ga0207690_11114985 Ga0207690_111149851 146
64 3300025937 Ga0207669_10029042 Ga0207669_100290423 146
65 3300025937 Ga0207669_10839533 Ga0207669_108395331 146
66 3300026078 Ga0207702_10596321 Ga0207702_105963212 146
67 3300026116 Ga0207674_11192107 Ga0207674_111921071 146
68 3300028379 Ga0268266_10233953 Ga0268266_102339532 146
69 3300028380 Ga0268265_11213129 Ga0268265_112131291 146
70 3300031241 Ga0265325_10390633 Ga0265325_103906331 146
71 3300031616 Ga0307508_10049567 Ga0307508_100495673 146
72 3300031824 Ga0307413_10399379 Ga0307413_103993792 146
73 3300031852 Ga0307410_10094642 Ga0307410_100946422 146
74 3300031903 Ga0307407_10499689 Ga0307407_104996892 146
75 3300035113 Ga0373936_0150457 Ga0373936_0150457_197_640 146
76 3300046518 Ga0495631_0049011 Ga0495631_0049011_605_1048 146
77 3300046535 Ga0495586_0379665 Ga0495586_0379665_26_469 146
78 3300046537 Ga0495598_0227310 Ga0495598_0227310_72_515 146
79 3300046559 Ga0495667_0652315 Ga0495667_0652315_93_536 146
80 3300046616 Ga0495668_0048247 Ga0495668_0048247_926_1369 146
81 3300046679 Ga0495623_0737871 Ga0495623_0737871_49_492 146
82 3300046694 Ga0495649_0368687 Ga0495649_0368687_127_570 146
83 3300046809 Ga0495600_0459810 Ga0495600_0459810_225_668 146
84 3300047322 Ga0495680_0473584 Ga0495680_0473584_103_546 146
85 3300047445 Ga0495677_0184590 Ga0495677_0184590_130_573 146
86 3300048910 Ga0496107_0838959 Ga0496107_0838959_149_592 146
87 3300048918 Ga0496115_0049091 Ga0496115_0049091_1488_1931 146
88 3300049570 Ga0501033_0623703 Ga0501033_0623703_70_522 146
89 3300049593 Ga0501077_0255377 Ga0501077_0255377_129_590 146
90 3300049743 Ga0501081_0428896 Ga0501081_0428896_20_481 146
91 3300050490 nmdc:mga03n38_477446_c1 nmdc:mga03n38_477446_c1_241_684 146
92 3300050493 nmdc:mga0k408_99872_c1 nmdc:mga0k408_99872_c1_780_1223 146
93 3300053158 Ga0500627_0054792 Ga0500627_0054792_1021_1464 146
94 3300053158 Ga0500627_0421085 Ga0500627_0421085_68_511 146
95 iso_pu_bacteria 2508501128 2509151346 146
96 iso_pu_bacteria 643348564 643604725 146
97 3300021384 Ga0213876_10048574 Ga0213876_100485744 147
98 3300038735 Ga0400485_18562 Ga0400485_18562_630_1088 147
99 3300039437 Ga0436365_1704593 Ga0436365_1704593_198_650 147
100 3300039450 Ga0436363_0282582 Ga0436363_0282582_33_485 147
101 3300046455 Ga0495603_0184270 Ga0495603_0184270_146_592 147
102 3300046491 Ga0495584_0295169 Ga0495584_0295169_191_667 147
103 3300046615 Ga0495656_0255011 Ga0495656_0255011_68_544 147
104 3300049568 Ga0501031_0185882 Ga0501031_0185882_582_1046 147
105 3300049570 Ga0501033_0824038 Ga0501033_0824038_58_522 147
106 3300049571 Ga0501034_0022650 Ga0501034_0022650_149_649 147
107 3300049573 Ga0501037_0294875 Ga0501037_0294875_341_805 147
108 3300049574 Ga0501038_0415028 Ga0501038_0415028_100_564 147
109 3300049576 Ga0501040_0131152 Ga0501040_0131152_1274_1741 147
110 3300049577 Ga0501041_0085869 Ga0501041_0085869_763_1227 147
111 3300049578 Ga0501042_0166663 Ga0501042_0166663_771_1235 147
112 3300049579 Ga0501043_0243711 Ga0501043_0243711_622_1086 147
113 3300049580 Ga0501046_0062747 Ga0501046_0062747_331_795 147
114 3300049582 Ga0501048_0058522 Ga0501048_0058522_1662_2126 147
115 3300049586 Ga0501070_0414481 Ga0501070_0414481_600_1064 147
116 3300049590 Ga0501074_0144381 Ga0501074_0144381_419_883 147
117 3300049742 Ga0501080_0055664 Ga0501080_0055664_935_1399 147
118 3300049743 Ga0501081_0025704 Ga0501081_0025704_1094_1558 147
119 3300049822 Ga0501035_0407459 Ga0501035_0407459_468_932 147
120 3300049824 Ga0501045_0023312 Ga0501045_0023312_3468_3935 147
121 3300054114 Ga0501084_0042351 Ga0501084_0042351_2127_2594 147
122 3300060353 Ga0501082_0009862 Ga0501082_0009862_550_1014 147
123 3300061734 Ga0530510_0190487 Ga0530510_0190487_108_572 147
124 iso_pu_bacteria 2507262055 2507509894 147
125 iso_pu_bacteria 2508501042 2508698166 147
126 iso_pu_bacteria 2511231028 2511395489 147
127 iso_pu_bacteria 2513237095 2513652932 147
128 iso_pu_bacteria 2513237102 2513703512 147
129 iso_pu_bacteria 2513237104 2513720920 147
130 iso_pu_bacteria 2513237139 2513875979 147
131 iso_pu_bacteria 2513237161 2514011362 147
132 iso_pu_bacteria 2515154112 2515629262 147
133 iso_pu_bacteria 2517093001 2517103401 147
134 iso_pu_bacteria 2528768022 2528853016 147
135 iso_pu_bacteria 2617270735 2617349418 147
136 iso_pu_bacteria 2802429603 2805917488 147
137 iso_pu_bacteria 2816332527 2818242399 147
138 iso_pu_bacteria 2824600985 2824602006 147
139 iso_pu_bacteria 2824609381 2824609994 147
140 iso_pu_bacteria 2824617872 2824620208 147
141 iso_pu_bacteria 2824626560 2824627580 147
142 iso_pu_bacteria 2824635225 2824639390 147
143 iso_pu_bacteria 2824644064 2824646498 147
144 iso_pu_bacteria 2824653114 2824659793 147
145 iso_pu_bacteria 2824661429 2824664870 147
146 iso_pu_bacteria 2824679649 2824685232 147
147 iso_pu_bacteria 2824696289 2824701731 147
148 iso_pu_bacteria 2824714736 2824718127 147
149 iso_pu_bacteria 2824723954 2824727014 147
150 iso_pu_bacteria 2824732956 2824737625 147
151 iso_pu_bacteria 2824746037 2824747311 147
152 iso_pu_bacteria 2824773399 2824774155 147
153 iso_pu_bacteria 2838122688 2838127675 147
154 iso_pu_bacteria 2841941048 2841941377 147
155 iso_pu_bacteria 2841949485 2841952610 147
156 iso_pu_bacteria 2841957949 2841959647 147
157 iso_pu_bacteria 2841966195 2841967512 147
158 iso_pu_bacteria 2841974524 2841979091 147
159 iso_pu_bacteria 2841983080 2841986634 147
160 iso_pu_bacteria 2842038055 2842038394 147
161 iso_pu_bacteria 2842045827 2842048661 147
162 iso_pu_bacteria 2844315083 2844317867 147
163 iso_pu_bacteria 2847930680 2847934652 147
164 iso_pu_bacteria 2847939898 2847945272 147
165 iso_pu_bacteria 2857509624 2857510108 147
166 iso_pu_bacteria 2874590934 2874596641 147
167 iso_pu_bacteria 2874612657 2874618362 147
168 iso_pu_bacteria 2874620515 2874621810 147
169 iso_pu_bacteria 2874628541 2874635850 147
170 iso_pu_bacteria 2876761206 2876766551 147
171 iso_pu_bacteria 2876771140 2876777063 147
172 iso_pu_bacteria 2876818435 2876825187 147
173 iso_pu_bacteria 2879074833 2879081200 147
174 iso_pu_bacteria 2879083081 2879088146 147
175 iso_pu_bacteria 2879099564 2879109159 147
176 iso_pu_bacteria 2881364244 2881366036 147
177 iso_pu_bacteria 2881665667 2881670441 147
178 iso_pu_bacteria 2885366525 2885372645 147
179 iso_pu_bacteria 2885409591 2885409714 147
180 iso_pu_bacteria 2888378607 2888382646 147
181 iso_pu_bacteria 2888388044 2888395078 147
182 iso_pu_bacteria 2888419890 2888423175 147
183 iso_pu_bacteria 2903727486 2903729797 147
184 iso_pu_bacteria 2904666416 2904668473 147
185 iso_pu_bacteria 2906602504 2906608954 147
186 iso_pu_bacteria 2906643746 2906644111 147
187 iso_pu_bacteria 2908775508 2908778838 147
188 iso_pu_bacteria 2922368715 2922375339 147
189 iso_pu_bacteria 2922393267 2922395108 147
190 iso_pu_bacteria 2929615660 2929616082 147
191 iso_pu_bacteria 2929624759 2929624826 147
192 iso_pu_bacteria 2932784394 2932792397 147
193 iso_pu_bacteria 2932809354 2932817524 147
194 iso_pu_bacteria 2932818245 2932819662 147
195 iso_pu_bacteria 2932828146 2932836523 147
196 iso_pu_bacteria 2933577622 2933578632 147
197 iso_pu_bacteria 2935608549 2935611198 147
198 iso_pu_bacteria 2935616580 2935618870 147
199 iso_pu_bacteria 2935638405 2935647518 147
200 iso_pu_bacteria 2935648319 2935648636 147
201 iso_pu_bacteria 2935656913 2935657376 147
202 iso_pu_bacteria 2935665750 2935672781 147
203 iso_pu_bacteria 2935675223 2935676856 147
204 iso_pu_bacteria 2935684952 2935687734 147
205 iso_pu_bacteria 2935694250 2935695548 147
206 iso_pu_bacteria 2935703347 2935712314 147
207 iso_pu_bacteria 2935713505 2935714753 147
208 iso_pu_bacteria 2935722832 2935726682 147
209 iso_pu_bacteria 2935732158 2935739451 147
210 iso_pu_bacteria 2935741537 2935748489 147
211 iso_pu_bacteria 2935750917 2935755010 147
212 iso_pu_bacteria 2935760218 2935761088 147
213 iso_pu_bacteria 2935769743 2935771598 147
214 iso_pu_bacteria 2935777560 2935779288 147
215 iso_pu_bacteria 2935785616 2935790744 147
216 iso_pu_bacteria 2935793552 2935799315 147
217 iso_pu_bacteria 2935801545 2935807455 147
218 iso_pu_bacteria 2935810662 2935812595 147
219 iso_pu_bacteria 2935819856 2935820683 147
220 iso_pu_bacteria 2935827899 2935837039 147
221 iso_pu_bacteria 2935837841 2935839378 147
222 iso_pu_bacteria 2935847175 2935849307 147
223 iso_pu_bacteria 2935855204 2935857235 147
224 iso_pu_bacteria 2935864058 2935864764 147
225 iso_pu_bacteria 2935873716 2935876542 147
226 iso_pu_bacteria 2935908558 2935911916 147
227 iso_pu_bacteria 2935916978 2935920450 147
228 iso_pu_bacteria 2935926038 2935928945 147
229 iso_pu_bacteria 2935934488 2935938590 147
230 iso_pu_bacteria 2935942939 2935945518 147
231 iso_pu_bacteria 2935951376 2935954875 147
232 iso_pu_bacteria 2935959822 2935963491 147
233 iso_pu_bacteria 2935967501 2935970762 147
234 iso_pu_bacteria 2935975950 2935978999 147
235 iso_pu_bacteria 2935984226 2935989705 147
236 iso_pu_bacteria 2935992306 2936001358 147
237 iso_pu_bacteria 2936002035 2936009337 147
238 iso_pu_bacteria 2936011229 2936011546 147
239 iso_pu_bacteria 2936019824 2936020141 147
240 iso_pu_bacteria 2936028420 2936028737 147
241 iso_pu_bacteria 2936037263 2936039188 147
242 iso_pu_bacteria 2936046547 2936046864 147
243 iso_pu_bacteria 2936055302 2936058264 147
244 iso_pu_bacteria 2940556831 2940559613 147
245 iso_pu_bacteria 2941538514 2941540067 147
246 iso_pu_bacteria 3005483717 3005488063 147
247 iso_pu_bacteria 3005506211 3005512832 147
248 iso_pu_bacteria 3005587118 3005590579 147
249 iso_pu_bacteria 3005594810 3005597618 147
250 iso_pu_bacteria 3005710791 3005713651 147
251 iso_pu_bacteria 8016511872 8016514811 147
252 iso_pu_bacteria 8016522445 8016530938 147
253 iso_pu_bacteria 8016530956 8016536230 147
254 iso_pu_bacteria 8016539877 8016540515 147
255 iso_pu_bacteria 8016548790 8016552729 147
256 iso_pu_bacteria 8016557553 8016561110 147
257 iso_pu_bacteria 8016566248 8016574592 147
258 iso_pu_bacteria 8016575299 8016578673 147
259 iso_pu_bacteria 8016595262 8016598967 147
260 iso_pu_bacteria 8016603502 8016612107 147
261 iso_pu_bacteria 8016630954 8016632451 147
262 iso_pu_bacteria 8017057580 8017061633 147
263 iso_pu_bacteria 8019530166 8019535953 147
264 iso_pu_bacteria 8019547302 8019555341 147
265 iso_pu_bacteria 8019576017 8019581019 147
266 iso_pu_bacteria 8019586578 8019588754 147
267 iso_pu_bacteria 8019597564 8019602587 147
268 iso_pu_bacteria 8019608314 8019615972 147
269 iso_pu_bacteria 8019619141 8019626681 147
270 iso_pu_bacteria 8019629233 8019635835 147
271 iso_pu_bacteria 8019638758 8019643824 147
272 iso_pu_bacteria 8019659431 8019663601 147
273 iso_pu_bacteria 8019687851 8019688573 147
274 iso_pu_bacteria 8055742211 8055747729 147
275 iso_pu_bacteria 8056967851 8056970115 147
276 3300003659 JGI25404J52841_10009065 JGI25404J52841_100090651 148
277 3300005328 Ga0070676_11289330 Ga0070676_112893301 148
278 3300005329 Ga0070683_100778079 Ga0070683_1007780791 148
279 3300005337 Ga0070682_100476317 Ga0070682_1004763172 148
280 3300005347 Ga0070668_100382218 Ga0070668_1003822181 148
281 3300005353 Ga0070669_100369060 Ga0070669_1003690602 148
282 3300005365 Ga0070688_100271878 Ga0070688_1002718782 148
283 3300005366 Ga0070659_100233720 Ga0070659_1002337202 148
284 3300005434 Ga0070709_10001049 Ga0070709_1000104913 148
285 3300005434 Ga0070709_10179542 Ga0070709_101795421 148
286 3300005435 Ga0070714_100001503 Ga0070714_10000150310 148
287 3300005435 Ga0070714_101192030 Ga0070714_1011920301 148
288 3300005436 Ga0070713_100009241 Ga0070713_1000092418 148
289 3300005436 Ga0070713_100258218 Ga0070713_1002582181 148
290 3300005436 Ga0070713_100708890 Ga0070713_1007088902 148
291 3300005436 Ga0070713_100854847 Ga0070713_1008548471 148
292 3300005437 Ga0070710_10024990 Ga0070710_100249902 148
293 3300005437 Ga0070710_10035049 Ga0070710_100350492 148
294 3300005439 Ga0070711_100003503 Ga0070711_10000350310 148
295 3300005439 Ga0070711_100062200 Ga0070711_1000622003 148
296 3300005439 Ga0070711_100387889 Ga0070711_1003878891 148
297 3300005440 Ga0070705_100290476 Ga0070705_1002904762 148
298 3300005455 Ga0070663_100066976 Ga0070663_1000669762 148
299 3300005456 Ga0070678_100127431 Ga0070678_1001274312 148
300 3300005456 Ga0070678_100173943 Ga0070678_1001739432 148
301 3300005456 Ga0070678_101131972 Ga0070678_1011319721 148
302 3300005458 Ga0070681_10035146 Ga0070681_100351464 148
303 3300005458 Ga0070681_10916849 Ga0070681_109168491 148
304 3300005459 Ga0068867_100328963 Ga0068867_1003289632 148
305 3300005536 Ga0070697_100728346 Ga0070697_1007283462 148
306 3300005548 Ga0070665_100155913 Ga0070665_1001559132 148
307 3300005563 Ga0068855_100745625 Ga0068855_1007456252 148
308 3300005577 Ga0068857_100753740 Ga0068857_1007537401 148
309 3300005615 Ga0070702_100040026 Ga0070702_1000400262 148
310 3300005841 Ga0068863_100867183 Ga0068863_1008671832 148
311 3300005842 Ga0068858_100202919 Ga0068858_1002029193 148
312 3300005842 Ga0068858_100478075 Ga0068858_1004780752 148
313 3300005981 Ga0081538_10042515 Ga0081538_100425152 148
314 3300005983 Ga0081540_1003440 Ga0081540_100344010 148
315 3300005983 Ga0081540_1004142 Ga0081540_10041422 148
316 3300006028 Ga0070717_10002312 Ga0070717_100023125 148
317 3300006048 Ga0075363_100020528 Ga0075363_1000205284 148
318 3300006051 Ga0075364_10295567 Ga0075364_102955671 148
319 3300006163 Ga0070715_10000192 Ga0070715_100001925 148
320 3300006173 Ga0070716_100063087 Ga0070716_1000630873 148
321 3300006175 Ga0070712_100008540 Ga0070712_1000085403 148
322 3300006178 Ga0075367_10016109 Ga0075367_100161095 148
323 3300006195 Ga0075366_10124194 Ga0075366_101241942 148
324 3300006353 Ga0075370_10022481 Ga0075370_100224815 148
325 3300006847 Ga0075431_101407414 Ga0075431_1014074141 148
326 3300009093 Ga0105240_11198258 Ga0105240_111982581 148
327 3300009098 Ga0105245_10027787 Ga0105245_100277878 148
328 3300009101 Ga0105247_10395620 Ga0105247_103956202 148
329 3300009101 Ga0105247_10455678 Ga0105247_104556781 148
330 3300009148 Ga0105243_11794713 Ga0105243_117947131 148
331 3300009174 Ga0105241_10116647 Ga0105241_101166472 148
332 3300009174 Ga0105241_11595263 Ga0105241_115952631 148
333 3300009174 Ga0105241_11672279 Ga0105241_116722791 148
334 3300009177 Ga0105248_10570502 Ga0105248_105705022 148
335 3300009545 Ga0105237_10202266 Ga0105237_102022662 148
336 3300009551 Ga0105238_10286069 Ga0105238_102860692 148
337 3300009553 Ga0105249_10380494 Ga0105249_103804942 148
338 3300010375 Ga0105239_10454113 Ga0105239_104541132 148
339 3300011119 Ga0105246_10106277 Ga0105246_101062773 148
340 3300013104 Ga0157370_10049664 Ga0157370_100496642 148
341 3300013296 Ga0157374_10035499 Ga0157374_100354991 148
342 3300013306 Ga0163162_12005991 Ga0163162_120059911 148
343 3300014325 Ga0163163_10105138 Ga0163163_101051382 148
344 3300014325 Ga0163163_10410562 Ga0163163_104105622 148
345 3300014968 Ga0157379_10071516 Ga0157379_100715163 148
346 3300021384 Ga0213876_10001877 Ga0213876_100018777 148
347 3300025898 Ga0207692_10000798 Ga0207692_100007985 148
348 3300025898 Ga0207692_10039773 Ga0207692_100397732 148
349 3300025900 Ga0207710_10038686 Ga0207710_100386862 148
350 3300025901 Ga0207688_10059877 Ga0207688_100598772 148
351 3300025903 Ga0207680_10060356 Ga0207680_100603562 148
352 3300025905 Ga0207685_10017711 Ga0207685_100177112 148
353 3300025906 Ga0207699_10001678 Ga0207699_100016784 148
354 3300025906 Ga0207699_10031117 Ga0207699_100311173 148
355 3300025907 Ga0207645_10035572 Ga0207645_100355724 148
356 3300025911 Ga0207654_10047186 Ga0207654_100471862 148
357 3300025914 Ga0207671_10122859 Ga0207671_101228591 148
358 3300025915 Ga0207693_10001679 Ga0207693_1000167911 148
359 3300025915 Ga0207693_10021981 Ga0207693_100219813 148
360 3300025916 Ga0207663_10000672 Ga0207663_1000067210 148
361 3300025916 Ga0207663_10435653 Ga0207663_104356532 148
362 3300025916 Ga0207663_10636806 Ga0207663_106368062 148
363 3300025919 Ga0207657_10178343 Ga0207657_101783432 148
364 3300025928 Ga0207700_10008661 Ga0207700_100086619 148
365 3300025928 Ga0207700_10165011 Ga0207700_101650112 148
366 3300025928 Ga0207700_10329667 Ga0207700_103296671 148
367 3300025928 Ga0207700_10521898 Ga0207700_105218981 148
368 3300025929 Ga0207664_10012380 Ga0207664_100123804 148
369 3300025932 Ga0207690_10429900 Ga0207690_104299002 148
370 3300025933 Ga0207706_10163653 Ga0207706_101636532 148
371 3300025939 Ga0207665_10000700 Ga0207665_1000070027 148
372 3300025939 Ga0207665_10465973 Ga0207665_104659731 148
373 3300025941 Ga0207711_10480020 Ga0207711_104800203 148
374 3300025942 Ga0207689_10338223 Ga0207689_103382232 148
375 3300025949 Ga0207667_10425834 Ga0207667_104258342 148
376 3300026035 Ga0207703_10614912 Ga0207703_106149121 148
377 3300026067 Ga0207678_10026683 Ga0207678_100266832 148
378 3300026088 Ga0207641_10530953 Ga0207641_105309532 148
379 3300026095 Ga0207676_10206133 Ga0207676_102061332 148
380 3300026095 Ga0207676_11021251 Ga0207676_110212511 148
381 3300026116 Ga0207674_10203175 Ga0207674_102031752 148
382 3300026121 Ga0207683_10153255 Ga0207683_101532552 148
383 3300026121 Ga0207683_10291320 Ga0207683_102913202 148
384 3300028379 Ga0268266_10030787 Ga0268266_100307876 148
385 3300028379 Ga0268266_10270068 Ga0268266_102700681 148
386 3300028794 Ga0307515_10355834 Ga0307515_103558342 148
387 3300031249 Ga0265339_10030751 Ga0265339_100307512 148
388 3300031548 Ga0307408_100327901 Ga0307408_1003279011 148
389 3300035113 Ga0373936_0122921 Ga0373936_0122921_497_946 148
390 3300035170 Ga0373943_0239776 Ga0373943_0239776_461_910 148
391 3300035695 Ga0373927_0001314 Ga0373927_0001314_11543_11992 148
392 3300035725 Ga0373947_0043194 Ga0373947_0043194_2216_2665 148
393 3300036401 Ga0373937_0580910 Ga0373937_0580910_313_762 148
394 3300039437 Ga0436365_0396709 Ga0436365_0396709_67202_67651 148
395 3300039437 Ga0436365_0658425 Ga0436365_0658425_596_1045 148
396 3300039450 Ga0436363_0874061 Ga0436363_0874061_23_472 148
397 3300039450 Ga0436363_1445334 Ga0436363_1445334_1044_1493 148
398 3300039453 Ga0436362_1295787 Ga0436362_1295787_653_1102 148
399 3300042005 Ga0439448_0191032 Ga0439448_0191032_82_531 148
400 3300044684 Ga0466966_0874786 Ga0466966_0874786_52_501 148
401 3300044694 Ga0466963_0315589 Ga0466963_0315589_488_949 148
402 3300044765 Ga0466970_0121485 Ga0466970_0121485_430_879 148
403 3300046475 Ga0495639_0288498 Ga0495639_0288498_281_730 148
404 3300046477 Ga0495664_0356689 Ga0495664_0356689_287_736 148
405 3300046531 Ga0495665_0443546 Ga0495665_0443546_148_597 148
406 3300046533 Ga0495640_0585540 Ga0495640_0585540_145_594 148
407 3300046679 Ga0495623_0275545 Ga0495623_0275545_63_512 148
408 3300046689 Ga0495613_0127022 Ga0495613_0127022_710_1159 148
409 3300047320 Ga0495672_0215594 Ga0495672_0215594_364_813 148
410 3300048903 Ga0496100_0278677 Ga0496100_0278677_244_693 148
411 3300048904 Ga0496101_0327599 Ga0496101_0327599_690_1139 148
412 3300048905 Ga0496102_0083006 Ga0496102_0083006_1920_2369 148
413 3300048905 Ga0496102_0270149 Ga0496102_0270149_200_649 148
414 3300048905 Ga0496102_0374778 Ga0496102_0374778_577_1026 148
415 3300048906 Ga0496103_0085727 Ga0496103_0085727_717_1166 148
416 3300048906 Ga0496103_0111335 Ga0496103_0111335_1075_1524 148
417 3300048908 Ga0496105_0283738 Ga0496105_0283738_611_1060 148
418 3300048909 Ga0496106_0076818 Ga0496106_0076818_1576_2025 148
419 3300048909 Ga0496106_0091610 Ga0496106_0091610_1434_1883 148
420 3300048910 Ga0496107_0194019 Ga0496107_0194019_20_469 148
421 3300048911 Ga0496108_0738291 Ga0496108_0738291_236_685 148
422 3300048912 Ga0496109_0304897 Ga0496109_0304897_584_1033 148
423 3300048912 Ga0496109_0625003 Ga0496109_0625003_63_512 148
424 3300048912 Ga0496109_0989925 Ga0496109_0989925_285_734 148
425 3300048913 Ga0496110_0040514 Ga0496110_0040514_857_1306 148
426 3300048915 Ga0496112_0007967 Ga0496112_0007967_1966_2415 148
427 3300048915 Ga0496112_0117718 Ga0496112_0117718_1424_1873 148
428 3300048917 Ga0496114_0529359 Ga0496114_0529359_506_955 148
429 3300048918 Ga0496115_0184723 Ga0496115_0184723_161_610 148
430 3300048920 Ga0496117_0128756 Ga0496117_0128756_648_1097 148
431 3300048928 Ga0496125_0000092 Ga0496125_0000092_74796_75245 148
432 3300048929 Ga0496126_0297425 Ga0496126_0297425_273_722 148
433 3300050490 nmdc:mga03n38_42619_c1 nmdc:mga03n38_42619_c1_1013_1462 148
434 3300050492 nmdc:mga0yw44_139125_c1 nmdc:mga0yw44_139125_c1_701_1150 148
435 3300050493 nmdc:mga0k408_279571_c1 nmdc:mga0k408_279571_c1_332_781 148
436 3300050494 nmdc:mga06z11_271591_c1 nmdc:mga06z11_271591_c1_82_531 148
437 3300050496 nmdc:mga07m45_415448_c1 nmdc:mga07m45_415448_c1_274_723 148
438 3300050496 nmdc:mga07m45_4525_c1 nmdc:mga07m45_4525_c1_1642_2091 148
439 3300050515 nmdc:mga0a205_1008445_c1 nmdc:mga0a205_1008445_c1_170_619 148
440 3300053083 Ga0495655_0200339 Ga0495655_0200339_125_574 148
441 3300053091 Ga0500647_0353335 Ga0500647_0353335_135_584 148
442 3300053094 Ga0500566_0013088 Ga0500566_0013088_902_1351 148
443 3300053102 Ga0500554_053556 Ga0500554_053556_149_598 148
444 3300053119 Ga0500595_000468 Ga0500595_000468_6947_7396 148
445 3300053119 Ga0500595_000947 Ga0500595_000947_14921_15370 148
446 3300053128 Ga0500626_067080 Ga0500626_067080_735_1184 148
447 3300053136 Ga0500559_0202559 Ga0500559_0202559_469_918 148
448 3300053162 Ga0500638_063082 Ga0500638_063082_527_976 148
449 3300053177 Ga0500636_0088066 Ga0500636_0088066_64_513 148
450 3300053177 Ga0500636_0197695 Ga0500636_0197695_559_1008 148
451 3300053178 Ga0500637_0011077 Ga0500637_0011077_979_1428 148
452 3300053729 Ga0500625_000384 Ga0500625_000384_3276_3725 148
453 3300055283 Ga0500661_001956 Ga0500661_001956_1521_1970 148
454 iso_pu_bacteria 2513237092 2513628615 148
455 iso_pu_bacteria 2791355196 2793060126 148
456 3300005334 Ga0068869_100603209 Ga0068869_1006032091 149
457 3300005337 Ga0070682_100591696 Ga0070682_1005916962 149
458 3300005338 Ga0068868_101554255 Ga0068868_1015542551 149
459 3300005340 Ga0070689_100383115 Ga0070689_1003831152 149
460 3300005355 Ga0070671_100386344 Ga0070671_1003863441 149
461 3300005356 Ga0070674_100485667 Ga0070674_1004856672 149
462 3300005365 Ga0070688_100196942 Ga0070688_1001969423 149
463 3300005365 Ga0070688_100282441 Ga0070688_1002824412 149
464 3300005437 Ga0070710_10040600 Ga0070710_100406004 149
465 3300005441 Ga0070700_100827428 Ga0070700_1008274281 149
466 3300005441 Ga0070700_101168434 Ga0070700_1011684341 149
467 3300005458 Ga0070681_10578438 Ga0070681_105784381 149
468 3300005466 Ga0070685_10576194 Ga0070685_105761942 149
469 3300005535 Ga0070684_100364981 Ga0070684_1003649812 149
470 3300005539 Ga0068853_100478174 Ga0068853_1004781742 149
471 3300005539 Ga0068853_100583638 Ga0068853_1005836381 149
472 3300005543 Ga0070672_100181742 Ga0070672_1001817422 149
473 3300005544 Ga0070686_100265387 Ga0070686_1002653871 149
474 3300005546 Ga0070696_100845924 Ga0070696_1008459242 149
475 3300005548 Ga0070665_100288465 Ga0070665_1002884652 149
476 3300005548 Ga0070665_101525214 Ga0070665_1015252141 149
477 3300005577 Ga0068857_100350521 Ga0068857_1003505212 149
478 3300005578 Ga0068854_100775218 Ga0068854_1007752182 149
479 3300005578 Ga0068854_101055113 Ga0068854_1010551132 149
480 3300005614 Ga0068856_100233961 Ga0068856_1002339613 149
481 3300005614 Ga0068856_101093097 Ga0068856_1010930971 149
482 3300005615 Ga0070702_100277620 Ga0070702_1002776201 149
483 3300005616 Ga0068852_100167350 Ga0068852_1001673502 149
484 3300005616 Ga0068852_101559146 Ga0068852_1015591462 149
485 3300005618 Ga0068864_100422577 Ga0068864_1004225772 149
486 3300005718 Ga0068866_10276860 Ga0068866_102768602 149
487 3300005842 Ga0068858_100039039 Ga0068858_1000390394 149
488 3300005843 Ga0068860_100371183 Ga0068860_1003711832 149
489 3300005937 Ga0081455_10002285 Ga0081455_100022854 149
490 3300005937 Ga0081455_10007249 Ga0081455_1000724912 149
491 3300006028 Ga0070717_10198890 Ga0070717_101988903 149
492 3300006028 Ga0070717_11464143 Ga0070717_114641431 149
493 3300006038 Ga0075365_10156057 Ga0075365_101560573 149
494 3300006042 Ga0075368_10011707 Ga0075368_100117071 149
495 3300006048 Ga0075363_100052001 Ga0075363_1000520011 149
496 3300006051 Ga0075364_10060911 Ga0075364_100609113 149
497 3300006178 Ga0075367_10230656 Ga0075367_102306562 149
498 3300006880 Ga0075429_100433848 Ga0075429_1004338482 149
499 3300006881 Ga0068865_100320808 Ga0068865_1003208081 149
500 3300009011 Ga0105251_10515109 Ga0105251_105151091 149
501 3300009093 Ga0105240_10012039 Ga0105240_100120392 149
502 3300009094 Ga0111539_10671213 Ga0111539_106712132 149
503 3300009094 Ga0111539_10985186 Ga0111539_109851862 149
504 3300009098 Ga0105245_10453074 Ga0105245_104530742 149
505 3300009101 Ga0105247_10008420 Ga0105247_100084206 149
506 3300009148 Ga0105243_10089736 Ga0105243_100897363 149
507 3300009177 Ga0105248_10164028 Ga0105248_101640282 149
508 3300009545 Ga0105237_10652715 Ga0105237_106527152 149
509 3300009553 Ga0105249_10556539 Ga0105249_105565392 149
510 3300010375 Ga0105239_11283959 Ga0105239_112839592 149
511 3300010375 Ga0105239_11509577 Ga0105239_115095772 149
512 3300013104 Ga0157370_10159756 Ga0157370_101597563 149
513 3300013105 Ga0157369_10103369 Ga0157369_101033692 149
514 3300013297 Ga0157378_10070096 Ga0157378_100700964 149
515 3300013307 Ga0157372_11478125 Ga0157372_114781252 149
516 3300013308 Ga0157375_10039817 Ga0157375_100398174 149
517 3300014326 Ga0157380_10434396 Ga0157380_104343961 149
518 3300014326 Ga0157380_11074853 Ga0157380_110748532 149
519 3300014968 Ga0157379_10003171 Ga0157379_1000317116 149
520 3300014969 Ga0157376_10332550 Ga0157376_103325502 149
521 3300021384 Ga0213876_10199567 Ga0213876_101995672 149
522 3300022467 Ga0224712_10042995 Ga0224712_100429953 149
523 3300025900 Ga0207710_10012085 Ga0207710_100120852 149
524 3300025913 Ga0207695_10035634 Ga0207695_100356343 149
525 3300025913 Ga0207695_10233374 Ga0207695_102333742 149
526 3300025914 Ga0207671_10576829 Ga0207671_105768292 149
527 3300025917 Ga0207660_10243663 Ga0207660_102436633 149
528 3300025924 Ga0207694_11633823 Ga0207694_116338231 149
529 3300025928 Ga0207700_10027097 Ga0207700_100270974 149
530 3300025931 Ga0207644_10644089 Ga0207644_106440891 149
531 3300025935 Ga0207709_10272671 Ga0207709_102726712 149
532 3300025936 Ga0207670_10519532 Ga0207670_105195322 149
533 3300025937 Ga0207669_10248924 Ga0207669_102489242 149
534 3300025938 Ga0207704_10122749 Ga0207704_101227493 149
535 3300025938 Ga0207704_10479932 Ga0207704_104799321 149
536 3300025941 Ga0207711_10115930 Ga0207711_101159302 149
537 3300025942 Ga0207689_10678558 Ga0207689_106785582 149
538 3300025961 Ga0207712_10626335 Ga0207712_106263351 149
539 3300025981 Ga0207640_10642756 Ga0207640_106427561 149
540 3300025986 Ga0207658_10038482 Ga0207658_100384821 149
541 3300026041 Ga0207639_10408576 Ga0207639_104085762 149
542 3300026067 Ga0207678_10571857 Ga0207678_105718572 149
543 3300026075 Ga0207708_10170684 Ga0207708_101706842 149
544 3300026095 Ga0207676_10631639 Ga0207676_106316392 149
545 3300026118 Ga0207675_100298166 Ga0207675_1002981661 149
546 3300028379 Ga0268266_10533691 Ga0268266_105336911 149
547 3300028379 Ga0268266_10601395 Ga0268266_106013952 149
548 3300030522 Ga0307512_10263719 Ga0307512_102637191 149
549 3300031691 Ga0316579_10323998 Ga0316579_103239982 149
550 3300035089 Ga0373944_0102069 Ga0373944_0102069_337_795 149
551 3300035111 Ga0373923_0295524 Ga0373923_0295524_90_548 149
552 3300035171 Ga0373946_0115373 Ga0373946_0115373_218_676 149
553 3300035692 Ga0373935_0032938 Ga0373935_0032938_1714_2172 149
554 3300035695 Ga0373927_0016642 Ga0373927_0016642_495_953 149
555 3300035725 Ga0373947_0032609 Ga0373947_0032609_2447_2905 149
556 3300036401 Ga0373937_1093704 Ga0373937_1093704_78_536 149
557 3300037068 Ga0373925_0009010 Ga0373925_0009010_4891_5349 149
558 3300037312 Ga0395899_0314745 Ga0395899_0314745_36_494 149
559 3300037312 Ga0395899_0838407 Ga0395899_0838407_95_550 149
560 3300037418 Ga0395900_0086928 Ga0395900_0086928_2224_2682 149
561 3300037466 Ga0395898_0111784 Ga0395898_0111784_393_851 149
562 3300037466 Ga0395898_0117507 Ga0395898_0117507_1601_2059 149
563 3300038443 Ga0395901_0161914 Ga0395901_0161914_1042_1500 149
564 3300039437 Ga0436365_1891429 Ga0436365_1891429_750_1208 149
565 3300039450 Ga0436363_1561684 Ga0436363_1561684_656_1114 149
566 3300044684 Ga0466966_0041436 Ga0466966_0041436_2414_2884 149
567 3300044842 Ga0466957_0037493 Ga0466957_0037493_2401_2871 149
568 3300045976 Ga0466967_0221409 Ga0466967_0221409_814_1272 149
569 3300046454 Ga0495592_0470201 Ga0495592_0470201_225_677 149
570 3300046455 Ga0495603_0000101 Ga0495603_0000101_5520_5978 149
571 3300046459 Ga0495629_0002313 Ga0495629_0002313_9173_9631 149
572 3300046461 Ga0495641_0008274 Ga0495641_0008274_2697_3155 149
573 3300046472 Ga0495580_0000825 Ga0495580_0000825_12897_13355 149
574 3300046473 Ga0495582_0000567 Ga0495582_0000567_6689_7147 149
575 3300046473 Ga0495582_0322383 Ga0495582_0322383_53_505 149
576 3300046475 Ga0495639_0005952 Ga0495639_0005952_4330_4788 149
577 3300046476 Ga0495662_0159561 Ga0495662_0159561_615_1073 149
578 3300046477 Ga0495664_0012345 Ga0495664_0012345_1897_2355 149
579 3300046491 Ga0495584_0123278 Ga0495584_0123278_506_976 149
580 3300046499 Ga0495594_0000023 Ga0495594_0000023_58624_59082 149
581 3300046517 Ga0495630_0626510 Ga0495630_0626510_164_622 149
582 3300046531 Ga0495665_0051214 Ga0495665_0051214_867_1325 149
583 3300046543 Ga0495645_0028858 Ga0495645_0028858_1087_1545 149
584 3300046557 Ga0495622_0001800 Ga0495622_0001800_3766_4224 149
585 3300046674 Ga0495588_0001677 Ga0495588_0001677_3888_4346 149
586 3300046678 Ga0495599_0112377 Ga0495599_0112377_656_1114 149
587 3300046681 Ga0495647_0001896 Ga0495647_0001896_996_1454 149
588 3300046683 Ga0495658_0014307 Ga0495658_0014307_1834_2292 149
589 3300046689 Ga0495613_0000209 Ga0495613_0000209_1401_1859 149
590 3300047315 Ga0495581_0003931 Ga0495581_0003931_4381_4839 149
591 3300047317 Ga0495604_0646201 Ga0495604_0646201_106_558 149
592 3300047321 Ga0495676_0112890 Ga0495676_0112890_819_1277 149
593 3300047471 Ga0495684_0102475 Ga0495684_0102475_524_982 149
594 3300047673 Ga0495593_0011735 Ga0495593_0011735_418_876 149
595 3300048089 Ga0495614_0006480 Ga0495614_0006480_936_1394 149
596 3300048904 Ga0496101_0560289 Ga0496101_0560289_286_756 149
597 3300048905 Ga0496102_0124843 Ga0496102_0124843_201_671 149
598 3300048907 Ga0496104_0182233 Ga0496104_0182233_148_618 149
599 3300048908 Ga0496105_0014239 Ga0496105_0014239_2641_3111 149
600 3300048908 Ga0496105_0492459 Ga0496105_0492459_153_623 149
601 3300048909 Ga0496106_0004380 Ga0496106_0004380_8938_9408 149
602 3300048910 Ga0496107_0008103 Ga0496107_0008103_3117_3587 149
603 3300048911 Ga0496108_0072191 Ga0496108_0072191_978_1448 149
604 3300048911 Ga0496108_0339498 Ga0496108_0339498_26_496 149
605 3300048912 Ga0496109_0027545 Ga0496109_0027545_2443_2913 149
606 3300048912 Ga0496109_0039020 Ga0496109_0039020_3385_3855 149
607 3300048913 Ga0496110_0181218 Ga0496110_0181218_1161_1631 149
608 3300048914 Ga0496111_0076985 Ga0496111_0076985_753_1223 149
609 3300048915 Ga0496112_0011676 Ga0496112_0011676_2524_2994 149
610 3300048916 Ga0496113_0052873 Ga0496113_0052873_441_911 149
611 3300048917 Ga0496114_0003436 Ga0496114_0003436_1498_1968 149
612 3300048918 Ga0496115_0001779 Ga0496115_0001779_3371_3841 149
613 3300048924 Ga0496121_0311134 Ga0496121_0311134_457_909 149
614 3300048929 Ga0496126_0380561 Ga0496126_0380561_544_1002 149
615 3300049568 Ga0501031_0032687 Ga0501031_0032687_697_1176 149
616 3300049568 Ga0501031_0472556 Ga0501031_0472556_102_557 149
617 3300049569 Ga0501032_0091399 Ga0501032_0091399_857_1336 149
618 3300049569 Ga0501032_0321513 Ga0501032_0321513_352_807 149
619 3300049570 Ga0501033_0063484 Ga0501033_0063484_1943_2398 149
620 3300049570 Ga0501033_0112705 Ga0501033_0112705_970_1449 149
621 3300049571 Ga0501034_0481310 Ga0501034_0481310_540_995 149
622 3300049572 Ga0501036_0053501 Ga0501036_0053501_2339_2794 149
623 3300049572 Ga0501036_0092271 Ga0501036_0092271_1493_1972 149
624 3300049572 Ga0501036_0874088 Ga0501036_0874088_105_572 149
625 3300049572 Ga0501036_0950107 Ga0501036_0950107_183_638 149
626 3300049573 Ga0501037_0007172 Ga0501037_0007172_152_607 149
627 3300049573 Ga0501037_0046285 Ga0501037_0046285_1632_2111 149
628 3300049574 Ga0501038_0004223 Ga0501038_0004223_5766_6221 149
629 3300049574 Ga0501038_0172058 Ga0501038_0172058_680_1159 149
630 3300049575 Ga0501039_0008477 Ga0501039_0008477_2646_3125 149
631 3300049575 Ga0501039_0354623 Ga0501039_0354623_163_618 149
632 3300049575 Ga0501039_0824020 Ga0501039_0824020_77_532 149
633 3300049576 Ga0501040_0020029 Ga0501040_0020029_2340_2819 149
634 3300049576 Ga0501040_0068930 Ga0501040_0068930_414_869 149
635 3300049577 Ga0501041_0032146 Ga0501041_0032146_1602_2081 149
636 3300049578 Ga0501042_0205634 Ga0501042_0205634_215_715 149
637 3300049579 Ga0501043_0008239 Ga0501043_0008239_1766_2221 149
638 3300049580 Ga0501046_0091643 Ga0501046_0091643_674_1153 149
639 3300049586 Ga0501070_0039742 Ga0501070_0039742_2504_2983 149
640 3300049586 Ga0501070_0430836 Ga0501070_0430836_366_821 149
641 3300049587 Ga0501071_0024526 Ga0501071_0024526_2972_3451 149
642 3300049587 Ga0501071_0051416 Ga0501071_0051416_2291_2755 149
643 3300049588 Ga0501072_0055713 Ga0501072_0055713_825_1304 149
644 3300049588 Ga0501072_0552318 Ga0501072_0552318_287_742 149
645 3300049589 Ga0501073_0101499 Ga0501073_0101499_1158_1637 149
646 3300049589 Ga0501073_0204924 Ga0501073_0204924_415_870 149
647 3300049590 Ga0501074_0032636 Ga0501074_0032636_2844_3323 149
648 3300049590 Ga0501074_0678180 Ga0501074_0678180_107_574 149
649 3300049591 Ga0501075_0019174 Ga0501075_0019174_607_1086 149
650 3300049591 Ga0501075_0346758 Ga0501075_0346758_322_825 149
651 3300049592 Ga0501076_0037829 Ga0501076_0037829_2331_2810 149
652 3300049592 Ga0501076_1048934 Ga0501076_1048934_77_577 149
653 3300049593 Ga0501077_0019658 Ga0501077_0019658_686_1165 149
654 3300049741 Ga0501079_0005574 Ga0501079_0005574_4039_4518 149
655 3300049741 Ga0501079_0282495 Ga0501079_0282495_310_789 149
656 3300049742 Ga0501080_0041070 Ga0501080_0041070_1312_1791 149
657 3300049742 Ga0501080_0358259 Ga0501080_0358259_356_811 149
658 3300049743 Ga0501081_0007723 Ga0501081_0007723_3636_4115 149
659 3300049822 Ga0501035_0039707 Ga0501035_0039707_1937_2392 149
660 3300049822 Ga0501035_0065996 Ga0501035_0065996_1235_1714 149
661 3300049823 Ga0501044_0018546 Ga0501044_0018546_4014_4469 149
662 3300049823 Ga0501044_0324969 Ga0501044_0324969_410_889 149
663 3300049824 Ga0501045_0055451 Ga0501045_0055451_1452_1931 149
664 3300050490 nmdc:mga03n38_92246_c1 nmdc:mga03n38_92246_c1_293_766 149
665 3300050491 nmdc:mga00v17_43495_c1 nmdc:mga00v17_43495_c1_1549_2022 149
666 3300050492 nmdc:mga0yw44_103621_c1 nmdc:mga0yw44_103621_c1_835_1308 149
667 3300050508 nmdc:mga09592_280849_c1 nmdc:mga09592_280849_c1_711_1190 149
668 3300053084 Ga0495595_0049648 Ga0495595_0049648_469_927 149
669 3300053084 Ga0495595_0107863 Ga0495595_0107863_364_816 149
670 3300053085 Ga0495619_0002921 Ga0495619_0002921_9805_10263 149
671 3300053085 Ga0495619_0102780 Ga0495619_0102780_614_1066 149
672 3300053094 Ga0500566_0149124 Ga0500566_0149124_570_1028 149
673 3300054114 Ga0501084_0037603 Ga0501084_0037603_2249_2728 149
674 3300054114 Ga0501084_0060211 Ga0501084_0060211_482_982 149
675 3300054114 Ga0501084_0351727 Ga0501084_0351727_168_647 149
676 3300054114 Ga0501084_0530879 Ga0501084_0530879_57_533 149
677 3300060353 Ga0501082_0105358 Ga0501082_0105358_594_1073 149
678 3300060353 Ga0501082_0273997 Ga0501082_0273997_628_1131 149
679 3300061719 Ga0466962_0190039 Ga0466962_0190039_263_733 149
680 3300061734 Ga0530510_0022872 Ga0530510_0022872_2285_2764 149
681 3300001990 JGI24737J22298_10126031 JGI24737J22298_101260312 150
682 3300002075 JGI24738J21930_10132361 JGI24738J21930_101323611 150
683 3300003214 JGI25165J46597_1007108 JGI25165J46597_10071081 150
684 3300003214 JGI25165J46597_1017932 JGI25165J46597_10179321 150
685 3300003215 JGI25153J46596_10001336 JGI25153J46596_1000133615 150
686 3300003215 JGI25153J46596_10006825 JGI25153J46596_100068252 150
687 3300003215 JGI25153J46596_10017942 JGI25153J46596_100179424 150
688 3300003215 JGI25153J46596_10065045 JGI25153J46596_100650452 150
689 3300003752 Ga0055539_1009871 Ga0055539_10098712 150
690 3300003762 Ga0055542_1015350 Ga0055542_10153501 150
691 3300003763 Ga0055529_1011705 Ga0055529_10117051 150
692 3300003771 Ga0055526_1030273 Ga0055526_10302732 150
693 3300003794 Ga0055531_10009682 Ga0055531_100096821 150
694 3300004625 Ga0055543_1004709 Ga0055543_10047092 150
695 3300005262 Ga0065165_1002378 Ga0065165_100237816 150
696 3300005262 Ga0065165_1007503 Ga0065165_10075035 150
697 3300005262 Ga0065165_1009915 Ga0065165_10099152 150
698 3300005331 Ga0070670_100669903 Ga0070670_1006699031 150
699 3300005334 Ga0068869_100219139 Ga0068869_1002191392 150
700 3300005335 Ga0070666_10904511 Ga0070666_109045111 150
701 3300005336 Ga0070680_100018149 Ga0070680_1000181496 150
702 3300005336 Ga0070680_100548580 Ga0070680_1005485802 150
703 3300005336 Ga0070680_100962359 Ga0070680_1009623591 150
704 3300005337 Ga0070682_100028973 Ga0070682_1000289734 150
705 3300005337 Ga0070682_100182311 Ga0070682_1001823112 150
706 3300005339 Ga0070660_100007944 Ga0070660_1000079444 150
707 3300005339 Ga0070660_100109160 Ga0070660_1001091602 150
708 3300005339 Ga0070660_100459735 Ga0070660_1004597351 150
709 3300005347 Ga0070668_100267653 Ga0070668_1002676532 150
710 3300005355 Ga0070671_100093201 Ga0070671_1000932012 150
711 3300005434 Ga0070709_10007480 Ga0070709_100074808 150
712 3300005436 Ga0070713_100014047 Ga0070713_1000140475 150
713 3300005436 Ga0070713_100288429 Ga0070713_1002884291 150
714 3300005437 Ga0070710_10012865 Ga0070710_100128655 150
715 3300005439 Ga0070711_100005982 Ga0070711_1000059822 150
716 3300005455 Ga0070663_100128105 Ga0070663_1001281051 150
717 3300005456 Ga0070678_100372199 Ga0070678_1003721992 150
718 3300005457 Ga0070662_100085799 Ga0070662_1000857992 150
719 3300005458 Ga0070681_10002115 Ga0070681_1000211518 150
720 3300005459 Ga0068867_101645434 Ga0068867_1016454341 150
721 3300005530 Ga0070679_100054054 Ga0070679_1000540546 150
722 3300005530 Ga0070679_100077530 Ga0070679_1000775304 150
723 3300005535 Ga0070684_100076765 Ga0070684_1000767651 150
724 3300005535 Ga0070684_100513144 Ga0070684_1005131442 150
725 3300005536 Ga0070697_100057741 Ga0070697_1000577414 150
726 3300005539 Ga0068853_100005334 Ga0068853_10000533410 150
727 3300005539 Ga0068853_100333664 Ga0068853_1003336642 150
728 3300005539 Ga0068853_100350830 Ga0068853_1003508302 150
729 3300005547 Ga0070693_100077815 Ga0070693_1000778152 150
730 3300005547 Ga0070693_100160649 Ga0070693_1001606492 150
731 3300005548 Ga0070665_100032740 Ga0070665_1000327402 150
732 3300005548 Ga0070665_100568505 Ga0070665_1005685052 150
733 3300005563 Ga0068855_100286486 Ga0068855_1002864862 150
734 3300005563 Ga0068855_100810069 Ga0068855_1008100692 150
735 3300005563 Ga0068855_101690327 Ga0068855_1016903272 150
736 3300005578 Ga0068854_100180476 Ga0068854_1001804762 150
737 3300005578 Ga0068854_101431811 Ga0068854_1014318111 150
738 3300005614 Ga0068856_100915358 Ga0068856_1009153582 150
739 3300005616 Ga0068852_100366915 Ga0068852_1003669152 150
740 3300005718 Ga0068866_10380781 Ga0068866_103807811 150
741 3300005719 Ga0068861_100767877 Ga0068861_1007678771 150
742 3300005834 Ga0068851_10006013 Ga0068851_100060131 150
743 3300005834 Ga0068851_10189203 Ga0068851_101892032 150
744 3300005842 Ga0068858_100152965 Ga0068858_1001529653 150
745 3300005842 Ga0068858_100379908 Ga0068858_1003799082 150
746 3300005843 Ga0068860_100000113 Ga0068860_10000011382 150
747 3300005981 Ga0081538_10031309 Ga0081538_100313095 150
748 3300005983 Ga0081540_1248391 Ga0081540_12483911 150
749 3300006028 Ga0070717_10042970 Ga0070717_100429704 150
750 3300006038 Ga0075365_10023032 Ga0075365_100230324 150
751 3300006048 Ga0075363_100105410 Ga0075363_1001054101 150
752 3300006048 Ga0075363_100155764 Ga0075363_1001557642 150
753 3300006163 Ga0070715_10488284 Ga0070715_104882841 150
754 3300006175 Ga0070712_100004044 Ga0070712_1000040445 150
755 3300006177 Ga0075362_10018122 Ga0075362_100181225 150
756 3300006178 Ga0075367_10338816 Ga0075367_103388162 150
757 3300006178 Ga0075367_10506098 Ga0075367_105060981 150
758 3300006186 Ga0075369_10052877 Ga0075369_100528772 150
759 3300006195 Ga0075366_10407868 Ga0075366_104078681 150
760 3300006353 Ga0075370_10008196 Ga0075370_100081965 150
761 3300006353 Ga0075370_10023253 Ga0075370_100232533 150
762 3300006353 Ga0075370_10485829 Ga0075370_104858292 150
763 3300006941 Ga0099825_1017767 Ga0099825_10177671 150
764 3300006944 Ga0099823_1073607 Ga0099823_10736072 150
765 3300007265 Ga0099794_10031429 Ga0099794_100314293 150
766 3300007265 Ga0099794_10056118 Ga0099794_100561182 150
767 3300007265 Ga0099794_10089519 Ga0099794_100895192 150
768 3300009093 Ga0105240_10001503 Ga0105240_1000150311 150
769 3300009093 Ga0105240_10016530 Ga0105240_100165302 150
770 3300009098 Ga0105245_10542760 Ga0105245_105427602 150
771 3300009101 Ga0105247_10066343 Ga0105247_100663432 150
772 3300009101 Ga0105247_10226155 Ga0105247_102261552 150
773 3300009148 Ga0105243_10130020 Ga0105243_101300203 150
774 3300009148 Ga0105243_10957536 Ga0105243_109575362 150
775 3300009174 Ga0105241_10053195 Ga0105241_100531951 150
776 3300009174 Ga0105241_10148004 Ga0105241_101480042 150
777 3300009174 Ga0105241_11537246 Ga0105241_115372461 150
778 3300009177 Ga0105248_10770470 Ga0105248_107704701 150
779 3300009545 Ga0105237_10000992 Ga0105237_100009925 150
780 3300009545 Ga0105237_10027416 Ga0105237_100274166 150
781 3300009545 Ga0105237_10088594 Ga0105237_100885942 150
782 3300009545 Ga0105237_10697830 Ga0105237_106978302 150
783 3300009545 Ga0105237_11468357 Ga0105237_114683571 150
784 3300009545 Ga0105237_11623165 Ga0105237_116231651 150
785 3300009551 Ga0105238_10006181 Ga0105238_100061812 150
786 3300009551 Ga0105238_10021503 Ga0105238_100215032 150
787 3300009551 Ga0105238_10223374 Ga0105238_102233742 150
788 3300009551 Ga0105238_10437442 Ga0105238_104374422 150
789 3300009551 Ga0105238_10571380 Ga0105238_105713802 150
790 3300009553 Ga0105249_11796859 Ga0105249_117968591 150
791 3300010159 Ga0099796_10021669 Ga0099796_100216692 150
792 3300010375 Ga0105239_10085316 Ga0105239_100853164 150
793 3300010375 Ga0105239_10109518 Ga0105239_101095185 150
794 3300010375 Ga0105239_10148096 Ga0105239_101480965 150
795 3300010375 Ga0105239_10281988 Ga0105239_102819883 150
796 3300010375 Ga0105239_10471752 Ga0105239_104717522 150
797 3300010375 Ga0105239_11514191 Ga0105239_115141911 150
798 3300011119 Ga0105246_10087956 Ga0105246_100879562 150
799 3300012503 Ga0157313_1022216 Ga0157313_10222161 150
800 3300013100 Ga0157373_10485336 Ga0157373_104853362 150
801 3300013102 Ga0157371_10082815 Ga0157371_100828152 150
802 3300013104 Ga0157370_10039353 Ga0157370_100393532 150
803 3300013104 Ga0157370_10171349 Ga0157370_101713492 150
804 3300013104 Ga0157370_10192821 Ga0157370_101928212 150
805 3300013105 Ga0157369_10069789 Ga0157369_100697894 150
806 3300013296 Ga0157374_10329366 Ga0157374_103293662 150
807 3300013296 Ga0157374_10704225 Ga0157374_107042251 150
808 3300013296 Ga0157374_11506452 Ga0157374_115064521 150
809 3300013297 Ga0157378_13074177 Ga0157378_130741771 150
810 3300013306 Ga0163162_10512952 Ga0163162_105129522 150
811 3300013307 Ga0157372_10548140 Ga0157372_105481402 150
812 3300013307 Ga0157372_11647710 Ga0157372_116477102 150
813 3300013308 Ga0157375_12424288 Ga0157375_124242881 150
814 3300014968 Ga0157379_11020154 Ga0157379_110201541 150
815 3300014969 Ga0157376_10446629 Ga0157376_104466292 150
816 3300020070 Ga0206356_11465087 Ga0206356_114650872 150
817 3300021320 Ga0214544_1000006 Ga0214544_1000006284 150
818 3300021321 Ga0214542_1000002 Ga0214542_100000291 150
819 3300021324 Ga0214545_1000002 Ga0214545_1000002628 150
820 3300021327 Ga0214543_1000017 Ga0214543_1000017231 150
821 3300021384 Ga0213876_10214428 Ga0213876_102144281 150
822 3300025230 Ga0209563_101649 Ga0209563_1016493 150
823 3300025250 Ga0209026_1046629 Ga0209026_10466291 150
824 3300025253 Ga0209677_101107 Ga0209677_10110710 150
825 3300025254 Ga0209148_1002189 Ga0209148_10021892 150
826 3300025258 Ga0209129_1028842 Ga0209129_10288421 150
827 3300025261 Ga0209233_1033160 Ga0209233_10331602 150
828 3300025272 Ga0209455_1002740 Ga0209455_10027405 150
829 3300025273 Ga0209673_1016891 Ga0209673_10168914 150
830 3300025290 Ga0207673_1007965 Ga0207673_10079651 150
831 3300025295 Ga0209564_1005255 Ga0209564_10052554 150
832 3300025295 Ga0209564_1006163 Ga0209564_10061637 150
833 3300025297 Ga0209758_1000065 Ga0209758_1000065169 150
834 3300025297 Ga0209758_1000189 Ga0209758_100018917 150
835 3300025297 Ga0209758_1000827 Ga0209758_100082715 150
836 3300025297 Ga0209758_1029926 Ga0209758_10299261 150
837 3300025297 Ga0209758_1143917 Ga0209758_11439171 150
838 3300025299 Ga0209256_1008826 Ga0209256_10088265 150
839 3300025302 Ga0207426_1001072 Ga0207426_100107214 150
840 3300025302 Ga0207426_1010712 Ga0207426_10107122 150
841 3300025302 Ga0207426_1034300 Ga0207426_10343002 150
842 3300025304 Ga0209257_1000880 Ga0209257_100088031 150
843 3300025304 Ga0209257_1011496 Ga0209257_10114962 150
844 3300025304 Ga0209257_1078112 Ga0209257_10781121 150
845 3300025315 Ga0207697_10058042 Ga0207697_100580422 150
846 3300025321 Ga0207656_10006242 Ga0207656_100062421 150
847 3300025898 Ga0207692_10001866 Ga0207692_100018666 150
848 3300025898 Ga0207692_10566667 Ga0207692_105666671 150
849 3300025900 Ga0207710_10021204 Ga0207710_100212043 150
850 3300025903 Ga0207680_10526427 Ga0207680_105264271 150
851 3300025904 Ga0207647_10005547 Ga0207647_100055473 150
852 3300025905 Ga0207685_10087116 Ga0207685_100871161 150
853 3300025909 Ga0207705_10028471 Ga0207705_100284714 150
854 3300025911 Ga0207654_10306940 Ga0207654_103069401 150
855 3300025912 Ga0207707_10002655 Ga0207707_100026555 150
856 3300025912 Ga0207707_10016927 Ga0207707_100169272 150
857 3300025913 Ga0207695_10000159 Ga0207695_1000015954 150
858 3300025913 Ga0207695_10286538 Ga0207695_102865382 150
859 3300025914 Ga0207671_10003280 Ga0207671_1000328010 150
860 3300025914 Ga0207671_10028648 Ga0207671_100286485 150
861 3300025914 Ga0207671_10028952 Ga0207671_100289521 150
862 3300025914 Ga0207671_10659772 Ga0207671_106597722 150
863 3300025915 Ga0207693_10004666 Ga0207693_1000466612 150
864 3300025916 Ga0207663_10124262 Ga0207663_101242621 150
865 3300025917 Ga0207660_10028715 Ga0207660_100287152 150
866 3300025917 Ga0207660_10305830 Ga0207660_103058302 150
867 3300025919 Ga0207657_10004801 Ga0207657_1000480111 150
868 3300025919 Ga0207657_10104815 Ga0207657_101048152 150
869 3300025919 Ga0207657_10147172 Ga0207657_101471722 150
870 3300025921 Ga0207652_10002660 Ga0207652_1000266011 150
871 3300025921 Ga0207652_10009472 Ga0207652_1000947210 150
872 3300025923 Ga0207681_10112482 Ga0207681_101124821 150
873 3300025924 Ga0207694_10021788 Ga0207694_100217885 150
874 3300025924 Ga0207694_10798524 Ga0207694_107985242 150
875 3300025928 Ga0207700_10152741 Ga0207700_101527413 150
876 3300025928 Ga0207700_10179479 Ga0207700_101794793 150
877 3300025931 Ga0207644_10109590 Ga0207644_101095903 150
878 3300025933 Ga0207706_10042861 Ga0207706_100428612 150
879 3300025939 Ga0207665_10857639 Ga0207665_108576391 150
880 3300025941 Ga0207711_10453437 Ga0207711_104534371 150
881 3300025942 Ga0207689_10072067 Ga0207689_100720672 150
882 3300025949 Ga0207667_10005344 Ga0207667_100053444 150
883 3300025949 Ga0207667_10047821 Ga0207667_100478214 150
884 3300025949 Ga0207667_11077373 Ga0207667_110773731 150
885 3300025949 Ga0207667_11147246 Ga0207667_111472461 150
886 3300025972 Ga0207668_10529148 Ga0207668_105291482 150
887 3300025981 Ga0207640_10059077 Ga0207640_100590772 150
888 3300025981 Ga0207640_10231667 Ga0207640_102316671 150
889 3300025981 Ga0207640_10903903 Ga0207640_109039031 150
890 3300025981 Ga0207640_11201870 Ga0207640_112018701 150
891 3300025986 Ga0207658_11673137 Ga0207658_116731371 150
892 3300026035 Ga0207703_10586752 Ga0207703_105867522 150
893 3300026041 Ga0207639_10403732 Ga0207639_104037321 150
894 3300026067 Ga0207678_10016512 Ga0207678_100165126 150
895 3300026067 Ga0207678_10068837 Ga0207678_100688373 150
896 3300026078 Ga0207702_10284656 Ga0207702_102846562 150
897 3300026089 Ga0207648_10066931 Ga0207648_100669314 150
898 3300026118 Ga0207675_101774510 Ga0207675_1017745101 150
899 3300026121 Ga0207683_10170578 Ga0207683_101705782 150
900 3300026142 Ga0207698_10075603 Ga0207698_100756032 150
901 3300026142 Ga0207698_10319500 Ga0207698_103195002 150
902 3300026142 Ga0207698_10350996 Ga0207698_103509962 150
903 3300027296 Ga0209389_1000239 Ga0209389_100023924 150
904 3300027296 Ga0209389_1000690 Ga0209389_10006906 150
905 3300027357 Ga0209589_1007787 Ga0209589_100778724 150
906 3300027361 Ga0209489_100030 Ga0209489_100030181 150
907 3300027361 Ga0209489_114919 Ga0209489_1149192 150
908 3300027363 Ga0209700_100031 Ga0209700_10003181 150
909 3300027512 Ga0209179_1088166 Ga0209179_10881661 150
910 3300027671 Ga0209588_1019963 Ga0209588_10199632 150
911 3300027671 Ga0209588_1037246 Ga0209588_10372462 150
912 3300027671 Ga0209588_1042228 Ga0209588_10422282 150
913 3300028379 Ga0268266_10023098 Ga0268266_100230982 150
914 3300028379 Ga0268266_10296513 Ga0268266_102965132 150
915 3300028381 Ga0268264_10000035 Ga0268264_10000035275 150
916 3300028786 Ga0307517_10213233 Ga0307517_102132331 150
917 3300031616 Ga0307508_10000021 Ga0307508_10000021144 150
918 3300031616 Ga0307508_10064014 Ga0307508_100640144 150
919 3300033180 Ga0307510_10004554 Ga0307510_100045544 150
920 3300033180 Ga0307510_10050493 Ga0307510_100504932 150
921 3300033180 Ga0307510_10170185 Ga0307510_101701851 150
922 3300035083 Ga0373926_0035223 Ga0373926_0035223_517_978 150
923 3300035111 Ga0373923_0089414 Ga0373923_0089414_65_520 150
924 3300035113 Ga0373936_0009414 Ga0373936_0009414_1629_2084 150
925 3300035113 Ga0373936_0021916 Ga0373936_0021916_963_1424 150
926 3300035113 Ga0373936_0054989 Ga0373936_0054989_547_1008 150
927 3300035118 Ga0373954_0175369 Ga0373954_0175369_503_958 150
928 3300035118 Ga0373954_0567197 Ga0373954_0567197_86_541 150
929 3300035170 Ga0373943_0353506 Ga0373943_0353506_200_655 150
930 3300035398 Ga0316574_0003983 Ga0316574_0003983_6910_7371 150
931 3300035692 Ga0373935_0042994 Ga0373935_0042994_1548_2009 150
932 3300035695 Ga0373927_0105328 Ga0373927_0105328_367_828 150
933 3300035695 Ga0373927_0517242 Ga0373927_0517242_206_682 150
934 3300035724 Ga0373933_0001657 Ga0373933_0001657_4250_4705 150
935 3300035725 Ga0373947_0096218 Ga0373947_0096218_313_768 150
936 3300036401 Ga0373937_0291711 Ga0373937_0291711_874_1329 150
937 3300036458 Ga0310112_022182 Ga0310112_022182_392_847 150
938 3300037068 Ga0373925_0089000 Ga0373925_0089000_716_1177 150
939 3300037068 Ga0373925_0459540 Ga0373925_0459540_377_838 150
940 3300037312 Ga0395899_0136972 Ga0395899_0136972_874_1329 150
941 3300037418 Ga0395900_0002922 Ga0395900_0002922_4399_4854 150
942 3300037418 Ga0395900_0132417 Ga0395900_0132417_1953_2408 150
943 3300037466 Ga0395898_0089582 Ga0395898_0089582_346_801 150
944 3300037466 Ga0395898_0234317 Ga0395898_0234317_229_684 150
945 3300037471 Ga0395905_0008568 Ga0395905_0008568_5952_6407 150
946 3300037471 Ga0395905_0349329 Ga0395905_0349329_283_738 150
947 3300037471 Ga0395905_0459564 Ga0395905_0459564_527_982 150
948 3300039437 Ga0436365_0712770 Ga0436365_0712770_93_554 150
949 3300039437 Ga0436365_1801845 Ga0436365_1801845_74_535 150
950 3300041443 Ga0451789_0121782 Ga0451789_0121782_99_554 150
951 3300041456 Ga0451795_0381612 Ga0451795_0381612_31_486 150
952 3300041492 Ga0451835_0222244 Ga0451835_0222244_21_476 150
953 3300041496 Ga0451839_0641073 Ga0451839_0641073_133_588 150
954 3300041498 Ga0451841_1338321 Ga0451841_1338321_586_1041 150
955 3300041509 Ga0451843_1523113 Ga0451843_1523113_282_737 150
956 3300041512 Ga0451853_4040531 Ga0451853_4040531_696_1151 150
957 3300044658 Ga0466972_0129894 Ga0466972_0129894_286_741 150
958 3300044658 Ga0466972_0139446 Ga0466972_0139446_545_1000 150
959 3300044683 Ga0466965_0077020 Ga0466965_0077020_714_1169 150
960 3300044684 Ga0466966_0000521 Ga0466966_0000521_18225_18680 150
961 3300044693 Ga0466961_0000366 Ga0466961_0000366_10658_11113 150
962 3300044694 Ga0466963_0004594 Ga0466963_0004594_2533_2988 150
963 3300044694 Ga0466963_0037426 Ga0466963_0037426_1246_1707 150
964 3300044694 Ga0466963_0090700 Ga0466963_0090700_1184_1639 150
965 3300044719 Ga0466971_0077492 Ga0466971_0077492_793_1248 150
966 3300044735 Ga0466968_0004579 Ga0466968_0004579_2872_3327 150
967 3300044842 Ga0466957_0269357 Ga0466957_0269357_616_1077 150
968 3300044901 Ga0466960_0007406 Ga0466960_0007406_815_1270 150
969 3300044901 Ga0466960_0089529 Ga0466960_0089529_589_1044 150
970 3300044901 Ga0466960_0095256 Ga0466960_0095256_622_1077 150
971 3300044901 Ga0466960_0199971 Ga0466960_0199971_601_1056 150
972 3300045049 Ga0466959_0002745 Ga0466959_0002745_5329_5784 150
973 3300045976 Ga0466967_0047144 Ga0466967_0047144_2690_3145 150
974 3300045976 Ga0466967_0047422 Ga0466967_0047422_909_1370 150
975 3300045976 Ga0466967_0348932 Ga0466967_0348932_928_1389 150
976 3300046454 Ga0495592_0122341 Ga0495592_0122341_747_1208 150
977 3300046455 Ga0495603_0151972 Ga0495603_0151972_527_982 150
978 3300046457 Ga0495590_0052445 Ga0495590_0052445_575_1030 150
979 3300046459 Ga0495629_0040426 Ga0495629_0040426_1185_1640 150
980 3300046459 Ga0495629_0198898 Ga0495629_0198898_86_547 150
981 3300046460 Ga0495638_0039683 Ga0495638_0039683_1826_2281 150
982 3300046461 Ga0495641_0041537 Ga0495641_0041537_1504_1959 150
983 3300046462 Ga0495651_0271890 Ga0495651_0271890_281_736 150
984 3300046463 Ga0495653_0073351 Ga0495653_0073351_1317_1772 150
985 3300046463 Ga0495653_0545348 Ga0495653_0545348_240_695 150
986 3300046471 Ga0495650_0100364 Ga0495650_0100364_530_985 150
987 3300046472 Ga0495580_0085055 Ga0495580_0085055_186_641 150
988 3300046473 Ga0495582_0165820 Ga0495582_0165820_233_688 150
989 3300046474 Ga0495605_0080479 Ga0495605_0080479_27_482 150
990 3300046474 Ga0495605_0134196 Ga0495605_0134196_571_1026 150
991 3300046477 Ga0495664_0010508 Ga0495664_0010508_4046_4507 150
992 3300046477 Ga0495664_0177913 Ga0495664_0177913_297_752 150
993 3300046477 Ga0495664_0393443 Ga0495664_0393443_19_474 150
994 3300046499 Ga0495594_0005644 Ga0495594_0005644_5641_6096 150
995 3300046501 Ga0495607_0185056 Ga0495607_0185056_20_475 150
996 3300046501 Ga0495607_0358055 Ga0495607_0358055_195_650 150
997 3300046507 Ga0495606_0072551 Ga0495606_0072551_1332_1787 150
998 3300046507 Ga0495606_0116087 Ga0495606_0116087_196_651 150
999 3300046507 Ga0495606_0188096 Ga0495606_0188096_618_1073 150
1000 3300046511 Ga0495608_0304897 Ga0495608_0304897_373_828 150
1001 3300046511 Ga0495608_0603768 Ga0495608_0603768_50_505 150
1002 3300046512 Ga0495610_0038221 Ga0495610_0038221_1396_1851 150
1003 3300046512 Ga0495610_0055240 Ga0495610_0055240_618_1073 150
1004 3300046513 Ga0495616_0400790 Ga0495616_0400790_46_501 150
1005 3300046515 Ga0495620_0167890 Ga0495620_0167890_182_637 150
1006 3300046515 Ga0495620_0313412 Ga0495620_0313412_98_553 150
1007 3300046516 Ga0495628_0033673 Ga0495628_0033673_2283_2738 150
1008 3300046516 Ga0495628_0852568 Ga0495628_0852568_25_480 150
1009 3300046516 Ga0495628_0977645 Ga0495628_0977645_45_506 150
1010 3300046522 Ga0495643_0090510 Ga0495643_0090510_421_876 150
1011 3300046522 Ga0495643_0189186 Ga0495643_0189186_111_566 150
1012 3300046522 Ga0495643_0269994 Ga0495643_0269994_129_584 150
1013 3300046524 Ga0495648_0002079 Ga0495648_0002079_14469_14924 150
1014 3300046524 Ga0495648_0004572 Ga0495648_0004572_11297_11752 150
1015 3300046524 Ga0495648_0039173 Ga0495648_0039173_2367_2822 150
1016 3300046526 Ga0495666_0022190 Ga0495666_0022190_270_725 150
1017 3300046529 Ga0495652_0037254 Ga0495652_0037254_1352_1807 150
1018 3300046529 Ga0495652_0120252 Ga0495652_0120252_1505_1960 150
1019 3300046531 Ga0495665_0007540 Ga0495665_0007540_3594_4055 150
1020 3300046533 Ga0495640_0039904 Ga0495640_0039904_1166_1621 150
1021 3300046533 Ga0495640_0505508 Ga0495640_0505508_240_695 150
1022 3300046536 Ga0495587_0004094 Ga0495587_0004094_7612_8067 150
1023 3300046538 Ga0495609_0033230 Ga0495609_0033230_593_1048 150
1024 3300046538 Ga0495609_0132198 Ga0495609_0132198_377_832 150
1025 3300046542 Ga0495597_0298355 Ga0495597_0298355_143_598 150
1026 3300046557 Ga0495622_0026565 Ga0495622_0026565_1166_1621 150
1027 3300046557 Ga0495622_0182664 Ga0495622_0182664_256_711 150
1028 3300046559 Ga0495667_0187515 Ga0495667_0187515_842_1297 150
1029 3300046559 Ga0495667_0273924 Ga0495667_0273924_594_1049 150
1030 3300046616 Ga0495668_0136803 Ga0495668_0136803_294_749 150
1031 3300046616 Ga0495668_0210384 Ga0495668_0210384_390_845 150
1032 3300046642 Ga0495634_0001188 Ga0495634_0001188_20405_20860 150
1033 3300046642 Ga0495634_0019165 Ga0495634_0019165_3561_4016 150
1034 3300046642 Ga0495634_0110244 Ga0495634_0110244_416_877 150
1035 3300046648 Ga0495611_0108056 Ga0495611_0108056_22_477 150
1036 3300046648 Ga0495611_0179006 Ga0495611_0179006_486_941 150
1037 3300046648 Ga0495611_0458921 Ga0495611_0458921_107_562 150
1038 3300046660 Ga0495625_0029775 Ga0495625_0029775_1855_2310 150
1039 3300046660 Ga0495625_0072992 Ga0495625_0072992_807_1262 150
1040 3300046663 Ga0495635_0002199 Ga0495635_0002199_4798_5253 150
1041 3300046663 Ga0495635_0116416 Ga0495635_0116416_1185_1640 150
1042 3300046663 Ga0495635_0162458 Ga0495635_0162458_998_1453 150
1043 3300046665 Ga0495661_0071787 Ga0495661_0071787_1211_1666 150
1044 3300046674 Ga0495588_0362169 Ga0495588_0362169_274_729 150
1045 3300046675 Ga0495657_0011029 Ga0495657_0011029_676_1131 150
1046 3300046675 Ga0495657_0157896 Ga0495657_0157896_132_587 150
1047 3300046678 Ga0495599_0020333 Ga0495599_0020333_529_984 150
1048 3300046679 Ga0495623_0555467 Ga0495623_0555467_56_511 150
1049 3300046680 Ga0495646_0039825 Ga0495646_0039825_1309_1764 150
1050 3300046680 Ga0495646_0132636 Ga0495646_0132636_51_506 150
1051 3300046681 Ga0495647_0556716 Ga0495647_0556716_41_502 150
1052 3300046683 Ga0495658_0199940 Ga0495658_0199940_86_547 150
1053 3300046689 Ga0495613_0074319 Ga0495613_0074319_1297_1752 150
1054 3300046689 Ga0495613_0093058 Ga0495613_0093058_1063_1518 150
1055 3300046690 Ga0495624_0021125 Ga0495624_0021125_1837_2292 150
1056 3300046690 Ga0495624_0057274 Ga0495624_0057274_1083_1538 150
1057 3300046690 Ga0495624_0157983 Ga0495624_0157983_455_916 150
1058 3300046692 Ga0495671_0052466 Ga0495671_0052466_1482_1937 150
1059 3300046694 Ga0495649_0032184 Ga0495649_0032184_2073_2528 150
1060 3300046794 Ga0495589_0102933 Ga0495589_0102933_172_627 150
1061 3300046809 Ga0495600_0012798 Ga0495600_0012798_1934_2389 150
1062 3300046810 Ga0495660_0213481 Ga0495660_0213481_12_467 150
1063 3300047315 Ga0495581_0000567 Ga0495581_0000567_8899_9354 150
1064 3300047315 Ga0495581_0051284 Ga0495581_0051284_1027_1482 150
1065 3300047315 Ga0495581_0206547 Ga0495581_0206547_41_496 150
1066 3300047317 Ga0495604_0002274 Ga0495604_0002274_13384_13839 150
1067 3300047317 Ga0495604_0043562 Ga0495604_0043562_2090_2545 150
1068 3300047319 Ga0495674_0313960 Ga0495674_0313960_553_1008 150
1069 3300047320 Ga0495672_0076176 Ga0495672_0076176_871_1326 150
1070 3300047321 Ga0495676_0161119 Ga0495676_0161119_364_819 150
1071 3300047322 Ga0495680_0001595 Ga0495680_0001595_16317_16772 150
1072 3300047323 Ga0495683_0215273 Ga0495683_0215273_138_593 150
1073 3300047443 Ga0495687_017339 Ga0495687_017339_2841_3296 150
1074 3300047443 Ga0495687_063407 Ga0495687_063407_199_654 150
1075 3300047444 Ga0495675_0017231 Ga0495675_0017231_2182_2637 150
1076 3300047469 Ga0495673_0021326 Ga0495673_0021326_1645_2100 150
1077 3300047469 Ga0495673_0058341 Ga0495673_0058341_685_1140 150
1078 3300047469 Ga0495673_0134074 Ga0495673_0134074_483_938 150
1079 3300047471 Ga0495684_0100756 Ga0495684_0100756_122_577 150
1080 3300047673 Ga0495593_0013868 Ga0495593_0013868_1948_2403 150
1081 3300047673 Ga0495593_0047886 Ga0495593_0047886_1597_2052 150
1082 3300047673 Ga0495593_0079851 Ga0495593_0079851_251_712 150
1083 3300048088 Ga0495602_0037408 Ga0495602_0037408_2678_3133 150
1084 3300048088 Ga0495602_0273637 Ga0495602_0273637_248_703 150
1085 3300048904 Ga0496101_0096933 Ga0496101_0096933_1661_2137 150
1086 3300048904 Ga0496101_0185444 Ga0496101_0185444_817_1272 150
1087 3300048905 Ga0496102_0012642 Ga0496102_0012642_5380_5835 150
1088 3300048905 Ga0496102_0197915 Ga0496102_0197915_977_1453 150
1089 3300048905 Ga0496102_0267429 Ga0496102_0267429_493_954 150
1090 3300048905 Ga0496102_0292351 Ga0496102_0292351_361_816 150
1091 3300048905 Ga0496102_0673079 Ga0496102_0673079_487_942 150
1092 3300048905 Ga0496102_1017614 Ga0496102_1017614_204_686 150
1093 3300048906 Ga0496103_0038684 Ga0496103_0038684_557_1012 150
1094 3300048906 Ga0496103_0052051 Ga0496103_0052051_966_1421 150
1095 3300048907 Ga0496104_0020012 Ga0496104_0020012_3923_4378 150
1096 3300048907 Ga0496104_0035023 Ga0496104_0035023_1200_1676 150
1097 3300048907 Ga0496104_0058432 Ga0496104_0058432_2879_3334 150
1098 3300048907 Ga0496104_0059878 Ga0496104_0059878_1788_2243 150
1099 3300048907 Ga0496104_0154652 Ga0496104_0154652_1685_2140 150
1100 3300048907 Ga0496104_0307686 Ga0496104_0307686_11_466 150
1101 3300048907 Ga0496104_1336276 Ga0496104_1336276_70_543 150
1102 3300048908 Ga0496105_0201571 Ga0496105_0201571_704_1159 150
1103 3300048909 Ga0496106_0000501 Ga0496106_0000501_14201_14677 150
1104 3300048909 Ga0496106_0251014 Ga0496106_0251014_426_881 150
1105 3300048910 Ga0496107_0006040 Ga0496107_0006040_4079_4555 150
1106 3300048910 Ga0496107_0068556 Ga0496107_0068556_882_1337 150
1107 3300048911 Ga0496108_0024615 Ga0496108_0024615_2033_2509 150
1108 3300048911 Ga0496108_0204531 Ga0496108_0204531_173_628 150
1109 3300048912 Ga0496109_0000607 Ga0496109_0000607_13760_14236 150
1110 3300048912 Ga0496109_0067975 Ga0496109_0067975_1119_1574 150
1111 3300048912 Ga0496109_0493161 Ga0496109_0493161_180_635 150
1112 3300048913 Ga0496110_0060742 Ga0496110_0060742_1854_2330 150
1113 3300048913 Ga0496110_0145032 Ga0496110_0145032_428_883 150
1114 3300048913 Ga0496110_0174904 Ga0496110_0174904_55_510 150
1115 3300048914 Ga0496111_0078080 Ga0496111_0078080_849_1325 150
1116 3300048914 Ga0496111_0166319 Ga0496111_0166319_1089_1544 150
1117 3300048914 Ga0496111_0497553 Ga0496111_0497553_124_579 150
1118 3300048915 Ga0496112_0025348 Ga0496112_0025348_2691_3146 150
1119 3300048915 Ga0496112_0065599 Ga0496112_0065599_484_960 150
1120 3300048915 Ga0496112_0075320 Ga0496112_0075320_117_572 150
1121 3300048916 Ga0496113_0016846 Ga0496113_0016846_3322_3798 150
1122 3300048916 Ga0496113_0079460 Ga0496113_0079460_1805_2260 150
1123 3300048916 Ga0496113_0217859 Ga0496113_0217859_429_884 150
1124 3300048916 Ga0496113_0811150 Ga0496113_0811150_223_678 150
1125 3300048917 Ga0496114_0083854 Ga0496114_0083854_370_825 150
1126 3300048918 Ga0496115_0038929 Ga0496115_0038929_1504_1959 150
1127 3300048919 Ga0496116_0062801 Ga0496116_0062801_1678_2133 150
1128 3300048920 Ga0496117_0210526 Ga0496117_0210526_613_1068 150
1129 3300048921 Ga0496118_0021216 Ga0496118_0021216_25_480 150
1130 3300048921 Ga0496118_0062071 Ga0496118_0062071_995_1450 150
1131 3300048922 Ga0496119_0026902 Ga0496119_0026902_300_755 150
1132 3300048923 Ga0496120_0029823 Ga0496120_0029823_1710_2165 150
1133 3300048924 Ga0496121_0000330 Ga0496121_0000330_49400_49855 150
1134 3300048924 Ga0496121_0026502 Ga0496121_0026502_965_1438 150
1135 3300048924 Ga0496121_0089878 Ga0496121_0089878_352_807 150
1136 3300048924 Ga0496121_0100440 Ga0496121_0100440_793_1248 150
1137 3300048924 Ga0496121_0431633 Ga0496121_0431633_251_706 150
1138 3300048925 Ga0496122_0267490 Ga0496122_0267490_444_899 150
1139 3300048926 Ga0496123_0124220 Ga0496123_0124220_369_824 150
1140 3300048927 Ga0496124_0104798 Ga0496124_0104798_715_1170 150
1141 3300048927 Ga0496124_0285506 Ga0496124_0285506_75_530 150
1142 3300048928 Ga0496125_0216754 Ga0496125_0216754_681_1136 150
1143 3300048929 Ga0496126_0024368 Ga0496126_0024368_4184_4657 150
1144 3300048929 Ga0496126_0040306 Ga0496126_0040306_1910_2365 150
1145 3300048929 Ga0496126_0086989 Ga0496126_0086989_482_943 150
1146 3300048929 Ga0496126_0316341 Ga0496126_0316341_476_931 150
1147 3300049460 Ga0495682_0049957 Ga0495682_0049957_383_838 150
1148 3300049460 Ga0495682_0058061 Ga0495682_0058061_468_923 150
1149 3300049568 Ga0501031_0013113 Ga0501031_0013113_3565_4023 150
1150 3300049569 Ga0501032_0004449 Ga0501032_0004449_3542_4000 150
1151 3300049570 Ga0501033_0001618 Ga0501033_0001618_14363_14821 150
1152 3300049571 Ga0501034_0000061 Ga0501034_0000061_125845_126303 150
1153 3300049572 Ga0501036_0000054 Ga0501036_0000054_68767_69225 150
1154 3300049573 Ga0501037_0000093 Ga0501037_0000093_68407_68865 150
1155 3300049574 Ga0501038_0000066 Ga0501038_0000066_57286_57744 150
1156 3300049575 Ga0501039_0019038 Ga0501039_0019038_2728_3186 150
1157 3300049578 Ga0501042_0286335 Ga0501042_0286335_581_1039 150
1158 3300049579 Ga0501043_0000325 Ga0501043_0000325_14090_14548 150
1159 3300049580 Ga0501046_0005977 Ga0501046_0005977_5219_5677 150
1160 3300049580 Ga0501046_0083668 Ga0501046_0083668_1020_1493 150
1161 3300049581 Ga0501047_0000621 Ga0501047_0000621_12576_13034 150
1162 3300049581 Ga0501047_0170642 Ga0501047_0170642_929_1402 150
1163 3300049582 Ga0501048_0001552 Ga0501048_0001552_16956_17414 150
1164 3300049583 Ga0501067_0000118 Ga0501067_0000118_29326_29784 150
1165 3300049584 Ga0501068_0000133 Ga0501068_0000133_10623_11081 150
1166 3300049585 Ga0501069_0053678 Ga0501069_0053678_1229_1687 150
1167 3300049586 Ga0501070_0002284 Ga0501070_0002284_15457_15915 150
1168 3300049586 Ga0501070_0055812 Ga0501070_0055812_1995_2468 150
1169 3300049586 Ga0501070_0337718 Ga0501070_0337718_72_527 150
1170 3300049588 Ga0501072_0014489 Ga0501072_0014489_2992_3450 150
1171 3300049588 Ga0501072_0620804 Ga0501072_0620804_356_814 150
1172 3300049589 Ga0501073_0002382 Ga0501073_0002382_7988_8446 150
1173 3300049589 Ga0501073_0104843 Ga0501073_0104843_867_1340 150
1174 3300049590 Ga0501074_0001116 Ga0501074_0001116_9170_9628 150
1175 3300049590 Ga0501074_0082760 Ga0501074_0082760_977_1450 150
1176 3300049592 Ga0501076_0159682 Ga0501076_0159682_916_1374 150
1177 3300049741 Ga0501079_0001682 Ga0501079_0001682_681_1139 150
1178 3300049742 Ga0501080_0001100 Ga0501080_0001100_8583_9041 150
1179 3300049742 Ga0501080_0128269 Ga0501080_0128269_973_1446 150
1180 3300049744 Ga0501083_0000331 Ga0501083_0000331_6532_6990 150
1181 3300049744 Ga0501083_0401067 Ga0501083_0401067_315_788 150
1182 3300049822 Ga0501035_0000099 Ga0501035_0000099_104104_104562 150
1183 3300049822 Ga0501035_0214243 Ga0501035_0214243_559_1032 150
1184 3300049822 Ga0501035_0333208 Ga0501035_0333208_503_958 150
1185 3300049823 Ga0501044_0000367 Ga0501044_0000367_27591_28049 150
1186 3300049823 Ga0501044_0154101 Ga0501044_0154101_871_1344 150
1187 3300049824 Ga0501045_0088929 Ga0501045_0088929_698_1156 150
1188 3300050489 nmdc:mga03683_143257_c1 nmdc:mga03683_143257_c1_519_974 150
1189 3300050491 nmdc:mga00v17_45090_c1 nmdc:mga00v17_45090_c1_612_1067 150
1190 3300050492 nmdc:mga0yw44_361482_c1 nmdc:mga0yw44_361482_c1_385_840 150
1191 3300050492 nmdc:mga0yw44_574553_c1 nmdc:mga0yw44_574553_c1_251_706 150
1192 3300050492 nmdc:mga0yw44_617652_c1 nmdc:mga0yw44_617652_c1_154_609 150
1193 3300050492 nmdc:mga0yw44_77229_c1 nmdc:mga0yw44_77229_c1_772_1227 150
1194 3300050493 nmdc:mga0k408_265081_c1 nmdc:mga0k408_265081_c1_556_1011 150
1195 3300050493 nmdc:mga0k408_66493_c1 nmdc:mga0k408_66493_c1_852_1307 150
1196 3300050494 nmdc:mga06z11_67849_c1 nmdc:mga06z11_67849_c1_130_585 150
1197 3300050496 nmdc:mga07m45_258218_c1 nmdc:mga07m45_258218_c1_430_885 150
1198 3300050496 nmdc:mga07m45_268193_c1 nmdc:mga07m45_268193_c1_265_720 150
1199 3300050496 nmdc:mga07m45_89974_c1 nmdc:mga07m45_89974_c1_639_1094 150
1200 3300053077 Ga0495601_0169277 Ga0495601_0169277_661_1116 150
1201 3300053078 Ga0495612_0026231 Ga0495612_0026231_915_1376 150
1202 3300053078 Ga0495612_0114142 Ga0495612_0114142_65_520 150
1203 3300053078 Ga0495612_0118165 Ga0495612_0118165_197_652 150
1204 3300053079 Ga0500610_0096060 Ga0500610_0096060_516_971 150
1205 3300053080 Ga0500635_0017606 Ga0500635_0017606_240_695 150
1206 3300053083 Ga0495655_0003985 Ga0495655_0003985_348_803 150
1207 3300053085 Ga0495619_0036177 Ga0495619_0036177_947_1402 150
1208 3300053086 Ga0500578_0081750 Ga0500578_0081750_1117_1572 150
1209 3300053087 Ga0500643_000040 Ga0500643_000040_166299_166754 150
1210 3300053088 Ga0500644_0082590 Ga0500644_0082590_611_1066 150
1211 3300053090 Ga0500646_0077478 Ga0500646_0077478_59_514 150
1212 3300053091 Ga0500647_0105909 Ga0500647_0105909_207_668 150
1213 3300053093 Ga0500651_0109234 Ga0500651_0109234_825_1280 150
1214 3300053093 Ga0500651_0302201 Ga0500651_0302201_442_897 150
1215 3300053094 Ga0500566_0000020 Ga0500566_0000020_13788_14249 150
1216 3300053094 Ga0500566_0000230 Ga0500566_0000230_11296_11760 150
1217 3300053094 Ga0500566_0106566 Ga0500566_0106566_787_1242 150
1218 3300053095 Ga0500640_000021 Ga0500640_000021_12789_13250 150
1219 3300053095 Ga0500640_052451 Ga0500640_052451_197_652 150
1220 3300053098 Ga0500650_0158756 Ga0500650_0158756_156_611 150
1221 3300053102 Ga0500554_014125 Ga0500554_014125_1344_1799 150
1222 3300053103 Ga0500555_002003 Ga0500555_002003_3634_4089 150
1223 3300053104 Ga0500556_0033670 Ga0500556_0033670_855_1310 150
1224 3300053105 Ga0500557_000063 Ga0500557_000063_3629_4084 150
1225 3300053108 Ga0500562_006548 Ga0500562_006548_91_546 150
1226 3300053109 Ga0500569_035310 Ga0500569_035310_588_1043 150
1227 3300053111 Ga0500572_000068 Ga0500572_000068_17864_18325 150
1228 3300053111 Ga0500572_228047 Ga0500572_228047_24_479 150
1229 3300053115 Ga0500591_041240 Ga0500591_041240_1627_2088 150
1230 3300053116 Ga0500592_004040 Ga0500592_004040_1409_1864 150
1231 3300053119 Ga0500595_002807 Ga0500595_002807_5118_5573 150
1232 3300053119 Ga0500595_009612 Ga0500595_009612_157_612 150
1233 3300053119 Ga0500595_040173 Ga0500595_040173_495_950 150
1234 3300053121 Ga0500607_068350 Ga0500607_068350_1321_1776 150
1235 3300053122 Ga0500608_018296 Ga0500608_018296_813_1274 150
1236 3300053122 Ga0500608_088864 Ga0500608_088864_969_1424 150
1237 3300053123 Ga0500614_000051 Ga0500614_000051_10700_11161 150
1238 3300053123 Ga0500614_013030 Ga0500614_013030_711_1166 150
1239 3300053125 Ga0500618_034285 Ga0500618_034285_470_925 150
1240 3300053125 Ga0500618_112380 Ga0500618_112380_19_474 150
1241 3300053126 Ga0500621_208198 Ga0500621_208198_80_535 150
1242 3300053130 Ga0500642_0001840 Ga0500642_0001840_4209_4664 150
1243 3300053131 Ga0500652_137450 Ga0500652_137450_366_821 150
1244 3300053133 Ga0500655_022750 Ga0500655_022750_467_922 150
1245 3300053134 Ga0500658_0044794 Ga0500658_0044794_439_894 150
1246 3300053136 Ga0500559_0002983 Ga0500559_0002983_3463_3924 150
1247 3300053138 Ga0500564_007088 Ga0500564_007088_3286_3741 150
1248 3300053139 Ga0500568_0003017 Ga0500568_0003017_368_823 150
1249 3300053139 Ga0500568_0005161 Ga0500568_0005161_4510_4965 150
1250 3300053144 Ga0500585_072775 Ga0500585_072775_730_1185 150
1251 3300053148 Ga0500590_239433 Ga0500590_239433_85_540 150
1252 3300053150 Ga0500603_001419 Ga0500603_001419_3405_3860 150
1253 3300053150 Ga0500603_001515 Ga0500603_001515_522_983 150
1254 3300053153 Ga0500616_0016770 Ga0500616_0016770_1582_2037 150
1255 3300053154 Ga0500619_057718 Ga0500619_057718_203_658 150
1256 3300053155 Ga0500620_010151 Ga0500620_010151_475_930 150
1257 3300053158 Ga0500627_0080236 Ga0500627_0080236_683_1138 150
1258 3300053159 Ga0500630_016613 Ga0500630_016613_881_1342 150
1259 3300053160 Ga0500633_0044024 Ga0500633_0044024_506_961 150
1260 3300053162 Ga0500638_216071 Ga0500638_216071_241_696 150
1261 3300053162 Ga0500638_286593 Ga0500638_286593_142_597 150
1262 3300053163 Ga0500639_000646 Ga0500639_000646_3239_3700 150
1263 3300053177 Ga0500636_0000120 Ga0500636_0000120_23993_24448 150
1264 3300053727 Ga0500611_006610 Ga0500611_006610_653_1108 150
1265 3300053731 Ga0500609_000334 Ga0500609_000334_304_759 150
1266 3300053735 Ga0500596_001023 Ga0500596_001023_2397_2858 150
1267 3300053736 Ga0500599_000648 Ga0500599_000648_1723_2178 150
1268 3300053737 Ga0500601_000586 Ga0500601_000586_3339_3794 150
1269 3300054114 Ga0501084_0020657 Ga0501084_0020657_2248_2706 150
1270 3300055283 Ga0500661_009211 Ga0500661_009211_862_1317 150
1271 3300055283 Ga0500661_022759 Ga0500661_022759_339_800 150
1272 3300059510 Ga0587090_040835 Ga0587090_040835_289_744 150
1273 3300059646 Ga0587078_058819 Ga0587078_058819_57_512 150
1274 3300060353 Ga0501082_0060808 Ga0501082_0060808_2767_3225 150
1275 3300061719 Ga0466962_0376500 Ga0466962_0376500_87_542 150
1276 3300025949 Ga0207667_10195106 Ga0207667_101951062 151
1277 3300044842 Ga0466957_0263354 Ga0466957_0263354_363_839 151
1278 3300006931 Ga0097620_100032736 Ga0097620_1000327364 152
1279 3300009101 Ga0105247_10012893 Ga0105247_100128934 152
1280 3300009545 Ga0105237_10210675 Ga0105237_102106751 152
1281 3300025914 Ga0207671_10256131 Ga0207671_102561311 152
1282 3300026035 Ga0207703_10212197 Ga0207703_102121973 152
1283 3300026088 Ga0207641_10993315 Ga0207641_109933151 152
1284 3300048921 Ga0496118_0471192 Ga0496118_0471192_122_583 152
1285 3300001989 JGI24739J22299_10005870 JGI24739J22299_100058706 154
1286 3300001990 JGI24737J22298_10005148 JGI24737J22298_100051487 154
1287 3300002067 JGI24735J21928_10153149 JGI24735J21928_101531491 154
1288 3300005344 Ga0070661_100905959 Ga0070661_1009059591 154
1289 3300005455 Ga0070663_100813350 Ga0070663_1008133501 154
1290 3300005539 Ga0068853_100040711 Ga0068853_1000407112 154
1291 3300005563 Ga0068855_100212992 Ga0068855_1002129924 154
1292 3300005577 Ga0068857_100064893 Ga0068857_1000648935 154
1293 3300005578 Ga0068854_100080974 Ga0068854_1000809744 154
1294 3300005614 Ga0068856_100124718 Ga0068856_1001247182 154
1295 3300005616 Ga0068852_100049727 Ga0068852_1000497276 154
1296 3300005834 Ga0068851_10167003 Ga0068851_101670032 154
1297 3300009093 Ga0105240_10031749 Ga0105240_100317498 154
1298 3300009174 Ga0105241_10876436 Ga0105241_108764362 154
1299 3300009545 Ga0105237_10037499 Ga0105237_100374992 154
1300 3300009551 Ga0105238_10008586 Ga0105238_100085869 154
1301 3300010375 Ga0105239_10008381 Ga0105239_100083819 154
1302 3300025321 Ga0207656_10184685 Ga0207656_101846852 154
1303 3300025904 Ga0207647_10005034 Ga0207647_100050341 154
1304 3300025911 Ga0207654_10958445 Ga0207654_109584452 154
1305 3300025924 Ga0207694_10093293 Ga0207694_100932933 154
1306 3300025949 Ga0207667_10050442 Ga0207667_100504427 154
1307 3300025981 Ga0207640_10011464 Ga0207640_100114648 154
1308 3300026041 Ga0207639_10120573 Ga0207639_101205732 154
1309 3300026078 Ga0207702_10038781 Ga0207702_100387815 154
1310 3300026116 Ga0207674_10007442 Ga0207674_100074427 154
1311 3300026142 Ga0207698_10079194 Ga0207698_100791942 154
1312 3300039447 Ga0436361_0940412 Ga0436361_0940412_1622_2113 154
1313 3300001979 JGI24740J21852_10007408 JGI24740J21852_100074082 158
1314 3300005539 Ga0068853_100062602 Ga0068853_1000626024 158
1315 3300009093 Ga0105240_10014484 Ga0105240_1001448410 158
1316 3300009174 Ga0105241_10016431 Ga0105241_100164313 158
1317 3300010375 Ga0105239_10040184 Ga0105239_100401844 158
1318 3300025914 Ga0207671_10162011 Ga0207671_101620112 158
1319 3300025949 Ga0207667_10003903 Ga0207667_100039039 158
1320 3300026116 Ga0207674_10037502 Ga0207674_100375026 158

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uft-assembly1.cif.gz_A crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus 0.9866 2 141
5uft-assembly1.cif.gz_A crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus 0.9529 2 141
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9351 9 136
6a6f-assembly1.cif.gz_B crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 0.9335 4 134
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9273 2 135
ID Description Score Start End Superfamily
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9262 5 134 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.907 2 135 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8901 2 148 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.881 5 134 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8757 2 135 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A257XGD5-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 1.003 42 143 GO:0005506
GO:0016226
GO:0051536
AF-A0A3D3UGF4-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9996 3 148 GO:0005506
GO:0016226
GO:0051536
AF-A0A3N1LID3-F1-model_v4 NifU-like protein involved in Fe-S cluster formation 0.9994 4 140 GO:0005506
GO:0016226
GO:0051536
AF-A0A1X3GDK4-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.999 2 142 GO:0005506
GO:0016226
GO:0051536
AF-A0A531A8H1-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9988 25 146 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
93.82 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map