F492975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1320 | 643 | 1150 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0346758|Ga0501075_0346758_322_825 |
| Length | 167 |
| Sequence | MRDFRSQGEPRRNMTLPEDIYSQRILELAAAIPRTARLAAPEATATAHSKLCGSTVTIDLAMEGDVVTDYGQSVKACLLGQSSASVMGREIVGSTAAELREVGSAMRKMLKEQGPAPGGKWGDLAVLEPVRDYKARHASTLLVFDAVEDAIGQIEAKREATAAEADA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 12 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 15 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 16 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 17 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 30 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 31 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 32 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 33 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 34 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 35 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 36 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 37 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 38 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 39 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 40 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 41 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 42 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 43 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 44 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 45 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 46 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 47 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 48 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 49 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 50 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 51 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 52 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 53 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 54 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 55 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 56 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 57 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 58 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 59 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 60 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 61 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 62 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 63 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 64 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 65 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 66 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 67 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 68 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 69 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 70 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 71 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 72 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 73 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 74 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 75 | 2922368715 | |||
| 76 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 77 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 78 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 79 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 80 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 81 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 82 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 83 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 84 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 85 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 86 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 87 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 88 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 89 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 90 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 91 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 92 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 93 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 94 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 95 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 96 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 97 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 98 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 99 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 100 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 101 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 102 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 103 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 104 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 105 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 106 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 107 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 108 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 109 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 110 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 111 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 112 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 113 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 114 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 115 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 116 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 117 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 118 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 119 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 120 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 121 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 122 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 123 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 124 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 125 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 126 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 127 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 128 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 129 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 130 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 131 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 132 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 133 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 134 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 135 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 136 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 137 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 138 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 139 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 140 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 141 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 142 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 143 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 144 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 145 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 146 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 147 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 148 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 149 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 150 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 151 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 152 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 153 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 154 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 155 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 157 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 159 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 161 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 162 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 163 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 165 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 171 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 173 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 175 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 183 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 184 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 186 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 187 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 188 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 189 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 191 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 195 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 196 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 197 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 198 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 200 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 201 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 202 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 203 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 204 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 205 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 206 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 207 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 208 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 209 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 210 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 212 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 213 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 214 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 215 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 219 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 220 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 221 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 222 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 224 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 225 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 226 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 227 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 229 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 230 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 231 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 244 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 247 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 248 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 262 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 263 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 264 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 265 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 266 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 267 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 268 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 269 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 271 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 281 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 336 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 337 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 338 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 339 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 345 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 346 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 347 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 348 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 349 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 350 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 351 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 352 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 353 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 354 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 355 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 356 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 357 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 358 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 359 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 360 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 361 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 362 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 363 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 364 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 365 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 366 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 367 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 368 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 369 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 370 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 371 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 372 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 373 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 374 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 375 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 376 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 377 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 378 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 379 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 380 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 381 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 382 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 383 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 384 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 385 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 386 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 387 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 388 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 389 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 390 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 391 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 392 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 393 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 394 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 395 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 396 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 397 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 398 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 399 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 400 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 401 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 402 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 480 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 481 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 482 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 483 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 484 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 485 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 486 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 488 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 489 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 490 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 491 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 492 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 493 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 494 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 495 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 496 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 497 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 498 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 499 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 500 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 501 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 502 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 503 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 504 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 505 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 540 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 541 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 542 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 543 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 544 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 545 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 546 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 551 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 552 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 556 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 557 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 558 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 559 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 560 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 561 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 562 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 563 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 564 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 565 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 566 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 567 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 568 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 569 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 570 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 571 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 572 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 573 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 574 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 575 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 576 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 577 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 578 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 579 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 580 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 581 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 582 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 583 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 584 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 585 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 586 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 587 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 588 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 589 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 590 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 591 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 592 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 593 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 595 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 596 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 597 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 598 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 599 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 600 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 601 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 602 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 603 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 604 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 605 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 606 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 608 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 609 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 610 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 611 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 612 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 613 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 614 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 615 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 616 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 617 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 618 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 619 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 620 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 621 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 622 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 623 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 624 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 625 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 626 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 627 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 628 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 629 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 630 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 631 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 632 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 633 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 634 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 635 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 636 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 637 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 638 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 639 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 640 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 641 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 642 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 643 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.81 |
| Metatranscriptomes | 0.38 |
| Isolates | 12.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.5 |
| Nodule | 10.61 |
| Rhizoplane | 6.29 |
| Rhizosphere | 62.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007408 | 3300001979 | Bacteria | 4463 |
| 2 | JGI24739J22299_10005870 | 3300001989 | Bacteria | 4648 |
| 3 | JGI24737J22298_10005148 | 3300001990 | Bacteria | 4526 |
| 4 | JGI24737J22298_10126031 | 3300001990 | Bacteria | 756 |
| 5 | JGI24735J21928_10153149 | 3300002067 | Bacteria | 666 |
| 6 | JGI24738J21930_10132361 | 3300002075 | Bacteria | 547 |
| 7 | JGI25165J46597_1007108 | 3300003214 | Bacteria | 1897 |
| 8 | JGI25165J46597_1017932 | 3300003214 | Bacteria | 939 |
| 9 | JGI25153J46596_10001336 | 3300003215 | Bacteria | 14751 |
| 10 | JGI25153J46596_10006825 | 3300003215 | Bacteria | 5713 |
| 11 | JGI25153J46596_10017942 | 3300003215 | Bacteria | 2767 |
| 12 | JGI25153J46596_10065045 | 3300003215 | Bacteria | 971 |
| 13 | JGI25404J52841_10009065 | 3300003659 | Bacteria | 2127 |
| 14 | Ga0055539_1009871 | 3300003752 | Bacteria | 1183 |
| 15 | Ga0055542_1015350 | 3300003762 | Bacteria | 1233 |
| 16 | Ga0055529_1011705 | 3300003763 | Bacteria | 1128 |
| 17 | Ga0055526_1030273 | 3300003771 | Bacteria | 1583 |
| 18 | Ga0055531_10009682 | 3300003794 | Bacteria | 4900 |
| 19 | Ga0055543_1004709 | 3300004625 | Bacteria | 3645 |
| 20 | Ga0065165_1002378 | 3300005262 | Bacteria | 16217 |
| 21 | Ga0065165_1007503 | 3300005262 | Bacteria | 5343 |
| 22 | Ga0065165_1009915 | 3300005262 | Bacteria | 4197 |
| 23 | Ga0070676_11289330 | 3300005328 | Bacteria | 557 |
| 24 | Ga0070683_100778079 | 3300005329 | Bacteria | 917 |
| 25 | Ga0070670_100669903 | 3300005331 | Bacteria | 932 |
| 26 | Ga0068869_100219139 | 3300005334 | Bacteria | 1507 |
| 27 | Ga0068869_100603209 | 3300005334 | Bacteria | 928 |
| 28 | Ga0070666_10904511 | 3300005335 | Bacteria | 653 |
| 29 | Ga0070680_100018149 | 3300005336 | Bacteria | 5558 |
| 30 | Ga0070680_100548580 | 3300005336 | Bacteria | 991 |
| 31 | Ga0070680_100962359 | 3300005336 | Bacteria | 737 |
| 32 | Ga0070682_100028973 | 3300005337 | Bacteria | 3333 |
| 33 | Ga0070682_100182311 | 3300005337 | Bacteria | 1468 |
| 34 | Ga0070682_100476317 | 3300005337 | Bacteria | 962 |
| 35 | Ga0070682_100591696 | 3300005337 | Bacteria | 875 |
| 36 | Ga0068868_101554255 | 3300005338 | Bacteria | 621 |
| 37 | Ga0070660_100007944 | 3300005339 | Bacteria | 7406 |
| 38 | Ga0070660_100109160 | 3300005339 | Bacteria | 2200 |
| 39 | Ga0070660_100459735 | 3300005339 | Bacteria | 1057 |
| 40 | Ga0070689_100383115 | 3300005340 | Bacteria | 1185 |
| 41 | Ga0070661_100905959 | 3300005344 | Bacteria | 728 |
| 42 | Ga0070668_100267653 | 3300005347 | Bacteria | 1423 |
| 43 | Ga0070668_100382218 | 3300005347 | Bacteria | 1198 |
| 44 | Ga0070669_100369060 | 3300005353 | Bacteria | 1169 |
| 45 | Ga0070671_100093201 | 3300005355 | Bacteria | 2524 |
| 46 | Ga0070671_100386344 | 3300005355 | Bacteria | 1197 |
| 47 | Ga0070671_100401212 | 3300005355 | Bacteria | 1173 |
| 48 | Ga0070674_100485667 | 3300005356 | Bacteria | 1026 |
| 49 | Ga0070688_100196942 | 3300005365 | Bacteria | 1407 |
| 50 | Ga0070688_100271878 | 3300005365 | Bacteria | 1214 |
| 51 | Ga0070688_100282441 | 3300005365 | Bacteria | 1193 |
| 52 | Ga0070659_100233720 | 3300005366 | Bacteria | 1519 |
| 53 | Ga0070709_10001049 | 3300005434 | Bacteria | 15239 |
| 54 | Ga0070709_10007480 | 3300005434 | Bacteria | 5989 |
| 55 | Ga0070709_10179542 | 3300005434 | Bacteria | 1485 |
| 56 | Ga0070714_100001503 | 3300005435 | Bacteria | 16962 |
| 57 | Ga0070714_101192030 | 3300005435 | Bacteria | 743 |
| 58 | Ga0070713_100009241 | 3300005436 | Bacteria | 7041 |
| 59 | Ga0070713_100014047 | 3300005436 | Bacteria | 5929 |
| 60 | Ga0070713_100258218 | 3300005436 | Bacteria | 1591 |
| 61 | Ga0070713_100288429 | 3300005436 | Bacteria | 1507 |
| 62 | Ga0070713_100708890 | 3300005436 | Bacteria | 961 |
| 63 | Ga0070713_100854847 | 3300005436 | Bacteria | 874 |
| 64 | Ga0070710_10012865 | 3300005437 | Bacteria | 4170 |
| 65 | Ga0070710_10024990 | 3300005437 | Bacteria | 3158 |
| 66 | Ga0070710_10035049 | 3300005437 | Bacteria | 2734 |
| 67 | Ga0070710_10040600 | 3300005437 | Bacteria | 2565 |
| 68 | Ga0070711_100003503 | 3300005439 | Bacteria | 9151 |
| 69 | Ga0070711_100005982 | 3300005439 | Bacteria | 7304 |
| 70 | Ga0070711_100062200 | 3300005439 | Bacteria | 2601 |
| 71 | Ga0070711_100387889 | 3300005439 | Bacteria | 1131 |
| 72 | Ga0070705_100290476 | 3300005440 | Bacteria | 1167 |
| 73 | Ga0070700_100827428 | 3300005441 | Bacteria | 748 |
| 74 | Ga0070700_101168434 | 3300005441 | Bacteria | 641 |
| 75 | Ga0070663_100066976 | 3300005455 | Bacteria | 2603 |
| 76 | Ga0070663_100128105 | 3300005455 | Bacteria | 1924 |
| 77 | Ga0070663_100813350 | 3300005455 | Bacteria | 802 |
| 78 | Ga0070678_100127431 | 3300005456 | Bacteria | 2017 |
| 79 | Ga0070678_100173943 | 3300005456 | Bacteria | 1756 |
| 80 | Ga0070678_100372199 | 3300005456 | Bacteria | 1234 |
| 81 | Ga0070678_101131972 | 3300005456 | Bacteria | 724 |
| 82 | Ga0070662_100085799 | 3300005457 | Bacteria | 2353 |
| 83 | Ga0070681_10002115 | 3300005458 | Bacteria | 18042 |
| 84 | Ga0070681_10035146 | 3300005458 | Bacteria | 5034 |
| 85 | Ga0070681_10414575 | 3300005458 | Bacteria | 1259 |
| 86 | Ga0070681_10578438 | 3300005458 | Bacteria | 1037 |
| 87 | Ga0070681_10916849 | 3300005458 | Bacteria | 795 |
| 88 | Ga0068867_100328963 | 3300005459 | Bacteria | 1268 |
| 89 | Ga0068867_101645434 | 3300005459 | Bacteria | 601 |
| 90 | Ga0070685_10576194 | 3300005466 | Bacteria | 807 |
| 91 | Ga0070679_100054054 | 3300005530 | Bacteria | 3997 |
| 92 | Ga0070679_100077530 | 3300005530 | Bacteria | 3312 |
| 93 | Ga0070679_100106756 | 3300005530 | Bacteria | 2786 |
| 94 | Ga0070684_100076765 | 3300005535 | Bacteria | 2949 |
| 95 | Ga0070684_100087521 | 3300005535 | Bacteria | 2766 |
| 96 | Ga0070684_100364981 | 3300005535 | Bacteria | 1329 |
| 97 | Ga0070684_100513144 | 3300005535 | Bacteria | 1111 |
| 98 | Ga0070697_100057741 | 3300005536 | Bacteria | 3157 |
| 99 | Ga0070697_100728346 | 3300005536 | Bacteria | 876 |
| 100 | Ga0068853_100005334 | 3300005539 | Bacteria | 10065 |
| 101 | Ga0068853_100040711 | 3300005539 | Bacteria | 3966 |
| 102 | Ga0068853_100062602 | 3300005539 | Bacteria | 3220 |
| 103 | Ga0068853_100333664 | 3300005539 | Bacteria | 1408 |
| 104 | Ga0068853_100350830 | 3300005539 | Bacteria | 1372 |
| 105 | Ga0068853_100478174 | 3300005539 | Bacteria | 1174 |
| 106 | Ga0068853_100583638 | 3300005539 | Unclassified | 1061 |
| 107 | Ga0070672_100181742 | 3300005543 | Bacteria | 1753 |
| 108 | Ga0070686_100265387 | 3300005544 | Bacteria | 1260 |
| 109 | Ga0070696_100845924 | 3300005546 | Unclassified | 756 |
| 110 | Ga0070693_100077815 | 3300005547 | Bacteria | 1970 |
| 111 | Ga0070693_100160649 | 3300005547 | Bacteria | 1431 |
| 112 | Ga0070665_100032740 | 3300005548 | Bacteria | 5230 |
| 113 | Ga0070665_100155913 | 3300005548 | Bacteria | 2285 |
| 114 | Ga0070665_100288465 | 3300005548 | Bacteria | 1643 |
| 115 | Ga0070665_100525949 | 3300005548 | Bacteria | 1194 |
| 116 | Ga0070665_100568505 | 3300005548 | Bacteria | 1146 |
| 117 | Ga0070665_100780239 | 3300005548 | Bacteria | 969 |
| 118 | Ga0070665_101525214 | 3300005548 | Bacteria | 677 |
| 119 | Ga0068855_100212992 | 3300005563 | Bacteria | 2170 |
| 120 | Ga0068855_100286486 | 3300005563 | Bacteria | 1827 |
| 121 | Ga0068855_100745625 | 3300005563 | Bacteria | 1045 |
| 122 | Ga0068855_100810069 | 3300005563 | Bacteria | 995 |
| 123 | Ga0068855_101690327 | 3300005563 | Bacteria | 646 |
| 124 | Ga0068857_100064893 | 3300005577 | Bacteria | 3246 |
| 125 | Ga0068857_100350521 | 3300005577 | Bacteria | 1367 |
| 126 | Ga0068857_100753740 | 3300005577 | Bacteria | 927 |
| 127 | Ga0068854_100013144 | 3300005578 | Bacteria | 5426 |
| 128 | Ga0068854_100080974 | 3300005578 | Bacteria | 2397 |
| 129 | Ga0068854_100180476 | 3300005578 | Bacteria | 1649 |
| 130 | Ga0068854_100775218 | 3300005578 | Bacteria | 834 |
| 131 | Ga0068854_101055113 | 3300005578 | Bacteria | 722 |
| 132 | Ga0068854_101431811 | 3300005578 | Bacteria | 626 |
| 133 | Ga0068856_100124718 | 3300005614 | Bacteria | 2578 |
| 134 | Ga0068856_100233961 | 3300005614 | Bacteria | 1853 |
| 135 | Ga0068856_100915358 | 3300005614 | Bacteria | 896 |
| 136 | Ga0068856_101093097 | 3300005614 | Bacteria | 815 |
| 137 | Ga0070702_100040026 | 3300005615 | Bacteria | 2619 |
| 138 | Ga0070702_100277620 | 3300005615 | Bacteria | 1149 |
| 139 | Ga0068852_100049727 | 3300005616 | Bacteria | 3588 |
| 140 | Ga0068852_100167350 | 3300005616 | Bacteria | 2058 |
| 141 | Ga0068852_100366915 | 3300005616 | Bacteria | 1410 |
| 142 | Ga0068852_101559146 | 3300005616 | Bacteria | 683 |
| 143 | Ga0068864_100422577 | 3300005618 | Bacteria | 1270 |
| 144 | Ga0068866_10276860 | 3300005718 | Bacteria | 1038 |
| 145 | Ga0068866_10380781 | 3300005718 | Bacteria | 905 |
| 146 | Ga0068861_100767877 | 3300005719 | Bacteria | 902 |
| 147 | Ga0068851_10006013 | 3300005834 | Bacteria | 5531 |
| 148 | Ga0068851_10167003 | 3300005834 | Bacteria | 1212 |
| 149 | Ga0068851_10189203 | 3300005834 | Bacteria | 1144 |
| 150 | Ga0068863_100867183 | 3300005841 | Bacteria | 902 |
| 151 | Ga0068858_100039039 | 3300005842 | Bacteria | 4404 |
| 152 | Ga0068858_100152965 | 3300005842 | Bacteria | 2170 |
| 153 | Ga0068858_100202919 | 3300005842 | Bacteria | 1875 |
| 154 | Ga0068858_100379908 | 3300005842 | Bacteria | 1356 |
| 155 | Ga0068858_100478075 | 3300005842 | Bacteria | 1202 |
| 156 | Ga0068860_100000113 | 3300005843 | Bacteria | 130939 |
| 157 | Ga0068860_100371183 | 3300005843 | Bacteria | 1411 |
| 158 | Ga0081455_10002285 | 3300005937 | Bacteria | 22872 |
| 159 | Ga0081455_10007249 | 3300005937 | Bacteria | 11706 |
| 160 | Ga0081538_10031309 | 3300005981 | Bacteria | 3590 |
| 161 | Ga0081538_10042515 | 3300005981 | Bacteria | 2866 |
| 162 | Ga0081540_1003440 | 3300005983 | Bacteria | 12500 |
| 163 | Ga0081540_1004142 | 3300005983 | Bacteria | 11183 |
| 164 | Ga0081540_1248391 | 3300005983 | Bacteria | 622 |
| 165 | Ga0070717_10002312 | 3300006028 | Bacteria | 13387 |
| 166 | Ga0070717_10042970 | 3300006028 | Bacteria | 3687 |
| 167 | Ga0070717_10198890 | 3300006028 | Bacteria | 1755 |
| 168 | Ga0070717_11464143 | 3300006028 | Bacteria | 620 |
| 169 | Ga0075365_10023032 | 3300006038 | Bacteria | 3912 |
| 170 | Ga0075365_10156057 | 3300006038 | Bacteria | 1589 |
| 171 | Ga0075368_10011707 | 3300006042 | Bacteria | 3196 |
| 172 | Ga0075363_100020528 | 3300006048 | Bacteria | 3315 |
| 173 | Ga0075363_100052001 | 3300006048 | Bacteria | 2186 |
| 174 | Ga0075363_100105410 | 3300006048 | Bacteria | 1563 |
| 175 | Ga0075363_100155764 | 3300006048 | Bacteria | 1291 |
| 176 | Ga0075364_10060911 | 3300006051 | Bacteria | 2475 |
| 177 | Ga0075364_10295567 | 3300006051 | Bacteria | 1102 |
| 178 | Ga0070715_10000192 | 3300006163 | Bacteria | 14303 |
| 179 | Ga0070715_10488284 | 3300006163 | Bacteria | 703 |
| 180 | Ga0070716_100063087 | 3300006173 | Bacteria | 2150 |
| 181 | Ga0070712_100004044 | 3300006175 | Bacteria | 9002 |
| 182 | Ga0070712_100008540 | 3300006175 | Bacteria | 6442 |
| 183 | Ga0075362_10018122 | 3300006177 | Bacteria | 2909 |
| 184 | Ga0075362_10115582 | 3300006177 | Bacteria | 1266 |
| 185 | Ga0075367_10016109 | 3300006178 | Bacteria | 4077 |
| 186 | Ga0075367_10120197 | 3300006178 | Bacteria | 1618 |
| 187 | Ga0075367_10230656 | 3300006178 | Bacteria | 1159 |
| 188 | Ga0075367_10338816 | 3300006178 | Bacteria | 948 |
| 189 | Ga0075367_10506098 | 3300006178 | Bacteria | 766 |
| 190 | Ga0075369_10052877 | 3300006186 | Bacteria | 1761 |
| 191 | Ga0075369_10214425 | 3300006186 | Bacteria | 890 |
| 192 | Ga0075366_10124194 | 3300006195 | Bacteria | 1556 |
| 193 | Ga0075366_10407868 | 3300006195 | Bacteria | 836 |
| 194 | Ga0097621_101721795 | 3300006237 | Bacteria | 597 |
| 195 | Ga0075370_10008196 | 3300006353 | Bacteria | 5363 |
| 196 | Ga0075370_10022481 | 3300006353 | Bacteria | 3463 |
| 197 | Ga0075370_10023253 | 3300006353 | Bacteria | 3412 |
| 198 | Ga0075370_10485829 | 3300006353 | Bacteria | 745 |
| 199 | Ga0075431_101407414 | 3300006847 | Bacteria | 657 |
| 200 | Ga0075429_100433848 | 3300006880 | Bacteria | 1151 |
| 201 | Ga0068865_100320808 | 3300006881 | Bacteria | 1246 |
| 202 | Ga0097620_100032736 | 3300006931 | Bacteria | 5222 |
| 203 | Ga0099825_1017767 | 3300006941 | Bacteria | 5721 |
| 204 | Ga0099823_1073607 | 3300006944 | Bacteria | 1460 |
| 205 | Ga0099794_10031429 | 3300007265 | Bacteria | 2485 |
| 206 | Ga0099794_10056118 | 3300007265 | Bacteria | 1905 |
| 207 | Ga0099794_10089519 | 3300007265 | Bacteria | 1526 |
| 208 | Ga0105251_10515109 | 3300009011 | Bacteria | 560 |
| 209 | Ga0105250_10053022 | 3300009092 | Bacteria | 1627 |
| 210 | Ga0105240_10001503 | 3300009093 | Bacteria | 39730 |
| 211 | Ga0105240_10012039 | 3300009093 | Bacteria | 11991 |
| 212 | Ga0105240_10014484 | 3300009093 | Bacteria | 10766 |
| 213 | Ga0105240_10016530 | 3300009093 | Bacteria | 9987 |
| 214 | Ga0105240_10031749 | 3300009093 | Bacteria | 6844 |
| 215 | Ga0105240_10453740 | 3300009093 | Bacteria | 1434 |
| 216 | Ga0105240_11198258 | 3300009093 | Bacteria | 804 |
| 217 | Ga0111539_10671213 | 3300009094 | Bacteria | 1207 |
| 218 | Ga0111539_10985186 | 3300009094 | Bacteria | 980 |
| 219 | Ga0105245_10027787 | 3300009098 | Bacteria | 4985 |
| 220 | Ga0105245_10453074 | 3300009098 | Bacteria | 1292 |
| 221 | Ga0105245_10542760 | 3300009098 | Bacteria | 1184 |
| 222 | Ga0105247_10008420 | 3300009101 | Bacteria | 6284 |
| 223 | Ga0105247_10012893 | 3300009101 | Bacteria | 5015 |
| 224 | Ga0105247_10066343 | 3300009101 | Bacteria | 2247 |
| 225 | Ga0105247_10226155 | 3300009101 | Bacteria | 1269 |
| 226 | Ga0105247_10395620 | 3300009101 | Bacteria | 983 |
| 227 | Ga0105247_10455678 | 3300009101 | Bacteria | 923 |
| 228 | Ga0105243_10089736 | 3300009148 | Bacteria | 2528 |
| 229 | Ga0105243_10130020 | 3300009148 | Bacteria | 2135 |
| 230 | Ga0105243_10957536 | 3300009148 | Bacteria | 856 |
| 231 | Ga0105243_11794713 | 3300009148 | Bacteria | 644 |
| 232 | Ga0105241_10016431 | 3300009174 | Bacteria | 5428 |
| 233 | Ga0105241_10053195 | 3300009174 | Bacteria | 3095 |
| 234 | Ga0105241_10116647 | 3300009174 | Bacteria | 2144 |
| 235 | Ga0105241_10148004 | 3300009174 | Bacteria | 1918 |
| 236 | Ga0105241_10876436 | 3300009174 | Bacteria | 832 |
| 237 | Ga0105241_11537246 | 3300009174 | Bacteria | 642 |
| 238 | Ga0105241_11595263 | 3300009174 | Bacteria | 631 |
| 239 | Ga0105241_11672279 | 3300009174 | Bacteria | 618 |
| 240 | Ga0105248_10164028 | 3300009177 | Bacteria | 2505 |
| 241 | Ga0105248_10570502 | 3300009177 | Bacteria | 1277 |
| 242 | Ga0105248_10770470 | 3300009177 | Bacteria | 1086 |
| 243 | Ga0105237_10000992 | 3300009545 | Bacteria | 38167 |
| 244 | Ga0105237_10027416 | 3300009545 | Bacteria | 5816 |
| 245 | Ga0105237_10037499 | 3300009545 | Bacteria | 4899 |
| 246 | Ga0105237_10088594 | 3300009545 | Bacteria | 3084 |
| 247 | Ga0105237_10202266 | 3300009545 | Bacteria | 1986 |
| 248 | Ga0105237_10210675 | 3300009545 | Bacteria | 1943 |
| 249 | Ga0105237_10652715 | 3300009545 | Bacteria | 1059 |
| 250 | Ga0105237_10697830 | 3300009545 | Bacteria | 1021 |
| 251 | Ga0105237_11468357 | 3300009545 | Bacteria | 688 |
| 252 | Ga0105237_11623165 | 3300009545 | Bacteria | 654 |
| 253 | Ga0105238_10006181 | 3300009551 | Bacteria | 11892 |
| 254 | Ga0105238_10008586 | 3300009551 | Bacteria | 10220 |
| 255 | Ga0105238_10021503 | 3300009551 | Bacteria | 6571 |
| 256 | Ga0105238_10223374 | 3300009551 | Bacteria | 1860 |
| 257 | Ga0105238_10286069 | 3300009551 | Bacteria | 1631 |
| 258 | Ga0105238_10437442 | 3300009551 | Bacteria | 1304 |
| 259 | Ga0105238_10571380 | 3300009551 | Bacteria | 1136 |
| 260 | Ga0105249_10380494 | 3300009553 | Bacteria | 1437 |
| 261 | Ga0105249_10556539 | 3300009553 | Bacteria | 1198 |
| 262 | Ga0105249_11796859 | 3300009553 | Bacteria | 686 |
| 263 | Ga0099796_10021669 | 3300010159 | Bacteria | 1982 |
| 264 | Ga0105239_10008381 | 3300010375 | Bacteria | 11777 |
| 265 | Ga0105239_10040184 | 3300010375 | Bacteria | 5125 |
| 266 | Ga0105239_10085316 | 3300010375 | Bacteria | 3480 |
| 267 | Ga0105239_10109518 | 3300010375 | Bacteria | 3061 |
| 268 | Ga0105239_10148096 | 3300010375 | Bacteria | 2619 |
| 269 | Ga0105239_10281988 | 3300010375 | Bacteria | 1870 |
| 270 | Ga0105239_10454113 | 3300010375 | Bacteria | 1454 |
| 271 | Ga0105239_10471752 | 3300010375 | Bacteria | 1425 |
| 272 | Ga0105239_11283959 | 3300010375 | Bacteria | 844 |
| 273 | Ga0105239_11509577 | 3300010375 | Bacteria | 776 |
| 274 | Ga0105239_11514191 | 3300010375 | Bacteria | 775 |
| 275 | Ga0105239_11986258 | 3300010375 | Bacteria | 675 |
| 276 | Ga0105246_10087956 | 3300011119 | Bacteria | 2231 |
| 277 | Ga0105246_10106277 | 3300011119 | Bacteria | 2053 |
| 278 | Ga0157322_1011308 | 3300012490 | Bacteria | 734 |
| 279 | Ga0157313_1022216 | 3300012503 | Bacteria | 657 |
| 280 | Ga0157373_10485336 | 3300013100 | Bacteria | 892 |
| 281 | Ga0157371_10082815 | 3300013102 | Bacteria | 2271 |
| 282 | Ga0157370_10039353 | 3300013104 | Bacteria | 4569 |
| 283 | Ga0157370_10049664 | 3300013104 | Bacteria | 4015 |
| 284 | Ga0157370_10159756 | 3300013104 | Bacteria | 2097 |
| 285 | Ga0157370_10171349 | 3300013104 | Bacteria | 2018 |
| 286 | Ga0157370_10192821 | 3300013104 | Bacteria | 1891 |
| 287 | Ga0157369_10069789 | 3300013105 | Bacteria | 3775 |
| 288 | Ga0157369_10103369 | 3300013105 | Bacteria | 3035 |
| 289 | Ga0157374_10035499 | 3300013296 | Bacteria | 4561 |
| 290 | Ga0157374_10329366 | 3300013296 | Bacteria | 1515 |
| 291 | Ga0157374_10704225 | 3300013296 | Bacteria | 1023 |
| 292 | Ga0157374_11506452 | 3300013296 | Bacteria | 696 |
| 293 | Ga0157374_11584631 | 3300013296 | Bacteria | 679 |
| 294 | Ga0157378_10070096 | 3300013297 | Bacteria | 3147 |
| 295 | Ga0157378_13074177 | 3300013297 | Bacteria | 518 |
| 296 | Ga0163162_10512952 | 3300013306 | Bacteria | 1329 |
| 297 | Ga0163162_12005991 | 3300013306 | Bacteria | 663 |
| 298 | Ga0157372_10548140 | 3300013307 | Bacteria | 1348 |
| 299 | Ga0157372_11478125 | 3300013307 | Bacteria | 783 |
| 300 | Ga0157372_11647710 | 3300013307 | Bacteria | 738 |
| 301 | Ga0157375_10039817 | 3300013308 | Bacteria | 4526 |
| 302 | Ga0157375_10298608 | 3300013308 | Bacteria | 1774 |
| 303 | Ga0157375_12424288 | 3300013308 | Bacteria | 626 |
| 304 | Ga0163163_10105138 | 3300014325 | Bacteria | 2848 |
| 305 | Ga0163163_10177924 | 3300014325 | Bacteria | 2174 |
| 306 | Ga0163163_10410562 | 3300014325 | Bacteria | 1413 |
| 307 | Ga0163163_10456111 | 3300014325 | Bacteria | 1339 |
| 308 | Ga0163163_10786430 | 3300014325 | Bacteria | 1015 |
| 309 | Ga0163163_11154795 | 3300014325 | Bacteria | 837 |
| 310 | Ga0157380_10009856 | 3300014326 | Bacteria | 6858 |
| 311 | Ga0157380_10434396 | 3300014326 | Bacteria | 1256 |
| 312 | Ga0157380_11074853 | 3300014326 | Bacteria | 842 |
| 313 | Ga0157379_10003171 | 3300014968 | Bacteria | 13922 |
| 314 | Ga0157379_10071516 | 3300014968 | Bacteria | 3103 |
| 315 | Ga0157379_10208848 | 3300014968 | Bacteria | 1767 |
| 316 | Ga0157379_11020154 | 3300014968 | Bacteria | 789 |
| 317 | Ga0157376_10332550 | 3300014969 | Bacteria | 1448 |
| 318 | Ga0157376_10446629 | 3300014969 | Bacteria | 1260 |
| 319 | Ga0157376_11981697 | 3300014969 | Bacteria | 620 |
| 320 | Ga0206356_11465087 | 3300020070 | Bacteria | 1152 |
| 321 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 322 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 323 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 324 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 325 | Ga0213876_10001877 | 3300021384 | Bacteria | 12635 |
| 326 | Ga0213876_10009781 | 3300021384 | Bacteria | 5160 |
| 327 | Ga0213876_10048574 | 3300021384 | Bacteria | 2242 |
| 328 | Ga0213876_10199567 | 3300021384 | Bacteria | 1063 |
| 329 | Ga0213876_10214428 | 3300021384 | Bacteria | 1024 |
| 330 | Ga0213875_10000861 | 3300021388 | Bacteria | 22412 |
| 331 | Ga0224712_10042995 | 3300022467 | Bacteria | 1715 |
| 332 | Ga0209563_101649 | 3300025230 | Bacteria | 5737 |
| 333 | Ga0209026_1046629 | 3300025250 | Bacteria | 622 |
| 334 | Ga0209677_101107 | 3300025253 | Bacteria | 12660 |
| 335 | Ga0209148_1002189 | 3300025254 | Bacteria | 7220 |
| 336 | Ga0209129_1028842 | 3300025258 | Bacteria | 940 |
| 337 | Ga0209233_1033160 | 3300025261 | Bacteria | 1187 |
| 338 | Ga0209455_1002740 | 3300025272 | Bacteria | 6614 |
| 339 | Ga0209673_1016891 | 3300025273 | Bacteria | 2711 |
| 340 | Ga0207673_1007965 | 3300025290 | Bacteria | 1336 |
| 341 | Ga0209564_1005255 | 3300025295 | Bacteria | 7475 |
| 342 | Ga0209564_1006163 | 3300025295 | Bacteria | 6569 |
| 343 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 344 | Ga0209758_1000189 | 3300025297 | Bacteria | 138296 |
| 345 | Ga0209758_1000827 | 3300025297 | Bacteria | 43314 |
| 346 | Ga0209758_1029926 | 3300025297 | Bacteria | 2264 |
| 347 | Ga0209758_1143917 | 3300025297 | Bacteria | 614 |
| 348 | Ga0209256_1008826 | 3300025299 | Bacteria | 4562 |
| 349 | Ga0207426_1001072 | 3300025302 | Bacteria | 25708 |
| 350 | Ga0207426_1010712 | 3300025302 | Bacteria | 3542 |
| 351 | Ga0207426_1034300 | 3300025302 | Bacteria | 1629 |
| 352 | Ga0209257_1000880 | 3300025304 | Bacteria | 42421 |
| 353 | Ga0209257_1011496 | 3300025304 | Bacteria | 4254 |
| 354 | Ga0209257_1078112 | 3300025304 | Bacteria | 856 |
| 355 | Ga0207697_10058042 | 3300025315 | Bacteria | 1607 |
| 356 | Ga0207656_10006242 | 3300025321 | Bacteria | 4270 |
| 357 | Ga0207656_10184685 | 3300025321 | Bacteria | 1002 |
| 358 | Ga0207692_10000798 | 3300025898 | Bacteria | 11222 |
| 359 | Ga0207692_10001866 | 3300025898 | Bacteria | 8006 |
| 360 | Ga0207692_10039773 | 3300025898 | Bacteria | 2317 |
| 361 | Ga0207692_10566667 | 3300025898 | Bacteria | 727 |
| 362 | Ga0207710_10012085 | 3300025900 | Bacteria | 3629 |
| 363 | Ga0207710_10021204 | 3300025900 | Bacteria | 2782 |
| 364 | Ga0207710_10038686 | 3300025900 | Bacteria | 2110 |
| 365 | Ga0207688_10059877 | 3300025901 | Bacteria | 2144 |
| 366 | Ga0207680_10060356 | 3300025903 | Bacteria | 2308 |
| 367 | Ga0207680_10526427 | 3300025903 | Bacteria | 843 |
| 368 | Ga0207647_10005034 | 3300025904 | Bacteria | 9740 |
| 369 | Ga0207647_10005547 | 3300025904 | Bacteria | 9237 |
| 370 | Ga0207685_10017711 | 3300025905 | Bacteria | 2311 |
| 371 | Ga0207685_10087116 | 3300025905 | Bacteria | 1306 |
| 372 | Ga0207699_10001678 | 3300025906 | Bacteria | 10478 |
| 373 | Ga0207699_10031117 | 3300025906 | Bacteria | 2993 |
| 374 | Ga0207645_10035572 | 3300025907 | Bacteria | 3198 |
| 375 | Ga0207705_10028471 | 3300025909 | Bacteria | 3983 |
| 376 | Ga0207654_10047186 | 3300025911 | Bacteria | 2460 |
| 377 | Ga0207654_10306940 | 3300025911 | Bacteria | 1081 |
| 378 | Ga0207654_10507518 | 3300025911 | Bacteria | 852 |
| 379 | Ga0207654_10958445 | 3300025911 | Bacteria | 621 |
| 380 | Ga0207707_10002655 | 3300025912 | Bacteria | 15989 |
| 381 | Ga0207707_10016927 | 3300025912 | Bacteria | 6350 |
| 382 | Ga0207695_10000159 | 3300025913 | Bacteria | 201367 |
| 383 | Ga0207695_10035634 | 3300025913 | Bacteria | 5392 |
| 384 | Ga0207695_10233374 | 3300025913 | Bacteria | 1743 |
| 385 | Ga0207695_10286538 | 3300025913 | Bacteria | 1540 |
| 386 | Ga0207695_10692486 | 3300025913 | Bacteria | 900 |
| 387 | Ga0207671_10003280 | 3300025914 | Bacteria | 16284 |
| 388 | Ga0207671_10028648 | 3300025914 | Bacteria | 4160 |
| 389 | Ga0207671_10028952 | 3300025914 | Bacteria | 4138 |
| 390 | Ga0207671_10122859 | 3300025914 | Bacteria | 1986 |
| 391 | Ga0207671_10162011 | 3300025914 | Bacteria | 1733 |
| 392 | Ga0207671_10256131 | 3300025914 | Bacteria | 1376 |
| 393 | Ga0207671_10576829 | 3300025914 | Bacteria | 897 |
| 394 | Ga0207671_10659772 | 3300025914 | Bacteria | 833 |
| 395 | Ga0207693_10001679 | 3300025915 | Bacteria | 19500 |
| 396 | Ga0207693_10004666 | 3300025915 | Bacteria | 11549 |
| 397 | Ga0207693_10021981 | 3300025915 | Bacteria | 5071 |
| 398 | Ga0207663_10000672 | 3300025916 | Bacteria | 15122 |
| 399 | Ga0207663_10124262 | 3300025916 | Bacteria | 1772 |
| 400 | Ga0207663_10435653 | 3300025916 | Bacteria | 1009 |
| 401 | Ga0207663_10636806 | 3300025916 | Bacteria | 840 |
| 402 | Ga0207660_10028715 | 3300025917 | Bacteria | 3807 |
| 403 | Ga0207660_10243663 | 3300025917 | Bacteria | 1417 |
| 404 | Ga0207660_10305830 | 3300025917 | Bacteria | 1267 |
| 405 | Ga0207657_10004801 | 3300025919 | Bacteria | 14253 |
| 406 | Ga0207657_10104815 | 3300025919 | Bacteria | 2342 |
| 407 | Ga0207657_10147172 | 3300025919 | Bacteria | 1921 |
| 408 | Ga0207657_10178343 | 3300025919 | Bacteria | 1718 |
| 409 | Ga0207652_10002660 | 3300025921 | Bacteria | 14994 |
| 410 | Ga0207652_10009472 | 3300025921 | Bacteria | 7830 |
| 411 | Ga0207652_10085230 | 3300025921 | Bacteria | 2769 |
| 412 | Ga0207681_10112482 | 3300025923 | Bacteria | 1983 |
| 413 | Ga0207694_10021788 | 3300025924 | Bacteria | 4857 |
| 414 | Ga0207694_10093293 | 3300025924 | Bacteria | 2378 |
| 415 | Ga0207694_10798524 | 3300025924 | Bacteria | 797 |
| 416 | Ga0207694_11633823 | 3300025924 | Bacteria | 543 |
| 417 | Ga0207700_10008661 | 3300025928 | Bacteria | 6317 |
| 418 | Ga0207700_10027097 | 3300025928 | Bacteria | 4008 |
| 419 | Ga0207700_10152741 | 3300025928 | Bacteria | 1909 |
| 420 | Ga0207700_10165011 | 3300025928 | Bacteria | 1842 |
| 421 | Ga0207700_10179479 | 3300025928 | Bacteria | 1772 |
| 422 | Ga0207700_10329667 | 3300025928 | Bacteria | 1325 |
| 423 | Ga0207700_10521898 | 3300025928 | Bacteria | 1052 |
| 424 | Ga0207664_10012380 | 3300025929 | Bacteria | 6096 |
| 425 | Ga0207644_10109590 | 3300025931 | Bacteria | 2086 |
| 426 | Ga0207644_10644089 | 3300025931 | Bacteria | 882 |
| 427 | Ga0207644_11332323 | 3300025931 | Bacteria | 603 |
| 428 | Ga0207690_10429900 | 3300025932 | Bacteria | 1058 |
| 429 | Ga0207690_10490573 | 3300025932 | Bacteria | 992 |
| 430 | Ga0207690_11114985 | 3300025932 | Bacteria | 658 |
| 431 | Ga0207706_10042861 | 3300025933 | Bacteria | 4010 |
| 432 | Ga0207706_10163653 | 3300025933 | Bacteria | 1955 |
| 433 | Ga0207709_10272671 | 3300025935 | Bacteria | 1246 |
| 434 | Ga0207670_10519532 | 3300025936 | Bacteria | 969 |
| 435 | Ga0207669_10029042 | 3300025937 | Bacteria | 3052 |
| 436 | Ga0207669_10248924 | 3300025937 | Bacteria | 1322 |
| 437 | Ga0207669_10839533 | 3300025937 | Bacteria | 764 |
| 438 | Ga0207704_10122749 | 3300025938 | Bacteria | 1782 |
| 439 | Ga0207704_10479932 | 3300025938 | Bacteria | 998 |
| 440 | Ga0207665_10000700 | 3300025939 | Bacteria | 22712 |
| 441 | Ga0207665_10465973 | 3300025939 | Bacteria | 972 |
| 442 | Ga0207665_10857639 | 3300025939 | Bacteria | 719 |
| 443 | Ga0207711_10115930 | 3300025941 | Bacteria | 2387 |
| 444 | Ga0207711_10453437 | 3300025941 | Bacteria | 1194 |
| 445 | Ga0207711_10480020 | 3300025941 | Bacteria | 1158 |
| 446 | Ga0207689_10072067 | 3300025942 | Bacteria | 2838 |
| 447 | Ga0207689_10338223 | 3300025942 | Bacteria | 1250 |
| 448 | Ga0207689_10678558 | 3300025942 | Bacteria | 868 |
| 449 | Ga0207661_10000755 | 3300025944 | Bacteria | 21031 |
| 450 | Ga0207667_10003903 | 3300025949 | Bacteria | 18339 |
| 451 | Ga0207667_10005344 | 3300025949 | Bacteria | 15656 |
| 452 | Ga0207667_10047821 | 3300025949 | Bacteria | 4526 |
| 453 | Ga0207667_10050442 | 3300025949 | Bacteria | 4390 |
| 454 | Ga0207667_10195106 | 3300025949 | Bacteria | 2077 |
| 455 | Ga0207667_10425834 | 3300025949 | Bacteria | 1350 |
| 456 | Ga0207667_11077373 | 3300025949 | Bacteria | 788 |
| 457 | Ga0207667_11147246 | 3300025949 | Bacteria | 759 |
| 458 | Ga0207712_10626335 | 3300025961 | Bacteria | 933 |
| 459 | Ga0207668_10529148 | 3300025972 | Bacteria | 1018 |
| 460 | Ga0207640_10007468 | 3300025981 | Bacteria | 6038 |
| 461 | Ga0207640_10011464 | 3300025981 | Bacteria | 5023 |
| 462 | Ga0207640_10059077 | 3300025981 | Bacteria | 2529 |
| 463 | Ga0207640_10231667 | 3300025981 | Bacteria | 1421 |
| 464 | Ga0207640_10642756 | 3300025981 | Bacteria | 903 |
| 465 | Ga0207640_10903903 | 3300025981 | Bacteria | 771 |
| 466 | Ga0207640_11201870 | 3300025981 | Bacteria | 674 |
| 467 | Ga0207658_10038482 | 3300025986 | Bacteria | 3446 |
| 468 | Ga0207658_11673137 | 3300025986 | Bacteria | 581 |
| 469 | Ga0207703_10212197 | 3300026035 | Bacteria | 1727 |
| 470 | Ga0207703_10586752 | 3300026035 | Bacteria | 1053 |
| 471 | Ga0207703_10614912 | 3300026035 | Bacteria | 1029 |
| 472 | Ga0207639_10005552 | 3300026041 | Bacteria | 8529 |
| 473 | Ga0207639_10120573 | 3300026041 | Bacteria | 2154 |
| 474 | Ga0207639_10403732 | 3300026041 | Bacteria | 1231 |
| 475 | Ga0207639_10408576 | 3300026041 | Bacteria | 1225 |
| 476 | Ga0207678_10016512 | 3300026067 | Bacteria | 6482 |
| 477 | Ga0207678_10026683 | 3300026067 | Bacteria | 5039 |
| 478 | Ga0207678_10068837 | 3300026067 | Bacteria | 3036 |
| 479 | Ga0207678_10571857 | 3300026067 | Bacteria | 989 |
| 480 | Ga0207678_10883321 | 3300026067 | Bacteria | 790 |
| 481 | Ga0207708_10170684 | 3300026075 | Bacteria | 1722 |
| 482 | Ga0207702_10038781 | 3300026078 | Bacteria | 3990 |
| 483 | Ga0207702_10284656 | 3300026078 | Bacteria | 1564 |
| 484 | Ga0207702_10596321 | 3300026078 | Bacteria | 1084 |
| 485 | Ga0207641_10530953 | 3300026088 | Bacteria | 1145 |
| 486 | Ga0207641_10993315 | 3300026088 | Bacteria | 836 |
| 487 | Ga0207648_10066931 | 3300026089 | Bacteria | 3133 |
| 488 | Ga0207676_10206133 | 3300026095 | Bacteria | 1741 |
| 489 | Ga0207676_10631639 | 3300026095 | Bacteria | 1032 |
| 490 | Ga0207676_11021251 | 3300026095 | Bacteria | 815 |
| 491 | Ga0207674_10007442 | 3300026116 | Bacteria | 12762 |
| 492 | Ga0207674_10037502 | 3300026116 | Bacteria | 5040 |
| 493 | Ga0207674_10203175 | 3300026116 | Bacteria | 1931 |
| 494 | Ga0207674_11192107 | 3300026116 | Bacteria | 731 |
| 495 | Ga0207675_100298166 | 3300026118 | Bacteria | 1570 |
| 496 | Ga0207675_101774510 | 3300026118 | Bacteria | 636 |
| 497 | Ga0207683_10153255 | 3300026121 | Bacteria | 2081 |
| 498 | Ga0207683_10170578 | 3300026121 | Bacteria | 1970 |
| 499 | Ga0207683_10291320 | 3300026121 | Bacteria | 1493 |
| 500 | Ga0207698_10075603 | 3300026142 | Bacteria | 2693 |
| 501 | Ga0207698_10079194 | 3300026142 | Bacteria | 2642 |
| 502 | Ga0207698_10319500 | 3300026142 | Bacteria | 1453 |
| 503 | Ga0207698_10350996 | 3300026142 | Bacteria | 1393 |
| 504 | Ga0209389_1000239 | 3300027296 | Bacteria | 35712 |
| 505 | Ga0209389_1000690 | 3300027296 | Bacteria | 21019 |
| 506 | Ga0209589_1007787 | 3300027357 | Bacteria | 17039 |
| 507 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 508 | Ga0209489_114919 | 3300027361 | Bacteria | 5112 |
| 509 | Ga0209700_100031 | 3300027363 | Bacteria | 207349 |
| 510 | Ga0209179_1088166 | 3300027512 | Bacteria | 687 |
| 511 | Ga0209588_1019963 | 3300027671 | Bacteria | 2096 |
| 512 | Ga0209588_1037246 | 3300027671 | Bacteria | 1565 |
| 513 | Ga0209588_1042228 | 3300027671 | Bacteria | 1473 |
| 514 | Ga0268266_10023098 | 3300028379 | Bacteria | 5293 |
| 515 | Ga0268266_10030787 | 3300028379 | Bacteria | 4557 |
| 516 | Ga0268266_10233953 | 3300028379 | Bacteria | 1693 |
| 517 | Ga0268266_10270068 | 3300028379 | Bacteria | 1578 |
| 518 | Ga0268266_10296513 | 3300028379 | Bacteria | 1507 |
| 519 | Ga0268266_10533691 | 3300028379 | Bacteria | 1123 |
| 520 | Ga0268266_10601395 | 3300028379 | Bacteria | 1056 |
| 521 | Ga0268265_11213129 | 3300028380 | Bacteria | 752 |
| 522 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 523 | Ga0307517_10213233 | 3300028786 | Bacteria | 1186 |
| 524 | Ga0307515_10355834 | 3300028794 | Bacteria | 1108 |
| 525 | Ga0307512_10263719 | 3300030522 | Bacteria | 843 |
| 526 | Ga0265325_10390633 | 3300031241 | Bacteria | 610 |
| 527 | Ga0265339_10030751 | 3300031249 | Bacteria | 3038 |
| 528 | Ga0307408_100327901 | 3300031548 | Bacteria | 1292 |
| 529 | Ga0307508_10000021 | 3300031616 | Bacteria | 183823 |
| 530 | Ga0307508_10049567 | 3300031616 | Bacteria | 3740 |
| 531 | Ga0307508_10064014 | 3300031616 | Bacteria | 3243 |
| 532 | Ga0316579_10323998 | 3300031691 | Bacteria | 745 |
| 533 | Ga0307413_10399379 | 3300031824 | Bacteria | 1076 |
| 534 | Ga0307410_10094642 | 3300031852 | Bacteria | 2128 |
| 535 | Ga0307407_10499689 | 3300031903 | Bacteria | 891 |
| 536 | Ga0307510_10004554 | 3300033180 | Bacteria | 16321 |
| 537 | Ga0307510_10050493 | 3300033180 | Bacteria | 4411 |
| 538 | Ga0307510_10170185 | 3300033180 | Bacteria | 1759 |
| 539 | Ga0373926_0035223 | 3300035083 | Bacteria | 1775 |
| 540 | Ga0373944_0102069 | 3300035089 | Bacteria | 970 |
| 541 | Ga0373923_0089414 | 3300035111 | Bacteria | 1345 |
| 542 | Ga0373923_0295524 | 3300035111 | Bacteria | 766 |
| 543 | Ga0373936_0009414 | 3300035113 | Bacteria | 3683 |
| 544 | Ga0373936_0021916 | 3300035113 | Bacteria | 2487 |
| 545 | Ga0373936_0054989 | 3300035113 | Bacteria | 1615 |
| 546 | Ga0373936_0122921 | 3300035113 | Bacteria | 1110 |
| 547 | Ga0373936_0150457 | 3300035113 | Bacteria | 1009 |
| 548 | Ga0373954_0175369 | 3300035118 | Bacteria | 1051 |
| 549 | Ga0373954_0567197 | 3300035118 | Bacteria | 563 |
| 550 | Ga0373943_0239776 | 3300035170 | Bacteria | 1016 |
| 551 | Ga0373943_0353506 | 3300035170 | Bacteria | 842 |
| 552 | Ga0373946_0115373 | 3300035171 | Bacteria | 1220 |
| 553 | Ga0316574_0003983 | 3300035398 | Bacteria | 7691 |
| 554 | Ga0373935_0032938 | 3300035692 | Bacteria | 3223 |
| 555 | Ga0373935_0042994 | 3300035692 | Bacteria | 2842 |
| 556 | Ga0373927_0001314 | 3300035695 | Bacteria | 18769 |
| 557 | Ga0373927_0016642 | 3300035695 | Bacteria | 4851 |
| 558 | Ga0373927_0105328 | 3300035695 | Bacteria | 1836 |
| 559 | Ga0373927_0517242 | 3300035695 | Bacteria | 789 |
| 560 | Ga0373933_0001657 | 3300035724 | Bacteria | 12952 |
| 561 | Ga0373947_0032609 | 3300035725 | Bacteria | 3071 |
| 562 | Ga0373947_0043194 | 3300035725 | Bacteria | 2692 |
| 563 | Ga0373947_0096218 | 3300035725 | Bacteria | 1853 |
| 564 | Ga0373937_0291711 | 3300036401 | Bacteria | 1541 |
| 565 | Ga0373937_0580910 | 3300036401 | Bacteria | 1064 |
| 566 | Ga0373937_1093704 | 3300036401 | Bacteria | 746 |
| 567 | Ga0310112_022182 | 3300036458 | Bacteria | 888 |
| 568 | Ga0373925_0009010 | 3300037068 | Bacteria | 7267 |
| 569 | Ga0373925_0089000 | 3300037068 | Bacteria | 2358 |
| 570 | Ga0373925_0459540 | 3300037068 | Bacteria | 1043 |
| 571 | Ga0395899_0136972 | 3300037312 | Bacteria | 1745 |
| 572 | Ga0395899_0314745 | 3300037312 | Bacteria | 1056 |
| 573 | Ga0395899_0838407 | 3300037312 | Bacteria | 565 |
| 574 | Ga0395900_0002922 | 3300037418 | Bacteria | 18612 |
| 575 | Ga0395900_0086928 | 3300037418 | Bacteria | 3213 |
| 576 | Ga0395900_0132417 | 3300037418 | Bacteria | 2555 |
| 577 | Ga0395898_0089582 | 3300037466 | Bacteria | 2961 |
| 578 | Ga0395898_0111784 | 3300037466 | Bacteria | 2618 |
| 579 | Ga0395898_0117507 | 3300037466 | Bacteria | 2548 |
| 580 | Ga0395898_0234317 | 3300037466 | Bacteria | 1751 |
| 581 | Ga0395905_0008568 | 3300037471 | Bacteria | 10082 |
| 582 | Ga0395905_0349329 | 3300037471 | Bacteria | 1371 |
| 583 | Ga0395905_0459564 | 3300037471 | Bacteria | 1171 |
| 584 | Ga0436364_0722239 | 3300037853 | Bacteria | 6801 |
| 585 | Ga0395901_0161914 | 3300038443 | Bacteria | 2350 |
| 586 | Ga0395901_0990892 | 3300038443 | Bacteria | 817 |
| 587 | Ga0400485_18562 | 3300038735 | Bacteria | 1200 |
| 588 | Ga0436365_0396709 | 3300039437 | Bacteria | 84982 |
| 589 | Ga0436365_0397559 | 3300039437 | Bacteria | 11175 |
| 590 | Ga0436365_0658425 | 3300039437 | Bacteria | 1177 |
| 591 | Ga0436365_0712770 | 3300039437 | Bacteria | 2536 |
| 592 | Ga0436365_1704593 | 3300039437 | Bacteria | 2629 |
| 593 | Ga0436365_1801845 | 3300039437 | Bacteria | 832 |
| 594 | Ga0436365_1891429 | 3300039437 | Bacteria | 2040 |
| 595 | Ga0436361_0940412 | 3300039447 | Bacteria | 5076 |
| 596 | Ga0436363_0282582 | 3300039450 | Bacteria | 712 |
| 597 | Ga0436363_0874061 | 3300039450 | Bacteria | 2000 |
| 598 | Ga0436363_1445334 | 3300039450 | Bacteria | 13114 |
| 599 | Ga0436363_1561684 | 3300039450 | Bacteria | 1190 |
| 600 | Ga0436362_1010515 | 3300039453 | Bacteria | 5111 |
| 601 | Ga0436362_1295787 | 3300039453 | Bacteria | 2077 |
| 602 | Ga0451789_0121782 | 3300041443 | Bacteria | 1162 |
| 603 | Ga0451795_0381612 | 3300041456 | Bacteria | 561 |
| 604 | Ga0451835_0222244 | 3300041492 | Bacteria | 556 |
| 605 | Ga0451839_0641073 | 3300041496 | Bacteria | 671 |
| 606 | Ga0451841_1338321 | 3300041498 | Bacteria | 1172 |
| 607 | Ga0451843_1523113 | 3300041509 | Bacteria | 900 |
| 608 | Ga0451853_4040531 | 3300041512 | Bacteria | 1214 |
| 609 | Ga0439448_0191032 | 3300042005 | Bacteria | 717 |
| 610 | Ga0466972_0129894 | 3300044658 | Bacteria | 1186 |
| 611 | Ga0466972_0139446 | 3300044658 | Bacteria | 1141 |
| 612 | Ga0466965_0077020 | 3300044683 | Bacteria | 1683 |
| 613 | Ga0466966_0000521 | 3300044684 | Bacteria | 24509 |
| 614 | Ga0466966_0041436 | 3300044684 | Bacteria | 2959 |
| 615 | Ga0466966_0874786 | 3300044684 | Bacteria | 542 |
| 616 | Ga0466961_0000366 | 3300044693 | Bacteria | 29235 |
| 617 | Ga0466963_0004594 | 3300044694 | Bacteria | 8038 |
| 618 | Ga0466963_0037426 | 3300044694 | Bacteria | 3168 |
| 619 | Ga0466963_0090700 | 3300044694 | Bacteria | 2081 |
| 620 | Ga0466963_0315589 | 3300044694 | Bacteria | 1100 |
| 621 | Ga0466971_0077492 | 3300044719 | Bacteria | 1513 |
| 622 | Ga0466968_0004579 | 3300044735 | Bacteria | 5172 |
| 623 | Ga0466970_0121485 | 3300044765 | Bacteria | 1431 |
| 624 | Ga0466957_0037493 | 3300044842 | Bacteria | 2919 |
| 625 | Ga0466957_0263354 | 3300044842 | Bacteria | 1149 |
| 626 | Ga0466957_0269357 | 3300044842 | Bacteria | 1137 |
| 627 | Ga0466960_0007406 | 3300044901 | Bacteria | 4457 |
| 628 | Ga0466960_0089529 | 3300044901 | Bacteria | 1566 |
| 629 | Ga0466960_0095256 | 3300044901 | Bacteria | 1524 |
| 630 | Ga0466960_0199971 | 3300044901 | Bacteria | 1091 |
| 631 | Ga0466959_0002745 | 3300045049 | Bacteria | 11338 |
| 632 | Ga0466967_0047144 | 3300045976 | Bacteria | 3756 |
| 633 | Ga0466967_0047422 | 3300045976 | Bacteria | 3745 |
| 634 | Ga0466967_0221409 | 3300045976 | Bacteria | 1798 |
| 635 | Ga0466967_0348932 | 3300045976 | Bacteria | 1432 |
| 636 | Ga0495592_0122341 | 3300046454 | Bacteria | 1829 |
| 637 | Ga0495592_0470201 | 3300046454 | Bacteria | 785 |
| 638 | Ga0495603_0000101 | 3300046455 | Bacteria | 40111 |
| 639 | Ga0495603_0151972 | 3300046455 | Bacteria | 1344 |
| 640 | Ga0495603_0184270 | 3300046455 | Bacteria | 1208 |
| 641 | Ga0495590_0052445 | 3300046457 | Bacteria | 1425 |
| 642 | Ga0495629_0002313 | 3300046459 | Bacteria | 14675 |
| 643 | Ga0495629_0040426 | 3300046459 | Bacteria | 3280 |
| 644 | Ga0495629_0198898 | 3300046459 | Bacteria | 1386 |
| 645 | Ga0495638_0039683 | 3300046460 | Bacteria | 2987 |
| 646 | Ga0495641_0008274 | 3300046461 | Bacteria | 6362 |
| 647 | Ga0495641_0041537 | 3300046461 | Bacteria | 2136 |
| 648 | Ga0495651_0271890 | 3300046462 | Bacteria | 1148 |
| 649 | Ga0495653_0073351 | 3300046463 | Bacteria | 2554 |
| 650 | Ga0495653_0545348 | 3300046463 | Bacteria | 718 |
| 651 | Ga0495650_0100364 | 3300046471 | Bacteria | 1088 |
| 652 | Ga0495580_0000825 | 3300046472 | Bacteria | 26887 |
| 653 | Ga0495580_0085055 | 3300046472 | Bacteria | 2203 |
| 654 | Ga0495582_0000567 | 3300046473 | Bacteria | 20465 |
| 655 | Ga0495582_0165820 | 3300046473 | Bacteria | 1257 |
| 656 | Ga0495582_0322383 | 3300046473 | Bacteria | 889 |
| 657 | Ga0495605_0080479 | 3300046474 | Bacteria | 1525 |
| 658 | Ga0495605_0134196 | 3300046474 | Bacteria | 1114 |
| 659 | Ga0495639_0005952 | 3300046475 | Bacteria | 5246 |
| 660 | Ga0495639_0288498 | 3300046475 | Bacteria | 817 |
| 661 | Ga0495662_0159561 | 3300046476 | Bacteria | 1111 |
| 662 | Ga0495664_0010508 | 3300046477 | Bacteria | 5194 |
| 663 | Ga0495664_0012345 | 3300046477 | Bacteria | 4837 |
| 664 | Ga0495664_0177913 | 3300046477 | Bacteria | 1290 |
| 665 | Ga0495664_0356689 | 3300046477 | Bacteria | 880 |
| 666 | Ga0495664_0393443 | 3300046477 | Bacteria | 832 |
| 667 | Ga0495584_0123278 | 3300046491 | Bacteria | 1313 |
| 668 | Ga0495584_0295169 | 3300046491 | Bacteria | 823 |
| 669 | Ga0495594_0000023 | 3300046499 | Bacteria | 70363 |
| 670 | Ga0495594_0005644 | 3300046499 | Bacteria | 6435 |
| 671 | Ga0495607_0185056 | 3300046501 | Bacteria | 1042 |
| 672 | Ga0495607_0358055 | 3300046501 | Bacteria | 672 |
| 673 | Ga0495606_0072551 | 3300046507 | Bacteria | 2162 |
| 674 | Ga0495606_0116087 | 3300046507 | Bacteria | 1608 |
| 675 | Ga0495606_0188096 | 3300046507 | Bacteria | 1185 |
| 676 | Ga0495608_0304897 | 3300046511 | Bacteria | 985 |
| 677 | Ga0495608_0603768 | 3300046511 | Bacteria | 658 |
| 678 | Ga0495610_0038221 | 3300046512 | Bacteria | 2438 |
| 679 | Ga0495610_0055240 | 3300046512 | Bacteria | 1915 |
| 680 | Ga0495616_0400790 | 3300046513 | Bacteria | 564 |
| 681 | Ga0495620_0167890 | 3300046515 | Bacteria | 851 |
| 682 | Ga0495620_0313412 | 3300046515 | Bacteria | 596 |
| 683 | Ga0495628_0033673 | 3300046516 | Bacteria | 4127 |
| 684 | Ga0495628_0852568 | 3300046516 | Bacteria | 635 |
| 685 | Ga0495628_0977645 | 3300046516 | Bacteria | 583 |
| 686 | Ga0495630_0626510 | 3300046517 | Bacteria | 824 |
| 687 | Ga0495631_0049011 | 3300046518 | Bacteria | 1851 |
| 688 | Ga0495643_0090510 | 3300046522 | Bacteria | 1579 |
| 689 | Ga0495643_0189186 | 3300046522 | Bacteria | 995 |
| 690 | Ga0495643_0269994 | 3300046522 | Bacteria | 786 |
| 691 | Ga0495648_0002079 | 3300046524 | Bacteria | 18947 |
| 692 | Ga0495648_0004572 | 3300046524 | Bacteria | 11787 |
| 693 | Ga0495648_0039173 | 3300046524 | Bacteria | 3019 |
| 694 | Ga0495666_0022190 | 3300046526 | Bacteria | 3143 |
| 695 | Ga0495652_0037254 | 3300046529 | Bacteria | 4220 |
| 696 | Ga0495652_0120252 | 3300046529 | Bacteria | 2096 |
| 697 | Ga0495665_0007540 | 3300046531 | Bacteria | 5890 |
| 698 | Ga0495665_0051214 | 3300046531 | Bacteria | 2187 |
| 699 | Ga0495665_0051943 | 3300046531 | Bacteria | 2170 |
| 700 | Ga0495665_0443546 | 3300046531 | Bacteria | 656 |
| 701 | Ga0495640_0039904 | 3300046533 | Bacteria | 3291 |
| 702 | Ga0495640_0505508 | 3300046533 | Bacteria | 735 |
| 703 | Ga0495640_0585540 | 3300046533 | Bacteria | 675 |
| 704 | Ga0495586_0379665 | 3300046535 | Bacteria | 813 |
| 705 | Ga0495587_0004094 | 3300046536 | Bacteria | 9650 |
| 706 | Ga0495598_0227310 | 3300046537 | Bacteria | 683 |
| 707 | Ga0495609_0033230 | 3300046538 | Bacteria | 2342 |
| 708 | Ga0495609_0132198 | 3300046538 | Bacteria | 1068 |
| 709 | Ga0495597_0298355 | 3300046542 | Bacteria | 625 |
| 710 | Ga0495645_0028858 | 3300046543 | Bacteria | 4032 |
| 711 | Ga0495622_0001800 | 3300046557 | Bacteria | 10567 |
| 712 | Ga0495622_0026565 | 3300046557 | Bacteria | 2702 |
| 713 | Ga0495622_0182664 | 3300046557 | Bacteria | 940 |
| 714 | Ga0495667_0187515 | 3300046559 | Bacteria | 1326 |
| 715 | Ga0495667_0273924 | 3300046559 | Bacteria | 1072 |
| 716 | Ga0495667_0652315 | 3300046559 | Bacteria | 654 |
| 717 | Ga0495656_0255011 | 3300046615 | Bacteria | 887 |
| 718 | Ga0495668_0048247 | 3300046616 | Bacteria | 2363 |
| 719 | Ga0495668_0136803 | 3300046616 | Bacteria | 1341 |
| 720 | Ga0495668_0210384 | 3300046616 | Bacteria | 1065 |
| 721 | Ga0495634_0001188 | 3300046642 | Bacteria | 24100 |
| 722 | Ga0495634_0019165 | 3300046642 | Bacteria | 4863 |
| 723 | Ga0495634_0110244 | 3300046642 | Bacteria | 1770 |
| 724 | Ga0495611_0108056 | 3300046648 | Bacteria | 1294 |
| 725 | Ga0495611_0179006 | 3300046648 | Bacteria | 991 |
| 726 | Ga0495611_0458921 | 3300046648 | Bacteria | 580 |
| 727 | Ga0495625_0029775 | 3300046660 | Bacteria | 4080 |
| 728 | Ga0495625_0072992 | 3300046660 | Bacteria | 2406 |
| 729 | Ga0495635_0002199 | 3300046663 | Bacteria | 13260 |
| 730 | Ga0495635_0116416 | 3300046663 | Bacteria | 1824 |
| 731 | Ga0495635_0162458 | 3300046663 | Bacteria | 1520 |
| 732 | Ga0495661_0071787 | 3300046665 | Bacteria | 2022 |
| 733 | Ga0495588_0001677 | 3300046674 | Bacteria | 9437 |
| 734 | Ga0495588_0362169 | 3300046674 | Bacteria | 762 |
| 735 | Ga0495657_0011029 | 3300046675 | Bacteria | 6776 |
| 736 | Ga0495657_0157896 | 3300046675 | Bacteria | 1404 |
| 737 | Ga0495599_0020333 | 3300046678 | Bacteria | 4134 |
| 738 | Ga0495599_0112377 | 3300046678 | Bacteria | 1696 |
| 739 | Ga0495623_0275545 | 3300046679 | Bacteria | 938 |
| 740 | Ga0495623_0485744 | 3300046679 | Bacteria | 654 |
| 741 | Ga0495623_0555467 | 3300046679 | Bacteria | 601 |
| 742 | Ga0495623_0737871 | 3300046679 | Bacteria | 502 |
| 743 | Ga0495646_0039825 | 3300046680 | Bacteria | 2896 |
| 744 | Ga0495646_0132636 | 3300046680 | Bacteria | 1401 |
| 745 | Ga0495647_0001896 | 3300046681 | Bacteria | 6509 |
| 746 | Ga0495647_0556716 | 3300046681 | Bacteria | 536 |
| 747 | Ga0495658_0014307 | 3300046683 | Bacteria | 4052 |
| 748 | Ga0495658_0199940 | 3300046683 | Bacteria | 1245 |
| 749 | Ga0495613_0000209 | 3300046689 | Bacteria | 57674 |
| 750 | Ga0495613_0074319 | 3300046689 | Bacteria | 2475 |
| 751 | Ga0495613_0093058 | 3300046689 | Bacteria | 2182 |
| 752 | Ga0495613_0127022 | 3300046689 | Bacteria | 1828 |
| 753 | Ga0495624_0021125 | 3300046690 | Bacteria | 4322 |
| 754 | Ga0495624_0057274 | 3300046690 | Bacteria | 2450 |
| 755 | Ga0495624_0157983 | 3300046690 | Bacteria | 1385 |
| 756 | Ga0495671_0052466 | 3300046692 | Bacteria | 2027 |
| 757 | Ga0495649_0032184 | 3300046694 | Bacteria | 2890 |
| 758 | Ga0495649_0368687 | 3300046694 | Bacteria | 724 |
| 759 | Ga0495589_0102933 | 3300046794 | Bacteria | 1381 |
| 760 | Ga0495600_0012798 | 3300046809 | Bacteria | 5255 |
| 761 | Ga0495600_0459810 | 3300046809 | Bacteria | 786 |
| 762 | Ga0495660_0213481 | 3300046810 | Bacteria | 914 |
| 763 | Ga0495581_0000567 | 3300047315 | Bacteria | 19221 |
| 764 | Ga0495581_0003931 | 3300047315 | Bacteria | 8555 |
| 765 | Ga0495581_0051284 | 3300047315 | Bacteria | 2383 |
| 766 | Ga0495581_0206547 | 3300047315 | Bacteria | 1149 |
| 767 | Ga0495604_0002274 | 3300047317 | Bacteria | 15383 |
| 768 | Ga0495604_0043562 | 3300047317 | Bacteria | 3512 |
| 769 | Ga0495604_0646201 | 3300047317 | Bacteria | 675 |
| 770 | Ga0495674_0313960 | 3300047319 | Bacteria | 1278 |
| 771 | Ga0495672_0076176 | 3300047320 | Bacteria | 1884 |
| 772 | Ga0495672_0215594 | 3300047320 | Bacteria | 951 |
| 773 | Ga0495676_0112890 | 3300047321 | Bacteria | 1990 |
| 774 | Ga0495676_0161119 | 3300047321 | Bacteria | 1587 |
| 775 | Ga0495680_0001595 | 3300047322 | Bacteria | 24172 |
| 776 | Ga0495680_0473584 | 3300047322 | Bacteria | 854 |
| 777 | Ga0495683_0215273 | 3300047323 | Bacteria | 859 |
| 778 | Ga0495687_017339 | 3300047443 | Bacteria | 3596 |
| 779 | Ga0495687_063407 | 3300047443 | Bacteria | 1513 |
| 780 | Ga0495675_0017231 | 3300047444 | Bacteria | 4577 |
| 781 | Ga0495677_0184590 | 3300047445 | Bacteria | 809 |
| 782 | Ga0495673_0021326 | 3300047469 | Bacteria | 3202 |
| 783 | Ga0495673_0058341 | 3300047469 | Bacteria | 1664 |
| 784 | Ga0495673_0134074 | 3300047469 | Bacteria | 971 |
| 785 | Ga0495684_0100756 | 3300047471 | Bacteria | 2184 |
| 786 | Ga0495684_0102475 | 3300047471 | Bacteria | 2163 |
| 787 | Ga0495593_0011735 | 3300047673 | Bacteria | 5025 |
| 788 | Ga0495593_0013868 | 3300047673 | Bacteria | 4590 |
| 789 | Ga0495593_0047886 | 3300047673 | Bacteria | 2273 |
| 790 | Ga0495593_0079851 | 3300047673 | Bacteria | 1693 |
| 791 | Ga0495602_0037408 | 3300048088 | Bacteria | 4505 |
| 792 | Ga0495602_0273637 | 3300048088 | Bacteria | 1247 |
| 793 | Ga0495614_0006480 | 3300048089 | Bacteria | 5252 |
| 794 | Ga0496100_0278677 | 3300048903 | Bacteria | 1246 |
| 795 | Ga0496101_0096933 | 3300048904 | Bacteria | 2201 |
| 796 | Ga0496101_0185444 | 3300048904 | Bacteria | 1604 |
| 797 | Ga0496101_0327599 | 3300048904 | Bacteria | 1202 |
| 798 | Ga0496101_0560289 | 3300048904 | Bacteria | 903 |
| 799 | Ga0496102_0012642 | 3300048905 | Bacteria | 7310 |
| 800 | Ga0496102_0083006 | 3300048905 | Bacteria | 2956 |
| 801 | Ga0496102_0124843 | 3300048905 | Bacteria | 2405 |
| 802 | Ga0496102_0197915 | 3300048905 | Bacteria | 1894 |
| 803 | Ga0496102_0267429 | 3300048905 | Bacteria | 1612 |
| 804 | Ga0496102_0270149 | 3300048905 | Bacteria | 1603 |
| 805 | Ga0496102_0292351 | 3300048905 | Bacteria | 1536 |
| 806 | Ga0496102_0374778 | 3300048905 | Bacteria | 1339 |
| 807 | Ga0496102_0673079 | 3300048905 | Bacteria | 958 |
| 808 | Ga0496102_1017614 | 3300048905 | Bacteria | 749 |
| 809 | Ga0496103_0038684 | 3300048906 | Bacteria | 2928 |
| 810 | Ga0496103_0052051 | 3300048906 | Bacteria | 2536 |
| 811 | Ga0496103_0085727 | 3300048906 | Bacteria | 1985 |
| 812 | Ga0496103_0111335 | 3300048906 | Bacteria | 1739 |
| 813 | Ga0496104_0020012 | 3300048907 | Bacteria | 6129 |
| 814 | Ga0496104_0035023 | 3300048907 | Bacteria | 4686 |
| 815 | Ga0496104_0058432 | 3300048907 | Bacteria | 3651 |
| 816 | Ga0496104_0059878 | 3300048907 | Bacteria | 3606 |
| 817 | Ga0496104_0154652 | 3300048907 | Bacteria | 2201 |
| 818 | Ga0496104_0182233 | 3300048907 | Bacteria | 2010 |
| 819 | Ga0496104_0307686 | 3300048907 | Bacteria | 1497 |
| 820 | Ga0496104_1336276 | 3300048907 | Bacteria | 620 |
| 821 | Ga0496105_0014239 | 3300048908 | Bacteria | 6328 |
| 822 | Ga0496105_0201571 | 3300048908 | Bacteria | 1624 |
| 823 | Ga0496105_0283738 | 3300048908 | Bacteria | 1335 |
| 824 | Ga0496105_0492459 | 3300048908 | Bacteria | 963 |
| 825 | Ga0496106_0000501 | 3300048909 | Bacteria | 27744 |
| 826 | Ga0496106_0004380 | 3300048909 | Bacteria | 10485 |
| 827 | Ga0496106_0076818 | 3300048909 | Bacteria | 2560 |
| 828 | Ga0496106_0091610 | 3300048909 | Bacteria | 2347 |
| 829 | Ga0496106_0251014 | 3300048909 | Bacteria | 1414 |
| 830 | Ga0496107_0006040 | 3300048910 | Bacteria | 8308 |
| 831 | Ga0496107_0008103 | 3300048910 | Bacteria | 7260 |
| 832 | Ga0496107_0068556 | 3300048910 | Bacteria | 2574 |
| 833 | Ga0496107_0194019 | 3300048910 | Bacteria | 1509 |
| 834 | Ga0496107_0838959 | 3300048910 | Bacteria | 672 |
| 835 | Ga0496108_0024615 | 3300048911 | Bacteria | 4957 |
| 836 | Ga0496108_0072191 | 3300048911 | Bacteria | 2913 |
| 837 | Ga0496108_0204531 | 3300048911 | Bacteria | 1713 |
| 838 | Ga0496108_0339498 | 3300048911 | Bacteria | 1310 |
| 839 | Ga0496108_0738291 | 3300048911 | Bacteria | 852 |
| 840 | Ga0496109_0000607 | 3300048912 | Bacteria | 29944 |
| 841 | Ga0496109_0027545 | 3300048912 | Bacteria | 5075 |
| 842 | Ga0496109_0039020 | 3300048912 | Bacteria | 4297 |
| 843 | Ga0496109_0067975 | 3300048912 | Bacteria | 3265 |
| 844 | Ga0496109_0304897 | 3300048912 | Bacteria | 1502 |
| 845 | Ga0496109_0493161 | 3300048912 | Bacteria | 1156 |
| 846 | Ga0496109_0625003 | 3300048912 | Bacteria | 1014 |
| 847 | Ga0496109_0989925 | 3300048912 | Bacteria | 778 |
| 848 | Ga0496110_0040514 | 3300048913 | Bacteria | 4059 |
| 849 | Ga0496110_0060742 | 3300048913 | Bacteria | 3334 |
| 850 | Ga0496110_0145032 | 3300048913 | Bacteria | 2147 |
| 851 | Ga0496110_0174904 | 3300048913 | Bacteria | 1948 |
| 852 | Ga0496110_0181218 | 3300048913 | Bacteria | 1913 |
| 853 | Ga0496111_0076985 | 3300048914 | Bacteria | 2432 |
| 854 | Ga0496111_0078080 | 3300048914 | Bacteria | 2414 |
| 855 | Ga0496111_0166319 | 3300048914 | Bacteria | 1638 |
| 856 | Ga0496111_0497553 | 3300048914 | Bacteria | 897 |
| 857 | Ga0496112_0007967 | 3300048915 | Bacteria | 9447 |
| 858 | Ga0496112_0011676 | 3300048915 | Bacteria | 8036 |
| 859 | Ga0496112_0025348 | 3300048915 | Bacteria | 5695 |
| 860 | Ga0496112_0065599 | 3300048915 | Bacteria | 3583 |
| 861 | Ga0496112_0075320 | 3300048915 | Bacteria | 3338 |
| 862 | Ga0496112_0117718 | 3300048915 | Bacteria | 2627 |
| 863 | Ga0496113_0016846 | 3300048916 | Bacteria | 5058 |
| 864 | Ga0496113_0052873 | 3300048916 | Bacteria | 3035 |
| 865 | Ga0496113_0079460 | 3300048916 | Bacteria | 2511 |
| 866 | Ga0496113_0217859 | 3300048916 | Bacteria | 1521 |
| 867 | Ga0496113_0811150 | 3300048916 | Bacteria | 743 |
| 868 | Ga0496114_0003436 | 3300048917 | Bacteria | 12148 |
| 869 | Ga0496114_0083854 | 3300048917 | Bacteria | 2697 |
| 870 | Ga0496114_0529359 | 3300048917 | Bacteria | 1042 |
| 871 | Ga0496115_0001779 | 3300048918 | Bacteria | 15419 |
| 872 | Ga0496115_0038929 | 3300048918 | Bacteria | 3776 |
| 873 | Ga0496115_0049091 | 3300048918 | Bacteria | 3377 |
| 874 | Ga0496115_0184723 | 3300048918 | Bacteria | 1723 |
| 875 | Ga0496116_0062801 | 3300048919 | Bacteria | 2397 |
| 876 | Ga0496117_0128756 | 3300048920 | Bacteria | 1539 |
| 877 | Ga0496117_0210526 | 3300048920 | Bacteria | 1090 |
| 878 | Ga0496118_0021216 | 3300048921 | Bacteria | 5727 |
| 879 | Ga0496118_0062071 | 3300048921 | Bacteria | 2762 |
| 880 | Ga0496118_0471192 | 3300048921 | Bacteria | 632 |
| 881 | Ga0496119_0026902 | 3300048922 | Bacteria | 3973 |
| 882 | Ga0496120_0029823 | 3300048923 | Bacteria | 3325 |
| 883 | Ga0496121_0000330 | 3300048924 | Bacteria | 98687 |
| 884 | Ga0496121_0026502 | 3300048924 | Bacteria | 5460 |
| 885 | Ga0496121_0089878 | 3300048924 | Bacteria | 2403 |
| 886 | Ga0496121_0100440 | 3300048924 | Bacteria | 2233 |
| 887 | Ga0496121_0311134 | 3300048924 | Bacteria | 1065 |
| 888 | Ga0496121_0431633 | 3300048924 | Bacteria | 854 |
| 889 | Ga0496122_0267490 | 3300048925 | Bacteria | 944 |
| 890 | Ga0496123_0124220 | 3300048926 | Bacteria | 1444 |
| 891 | Ga0496124_0104798 | 3300048927 | Bacteria | 2286 |
| 892 | Ga0496124_0285506 | 3300048927 | Bacteria | 1201 |
| 893 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 894 | Ga0496125_0216754 | 3300048928 | Bacteria | 1237 |
| 895 | Ga0496126_0024368 | 3300048929 | Bacteria | 5843 |
| 896 | Ga0496126_0040306 | 3300048929 | Bacteria | 4330 |
| 897 | Ga0496126_0086989 | 3300048929 | Bacteria | 2754 |
| 898 | Ga0496126_0297425 | 3300048929 | Bacteria | 1333 |
| 899 | Ga0496126_0316341 | 3300048929 | Bacteria | 1284 |
| 900 | Ga0496126_0380561 | 3300048929 | Bacteria | 1149 |
| 901 | Ga0495682_0049957 | 3300049460 | Bacteria | 1523 |
| 902 | Ga0495682_0058061 | 3300049460 | Bacteria | 1400 |
| 903 | Ga0501031_0013113 | 3300049568 | Bacteria | 5406 |
| 904 | Ga0501031_0032687 | 3300049568 | Bacteria | 3392 |
| 905 | Ga0501031_0185882 | 3300049568 | Bacteria | 1357 |
| 906 | Ga0501031_0472556 | 3300049568 | Bacteria | 809 |
| 907 | Ga0501032_0004449 | 3300049569 | Bacteria | 10567 |
| 908 | Ga0501032_0091399 | 3300049569 | Bacteria | 2019 |
| 909 | Ga0501032_0321513 | 3300049569 | Bacteria | 998 |
| 910 | Ga0501033_0001618 | 3300049570 | Bacteria | 19786 |
| 911 | Ga0501033_0063484 | 3300049570 | Bacteria | 2718 |
| 912 | Ga0501033_0112705 | 3300049570 | Bacteria | 1978 |
| 913 | Ga0501033_0623703 | 3300049570 | Bacteria | 738 |
| 914 | Ga0501033_0824038 | 3300049570 | Bacteria | 626 |
| 915 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 916 | Ga0501034_0022650 | 3300049571 | Bacteria | 6400 |
| 917 | Ga0501034_0481310 | 3300049571 | Bacteria | 1156 |
| 918 | Ga0501036_0000054 | 3300049572 | Bacteria | 74190 |
| 919 | Ga0501036_0053501 | 3300049572 | Bacteria | 3418 |
| 920 | Ga0501036_0092271 | 3300049572 | Bacteria | 2558 |
| 921 | Ga0501036_0874088 | 3300049572 | Bacteria | 738 |
| 922 | Ga0501036_0950107 | 3300049572 | Bacteria | 704 |
| 923 | Ga0501037_0000093 | 3300049573 | Bacteria | 83246 |
| 924 | Ga0501037_0007172 | 3300049573 | Bacteria | 8144 |
| 925 | Ga0501037_0046285 | 3300049573 | Bacteria | 3191 |
| 926 | Ga0501037_0294875 | 3300049573 | Bacteria | 1127 |
| 927 | Ga0501038_0000066 | 3300049574 | Bacteria | 86216 |
| 928 | Ga0501038_0004223 | 3300049574 | Bacteria | 13348 |
| 929 | Ga0501038_0172058 | 3300049574 | Bacteria | 1752 |
| 930 | Ga0501038_0415028 | 3300049574 | Bacteria | 1039 |
| 931 | Ga0501039_0008477 | 3300049575 | Bacteria | 7837 |
| 932 | Ga0501039_0019038 | 3300049575 | Bacteria | 5267 |
| 933 | Ga0501039_0354623 | 3300049575 | Bacteria | 1152 |
| 934 | Ga0501039_0824020 | 3300049575 | Bacteria | 723 |
| 935 | Ga0501039_1393036 | 3300049575 | Unclassified | 540 |
| 936 | Ga0501040_0020029 | 3300049576 | Bacteria | 4455 |
| 937 | Ga0501040_0068930 | 3300049576 | Bacteria | 2439 |
| 938 | Ga0501040_0131152 | 3300049576 | Bacteria | 1762 |
| 939 | Ga0501041_0032146 | 3300049577 | Bacteria | 3171 |
| 940 | Ga0501041_0085869 | 3300049577 | Bacteria | 1941 |
| 941 | Ga0501042_0166663 | 3300049578 | Bacteria | 1589 |
| 942 | Ga0501042_0205634 | 3300049578 | Bacteria | 1420 |
| 943 | Ga0501042_0286335 | 3300049578 | Bacteria | 1190 |
| 944 | Ga0501043_0000325 | 3300049579 | Bacteria | 43003 |
| 945 | Ga0501043_0008239 | 3300049579 | Bacteria | 8214 |
| 946 | Ga0501043_0243711 | 3300049579 | Bacteria | 1386 |
| 947 | Ga0501046_0005977 | 3300049580 | Bacteria | 10832 |
| 948 | Ga0501046_0062747 | 3300049580 | Bacteria | 2903 |
| 949 | Ga0501046_0083668 | 3300049580 | Bacteria | 2462 |
| 950 | Ga0501046_0091643 | 3300049580 | Bacteria | 2337 |
| 951 | Ga0501047_0000621 | 3300049581 | Bacteria | 37465 |
| 952 | Ga0501047_0170642 | 3300049581 | Bacteria | 2044 |
| 953 | Ga0501048_0001552 | 3300049582 | Bacteria | 17450 |
| 954 | Ga0501048_0058522 | 3300049582 | Bacteria | 2731 |
| 955 | Ga0501067_0000118 | 3300049583 | Bacteria | 44933 |
| 956 | Ga0501068_0000133 | 3300049584 | Bacteria | 33616 |
| 957 | Ga0501069_0053678 | 3300049585 | Bacteria | 2244 |
| 958 | Ga0501070_0002284 | 3300049586 | Bacteria | 16847 |
| 959 | Ga0501070_0039742 | 3300049586 | Bacteria | 3923 |
| 960 | Ga0501070_0055812 | 3300049586 | Bacteria | 3274 |
| 961 | Ga0501070_0337718 | 3300049586 | Bacteria | 1224 |
| 962 | Ga0501070_0414481 | 3300049586 | Bacteria | 1088 |
| 963 | Ga0501070_0430836 | 3300049586 | Bacteria | 1064 |
| 964 | Ga0501071_0024526 | 3300049587 | Bacteria | 4219 |
| 965 | Ga0501071_0051416 | 3300049587 | Bacteria | 2969 |
| 966 | Ga0501072_0014489 | 3300049588 | Bacteria | 6043 |
| 967 | Ga0501072_0055713 | 3300049588 | Bacteria | 3115 |
| 968 | Ga0501072_0176281 | 3300049588 | Bacteria | 1705 |
| 969 | Ga0501072_0552318 | 3300049588 | Bacteria | 909 |
| 970 | Ga0501072_0620804 | 3300049588 | Bacteria | 852 |
| 971 | Ga0501073_0002382 | 3300049589 | Bacteria | 14070 |
| 972 | Ga0501073_0101499 | 3300049589 | Bacteria | 1998 |
| 973 | Ga0501073_0104843 | 3300049589 | Bacteria | 1962 |
| 974 | Ga0501073_0204924 | 3300049589 | Bacteria | 1363 |
| 975 | Ga0501074_0001116 | 3300049590 | Bacteria | 17526 |
| 976 | Ga0501074_0032636 | 3300049590 | Bacteria | 3771 |
| 977 | Ga0501074_0082760 | 3300049590 | Bacteria | 2301 |
| 978 | Ga0501074_0144381 | 3300049590 | Bacteria | 1702 |
| 979 | Ga0501074_0678180 | 3300049590 | Bacteria | 728 |
| 980 | Ga0501075_0019174 | 3300049591 | Bacteria | 4960 |
| 981 | Ga0501075_0346758 | 3300049591 | Bacteria | 1132 |
| 982 | Ga0501076_0037829 | 3300049592 | Bacteria | 3786 |
| 983 | Ga0501076_0159682 | 3300049592 | Bacteria | 1836 |
| 984 | Ga0501076_1048934 | 3300049592 | Bacteria | 671 |
| 985 | Ga0501077_0019658 | 3300049593 | Bacteria | 4272 |
| 986 | Ga0501077_0255377 | 3300049593 | Bacteria | 1115 |
| 987 | Ga0501079_0001682 | 3300049741 | Bacteria | 15732 |
| 988 | Ga0501079_0005574 | 3300049741 | Bacteria | 9395 |
| 989 | Ga0501079_0282495 | 3300049741 | Bacteria | 1298 |
| 990 | Ga0501080_0001100 | 3300049742 | Bacteria | 22276 |
| 991 | Ga0501080_0041070 | 3300049742 | Bacteria | 4312 |
| 992 | Ga0501080_0055664 | 3300049742 | Bacteria | 3684 |
| 993 | Ga0501080_0128269 | 3300049742 | Bacteria | 2348 |
| 994 | Ga0501080_0263073 | 3300049742 | Bacteria | 1571 |
| 995 | Ga0501080_0358259 | 3300049742 | Bacteria | 1316 |
| 996 | Ga0501081_0007723 | 3300049743 | Bacteria | 6973 |
| 997 | Ga0501081_0025704 | 3300049743 | Bacteria | 3964 |
| 998 | Ga0501081_0428896 | 3300049743 | Bacteria | 981 |
| 999 | Ga0501083_0000331 | 3300049744 | Bacteria | 29941 |
| 1000 | Ga0501083_0109353 | 3300049744 | Bacteria | 1818 |
| 1001 | Ga0501083_0139323 | 3300049744 | Bacteria | 1589 |
| 1002 | Ga0501083_0401067 | 3300049744 | Bacteria | 892 |
| 1003 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 1004 | Ga0501035_0039707 | 3300049822 | Bacteria | 4258 |
| 1005 | Ga0501035_0065996 | 3300049822 | Bacteria | 3212 |
| 1006 | Ga0501035_0214243 | 3300049822 | Bacteria | 1647 |
| 1007 | Ga0501035_0333208 | 3300049822 | Bacteria | 1273 |
| 1008 | Ga0501035_0407459 | 3300049822 | Bacteria | 1130 |
| 1009 | Ga0501044_0000367 | 3300049823 | Bacteria | 56521 |
| 1010 | Ga0501044_0018546 | 3300049823 | Bacteria | 7456 |
| 1011 | Ga0501044_0154101 | 3300049823 | Bacteria | 2278 |
| 1012 | Ga0501044_0324969 | 3300049823 | Bacteria | 1462 |
| 1013 | Ga0501045_0023312 | 3300049824 | Bacteria | 4437 |
| 1014 | Ga0501045_0055451 | 3300049824 | Bacteria | 2898 |
| 1015 | Ga0501045_0088929 | 3300049824 | Bacteria | 2281 |
| 1016 | nmdc:mga03683_143257_c1 | 3300050489 | Bacteria | 1075 |
| 1017 | nmdc:mga03n38_42619_c1 | 3300050490 | Bacteria | 1985 |
| 1018 | nmdc:mga03n38_477446_c1 | 3300050490 | Bacteria | 697 |
| 1019 | nmdc:mga03n38_92246_c1 | 3300050490 | Bacteria | 1444 |
| 1020 | nmdc:mga00v17_43495_c1 | 3300050491 | Bacteria | 2705 |
| 1021 | nmdc:mga00v17_45090_c1 | 3300050491 | Bacteria | 2662 |
| 1022 | nmdc:mga0yw44_103621_c1 | 3300050492 | Bacteria | 1815 |
| 1023 | nmdc:mga0yw44_139125_c1 | 3300050492 | Bacteria | 1577 |
| 1024 | nmdc:mga0yw44_361482_c1 | 3300050492 | Bacteria | 978 |
| 1025 | nmdc:mga0yw44_574553_c1 | 3300050492 | Bacteria | 766 |
| 1026 | nmdc:mga0yw44_617652_c1 | 3300050492 | Bacteria | 737 |
| 1027 | nmdc:mga0yw44_77229_c1 | 3300050492 | Bacteria | 2080 |
| 1028 | nmdc:mga0k408_265081_c1 | 3300050493 | Bacteria | 1026 |
| 1029 | nmdc:mga0k408_279571_c1 | 3300050493 | Bacteria | 996 |
| 1030 | nmdc:mga0k408_66493_c1 | 3300050493 | Bacteria | 2100 |
| 1031 | nmdc:mga0k408_99872_c1 | 3300050493 | Bacteria | 1710 |
| 1032 | nmdc:mga06z11_271591_c1 | 3300050494 | Bacteria | 1003 |
| 1033 | nmdc:mga06z11_67849_c1 | 3300050494 | Bacteria | 1879 |
| 1034 | nmdc:mga07m45_258218_c1 | 3300050496 | Bacteria | 1014 |
| 1035 | nmdc:mga07m45_268193_c1 | 3300050496 | Bacteria | 993 |
| 1036 | nmdc:mga07m45_415448_c1 | 3300050496 | Bacteria | 781 |
| 1037 | nmdc:mga07m45_4525_c1 | 3300050496 | Bacteria | 6809 |
| 1038 | nmdc:mga07m45_89974_c1 | 3300050496 | Bacteria | 1758 |
| 1039 | nmdc:mga09592_280849_c1 | 3300050508 | Bacteria | 1444 |
| 1040 | nmdc:mga0a205_1008445_c1 | 3300050515 | Bacteria | 679 |
| 1041 | Ga0495601_0169277 | 3300053077 | Bacteria | 1428 |
| 1042 | Ga0495612_0026231 | 3300053078 | Bacteria | 2342 |
| 1043 | Ga0495612_0114142 | 3300053078 | Bacteria | 1158 |
| 1044 | Ga0495612_0118165 | 3300053078 | Bacteria | 1139 |
| 1045 | Ga0500610_0096060 | 3300053079 | Bacteria | 1537 |
| 1046 | Ga0500635_0017606 | 3300053080 | Bacteria | 2144 |
| 1047 | Ga0495655_0003985 | 3300053083 | Bacteria | 2488 |
| 1048 | Ga0495655_0200339 | 3300053083 | Bacteria | 652 |
| 1049 | Ga0495595_0049648 | 3300053084 | Bacteria | 1941 |
| 1050 | Ga0495595_0107863 | 3300053084 | Bacteria | 1348 |
| 1051 | Ga0495619_0002921 | 3300053085 | Bacteria | 11107 |
| 1052 | Ga0495619_0036177 | 3300053085 | Bacteria | 3214 |
| 1053 | Ga0495619_0102780 | 3300053085 | Bacteria | 1946 |
| 1054 | Ga0500578_0081750 | 3300053086 | Bacteria | 2054 |
| 1055 | Ga0500643_000040 | 3300053087 | Bacteria | 168108 |
| 1056 | Ga0500644_0082590 | 3300053088 | Bacteria | 1185 |
| 1057 | Ga0500646_0077478 | 3300053090 | Bacteria | 1008 |
| 1058 | Ga0500647_0105909 | 3300053091 | Bacteria | 1340 |
| 1059 | Ga0500647_0353335 | 3300053091 | Bacteria | 611 |
| 1060 | Ga0500651_0109234 | 3300053093 | Bacteria | 1689 |
| 1061 | Ga0500651_0302201 | 3300053093 | Bacteria | 918 |
| 1062 | Ga0500566_0000020 | 3300053094 | Bacteria | 83462 |
| 1063 | Ga0500566_0000230 | 3300053094 | Bacteria | 29930 |
| 1064 | Ga0500566_0013088 | 3300053094 | Bacteria | 4890 |
| 1065 | Ga0500566_0106566 | 3300053094 | Bacteria | 1529 |
| 1066 | Ga0500566_0149124 | 3300053094 | Bacteria | 1232 |
| 1067 | Ga0500640_000021 | 3300053095 | Bacteria | 23372 |
| 1068 | Ga0500640_052451 | 3300053095 | Bacteria | 1781 |
| 1069 | Ga0500650_0158756 | 3300053098 | Bacteria | 1043 |
| 1070 | Ga0500554_014125 | 3300053102 | Bacteria | 2053 |
| 1071 | Ga0500554_053556 | 3300053102 | Bacteria | 1276 |
| 1072 | Ga0500555_002003 | 3300053103 | Bacteria | 6011 |
| 1073 | Ga0500556_0033670 | 3300053104 | Bacteria | 1758 |
| 1074 | Ga0500557_000063 | 3300053105 | Bacteria | 43744 |
| 1075 | Ga0500562_006379 | 3300053108 | Bacteria | 2974 |
| 1076 | Ga0500562_006548 | 3300053108 | Bacteria | 2934 |
| 1077 | Ga0500569_035310 | 3300053109 | Bacteria | 1432 |
| 1078 | Ga0500572_000068 | 3300053111 | Bacteria | 32485 |
| 1079 | Ga0500572_228047 | 3300053111 | Bacteria | 608 |
| 1080 | Ga0500591_041240 | 3300053115 | Bacteria | 2195 |
| 1081 | Ga0500592_004040 | 3300053116 | Bacteria | 2341 |
| 1082 | Ga0500595_000468 | 3300053119 | Bacteria | 24982 |
| 1083 | Ga0500595_000947 | 3300053119 | Bacteria | 16362 |
| 1084 | Ga0500595_002807 | 3300053119 | Bacteria | 8379 |
| 1085 | Ga0500595_009612 | 3300053119 | Bacteria | 3895 |
| 1086 | Ga0500595_040173 | 3300053119 | Bacteria | 1510 |
| 1087 | Ga0500607_068350 | 3300053121 | Bacteria | 1838 |
| 1088 | Ga0500608_018296 | 3300053122 | Bacteria | 3194 |
| 1089 | Ga0500608_088864 | 3300053122 | Bacteria | 1447 |
| 1090 | Ga0500614_000051 | 3300053123 | Bacteria | 24948 |
| 1091 | Ga0500614_013030 | 3300053123 | Bacteria | 1821 |
| 1092 | Ga0500618_034285 | 3300053125 | Bacteria | 1181 |
| 1093 | Ga0500618_112380 | 3300053125 | Bacteria | 615 |
| 1094 | Ga0500621_208198 | 3300053126 | Bacteria | 687 |
| 1095 | Ga0500626_067080 | 3300053128 | Bacteria | 1600 |
| 1096 | Ga0500642_0001840 | 3300053130 | Bacteria | 6124 |
| 1097 | Ga0500652_137450 | 3300053131 | Bacteria | 1018 |
| 1098 | Ga0500655_022750 | 3300053133 | Bacteria | 1181 |
| 1099 | Ga0500658_0044794 | 3300053134 | Bacteria | 1786 |
| 1100 | Ga0500559_0002983 | 3300053136 | Bacteria | 8485 |
| 1101 | Ga0500559_0202559 | 3300053136 | Bacteria | 936 |
| 1102 | Ga0500564_007088 | 3300053138 | Bacteria | 4730 |
| 1103 | Ga0500568_0003017 | 3300053139 | Bacteria | 9628 |
| 1104 | Ga0500568_0005161 | 3300053139 | Bacteria | 6809 |
| 1105 | Ga0500585_072775 | 3300053144 | Bacteria | 1241 |
| 1106 | Ga0500590_239433 | 3300053148 | Bacteria | 731 |
| 1107 | Ga0500603_001419 | 3300053150 | Bacteria | 5474 |
| 1108 | Ga0500603_001515 | 3300053150 | Bacteria | 5282 |
| 1109 | Ga0500616_0016770 | 3300053153 | Bacteria | 4163 |
| 1110 | Ga0500619_057718 | 3300053154 | Bacteria | 1270 |
| 1111 | Ga0500620_010151 | 3300053155 | Bacteria | 2464 |
| 1112 | Ga0500627_0054792 | 3300053158 | Bacteria | 1745 |
| 1113 | Ga0500627_0080236 | 3300053158 | Bacteria | 1454 |
| 1114 | Ga0500627_0421085 | 3300053158 | Bacteria | 566 |
| 1115 | Ga0500630_016613 | 3300053159 | Bacteria | 3623 |
| 1116 | Ga0500633_0044024 | 3300053160 | Bacteria | 1513 |
| 1117 | Ga0500638_063082 | 3300053162 | Bacteria | 1778 |
| 1118 | Ga0500638_216071 | 3300053162 | Bacteria | 799 |
| 1119 | Ga0500638_286593 | 3300053162 | Bacteria | 643 |
| 1120 | Ga0500639_000646 | 3300053163 | Bacteria | 17487 |
| 1121 | Ga0500636_0000120 | 3300053177 | Bacteria | 41238 |
| 1122 | Ga0500636_0088066 | 3300053177 | Bacteria | 1781 |
| 1123 | Ga0500636_0197695 | 3300053177 | Bacteria | 1066 |
| 1124 | Ga0500637_0011077 | 3300053178 | Bacteria | 4645 |
| 1125 | Ga0500611_006610 | 3300053727 | Bacteria | 1698 |
| 1126 | Ga0500625_000384 | 3300053729 | Bacteria | 11384 |
| 1127 | Ga0500609_000334 | 3300053731 | Bacteria | 6983 |
| 1128 | Ga0500596_001023 | 3300053735 | Bacteria | 5605 |
| 1129 | Ga0500599_000648 | 3300053736 | Bacteria | 3728 |
| 1130 | Ga0500601_000586 | 3300053737 | Bacteria | 5199 |
| 1131 | Ga0501084_0020657 | 3300054114 | Bacteria | 5492 |
| 1132 | Ga0501084_0037603 | 3300054114 | Bacteria | 4045 |
| 1133 | Ga0501084_0042351 | 3300054114 | Bacteria | 3809 |
| 1134 | Ga0501084_0060211 | 3300054114 | Bacteria | 3179 |
| 1135 | Ga0501084_0351727 | 3300054114 | Unclassified | 1245 |
| 1136 | Ga0501084_0530879 | 3300054114 | Bacteria | 995 |
| 1137 | Ga0500661_001956 | 3300055283 | Bacteria | 3887 |
| 1138 | Ga0500661_009211 | 3300055283 | Bacteria | 1811 |
| 1139 | Ga0500661_022759 | 3300055283 | Bacteria | 1110 |
| 1140 | Ga0587090_040835 | 3300059510 | Bacteria | 816 |
| 1141 | Ga0587078_058819 | 3300059646 | Bacteria | 578 |
| 1142 | Ga0501082_0009862 | 3300060353 | Bacteria | 8229 |
| 1143 | Ga0501082_0060808 | 3300060353 | Bacteria | 3252 |
| 1144 | Ga0501082_0105358 | 3300060353 | Bacteria | 2439 |
| 1145 | Ga0501082_0188884 | 3300060353 | Bacteria | 1792 |
| 1146 | Ga0501082_0273997 | 3300060353 | Bacteria | 1469 |
| 1147 | Ga0466962_0190039 | 3300061719 | Bacteria | 1002 |
| 1148 | Ga0466962_0376500 | 3300061719 | Bacteria | 709 |
| 1149 | Ga0530510_0022872 | 3300061734 | Bacteria | 4454 |
| 1150 | Ga0530510_0190487 | 3300061734 | Bacteria | 1522 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0990892 | Ga0395901_0990892_35_436 | 131 |
| 2 | 3300049744 | Ga0501083_0109353 | Ga0501083_0109353_1389_1799 | 132 |
| 3 | 3300014325 | Ga0163163_10786430 | Ga0163163_107864302 | 134 |
| 4 | 3300025911 | Ga0207654_10507518 | Ga0207654_105075181 | 135 |
| 5 | 3300053108 | Ga0500562_006379 | Ga0500562_006379_2382_2849 | 135 |
| 6 | 3300014326 | Ga0157380_10009856 | Ga0157380_100098567 | 136 |
| 7 | 3300026067 | Ga0207678_10883321 | Ga0207678_108833212 | 136 |
| 8 | 3300025932 | Ga0207690_10490573 | Ga0207690_104905732 | 139 |
| 9 | 3300046531 | Ga0495665_0051943 | Ga0495665_0051943_1438_1866 | 139 |
| 10 | 3300046679 | Ga0495623_0485744 | Ga0495623_0485744_218_643 | 139 |
| 11 | 3300049588 | Ga0501072_0176281 | Ga0501072_0176281_899_1348 | 141 |
| 12 | 3300049742 | Ga0501080_0263073 | Ga0501080_0263073_240_689 | 141 |
| 13 | 3300049744 | Ga0501083_0139323 | Ga0501083_0139323_554_1003 | 141 |
| 14 | 3300060353 | Ga0501082_0188884 | Ga0501082_0188884_994_1443 | 141 |
| 15 | 3300005578 | Ga0068854_100013144 | Ga0068854_1000131446 | 142 |
| 16 | 3300025981 | Ga0207640_10007468 | Ga0207640_100074687 | 142 |
| 17 | 3300026041 | Ga0207639_10005552 | Ga0207639_100055523 | 142 |
| 18 | 3300005458 | Ga0070681_10414575 | Ga0070681_104145752 | 143 |
| 19 | 3300005535 | Ga0070684_100087521 | Ga0070684_1000875213 | 143 |
| 20 | 3300025944 | Ga0207661_10000755 | Ga0207661_1000075516 | 143 |
| 21 | iso_pu_bacteria | 2738541293 | 2738799044 | 143 |
| 22 | 3300014325 | Ga0163163_10456111 | Ga0163163_104561111 | 144 |
| 23 | 3300049575 | Ga0501039_1393036 | Ga0501039_1393036_55_525 | 144 |
| 24 | 3300021384 | Ga0213876_10009781 | Ga0213876_100097812 | 145 |
| 25 | 3300021388 | Ga0213875_10000861 | Ga0213875_100008613 | 145 |
| 26 | 3300037853 | Ga0436364_0722239 | Ga0436364_0722239_6064_6546 | 145 |
| 27 | 3300039437 | Ga0436365_0397559 | Ga0436365_0397559_6278_6760 | 145 |
| 28 | 3300039453 | Ga0436362_1010515 | Ga0436362_1010515_3344_3826 | 145 |
| 29 | iso_pu_bacteria | 2513237101 | 2513696032 | 145 |
| 30 | iso_pu_bacteria | 2721755755 | 2723846267 | 145 |
| 31 | iso_pu_bacteria | 2842509118 | 2842510330 | 145 |
| 32 | iso_pu_bacteria | 2851182111 | 2851187065 | 145 |
| 33 | iso_pu_bacteria | 2874604998 | 2874610768 | 145 |
| 34 | iso_pu_bacteria | 2922361189 | 2922362070 | 145 |
| 35 | iso_pu_bacteria | 2922386360 | 2922388162 | 145 |
| 36 | iso_pu_bacteria | 3003930520 | 3003933356 | 145 |
| 37 | iso_pu_bacteria | 8006964411 | 8006964642 | 145 |
| 38 | iso_pu_bacteria | 8006994254 | 8006999936 | 145 |
| 39 | iso_pu_bacteria | 8019668869 | 8019673242 | 145 |
| 40 | iso_pu_bacteria | 8019678201 | 8019682886 | 145 |
| 41 | iso_pu_bacteria | 8057529695 | 8057535321 | 145 |
| 42 | 3300005355 | Ga0070671_100401212 | Ga0070671_1004012123 | 146 |
| 43 | 3300005530 | Ga0070679_100106756 | Ga0070679_1001067563 | 146 |
| 44 | 3300005548 | Ga0070665_100525949 | Ga0070665_1005259492 | 146 |
| 45 | 3300005548 | Ga0070665_100780239 | Ga0070665_1007802391 | 146 |
| 46 | 3300006177 | Ga0075362_10115582 | Ga0075362_101155822 | 146 |
| 47 | 3300006178 | Ga0075367_10120197 | Ga0075367_101201972 | 146 |
| 48 | 3300006186 | Ga0075369_10214425 | Ga0075369_102144251 | 146 |
| 49 | 3300006237 | Ga0097621_101721795 | Ga0097621_1017217952 | 146 |
| 50 | 3300009092 | Ga0105250_10053022 | Ga0105250_100530221 | 146 |
| 51 | 3300009093 | Ga0105240_10453740 | Ga0105240_104537402 | 146 |
| 52 | 3300010375 | Ga0105239_11986258 | Ga0105239_119862581 | 146 |
| 53 | 3300012490 | Ga0157322_1011308 | Ga0157322_10113081 | 146 |
| 54 | 3300013296 | Ga0157374_11584631 | Ga0157374_115846311 | 146 |
| 55 | 3300013308 | Ga0157375_10298608 | Ga0157375_102986082 | 146 |
| 56 | 3300014325 | Ga0163163_10177924 | Ga0163163_101779244 | 146 |
| 57 | 3300014325 | Ga0163163_11154795 | Ga0163163_111547951 | 146 |
| 58 | 3300014968 | Ga0157379_10208848 | Ga0157379_102088481 | 146 |
| 59 | 3300014969 | Ga0157376_11981697 | Ga0157376_119816971 | 146 |
| 60 | 3300025913 | Ga0207695_10692486 | Ga0207695_106924861 | 146 |
| 61 | 3300025921 | Ga0207652_10085230 | Ga0207652_100852304 | 146 |
| 62 | 3300025931 | Ga0207644_11332323 | Ga0207644_113323231 | 146 |
| 63 | 3300025932 | Ga0207690_11114985 | Ga0207690_111149851 | 146 |
| 64 | 3300025937 | Ga0207669_10029042 | Ga0207669_100290423 | 146 |
| 65 | 3300025937 | Ga0207669_10839533 | Ga0207669_108395331 | 146 |
| 66 | 3300026078 | Ga0207702_10596321 | Ga0207702_105963212 | 146 |
| 67 | 3300026116 | Ga0207674_11192107 | Ga0207674_111921071 | 146 |
| 68 | 3300028379 | Ga0268266_10233953 | Ga0268266_102339532 | 146 |
| 69 | 3300028380 | Ga0268265_11213129 | Ga0268265_112131291 | 146 |
| 70 | 3300031241 | Ga0265325_10390633 | Ga0265325_103906331 | 146 |
| 71 | 3300031616 | Ga0307508_10049567 | Ga0307508_100495673 | 146 |
| 72 | 3300031824 | Ga0307413_10399379 | Ga0307413_103993792 | 146 |
| 73 | 3300031852 | Ga0307410_10094642 | Ga0307410_100946422 | 146 |
| 74 | 3300031903 | Ga0307407_10499689 | Ga0307407_104996892 | 146 |
| 75 | 3300035113 | Ga0373936_0150457 | Ga0373936_0150457_197_640 | 146 |
| 76 | 3300046518 | Ga0495631_0049011 | Ga0495631_0049011_605_1048 | 146 |
| 77 | 3300046535 | Ga0495586_0379665 | Ga0495586_0379665_26_469 | 146 |
| 78 | 3300046537 | Ga0495598_0227310 | Ga0495598_0227310_72_515 | 146 |
| 79 | 3300046559 | Ga0495667_0652315 | Ga0495667_0652315_93_536 | 146 |
| 80 | 3300046616 | Ga0495668_0048247 | Ga0495668_0048247_926_1369 | 146 |
| 81 | 3300046679 | Ga0495623_0737871 | Ga0495623_0737871_49_492 | 146 |
| 82 | 3300046694 | Ga0495649_0368687 | Ga0495649_0368687_127_570 | 146 |
| 83 | 3300046809 | Ga0495600_0459810 | Ga0495600_0459810_225_668 | 146 |
| 84 | 3300047322 | Ga0495680_0473584 | Ga0495680_0473584_103_546 | 146 |
| 85 | 3300047445 | Ga0495677_0184590 | Ga0495677_0184590_130_573 | 146 |
| 86 | 3300048910 | Ga0496107_0838959 | Ga0496107_0838959_149_592 | 146 |
| 87 | 3300048918 | Ga0496115_0049091 | Ga0496115_0049091_1488_1931 | 146 |
| 88 | 3300049570 | Ga0501033_0623703 | Ga0501033_0623703_70_522 | 146 |
| 89 | 3300049593 | Ga0501077_0255377 | Ga0501077_0255377_129_590 | 146 |
| 90 | 3300049743 | Ga0501081_0428896 | Ga0501081_0428896_20_481 | 146 |
| 91 | 3300050490 | nmdc:mga03n38_477446_c1 | nmdc:mga03n38_477446_c1_241_684 | 146 |
| 92 | 3300050493 | nmdc:mga0k408_99872_c1 | nmdc:mga0k408_99872_c1_780_1223 | 146 |
| 93 | 3300053158 | Ga0500627_0054792 | Ga0500627_0054792_1021_1464 | 146 |
| 94 | 3300053158 | Ga0500627_0421085 | Ga0500627_0421085_68_511 | 146 |
| 95 | iso_pu_bacteria | 2508501128 | 2509151346 | 146 |
| 96 | iso_pu_bacteria | 643348564 | 643604725 | 146 |
| 97 | 3300021384 | Ga0213876_10048574 | Ga0213876_100485744 | 147 |
| 98 | 3300038735 | Ga0400485_18562 | Ga0400485_18562_630_1088 | 147 |
| 99 | 3300039437 | Ga0436365_1704593 | Ga0436365_1704593_198_650 | 147 |
| 100 | 3300039450 | Ga0436363_0282582 | Ga0436363_0282582_33_485 | 147 |
| 101 | 3300046455 | Ga0495603_0184270 | Ga0495603_0184270_146_592 | 147 |
| 102 | 3300046491 | Ga0495584_0295169 | Ga0495584_0295169_191_667 | 147 |
| 103 | 3300046615 | Ga0495656_0255011 | Ga0495656_0255011_68_544 | 147 |
| 104 | 3300049568 | Ga0501031_0185882 | Ga0501031_0185882_582_1046 | 147 |
| 105 | 3300049570 | Ga0501033_0824038 | Ga0501033_0824038_58_522 | 147 |
| 106 | 3300049571 | Ga0501034_0022650 | Ga0501034_0022650_149_649 | 147 |
| 107 | 3300049573 | Ga0501037_0294875 | Ga0501037_0294875_341_805 | 147 |
| 108 | 3300049574 | Ga0501038_0415028 | Ga0501038_0415028_100_564 | 147 |
| 109 | 3300049576 | Ga0501040_0131152 | Ga0501040_0131152_1274_1741 | 147 |
| 110 | 3300049577 | Ga0501041_0085869 | Ga0501041_0085869_763_1227 | 147 |
| 111 | 3300049578 | Ga0501042_0166663 | Ga0501042_0166663_771_1235 | 147 |
| 112 | 3300049579 | Ga0501043_0243711 | Ga0501043_0243711_622_1086 | 147 |
| 113 | 3300049580 | Ga0501046_0062747 | Ga0501046_0062747_331_795 | 147 |
| 114 | 3300049582 | Ga0501048_0058522 | Ga0501048_0058522_1662_2126 | 147 |
| 115 | 3300049586 | Ga0501070_0414481 | Ga0501070_0414481_600_1064 | 147 |
| 116 | 3300049590 | Ga0501074_0144381 | Ga0501074_0144381_419_883 | 147 |
| 117 | 3300049742 | Ga0501080_0055664 | Ga0501080_0055664_935_1399 | 147 |
| 118 | 3300049743 | Ga0501081_0025704 | Ga0501081_0025704_1094_1558 | 147 |
| 119 | 3300049822 | Ga0501035_0407459 | Ga0501035_0407459_468_932 | 147 |
| 120 | 3300049824 | Ga0501045_0023312 | Ga0501045_0023312_3468_3935 | 147 |
| 121 | 3300054114 | Ga0501084_0042351 | Ga0501084_0042351_2127_2594 | 147 |
| 122 | 3300060353 | Ga0501082_0009862 | Ga0501082_0009862_550_1014 | 147 |
| 123 | 3300061734 | Ga0530510_0190487 | Ga0530510_0190487_108_572 | 147 |
| 124 | iso_pu_bacteria | 2507262055 | 2507509894 | 147 |
| 125 | iso_pu_bacteria | 2508501042 | 2508698166 | 147 |
| 126 | iso_pu_bacteria | 2511231028 | 2511395489 | 147 |
| 127 | iso_pu_bacteria | 2513237095 | 2513652932 | 147 |
| 128 | iso_pu_bacteria | 2513237102 | 2513703512 | 147 |
| 129 | iso_pu_bacteria | 2513237104 | 2513720920 | 147 |
| 130 | iso_pu_bacteria | 2513237139 | 2513875979 | 147 |
| 131 | iso_pu_bacteria | 2513237161 | 2514011362 | 147 |
| 132 | iso_pu_bacteria | 2515154112 | 2515629262 | 147 |
| 133 | iso_pu_bacteria | 2517093001 | 2517103401 | 147 |
| 134 | iso_pu_bacteria | 2528768022 | 2528853016 | 147 |
| 135 | iso_pu_bacteria | 2617270735 | 2617349418 | 147 |
| 136 | iso_pu_bacteria | 2802429603 | 2805917488 | 147 |
| 137 | iso_pu_bacteria | 2816332527 | 2818242399 | 147 |
| 138 | iso_pu_bacteria | 2824600985 | 2824602006 | 147 |
| 139 | iso_pu_bacteria | 2824609381 | 2824609994 | 147 |
| 140 | iso_pu_bacteria | 2824617872 | 2824620208 | 147 |
| 141 | iso_pu_bacteria | 2824626560 | 2824627580 | 147 |
| 142 | iso_pu_bacteria | 2824635225 | 2824639390 | 147 |
| 143 | iso_pu_bacteria | 2824644064 | 2824646498 | 147 |
| 144 | iso_pu_bacteria | 2824653114 | 2824659793 | 147 |
| 145 | iso_pu_bacteria | 2824661429 | 2824664870 | 147 |
| 146 | iso_pu_bacteria | 2824679649 | 2824685232 | 147 |
| 147 | iso_pu_bacteria | 2824696289 | 2824701731 | 147 |
| 148 | iso_pu_bacteria | 2824714736 | 2824718127 | 147 |
| 149 | iso_pu_bacteria | 2824723954 | 2824727014 | 147 |
| 150 | iso_pu_bacteria | 2824732956 | 2824737625 | 147 |
| 151 | iso_pu_bacteria | 2824746037 | 2824747311 | 147 |
| 152 | iso_pu_bacteria | 2824773399 | 2824774155 | 147 |
| 153 | iso_pu_bacteria | 2838122688 | 2838127675 | 147 |
| 154 | iso_pu_bacteria | 2841941048 | 2841941377 | 147 |
| 155 | iso_pu_bacteria | 2841949485 | 2841952610 | 147 |
| 156 | iso_pu_bacteria | 2841957949 | 2841959647 | 147 |
| 157 | iso_pu_bacteria | 2841966195 | 2841967512 | 147 |
| 158 | iso_pu_bacteria | 2841974524 | 2841979091 | 147 |
| 159 | iso_pu_bacteria | 2841983080 | 2841986634 | 147 |
| 160 | iso_pu_bacteria | 2842038055 | 2842038394 | 147 |
| 161 | iso_pu_bacteria | 2842045827 | 2842048661 | 147 |
| 162 | iso_pu_bacteria | 2844315083 | 2844317867 | 147 |
| 163 | iso_pu_bacteria | 2847930680 | 2847934652 | 147 |
| 164 | iso_pu_bacteria | 2847939898 | 2847945272 | 147 |
| 165 | iso_pu_bacteria | 2857509624 | 2857510108 | 147 |
| 166 | iso_pu_bacteria | 2874590934 | 2874596641 | 147 |
| 167 | iso_pu_bacteria | 2874612657 | 2874618362 | 147 |
| 168 | iso_pu_bacteria | 2874620515 | 2874621810 | 147 |
| 169 | iso_pu_bacteria | 2874628541 | 2874635850 | 147 |
| 170 | iso_pu_bacteria | 2876761206 | 2876766551 | 147 |
| 171 | iso_pu_bacteria | 2876771140 | 2876777063 | 147 |
| 172 | iso_pu_bacteria | 2876818435 | 2876825187 | 147 |
| 173 | iso_pu_bacteria | 2879074833 | 2879081200 | 147 |
| 174 | iso_pu_bacteria | 2879083081 | 2879088146 | 147 |
| 175 | iso_pu_bacteria | 2879099564 | 2879109159 | 147 |
| 176 | iso_pu_bacteria | 2881364244 | 2881366036 | 147 |
| 177 | iso_pu_bacteria | 2881665667 | 2881670441 | 147 |
| 178 | iso_pu_bacteria | 2885366525 | 2885372645 | 147 |
| 179 | iso_pu_bacteria | 2885409591 | 2885409714 | 147 |
| 180 | iso_pu_bacteria | 2888378607 | 2888382646 | 147 |
| 181 | iso_pu_bacteria | 2888388044 | 2888395078 | 147 |
| 182 | iso_pu_bacteria | 2888419890 | 2888423175 | 147 |
| 183 | iso_pu_bacteria | 2903727486 | 2903729797 | 147 |
| 184 | iso_pu_bacteria | 2904666416 | 2904668473 | 147 |
| 185 | iso_pu_bacteria | 2906602504 | 2906608954 | 147 |
| 186 | iso_pu_bacteria | 2906643746 | 2906644111 | 147 |
| 187 | iso_pu_bacteria | 2908775508 | 2908778838 | 147 |
| 188 | iso_pu_bacteria | 2922368715 | 2922375339 | 147 |
| 189 | iso_pu_bacteria | 2922393267 | 2922395108 | 147 |
| 190 | iso_pu_bacteria | 2929615660 | 2929616082 | 147 |
| 191 | iso_pu_bacteria | 2929624759 | 2929624826 | 147 |
| 192 | iso_pu_bacteria | 2932784394 | 2932792397 | 147 |
| 193 | iso_pu_bacteria | 2932809354 | 2932817524 | 147 |
| 194 | iso_pu_bacteria | 2932818245 | 2932819662 | 147 |
| 195 | iso_pu_bacteria | 2932828146 | 2932836523 | 147 |
| 196 | iso_pu_bacteria | 2933577622 | 2933578632 | 147 |
| 197 | iso_pu_bacteria | 2935608549 | 2935611198 | 147 |
| 198 | iso_pu_bacteria | 2935616580 | 2935618870 | 147 |
| 199 | iso_pu_bacteria | 2935638405 | 2935647518 | 147 |
| 200 | iso_pu_bacteria | 2935648319 | 2935648636 | 147 |
| 201 | iso_pu_bacteria | 2935656913 | 2935657376 | 147 |
| 202 | iso_pu_bacteria | 2935665750 | 2935672781 | 147 |
| 203 | iso_pu_bacteria | 2935675223 | 2935676856 | 147 |
| 204 | iso_pu_bacteria | 2935684952 | 2935687734 | 147 |
| 205 | iso_pu_bacteria | 2935694250 | 2935695548 | 147 |
| 206 | iso_pu_bacteria | 2935703347 | 2935712314 | 147 |
| 207 | iso_pu_bacteria | 2935713505 | 2935714753 | 147 |
| 208 | iso_pu_bacteria | 2935722832 | 2935726682 | 147 |
| 209 | iso_pu_bacteria | 2935732158 | 2935739451 | 147 |
| 210 | iso_pu_bacteria | 2935741537 | 2935748489 | 147 |
| 211 | iso_pu_bacteria | 2935750917 | 2935755010 | 147 |
| 212 | iso_pu_bacteria | 2935760218 | 2935761088 | 147 |
| 213 | iso_pu_bacteria | 2935769743 | 2935771598 | 147 |
| 214 | iso_pu_bacteria | 2935777560 | 2935779288 | 147 |
| 215 | iso_pu_bacteria | 2935785616 | 2935790744 | 147 |
| 216 | iso_pu_bacteria | 2935793552 | 2935799315 | 147 |
| 217 | iso_pu_bacteria | 2935801545 | 2935807455 | 147 |
| 218 | iso_pu_bacteria | 2935810662 | 2935812595 | 147 |
| 219 | iso_pu_bacteria | 2935819856 | 2935820683 | 147 |
| 220 | iso_pu_bacteria | 2935827899 | 2935837039 | 147 |
| 221 | iso_pu_bacteria | 2935837841 | 2935839378 | 147 |
| 222 | iso_pu_bacteria | 2935847175 | 2935849307 | 147 |
| 223 | iso_pu_bacteria | 2935855204 | 2935857235 | 147 |
| 224 | iso_pu_bacteria | 2935864058 | 2935864764 | 147 |
| 225 | iso_pu_bacteria | 2935873716 | 2935876542 | 147 |
| 226 | iso_pu_bacteria | 2935908558 | 2935911916 | 147 |
| 227 | iso_pu_bacteria | 2935916978 | 2935920450 | 147 |
| 228 | iso_pu_bacteria | 2935926038 | 2935928945 | 147 |
| 229 | iso_pu_bacteria | 2935934488 | 2935938590 | 147 |
| 230 | iso_pu_bacteria | 2935942939 | 2935945518 | 147 |
| 231 | iso_pu_bacteria | 2935951376 | 2935954875 | 147 |
| 232 | iso_pu_bacteria | 2935959822 | 2935963491 | 147 |
| 233 | iso_pu_bacteria | 2935967501 | 2935970762 | 147 |
| 234 | iso_pu_bacteria | 2935975950 | 2935978999 | 147 |
| 235 | iso_pu_bacteria | 2935984226 | 2935989705 | 147 |
| 236 | iso_pu_bacteria | 2935992306 | 2936001358 | 147 |
| 237 | iso_pu_bacteria | 2936002035 | 2936009337 | 147 |
| 238 | iso_pu_bacteria | 2936011229 | 2936011546 | 147 |
| 239 | iso_pu_bacteria | 2936019824 | 2936020141 | 147 |
| 240 | iso_pu_bacteria | 2936028420 | 2936028737 | 147 |
| 241 | iso_pu_bacteria | 2936037263 | 2936039188 | 147 |
| 242 | iso_pu_bacteria | 2936046547 | 2936046864 | 147 |
| 243 | iso_pu_bacteria | 2936055302 | 2936058264 | 147 |
| 244 | iso_pu_bacteria | 2940556831 | 2940559613 | 147 |
| 245 | iso_pu_bacteria | 2941538514 | 2941540067 | 147 |
| 246 | iso_pu_bacteria | 3005483717 | 3005488063 | 147 |
| 247 | iso_pu_bacteria | 3005506211 | 3005512832 | 147 |
| 248 | iso_pu_bacteria | 3005587118 | 3005590579 | 147 |
| 249 | iso_pu_bacteria | 3005594810 | 3005597618 | 147 |
| 250 | iso_pu_bacteria | 3005710791 | 3005713651 | 147 |
| 251 | iso_pu_bacteria | 8016511872 | 8016514811 | 147 |
| 252 | iso_pu_bacteria | 8016522445 | 8016530938 | 147 |
| 253 | iso_pu_bacteria | 8016530956 | 8016536230 | 147 |
| 254 | iso_pu_bacteria | 8016539877 | 8016540515 | 147 |
| 255 | iso_pu_bacteria | 8016548790 | 8016552729 | 147 |
| 256 | iso_pu_bacteria | 8016557553 | 8016561110 | 147 |
| 257 | iso_pu_bacteria | 8016566248 | 8016574592 | 147 |
| 258 | iso_pu_bacteria | 8016575299 | 8016578673 | 147 |
| 259 | iso_pu_bacteria | 8016595262 | 8016598967 | 147 |
| 260 | iso_pu_bacteria | 8016603502 | 8016612107 | 147 |
| 261 | iso_pu_bacteria | 8016630954 | 8016632451 | 147 |
| 262 | iso_pu_bacteria | 8017057580 | 8017061633 | 147 |
| 263 | iso_pu_bacteria | 8019530166 | 8019535953 | 147 |
| 264 | iso_pu_bacteria | 8019547302 | 8019555341 | 147 |
| 265 | iso_pu_bacteria | 8019576017 | 8019581019 | 147 |
| 266 | iso_pu_bacteria | 8019586578 | 8019588754 | 147 |
| 267 | iso_pu_bacteria | 8019597564 | 8019602587 | 147 |
| 268 | iso_pu_bacteria | 8019608314 | 8019615972 | 147 |
| 269 | iso_pu_bacteria | 8019619141 | 8019626681 | 147 |
| 270 | iso_pu_bacteria | 8019629233 | 8019635835 | 147 |
| 271 | iso_pu_bacteria | 8019638758 | 8019643824 | 147 |
| 272 | iso_pu_bacteria | 8019659431 | 8019663601 | 147 |
| 273 | iso_pu_bacteria | 8019687851 | 8019688573 | 147 |
| 274 | iso_pu_bacteria | 8055742211 | 8055747729 | 147 |
| 275 | iso_pu_bacteria | 8056967851 | 8056970115 | 147 |
| 276 | 3300003659 | JGI25404J52841_10009065 | JGI25404J52841_100090651 | 148 |
| 277 | 3300005328 | Ga0070676_11289330 | Ga0070676_112893301 | 148 |
| 278 | 3300005329 | Ga0070683_100778079 | Ga0070683_1007780791 | 148 |
| 279 | 3300005337 | Ga0070682_100476317 | Ga0070682_1004763172 | 148 |
| 280 | 3300005347 | Ga0070668_100382218 | Ga0070668_1003822181 | 148 |
| 281 | 3300005353 | Ga0070669_100369060 | Ga0070669_1003690602 | 148 |
| 282 | 3300005365 | Ga0070688_100271878 | Ga0070688_1002718782 | 148 |
| 283 | 3300005366 | Ga0070659_100233720 | Ga0070659_1002337202 | 148 |
| 284 | 3300005434 | Ga0070709_10001049 | Ga0070709_1000104913 | 148 |
| 285 | 3300005434 | Ga0070709_10179542 | Ga0070709_101795421 | 148 |
| 286 | 3300005435 | Ga0070714_100001503 | Ga0070714_10000150310 | 148 |
| 287 | 3300005435 | Ga0070714_101192030 | Ga0070714_1011920301 | 148 |
| 288 | 3300005436 | Ga0070713_100009241 | Ga0070713_1000092418 | 148 |
| 289 | 3300005436 | Ga0070713_100258218 | Ga0070713_1002582181 | 148 |
| 290 | 3300005436 | Ga0070713_100708890 | Ga0070713_1007088902 | 148 |
| 291 | 3300005436 | Ga0070713_100854847 | Ga0070713_1008548471 | 148 |
| 292 | 3300005437 | Ga0070710_10024990 | Ga0070710_100249902 | 148 |
| 293 | 3300005437 | Ga0070710_10035049 | Ga0070710_100350492 | 148 |
| 294 | 3300005439 | Ga0070711_100003503 | Ga0070711_10000350310 | 148 |
| 295 | 3300005439 | Ga0070711_100062200 | Ga0070711_1000622003 | 148 |
| 296 | 3300005439 | Ga0070711_100387889 | Ga0070711_1003878891 | 148 |
| 297 | 3300005440 | Ga0070705_100290476 | Ga0070705_1002904762 | 148 |
| 298 | 3300005455 | Ga0070663_100066976 | Ga0070663_1000669762 | 148 |
| 299 | 3300005456 | Ga0070678_100127431 | Ga0070678_1001274312 | 148 |
| 300 | 3300005456 | Ga0070678_100173943 | Ga0070678_1001739432 | 148 |
| 301 | 3300005456 | Ga0070678_101131972 | Ga0070678_1011319721 | 148 |
| 302 | 3300005458 | Ga0070681_10035146 | Ga0070681_100351464 | 148 |
| 303 | 3300005458 | Ga0070681_10916849 | Ga0070681_109168491 | 148 |
| 304 | 3300005459 | Ga0068867_100328963 | Ga0068867_1003289632 | 148 |
| 305 | 3300005536 | Ga0070697_100728346 | Ga0070697_1007283462 | 148 |
| 306 | 3300005548 | Ga0070665_100155913 | Ga0070665_1001559132 | 148 |
| 307 | 3300005563 | Ga0068855_100745625 | Ga0068855_1007456252 | 148 |
| 308 | 3300005577 | Ga0068857_100753740 | Ga0068857_1007537401 | 148 |
| 309 | 3300005615 | Ga0070702_100040026 | Ga0070702_1000400262 | 148 |
| 310 | 3300005841 | Ga0068863_100867183 | Ga0068863_1008671832 | 148 |
| 311 | 3300005842 | Ga0068858_100202919 | Ga0068858_1002029193 | 148 |
| 312 | 3300005842 | Ga0068858_100478075 | Ga0068858_1004780752 | 148 |
| 313 | 3300005981 | Ga0081538_10042515 | Ga0081538_100425152 | 148 |
| 314 | 3300005983 | Ga0081540_1003440 | Ga0081540_100344010 | 148 |
| 315 | 3300005983 | Ga0081540_1004142 | Ga0081540_10041422 | 148 |
| 316 | 3300006028 | Ga0070717_10002312 | Ga0070717_100023125 | 148 |
| 317 | 3300006048 | Ga0075363_100020528 | Ga0075363_1000205284 | 148 |
| 318 | 3300006051 | Ga0075364_10295567 | Ga0075364_102955671 | 148 |
| 319 | 3300006163 | Ga0070715_10000192 | Ga0070715_100001925 | 148 |
| 320 | 3300006173 | Ga0070716_100063087 | Ga0070716_1000630873 | 148 |
| 321 | 3300006175 | Ga0070712_100008540 | Ga0070712_1000085403 | 148 |
| 322 | 3300006178 | Ga0075367_10016109 | Ga0075367_100161095 | 148 |
| 323 | 3300006195 | Ga0075366_10124194 | Ga0075366_101241942 | 148 |
| 324 | 3300006353 | Ga0075370_10022481 | Ga0075370_100224815 | 148 |
| 325 | 3300006847 | Ga0075431_101407414 | Ga0075431_1014074141 | 148 |
| 326 | 3300009093 | Ga0105240_11198258 | Ga0105240_111982581 | 148 |
| 327 | 3300009098 | Ga0105245_10027787 | Ga0105245_100277878 | 148 |
| 328 | 3300009101 | Ga0105247_10395620 | Ga0105247_103956202 | 148 |
| 329 | 3300009101 | Ga0105247_10455678 | Ga0105247_104556781 | 148 |
| 330 | 3300009148 | Ga0105243_11794713 | Ga0105243_117947131 | 148 |
| 331 | 3300009174 | Ga0105241_10116647 | Ga0105241_101166472 | 148 |
| 332 | 3300009174 | Ga0105241_11595263 | Ga0105241_115952631 | 148 |
| 333 | 3300009174 | Ga0105241_11672279 | Ga0105241_116722791 | 148 |
| 334 | 3300009177 | Ga0105248_10570502 | Ga0105248_105705022 | 148 |
| 335 | 3300009545 | Ga0105237_10202266 | Ga0105237_102022662 | 148 |
| 336 | 3300009551 | Ga0105238_10286069 | Ga0105238_102860692 | 148 |
| 337 | 3300009553 | Ga0105249_10380494 | Ga0105249_103804942 | 148 |
| 338 | 3300010375 | Ga0105239_10454113 | Ga0105239_104541132 | 148 |
| 339 | 3300011119 | Ga0105246_10106277 | Ga0105246_101062773 | 148 |
| 340 | 3300013104 | Ga0157370_10049664 | Ga0157370_100496642 | 148 |
| 341 | 3300013296 | Ga0157374_10035499 | Ga0157374_100354991 | 148 |
| 342 | 3300013306 | Ga0163162_12005991 | Ga0163162_120059911 | 148 |
| 343 | 3300014325 | Ga0163163_10105138 | Ga0163163_101051382 | 148 |
| 344 | 3300014325 | Ga0163163_10410562 | Ga0163163_104105622 | 148 |
| 345 | 3300014968 | Ga0157379_10071516 | Ga0157379_100715163 | 148 |
| 346 | 3300021384 | Ga0213876_10001877 | Ga0213876_100018777 | 148 |
| 347 | 3300025898 | Ga0207692_10000798 | Ga0207692_100007985 | 148 |
| 348 | 3300025898 | Ga0207692_10039773 | Ga0207692_100397732 | 148 |
| 349 | 3300025900 | Ga0207710_10038686 | Ga0207710_100386862 | 148 |
| 350 | 3300025901 | Ga0207688_10059877 | Ga0207688_100598772 | 148 |
| 351 | 3300025903 | Ga0207680_10060356 | Ga0207680_100603562 | 148 |
| 352 | 3300025905 | Ga0207685_10017711 | Ga0207685_100177112 | 148 |
| 353 | 3300025906 | Ga0207699_10001678 | Ga0207699_100016784 | 148 |
| 354 | 3300025906 | Ga0207699_10031117 | Ga0207699_100311173 | 148 |
| 355 | 3300025907 | Ga0207645_10035572 | Ga0207645_100355724 | 148 |
| 356 | 3300025911 | Ga0207654_10047186 | Ga0207654_100471862 | 148 |
| 357 | 3300025914 | Ga0207671_10122859 | Ga0207671_101228591 | 148 |
| 358 | 3300025915 | Ga0207693_10001679 | Ga0207693_1000167911 | 148 |
| 359 | 3300025915 | Ga0207693_10021981 | Ga0207693_100219813 | 148 |
| 360 | 3300025916 | Ga0207663_10000672 | Ga0207663_1000067210 | 148 |
| 361 | 3300025916 | Ga0207663_10435653 | Ga0207663_104356532 | 148 |
| 362 | 3300025916 | Ga0207663_10636806 | Ga0207663_106368062 | 148 |
| 363 | 3300025919 | Ga0207657_10178343 | Ga0207657_101783432 | 148 |
| 364 | 3300025928 | Ga0207700_10008661 | Ga0207700_100086619 | 148 |
| 365 | 3300025928 | Ga0207700_10165011 | Ga0207700_101650112 | 148 |
| 366 | 3300025928 | Ga0207700_10329667 | Ga0207700_103296671 | 148 |
| 367 | 3300025928 | Ga0207700_10521898 | Ga0207700_105218981 | 148 |
| 368 | 3300025929 | Ga0207664_10012380 | Ga0207664_100123804 | 148 |
| 369 | 3300025932 | Ga0207690_10429900 | Ga0207690_104299002 | 148 |
| 370 | 3300025933 | Ga0207706_10163653 | Ga0207706_101636532 | 148 |
| 371 | 3300025939 | Ga0207665_10000700 | Ga0207665_1000070027 | 148 |
| 372 | 3300025939 | Ga0207665_10465973 | Ga0207665_104659731 | 148 |
| 373 | 3300025941 | Ga0207711_10480020 | Ga0207711_104800203 | 148 |
| 374 | 3300025942 | Ga0207689_10338223 | Ga0207689_103382232 | 148 |
| 375 | 3300025949 | Ga0207667_10425834 | Ga0207667_104258342 | 148 |
| 376 | 3300026035 | Ga0207703_10614912 | Ga0207703_106149121 | 148 |
| 377 | 3300026067 | Ga0207678_10026683 | Ga0207678_100266832 | 148 |
| 378 | 3300026088 | Ga0207641_10530953 | Ga0207641_105309532 | 148 |
| 379 | 3300026095 | Ga0207676_10206133 | Ga0207676_102061332 | 148 |
| 380 | 3300026095 | Ga0207676_11021251 | Ga0207676_110212511 | 148 |
| 381 | 3300026116 | Ga0207674_10203175 | Ga0207674_102031752 | 148 |
| 382 | 3300026121 | Ga0207683_10153255 | Ga0207683_101532552 | 148 |
| 383 | 3300026121 | Ga0207683_10291320 | Ga0207683_102913202 | 148 |
| 384 | 3300028379 | Ga0268266_10030787 | Ga0268266_100307876 | 148 |
| 385 | 3300028379 | Ga0268266_10270068 | Ga0268266_102700681 | 148 |
| 386 | 3300028794 | Ga0307515_10355834 | Ga0307515_103558342 | 148 |
| 387 | 3300031249 | Ga0265339_10030751 | Ga0265339_100307512 | 148 |
| 388 | 3300031548 | Ga0307408_100327901 | Ga0307408_1003279011 | 148 |
| 389 | 3300035113 | Ga0373936_0122921 | Ga0373936_0122921_497_946 | 148 |
| 390 | 3300035170 | Ga0373943_0239776 | Ga0373943_0239776_461_910 | 148 |
| 391 | 3300035695 | Ga0373927_0001314 | Ga0373927_0001314_11543_11992 | 148 |
| 392 | 3300035725 | Ga0373947_0043194 | Ga0373947_0043194_2216_2665 | 148 |
| 393 | 3300036401 | Ga0373937_0580910 | Ga0373937_0580910_313_762 | 148 |
| 394 | 3300039437 | Ga0436365_0396709 | Ga0436365_0396709_67202_67651 | 148 |
| 395 | 3300039437 | Ga0436365_0658425 | Ga0436365_0658425_596_1045 | 148 |
| 396 | 3300039450 | Ga0436363_0874061 | Ga0436363_0874061_23_472 | 148 |
| 397 | 3300039450 | Ga0436363_1445334 | Ga0436363_1445334_1044_1493 | 148 |
| 398 | 3300039453 | Ga0436362_1295787 | Ga0436362_1295787_653_1102 | 148 |
| 399 | 3300042005 | Ga0439448_0191032 | Ga0439448_0191032_82_531 | 148 |
| 400 | 3300044684 | Ga0466966_0874786 | Ga0466966_0874786_52_501 | 148 |
| 401 | 3300044694 | Ga0466963_0315589 | Ga0466963_0315589_488_949 | 148 |
| 402 | 3300044765 | Ga0466970_0121485 | Ga0466970_0121485_430_879 | 148 |
| 403 | 3300046475 | Ga0495639_0288498 | Ga0495639_0288498_281_730 | 148 |
| 404 | 3300046477 | Ga0495664_0356689 | Ga0495664_0356689_287_736 | 148 |
| 405 | 3300046531 | Ga0495665_0443546 | Ga0495665_0443546_148_597 | 148 |
| 406 | 3300046533 | Ga0495640_0585540 | Ga0495640_0585540_145_594 | 148 |
| 407 | 3300046679 | Ga0495623_0275545 | Ga0495623_0275545_63_512 | 148 |
| 408 | 3300046689 | Ga0495613_0127022 | Ga0495613_0127022_710_1159 | 148 |
| 409 | 3300047320 | Ga0495672_0215594 | Ga0495672_0215594_364_813 | 148 |
| 410 | 3300048903 | Ga0496100_0278677 | Ga0496100_0278677_244_693 | 148 |
| 411 | 3300048904 | Ga0496101_0327599 | Ga0496101_0327599_690_1139 | 148 |
| 412 | 3300048905 | Ga0496102_0083006 | Ga0496102_0083006_1920_2369 | 148 |
| 413 | 3300048905 | Ga0496102_0270149 | Ga0496102_0270149_200_649 | 148 |
| 414 | 3300048905 | Ga0496102_0374778 | Ga0496102_0374778_577_1026 | 148 |
| 415 | 3300048906 | Ga0496103_0085727 | Ga0496103_0085727_717_1166 | 148 |
| 416 | 3300048906 | Ga0496103_0111335 | Ga0496103_0111335_1075_1524 | 148 |
| 417 | 3300048908 | Ga0496105_0283738 | Ga0496105_0283738_611_1060 | 148 |
| 418 | 3300048909 | Ga0496106_0076818 | Ga0496106_0076818_1576_2025 | 148 |
| 419 | 3300048909 | Ga0496106_0091610 | Ga0496106_0091610_1434_1883 | 148 |
| 420 | 3300048910 | Ga0496107_0194019 | Ga0496107_0194019_20_469 | 148 |
| 421 | 3300048911 | Ga0496108_0738291 | Ga0496108_0738291_236_685 | 148 |
| 422 | 3300048912 | Ga0496109_0304897 | Ga0496109_0304897_584_1033 | 148 |
| 423 | 3300048912 | Ga0496109_0625003 | Ga0496109_0625003_63_512 | 148 |
| 424 | 3300048912 | Ga0496109_0989925 | Ga0496109_0989925_285_734 | 148 |
| 425 | 3300048913 | Ga0496110_0040514 | Ga0496110_0040514_857_1306 | 148 |
| 426 | 3300048915 | Ga0496112_0007967 | Ga0496112_0007967_1966_2415 | 148 |
| 427 | 3300048915 | Ga0496112_0117718 | Ga0496112_0117718_1424_1873 | 148 |
| 428 | 3300048917 | Ga0496114_0529359 | Ga0496114_0529359_506_955 | 148 |
| 429 | 3300048918 | Ga0496115_0184723 | Ga0496115_0184723_161_610 | 148 |
| 430 | 3300048920 | Ga0496117_0128756 | Ga0496117_0128756_648_1097 | 148 |
| 431 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_74796_75245 | 148 |
| 432 | 3300048929 | Ga0496126_0297425 | Ga0496126_0297425_273_722 | 148 |
| 433 | 3300050490 | nmdc:mga03n38_42619_c1 | nmdc:mga03n38_42619_c1_1013_1462 | 148 |
| 434 | 3300050492 | nmdc:mga0yw44_139125_c1 | nmdc:mga0yw44_139125_c1_701_1150 | 148 |
| 435 | 3300050493 | nmdc:mga0k408_279571_c1 | nmdc:mga0k408_279571_c1_332_781 | 148 |
| 436 | 3300050494 | nmdc:mga06z11_271591_c1 | nmdc:mga06z11_271591_c1_82_531 | 148 |
| 437 | 3300050496 | nmdc:mga07m45_415448_c1 | nmdc:mga07m45_415448_c1_274_723 | 148 |
| 438 | 3300050496 | nmdc:mga07m45_4525_c1 | nmdc:mga07m45_4525_c1_1642_2091 | 148 |
| 439 | 3300050515 | nmdc:mga0a205_1008445_c1 | nmdc:mga0a205_1008445_c1_170_619 | 148 |
| 440 | 3300053083 | Ga0495655_0200339 | Ga0495655_0200339_125_574 | 148 |
| 441 | 3300053091 | Ga0500647_0353335 | Ga0500647_0353335_135_584 | 148 |
| 442 | 3300053094 | Ga0500566_0013088 | Ga0500566_0013088_902_1351 | 148 |
| 443 | 3300053102 | Ga0500554_053556 | Ga0500554_053556_149_598 | 148 |
| 444 | 3300053119 | Ga0500595_000468 | Ga0500595_000468_6947_7396 | 148 |
| 445 | 3300053119 | Ga0500595_000947 | Ga0500595_000947_14921_15370 | 148 |
| 446 | 3300053128 | Ga0500626_067080 | Ga0500626_067080_735_1184 | 148 |
| 447 | 3300053136 | Ga0500559_0202559 | Ga0500559_0202559_469_918 | 148 |
| 448 | 3300053162 | Ga0500638_063082 | Ga0500638_063082_527_976 | 148 |
| 449 | 3300053177 | Ga0500636_0088066 | Ga0500636_0088066_64_513 | 148 |
| 450 | 3300053177 | Ga0500636_0197695 | Ga0500636_0197695_559_1008 | 148 |
| 451 | 3300053178 | Ga0500637_0011077 | Ga0500637_0011077_979_1428 | 148 |
| 452 | 3300053729 | Ga0500625_000384 | Ga0500625_000384_3276_3725 | 148 |
| 453 | 3300055283 | Ga0500661_001956 | Ga0500661_001956_1521_1970 | 148 |
| 454 | iso_pu_bacteria | 2513237092 | 2513628615 | 148 |
| 455 | iso_pu_bacteria | 2791355196 | 2793060126 | 148 |
| 456 | 3300005334 | Ga0068869_100603209 | Ga0068869_1006032091 | 149 |
| 457 | 3300005337 | Ga0070682_100591696 | Ga0070682_1005916962 | 149 |
| 458 | 3300005338 | Ga0068868_101554255 | Ga0068868_1015542551 | 149 |
| 459 | 3300005340 | Ga0070689_100383115 | Ga0070689_1003831152 | 149 |
| 460 | 3300005355 | Ga0070671_100386344 | Ga0070671_1003863441 | 149 |
| 461 | 3300005356 | Ga0070674_100485667 | Ga0070674_1004856672 | 149 |
| 462 | 3300005365 | Ga0070688_100196942 | Ga0070688_1001969423 | 149 |
| 463 | 3300005365 | Ga0070688_100282441 | Ga0070688_1002824412 | 149 |
| 464 | 3300005437 | Ga0070710_10040600 | Ga0070710_100406004 | 149 |
| 465 | 3300005441 | Ga0070700_100827428 | Ga0070700_1008274281 | 149 |
| 466 | 3300005441 | Ga0070700_101168434 | Ga0070700_1011684341 | 149 |
| 467 | 3300005458 | Ga0070681_10578438 | Ga0070681_105784381 | 149 |
| 468 | 3300005466 | Ga0070685_10576194 | Ga0070685_105761942 | 149 |
| 469 | 3300005535 | Ga0070684_100364981 | Ga0070684_1003649812 | 149 |
| 470 | 3300005539 | Ga0068853_100478174 | Ga0068853_1004781742 | 149 |
| 471 | 3300005539 | Ga0068853_100583638 | Ga0068853_1005836381 | 149 |
| 472 | 3300005543 | Ga0070672_100181742 | Ga0070672_1001817422 | 149 |
| 473 | 3300005544 | Ga0070686_100265387 | Ga0070686_1002653871 | 149 |
| 474 | 3300005546 | Ga0070696_100845924 | Ga0070696_1008459242 | 149 |
| 475 | 3300005548 | Ga0070665_100288465 | Ga0070665_1002884652 | 149 |
| 476 | 3300005548 | Ga0070665_101525214 | Ga0070665_1015252141 | 149 |
| 477 | 3300005577 | Ga0068857_100350521 | Ga0068857_1003505212 | 149 |
| 478 | 3300005578 | Ga0068854_100775218 | Ga0068854_1007752182 | 149 |
| 479 | 3300005578 | Ga0068854_101055113 | Ga0068854_1010551132 | 149 |
| 480 | 3300005614 | Ga0068856_100233961 | Ga0068856_1002339613 | 149 |
| 481 | 3300005614 | Ga0068856_101093097 | Ga0068856_1010930971 | 149 |
| 482 | 3300005615 | Ga0070702_100277620 | Ga0070702_1002776201 | 149 |
| 483 | 3300005616 | Ga0068852_100167350 | Ga0068852_1001673502 | 149 |
| 484 | 3300005616 | Ga0068852_101559146 | Ga0068852_1015591462 | 149 |
| 485 | 3300005618 | Ga0068864_100422577 | Ga0068864_1004225772 | 149 |
| 486 | 3300005718 | Ga0068866_10276860 | Ga0068866_102768602 | 149 |
| 487 | 3300005842 | Ga0068858_100039039 | Ga0068858_1000390394 | 149 |
| 488 | 3300005843 | Ga0068860_100371183 | Ga0068860_1003711832 | 149 |
| 489 | 3300005937 | Ga0081455_10002285 | Ga0081455_100022854 | 149 |
| 490 | 3300005937 | Ga0081455_10007249 | Ga0081455_1000724912 | 149 |
| 491 | 3300006028 | Ga0070717_10198890 | Ga0070717_101988903 | 149 |
| 492 | 3300006028 | Ga0070717_11464143 | Ga0070717_114641431 | 149 |
| 493 | 3300006038 | Ga0075365_10156057 | Ga0075365_101560573 | 149 |
| 494 | 3300006042 | Ga0075368_10011707 | Ga0075368_100117071 | 149 |
| 495 | 3300006048 | Ga0075363_100052001 | Ga0075363_1000520011 | 149 |
| 496 | 3300006051 | Ga0075364_10060911 | Ga0075364_100609113 | 149 |
| 497 | 3300006178 | Ga0075367_10230656 | Ga0075367_102306562 | 149 |
| 498 | 3300006880 | Ga0075429_100433848 | Ga0075429_1004338482 | 149 |
| 499 | 3300006881 | Ga0068865_100320808 | Ga0068865_1003208081 | 149 |
| 500 | 3300009011 | Ga0105251_10515109 | Ga0105251_105151091 | 149 |
| 501 | 3300009093 | Ga0105240_10012039 | Ga0105240_100120392 | 149 |
| 502 | 3300009094 | Ga0111539_10671213 | Ga0111539_106712132 | 149 |
| 503 | 3300009094 | Ga0111539_10985186 | Ga0111539_109851862 | 149 |
| 504 | 3300009098 | Ga0105245_10453074 | Ga0105245_104530742 | 149 |
| 505 | 3300009101 | Ga0105247_10008420 | Ga0105247_100084206 | 149 |
| 506 | 3300009148 | Ga0105243_10089736 | Ga0105243_100897363 | 149 |
| 507 | 3300009177 | Ga0105248_10164028 | Ga0105248_101640282 | 149 |
| 508 | 3300009545 | Ga0105237_10652715 | Ga0105237_106527152 | 149 |
| 509 | 3300009553 | Ga0105249_10556539 | Ga0105249_105565392 | 149 |
| 510 | 3300010375 | Ga0105239_11283959 | Ga0105239_112839592 | 149 |
| 511 | 3300010375 | Ga0105239_11509577 | Ga0105239_115095772 | 149 |
| 512 | 3300013104 | Ga0157370_10159756 | Ga0157370_101597563 | 149 |
| 513 | 3300013105 | Ga0157369_10103369 | Ga0157369_101033692 | 149 |
| 514 | 3300013297 | Ga0157378_10070096 | Ga0157378_100700964 | 149 |
| 515 | 3300013307 | Ga0157372_11478125 | Ga0157372_114781252 | 149 |
| 516 | 3300013308 | Ga0157375_10039817 | Ga0157375_100398174 | 149 |
| 517 | 3300014326 | Ga0157380_10434396 | Ga0157380_104343961 | 149 |
| 518 | 3300014326 | Ga0157380_11074853 | Ga0157380_110748532 | 149 |
| 519 | 3300014968 | Ga0157379_10003171 | Ga0157379_1000317116 | 149 |
| 520 | 3300014969 | Ga0157376_10332550 | Ga0157376_103325502 | 149 |
| 521 | 3300021384 | Ga0213876_10199567 | Ga0213876_101995672 | 149 |
| 522 | 3300022467 | Ga0224712_10042995 | Ga0224712_100429953 | 149 |
| 523 | 3300025900 | Ga0207710_10012085 | Ga0207710_100120852 | 149 |
| 524 | 3300025913 | Ga0207695_10035634 | Ga0207695_100356343 | 149 |
| 525 | 3300025913 | Ga0207695_10233374 | Ga0207695_102333742 | 149 |
| 526 | 3300025914 | Ga0207671_10576829 | Ga0207671_105768292 | 149 |
| 527 | 3300025917 | Ga0207660_10243663 | Ga0207660_102436633 | 149 |
| 528 | 3300025924 | Ga0207694_11633823 | Ga0207694_116338231 | 149 |
| 529 | 3300025928 | Ga0207700_10027097 | Ga0207700_100270974 | 149 |
| 530 | 3300025931 | Ga0207644_10644089 | Ga0207644_106440891 | 149 |
| 531 | 3300025935 | Ga0207709_10272671 | Ga0207709_102726712 | 149 |
| 532 | 3300025936 | Ga0207670_10519532 | Ga0207670_105195322 | 149 |
| 533 | 3300025937 | Ga0207669_10248924 | Ga0207669_102489242 | 149 |
| 534 | 3300025938 | Ga0207704_10122749 | Ga0207704_101227493 | 149 |
| 535 | 3300025938 | Ga0207704_10479932 | Ga0207704_104799321 | 149 |
| 536 | 3300025941 | Ga0207711_10115930 | Ga0207711_101159302 | 149 |
| 537 | 3300025942 | Ga0207689_10678558 | Ga0207689_106785582 | 149 |
| 538 | 3300025961 | Ga0207712_10626335 | Ga0207712_106263351 | 149 |
| 539 | 3300025981 | Ga0207640_10642756 | Ga0207640_106427561 | 149 |
| 540 | 3300025986 | Ga0207658_10038482 | Ga0207658_100384821 | 149 |
| 541 | 3300026041 | Ga0207639_10408576 | Ga0207639_104085762 | 149 |
| 542 | 3300026067 | Ga0207678_10571857 | Ga0207678_105718572 | 149 |
| 543 | 3300026075 | Ga0207708_10170684 | Ga0207708_101706842 | 149 |
| 544 | 3300026095 | Ga0207676_10631639 | Ga0207676_106316392 | 149 |
| 545 | 3300026118 | Ga0207675_100298166 | Ga0207675_1002981661 | 149 |
| 546 | 3300028379 | Ga0268266_10533691 | Ga0268266_105336911 | 149 |
| 547 | 3300028379 | Ga0268266_10601395 | Ga0268266_106013952 | 149 |
| 548 | 3300030522 | Ga0307512_10263719 | Ga0307512_102637191 | 149 |
| 549 | 3300031691 | Ga0316579_10323998 | Ga0316579_103239982 | 149 |
| 550 | 3300035089 | Ga0373944_0102069 | Ga0373944_0102069_337_795 | 149 |
| 551 | 3300035111 | Ga0373923_0295524 | Ga0373923_0295524_90_548 | 149 |
| 552 | 3300035171 | Ga0373946_0115373 | Ga0373946_0115373_218_676 | 149 |
| 553 | 3300035692 | Ga0373935_0032938 | Ga0373935_0032938_1714_2172 | 149 |
| 554 | 3300035695 | Ga0373927_0016642 | Ga0373927_0016642_495_953 | 149 |
| 555 | 3300035725 | Ga0373947_0032609 | Ga0373947_0032609_2447_2905 | 149 |
| 556 | 3300036401 | Ga0373937_1093704 | Ga0373937_1093704_78_536 | 149 |
| 557 | 3300037068 | Ga0373925_0009010 | Ga0373925_0009010_4891_5349 | 149 |
| 558 | 3300037312 | Ga0395899_0314745 | Ga0395899_0314745_36_494 | 149 |
| 559 | 3300037312 | Ga0395899_0838407 | Ga0395899_0838407_95_550 | 149 |
| 560 | 3300037418 | Ga0395900_0086928 | Ga0395900_0086928_2224_2682 | 149 |
| 561 | 3300037466 | Ga0395898_0111784 | Ga0395898_0111784_393_851 | 149 |
| 562 | 3300037466 | Ga0395898_0117507 | Ga0395898_0117507_1601_2059 | 149 |
| 563 | 3300038443 | Ga0395901_0161914 | Ga0395901_0161914_1042_1500 | 149 |
| 564 | 3300039437 | Ga0436365_1891429 | Ga0436365_1891429_750_1208 | 149 |
| 565 | 3300039450 | Ga0436363_1561684 | Ga0436363_1561684_656_1114 | 149 |
| 566 | 3300044684 | Ga0466966_0041436 | Ga0466966_0041436_2414_2884 | 149 |
| 567 | 3300044842 | Ga0466957_0037493 | Ga0466957_0037493_2401_2871 | 149 |
| 568 | 3300045976 | Ga0466967_0221409 | Ga0466967_0221409_814_1272 | 149 |
| 569 | 3300046454 | Ga0495592_0470201 | Ga0495592_0470201_225_677 | 149 |
| 570 | 3300046455 | Ga0495603_0000101 | Ga0495603_0000101_5520_5978 | 149 |
| 571 | 3300046459 | Ga0495629_0002313 | Ga0495629_0002313_9173_9631 | 149 |
| 572 | 3300046461 | Ga0495641_0008274 | Ga0495641_0008274_2697_3155 | 149 |
| 573 | 3300046472 | Ga0495580_0000825 | Ga0495580_0000825_12897_13355 | 149 |
| 574 | 3300046473 | Ga0495582_0000567 | Ga0495582_0000567_6689_7147 | 149 |
| 575 | 3300046473 | Ga0495582_0322383 | Ga0495582_0322383_53_505 | 149 |
| 576 | 3300046475 | Ga0495639_0005952 | Ga0495639_0005952_4330_4788 | 149 |
| 577 | 3300046476 | Ga0495662_0159561 | Ga0495662_0159561_615_1073 | 149 |
| 578 | 3300046477 | Ga0495664_0012345 | Ga0495664_0012345_1897_2355 | 149 |
| 579 | 3300046491 | Ga0495584_0123278 | Ga0495584_0123278_506_976 | 149 |
| 580 | 3300046499 | Ga0495594_0000023 | Ga0495594_0000023_58624_59082 | 149 |
| 581 | 3300046517 | Ga0495630_0626510 | Ga0495630_0626510_164_622 | 149 |
| 582 | 3300046531 | Ga0495665_0051214 | Ga0495665_0051214_867_1325 | 149 |
| 583 | 3300046543 | Ga0495645_0028858 | Ga0495645_0028858_1087_1545 | 149 |
| 584 | 3300046557 | Ga0495622_0001800 | Ga0495622_0001800_3766_4224 | 149 |
| 585 | 3300046674 | Ga0495588_0001677 | Ga0495588_0001677_3888_4346 | 149 |
| 586 | 3300046678 | Ga0495599_0112377 | Ga0495599_0112377_656_1114 | 149 |
| 587 | 3300046681 | Ga0495647_0001896 | Ga0495647_0001896_996_1454 | 149 |
| 588 | 3300046683 | Ga0495658_0014307 | Ga0495658_0014307_1834_2292 | 149 |
| 589 | 3300046689 | Ga0495613_0000209 | Ga0495613_0000209_1401_1859 | 149 |
| 590 | 3300047315 | Ga0495581_0003931 | Ga0495581_0003931_4381_4839 | 149 |
| 591 | 3300047317 | Ga0495604_0646201 | Ga0495604_0646201_106_558 | 149 |
| 592 | 3300047321 | Ga0495676_0112890 | Ga0495676_0112890_819_1277 | 149 |
| 593 | 3300047471 | Ga0495684_0102475 | Ga0495684_0102475_524_982 | 149 |
| 594 | 3300047673 | Ga0495593_0011735 | Ga0495593_0011735_418_876 | 149 |
| 595 | 3300048089 | Ga0495614_0006480 | Ga0495614_0006480_936_1394 | 149 |
| 596 | 3300048904 | Ga0496101_0560289 | Ga0496101_0560289_286_756 | 149 |
| 597 | 3300048905 | Ga0496102_0124843 | Ga0496102_0124843_201_671 | 149 |
| 598 | 3300048907 | Ga0496104_0182233 | Ga0496104_0182233_148_618 | 149 |
| 599 | 3300048908 | Ga0496105_0014239 | Ga0496105_0014239_2641_3111 | 149 |
| 600 | 3300048908 | Ga0496105_0492459 | Ga0496105_0492459_153_623 | 149 |
| 601 | 3300048909 | Ga0496106_0004380 | Ga0496106_0004380_8938_9408 | 149 |
| 602 | 3300048910 | Ga0496107_0008103 | Ga0496107_0008103_3117_3587 | 149 |
| 603 | 3300048911 | Ga0496108_0072191 | Ga0496108_0072191_978_1448 | 149 |
| 604 | 3300048911 | Ga0496108_0339498 | Ga0496108_0339498_26_496 | 149 |
| 605 | 3300048912 | Ga0496109_0027545 | Ga0496109_0027545_2443_2913 | 149 |
| 606 | 3300048912 | Ga0496109_0039020 | Ga0496109_0039020_3385_3855 | 149 |
| 607 | 3300048913 | Ga0496110_0181218 | Ga0496110_0181218_1161_1631 | 149 |
| 608 | 3300048914 | Ga0496111_0076985 | Ga0496111_0076985_753_1223 | 149 |
| 609 | 3300048915 | Ga0496112_0011676 | Ga0496112_0011676_2524_2994 | 149 |
| 610 | 3300048916 | Ga0496113_0052873 | Ga0496113_0052873_441_911 | 149 |
| 611 | 3300048917 | Ga0496114_0003436 | Ga0496114_0003436_1498_1968 | 149 |
| 612 | 3300048918 | Ga0496115_0001779 | Ga0496115_0001779_3371_3841 | 149 |
| 613 | 3300048924 | Ga0496121_0311134 | Ga0496121_0311134_457_909 | 149 |
| 614 | 3300048929 | Ga0496126_0380561 | Ga0496126_0380561_544_1002 | 149 |
| 615 | 3300049568 | Ga0501031_0032687 | Ga0501031_0032687_697_1176 | 149 |
| 616 | 3300049568 | Ga0501031_0472556 | Ga0501031_0472556_102_557 | 149 |
| 617 | 3300049569 | Ga0501032_0091399 | Ga0501032_0091399_857_1336 | 149 |
| 618 | 3300049569 | Ga0501032_0321513 | Ga0501032_0321513_352_807 | 149 |
| 619 | 3300049570 | Ga0501033_0063484 | Ga0501033_0063484_1943_2398 | 149 |
| 620 | 3300049570 | Ga0501033_0112705 | Ga0501033_0112705_970_1449 | 149 |
| 621 | 3300049571 | Ga0501034_0481310 | Ga0501034_0481310_540_995 | 149 |
| 622 | 3300049572 | Ga0501036_0053501 | Ga0501036_0053501_2339_2794 | 149 |
| 623 | 3300049572 | Ga0501036_0092271 | Ga0501036_0092271_1493_1972 | 149 |
| 624 | 3300049572 | Ga0501036_0874088 | Ga0501036_0874088_105_572 | 149 |
| 625 | 3300049572 | Ga0501036_0950107 | Ga0501036_0950107_183_638 | 149 |
| 626 | 3300049573 | Ga0501037_0007172 | Ga0501037_0007172_152_607 | 149 |
| 627 | 3300049573 | Ga0501037_0046285 | Ga0501037_0046285_1632_2111 | 149 |
| 628 | 3300049574 | Ga0501038_0004223 | Ga0501038_0004223_5766_6221 | 149 |
| 629 | 3300049574 | Ga0501038_0172058 | Ga0501038_0172058_680_1159 | 149 |
| 630 | 3300049575 | Ga0501039_0008477 | Ga0501039_0008477_2646_3125 | 149 |
| 631 | 3300049575 | Ga0501039_0354623 | Ga0501039_0354623_163_618 | 149 |
| 632 | 3300049575 | Ga0501039_0824020 | Ga0501039_0824020_77_532 | 149 |
| 633 | 3300049576 | Ga0501040_0020029 | Ga0501040_0020029_2340_2819 | 149 |
| 634 | 3300049576 | Ga0501040_0068930 | Ga0501040_0068930_414_869 | 149 |
| 635 | 3300049577 | Ga0501041_0032146 | Ga0501041_0032146_1602_2081 | 149 |
| 636 | 3300049578 | Ga0501042_0205634 | Ga0501042_0205634_215_715 | 149 |
| 637 | 3300049579 | Ga0501043_0008239 | Ga0501043_0008239_1766_2221 | 149 |
| 638 | 3300049580 | Ga0501046_0091643 | Ga0501046_0091643_674_1153 | 149 |
| 639 | 3300049586 | Ga0501070_0039742 | Ga0501070_0039742_2504_2983 | 149 |
| 640 | 3300049586 | Ga0501070_0430836 | Ga0501070_0430836_366_821 | 149 |
| 641 | 3300049587 | Ga0501071_0024526 | Ga0501071_0024526_2972_3451 | 149 |
| 642 | 3300049587 | Ga0501071_0051416 | Ga0501071_0051416_2291_2755 | 149 |
| 643 | 3300049588 | Ga0501072_0055713 | Ga0501072_0055713_825_1304 | 149 |
| 644 | 3300049588 | Ga0501072_0552318 | Ga0501072_0552318_287_742 | 149 |
| 645 | 3300049589 | Ga0501073_0101499 | Ga0501073_0101499_1158_1637 | 149 |
| 646 | 3300049589 | Ga0501073_0204924 | Ga0501073_0204924_415_870 | 149 |
| 647 | 3300049590 | Ga0501074_0032636 | Ga0501074_0032636_2844_3323 | 149 |
| 648 | 3300049590 | Ga0501074_0678180 | Ga0501074_0678180_107_574 | 149 |
| 649 | 3300049591 | Ga0501075_0019174 | Ga0501075_0019174_607_1086 | 149 |
| 650 | 3300049591 | Ga0501075_0346758 | Ga0501075_0346758_322_825 | 149 |
| 651 | 3300049592 | Ga0501076_0037829 | Ga0501076_0037829_2331_2810 | 149 |
| 652 | 3300049592 | Ga0501076_1048934 | Ga0501076_1048934_77_577 | 149 |
| 653 | 3300049593 | Ga0501077_0019658 | Ga0501077_0019658_686_1165 | 149 |
| 654 | 3300049741 | Ga0501079_0005574 | Ga0501079_0005574_4039_4518 | 149 |
| 655 | 3300049741 | Ga0501079_0282495 | Ga0501079_0282495_310_789 | 149 |
| 656 | 3300049742 | Ga0501080_0041070 | Ga0501080_0041070_1312_1791 | 149 |
| 657 | 3300049742 | Ga0501080_0358259 | Ga0501080_0358259_356_811 | 149 |
| 658 | 3300049743 | Ga0501081_0007723 | Ga0501081_0007723_3636_4115 | 149 |
| 659 | 3300049822 | Ga0501035_0039707 | Ga0501035_0039707_1937_2392 | 149 |
| 660 | 3300049822 | Ga0501035_0065996 | Ga0501035_0065996_1235_1714 | 149 |
| 661 | 3300049823 | Ga0501044_0018546 | Ga0501044_0018546_4014_4469 | 149 |
| 662 | 3300049823 | Ga0501044_0324969 | Ga0501044_0324969_410_889 | 149 |
| 663 | 3300049824 | Ga0501045_0055451 | Ga0501045_0055451_1452_1931 | 149 |
| 664 | 3300050490 | nmdc:mga03n38_92246_c1 | nmdc:mga03n38_92246_c1_293_766 | 149 |
| 665 | 3300050491 | nmdc:mga00v17_43495_c1 | nmdc:mga00v17_43495_c1_1549_2022 | 149 |
| 666 | 3300050492 | nmdc:mga0yw44_103621_c1 | nmdc:mga0yw44_103621_c1_835_1308 | 149 |
| 667 | 3300050508 | nmdc:mga09592_280849_c1 | nmdc:mga09592_280849_c1_711_1190 | 149 |
| 668 | 3300053084 | Ga0495595_0049648 | Ga0495595_0049648_469_927 | 149 |
| 669 | 3300053084 | Ga0495595_0107863 | Ga0495595_0107863_364_816 | 149 |
| 670 | 3300053085 | Ga0495619_0002921 | Ga0495619_0002921_9805_10263 | 149 |
| 671 | 3300053085 | Ga0495619_0102780 | Ga0495619_0102780_614_1066 | 149 |
| 672 | 3300053094 | Ga0500566_0149124 | Ga0500566_0149124_570_1028 | 149 |
| 673 | 3300054114 | Ga0501084_0037603 | Ga0501084_0037603_2249_2728 | 149 |
| 674 | 3300054114 | Ga0501084_0060211 | Ga0501084_0060211_482_982 | 149 |
| 675 | 3300054114 | Ga0501084_0351727 | Ga0501084_0351727_168_647 | 149 |
| 676 | 3300054114 | Ga0501084_0530879 | Ga0501084_0530879_57_533 | 149 |
| 677 | 3300060353 | Ga0501082_0105358 | Ga0501082_0105358_594_1073 | 149 |
| 678 | 3300060353 | Ga0501082_0273997 | Ga0501082_0273997_628_1131 | 149 |
| 679 | 3300061719 | Ga0466962_0190039 | Ga0466962_0190039_263_733 | 149 |
| 680 | 3300061734 | Ga0530510_0022872 | Ga0530510_0022872_2285_2764 | 149 |
| 681 | 3300001990 | JGI24737J22298_10126031 | JGI24737J22298_101260312 | 150 |
| 682 | 3300002075 | JGI24738J21930_10132361 | JGI24738J21930_101323611 | 150 |
| 683 | 3300003214 | JGI25165J46597_1007108 | JGI25165J46597_10071081 | 150 |
| 684 | 3300003214 | JGI25165J46597_1017932 | JGI25165J46597_10179321 | 150 |
| 685 | 3300003215 | JGI25153J46596_10001336 | JGI25153J46596_1000133615 | 150 |
| 686 | 3300003215 | JGI25153J46596_10006825 | JGI25153J46596_100068252 | 150 |
| 687 | 3300003215 | JGI25153J46596_10017942 | JGI25153J46596_100179424 | 150 |
| 688 | 3300003215 | JGI25153J46596_10065045 | JGI25153J46596_100650452 | 150 |
| 689 | 3300003752 | Ga0055539_1009871 | Ga0055539_10098712 | 150 |
| 690 | 3300003762 | Ga0055542_1015350 | Ga0055542_10153501 | 150 |
| 691 | 3300003763 | Ga0055529_1011705 | Ga0055529_10117051 | 150 |
| 692 | 3300003771 | Ga0055526_1030273 | Ga0055526_10302732 | 150 |
| 693 | 3300003794 | Ga0055531_10009682 | Ga0055531_100096821 | 150 |
| 694 | 3300004625 | Ga0055543_1004709 | Ga0055543_10047092 | 150 |
| 695 | 3300005262 | Ga0065165_1002378 | Ga0065165_100237816 | 150 |
| 696 | 3300005262 | Ga0065165_1007503 | Ga0065165_10075035 | 150 |
| 697 | 3300005262 | Ga0065165_1009915 | Ga0065165_10099152 | 150 |
| 698 | 3300005331 | Ga0070670_100669903 | Ga0070670_1006699031 | 150 |
| 699 | 3300005334 | Ga0068869_100219139 | Ga0068869_1002191392 | 150 |
| 700 | 3300005335 | Ga0070666_10904511 | Ga0070666_109045111 | 150 |
| 701 | 3300005336 | Ga0070680_100018149 | Ga0070680_1000181496 | 150 |
| 702 | 3300005336 | Ga0070680_100548580 | Ga0070680_1005485802 | 150 |
| 703 | 3300005336 | Ga0070680_100962359 | Ga0070680_1009623591 | 150 |
| 704 | 3300005337 | Ga0070682_100028973 | Ga0070682_1000289734 | 150 |
| 705 | 3300005337 | Ga0070682_100182311 | Ga0070682_1001823112 | 150 |
| 706 | 3300005339 | Ga0070660_100007944 | Ga0070660_1000079444 | 150 |
| 707 | 3300005339 | Ga0070660_100109160 | Ga0070660_1001091602 | 150 |
| 708 | 3300005339 | Ga0070660_100459735 | Ga0070660_1004597351 | 150 |
| 709 | 3300005347 | Ga0070668_100267653 | Ga0070668_1002676532 | 150 |
| 710 | 3300005355 | Ga0070671_100093201 | Ga0070671_1000932012 | 150 |
| 711 | 3300005434 | Ga0070709_10007480 | Ga0070709_100074808 | 150 |
| 712 | 3300005436 | Ga0070713_100014047 | Ga0070713_1000140475 | 150 |
| 713 | 3300005436 | Ga0070713_100288429 | Ga0070713_1002884291 | 150 |
| 714 | 3300005437 | Ga0070710_10012865 | Ga0070710_100128655 | 150 |
| 715 | 3300005439 | Ga0070711_100005982 | Ga0070711_1000059822 | 150 |
| 716 | 3300005455 | Ga0070663_100128105 | Ga0070663_1001281051 | 150 |
| 717 | 3300005456 | Ga0070678_100372199 | Ga0070678_1003721992 | 150 |
| 718 | 3300005457 | Ga0070662_100085799 | Ga0070662_1000857992 | 150 |
| 719 | 3300005458 | Ga0070681_10002115 | Ga0070681_1000211518 | 150 |
| 720 | 3300005459 | Ga0068867_101645434 | Ga0068867_1016454341 | 150 |
| 721 | 3300005530 | Ga0070679_100054054 | Ga0070679_1000540546 | 150 |
| 722 | 3300005530 | Ga0070679_100077530 | Ga0070679_1000775304 | 150 |
| 723 | 3300005535 | Ga0070684_100076765 | Ga0070684_1000767651 | 150 |
| 724 | 3300005535 | Ga0070684_100513144 | Ga0070684_1005131442 | 150 |
| 725 | 3300005536 | Ga0070697_100057741 | Ga0070697_1000577414 | 150 |
| 726 | 3300005539 | Ga0068853_100005334 | Ga0068853_10000533410 | 150 |
| 727 | 3300005539 | Ga0068853_100333664 | Ga0068853_1003336642 | 150 |
| 728 | 3300005539 | Ga0068853_100350830 | Ga0068853_1003508302 | 150 |
| 729 | 3300005547 | Ga0070693_100077815 | Ga0070693_1000778152 | 150 |
| 730 | 3300005547 | Ga0070693_100160649 | Ga0070693_1001606492 | 150 |
| 731 | 3300005548 | Ga0070665_100032740 | Ga0070665_1000327402 | 150 |
| 732 | 3300005548 | Ga0070665_100568505 | Ga0070665_1005685052 | 150 |
| 733 | 3300005563 | Ga0068855_100286486 | Ga0068855_1002864862 | 150 |
| 734 | 3300005563 | Ga0068855_100810069 | Ga0068855_1008100692 | 150 |
| 735 | 3300005563 | Ga0068855_101690327 | Ga0068855_1016903272 | 150 |
| 736 | 3300005578 | Ga0068854_100180476 | Ga0068854_1001804762 | 150 |
| 737 | 3300005578 | Ga0068854_101431811 | Ga0068854_1014318111 | 150 |
| 738 | 3300005614 | Ga0068856_100915358 | Ga0068856_1009153582 | 150 |
| 739 | 3300005616 | Ga0068852_100366915 | Ga0068852_1003669152 | 150 |
| 740 | 3300005718 | Ga0068866_10380781 | Ga0068866_103807811 | 150 |
| 741 | 3300005719 | Ga0068861_100767877 | Ga0068861_1007678771 | 150 |
| 742 | 3300005834 | Ga0068851_10006013 | Ga0068851_100060131 | 150 |
| 743 | 3300005834 | Ga0068851_10189203 | Ga0068851_101892032 | 150 |
| 744 | 3300005842 | Ga0068858_100152965 | Ga0068858_1001529653 | 150 |
| 745 | 3300005842 | Ga0068858_100379908 | Ga0068858_1003799082 | 150 |
| 746 | 3300005843 | Ga0068860_100000113 | Ga0068860_10000011382 | 150 |
| 747 | 3300005981 | Ga0081538_10031309 | Ga0081538_100313095 | 150 |
| 748 | 3300005983 | Ga0081540_1248391 | Ga0081540_12483911 | 150 |
| 749 | 3300006028 | Ga0070717_10042970 | Ga0070717_100429704 | 150 |
| 750 | 3300006038 | Ga0075365_10023032 | Ga0075365_100230324 | 150 |
| 751 | 3300006048 | Ga0075363_100105410 | Ga0075363_1001054101 | 150 |
| 752 | 3300006048 | Ga0075363_100155764 | Ga0075363_1001557642 | 150 |
| 753 | 3300006163 | Ga0070715_10488284 | Ga0070715_104882841 | 150 |
| 754 | 3300006175 | Ga0070712_100004044 | Ga0070712_1000040445 | 150 |
| 755 | 3300006177 | Ga0075362_10018122 | Ga0075362_100181225 | 150 |
| 756 | 3300006178 | Ga0075367_10338816 | Ga0075367_103388162 | 150 |
| 757 | 3300006178 | Ga0075367_10506098 | Ga0075367_105060981 | 150 |
| 758 | 3300006186 | Ga0075369_10052877 | Ga0075369_100528772 | 150 |
| 759 | 3300006195 | Ga0075366_10407868 | Ga0075366_104078681 | 150 |
| 760 | 3300006353 | Ga0075370_10008196 | Ga0075370_100081965 | 150 |
| 761 | 3300006353 | Ga0075370_10023253 | Ga0075370_100232533 | 150 |
| 762 | 3300006353 | Ga0075370_10485829 | Ga0075370_104858292 | 150 |
| 763 | 3300006941 | Ga0099825_1017767 | Ga0099825_10177671 | 150 |
| 764 | 3300006944 | Ga0099823_1073607 | Ga0099823_10736072 | 150 |
| 765 | 3300007265 | Ga0099794_10031429 | Ga0099794_100314293 | 150 |
| 766 | 3300007265 | Ga0099794_10056118 | Ga0099794_100561182 | 150 |
| 767 | 3300007265 | Ga0099794_10089519 | Ga0099794_100895192 | 150 |
| 768 | 3300009093 | Ga0105240_10001503 | Ga0105240_1000150311 | 150 |
| 769 | 3300009093 | Ga0105240_10016530 | Ga0105240_100165302 | 150 |
| 770 | 3300009098 | Ga0105245_10542760 | Ga0105245_105427602 | 150 |
| 771 | 3300009101 | Ga0105247_10066343 | Ga0105247_100663432 | 150 |
| 772 | 3300009101 | Ga0105247_10226155 | Ga0105247_102261552 | 150 |
| 773 | 3300009148 | Ga0105243_10130020 | Ga0105243_101300203 | 150 |
| 774 | 3300009148 | Ga0105243_10957536 | Ga0105243_109575362 | 150 |
| 775 | 3300009174 | Ga0105241_10053195 | Ga0105241_100531951 | 150 |
| 776 | 3300009174 | Ga0105241_10148004 | Ga0105241_101480042 | 150 |
| 777 | 3300009174 | Ga0105241_11537246 | Ga0105241_115372461 | 150 |
| 778 | 3300009177 | Ga0105248_10770470 | Ga0105248_107704701 | 150 |
| 779 | 3300009545 | Ga0105237_10000992 | Ga0105237_100009925 | 150 |
| 780 | 3300009545 | Ga0105237_10027416 | Ga0105237_100274166 | 150 |
| 781 | 3300009545 | Ga0105237_10088594 | Ga0105237_100885942 | 150 |
| 782 | 3300009545 | Ga0105237_10697830 | Ga0105237_106978302 | 150 |
| 783 | 3300009545 | Ga0105237_11468357 | Ga0105237_114683571 | 150 |
| 784 | 3300009545 | Ga0105237_11623165 | Ga0105237_116231651 | 150 |
| 785 | 3300009551 | Ga0105238_10006181 | Ga0105238_100061812 | 150 |
| 786 | 3300009551 | Ga0105238_10021503 | Ga0105238_100215032 | 150 |
| 787 | 3300009551 | Ga0105238_10223374 | Ga0105238_102233742 | 150 |
| 788 | 3300009551 | Ga0105238_10437442 | Ga0105238_104374422 | 150 |
| 789 | 3300009551 | Ga0105238_10571380 | Ga0105238_105713802 | 150 |
| 790 | 3300009553 | Ga0105249_11796859 | Ga0105249_117968591 | 150 |
| 791 | 3300010159 | Ga0099796_10021669 | Ga0099796_100216692 | 150 |
| 792 | 3300010375 | Ga0105239_10085316 | Ga0105239_100853164 | 150 |
| 793 | 3300010375 | Ga0105239_10109518 | Ga0105239_101095185 | 150 |
| 794 | 3300010375 | Ga0105239_10148096 | Ga0105239_101480965 | 150 |
| 795 | 3300010375 | Ga0105239_10281988 | Ga0105239_102819883 | 150 |
| 796 | 3300010375 | Ga0105239_10471752 | Ga0105239_104717522 | 150 |
| 797 | 3300010375 | Ga0105239_11514191 | Ga0105239_115141911 | 150 |
| 798 | 3300011119 | Ga0105246_10087956 | Ga0105246_100879562 | 150 |
| 799 | 3300012503 | Ga0157313_1022216 | Ga0157313_10222161 | 150 |
| 800 | 3300013100 | Ga0157373_10485336 | Ga0157373_104853362 | 150 |
| 801 | 3300013102 | Ga0157371_10082815 | Ga0157371_100828152 | 150 |
| 802 | 3300013104 | Ga0157370_10039353 | Ga0157370_100393532 | 150 |
| 803 | 3300013104 | Ga0157370_10171349 | Ga0157370_101713492 | 150 |
| 804 | 3300013104 | Ga0157370_10192821 | Ga0157370_101928212 | 150 |
| 805 | 3300013105 | Ga0157369_10069789 | Ga0157369_100697894 | 150 |
| 806 | 3300013296 | Ga0157374_10329366 | Ga0157374_103293662 | 150 |
| 807 | 3300013296 | Ga0157374_10704225 | Ga0157374_107042251 | 150 |
| 808 | 3300013296 | Ga0157374_11506452 | Ga0157374_115064521 | 150 |
| 809 | 3300013297 | Ga0157378_13074177 | Ga0157378_130741771 | 150 |
| 810 | 3300013306 | Ga0163162_10512952 | Ga0163162_105129522 | 150 |
| 811 | 3300013307 | Ga0157372_10548140 | Ga0157372_105481402 | 150 |
| 812 | 3300013307 | Ga0157372_11647710 | Ga0157372_116477102 | 150 |
| 813 | 3300013308 | Ga0157375_12424288 | Ga0157375_124242881 | 150 |
| 814 | 3300014968 | Ga0157379_11020154 | Ga0157379_110201541 | 150 |
| 815 | 3300014969 | Ga0157376_10446629 | Ga0157376_104466292 | 150 |
| 816 | 3300020070 | Ga0206356_11465087 | Ga0206356_114650872 | 150 |
| 817 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006284 | 150 |
| 818 | 3300021321 | Ga0214542_1000002 | Ga0214542_100000291 | 150 |
| 819 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002628 | 150 |
| 820 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017231 | 150 |
| 821 | 3300021384 | Ga0213876_10214428 | Ga0213876_102144281 | 150 |
| 822 | 3300025230 | Ga0209563_101649 | Ga0209563_1016493 | 150 |
| 823 | 3300025250 | Ga0209026_1046629 | Ga0209026_10466291 | 150 |
| 824 | 3300025253 | Ga0209677_101107 | Ga0209677_10110710 | 150 |
| 825 | 3300025254 | Ga0209148_1002189 | Ga0209148_10021892 | 150 |
| 826 | 3300025258 | Ga0209129_1028842 | Ga0209129_10288421 | 150 |
| 827 | 3300025261 | Ga0209233_1033160 | Ga0209233_10331602 | 150 |
| 828 | 3300025272 | Ga0209455_1002740 | Ga0209455_10027405 | 150 |
| 829 | 3300025273 | Ga0209673_1016891 | Ga0209673_10168914 | 150 |
| 830 | 3300025290 | Ga0207673_1007965 | Ga0207673_10079651 | 150 |
| 831 | 3300025295 | Ga0209564_1005255 | Ga0209564_10052554 | 150 |
| 832 | 3300025295 | Ga0209564_1006163 | Ga0209564_10061637 | 150 |
| 833 | 3300025297 | Ga0209758_1000065 | Ga0209758_1000065169 | 150 |
| 834 | 3300025297 | Ga0209758_1000189 | Ga0209758_100018917 | 150 |
| 835 | 3300025297 | Ga0209758_1000827 | Ga0209758_100082715 | 150 |
| 836 | 3300025297 | Ga0209758_1029926 | Ga0209758_10299261 | 150 |
| 837 | 3300025297 | Ga0209758_1143917 | Ga0209758_11439171 | 150 |
| 838 | 3300025299 | Ga0209256_1008826 | Ga0209256_10088265 | 150 |
| 839 | 3300025302 | Ga0207426_1001072 | Ga0207426_100107214 | 150 |
| 840 | 3300025302 | Ga0207426_1010712 | Ga0207426_10107122 | 150 |
| 841 | 3300025302 | Ga0207426_1034300 | Ga0207426_10343002 | 150 |
| 842 | 3300025304 | Ga0209257_1000880 | Ga0209257_100088031 | 150 |
| 843 | 3300025304 | Ga0209257_1011496 | Ga0209257_10114962 | 150 |
| 844 | 3300025304 | Ga0209257_1078112 | Ga0209257_10781121 | 150 |
| 845 | 3300025315 | Ga0207697_10058042 | Ga0207697_100580422 | 150 |
| 846 | 3300025321 | Ga0207656_10006242 | Ga0207656_100062421 | 150 |
| 847 | 3300025898 | Ga0207692_10001866 | Ga0207692_100018666 | 150 |
| 848 | 3300025898 | Ga0207692_10566667 | Ga0207692_105666671 | 150 |
| 849 | 3300025900 | Ga0207710_10021204 | Ga0207710_100212043 | 150 |
| 850 | 3300025903 | Ga0207680_10526427 | Ga0207680_105264271 | 150 |
| 851 | 3300025904 | Ga0207647_10005547 | Ga0207647_100055473 | 150 |
| 852 | 3300025905 | Ga0207685_10087116 | Ga0207685_100871161 | 150 |
| 853 | 3300025909 | Ga0207705_10028471 | Ga0207705_100284714 | 150 |
| 854 | 3300025911 | Ga0207654_10306940 | Ga0207654_103069401 | 150 |
| 855 | 3300025912 | Ga0207707_10002655 | Ga0207707_100026555 | 150 |
| 856 | 3300025912 | Ga0207707_10016927 | Ga0207707_100169272 | 150 |
| 857 | 3300025913 | Ga0207695_10000159 | Ga0207695_1000015954 | 150 |
| 858 | 3300025913 | Ga0207695_10286538 | Ga0207695_102865382 | 150 |
| 859 | 3300025914 | Ga0207671_10003280 | Ga0207671_1000328010 | 150 |
| 860 | 3300025914 | Ga0207671_10028648 | Ga0207671_100286485 | 150 |
| 861 | 3300025914 | Ga0207671_10028952 | Ga0207671_100289521 | 150 |
| 862 | 3300025914 | Ga0207671_10659772 | Ga0207671_106597722 | 150 |
| 863 | 3300025915 | Ga0207693_10004666 | Ga0207693_1000466612 | 150 |
| 864 | 3300025916 | Ga0207663_10124262 | Ga0207663_101242621 | 150 |
| 865 | 3300025917 | Ga0207660_10028715 | Ga0207660_100287152 | 150 |
| 866 | 3300025917 | Ga0207660_10305830 | Ga0207660_103058302 | 150 |
| 867 | 3300025919 | Ga0207657_10004801 | Ga0207657_1000480111 | 150 |
| 868 | 3300025919 | Ga0207657_10104815 | Ga0207657_101048152 | 150 |
| 869 | 3300025919 | Ga0207657_10147172 | Ga0207657_101471722 | 150 |
| 870 | 3300025921 | Ga0207652_10002660 | Ga0207652_1000266011 | 150 |
| 871 | 3300025921 | Ga0207652_10009472 | Ga0207652_1000947210 | 150 |
| 872 | 3300025923 | Ga0207681_10112482 | Ga0207681_101124821 | 150 |
| 873 | 3300025924 | Ga0207694_10021788 | Ga0207694_100217885 | 150 |
| 874 | 3300025924 | Ga0207694_10798524 | Ga0207694_107985242 | 150 |
| 875 | 3300025928 | Ga0207700_10152741 | Ga0207700_101527413 | 150 |
| 876 | 3300025928 | Ga0207700_10179479 | Ga0207700_101794793 | 150 |
| 877 | 3300025931 | Ga0207644_10109590 | Ga0207644_101095903 | 150 |
| 878 | 3300025933 | Ga0207706_10042861 | Ga0207706_100428612 | 150 |
| 879 | 3300025939 | Ga0207665_10857639 | Ga0207665_108576391 | 150 |
| 880 | 3300025941 | Ga0207711_10453437 | Ga0207711_104534371 | 150 |
| 881 | 3300025942 | Ga0207689_10072067 | Ga0207689_100720672 | 150 |
| 882 | 3300025949 | Ga0207667_10005344 | Ga0207667_100053444 | 150 |
| 883 | 3300025949 | Ga0207667_10047821 | Ga0207667_100478214 | 150 |
| 884 | 3300025949 | Ga0207667_11077373 | Ga0207667_110773731 | 150 |
| 885 | 3300025949 | Ga0207667_11147246 | Ga0207667_111472461 | 150 |
| 886 | 3300025972 | Ga0207668_10529148 | Ga0207668_105291482 | 150 |
| 887 | 3300025981 | Ga0207640_10059077 | Ga0207640_100590772 | 150 |
| 888 | 3300025981 | Ga0207640_10231667 | Ga0207640_102316671 | 150 |
| 889 | 3300025981 | Ga0207640_10903903 | Ga0207640_109039031 | 150 |
| 890 | 3300025981 | Ga0207640_11201870 | Ga0207640_112018701 | 150 |
| 891 | 3300025986 | Ga0207658_11673137 | Ga0207658_116731371 | 150 |
| 892 | 3300026035 | Ga0207703_10586752 | Ga0207703_105867522 | 150 |
| 893 | 3300026041 | Ga0207639_10403732 | Ga0207639_104037321 | 150 |
| 894 | 3300026067 | Ga0207678_10016512 | Ga0207678_100165126 | 150 |
| 895 | 3300026067 | Ga0207678_10068837 | Ga0207678_100688373 | 150 |
| 896 | 3300026078 | Ga0207702_10284656 | Ga0207702_102846562 | 150 |
| 897 | 3300026089 | Ga0207648_10066931 | Ga0207648_100669314 | 150 |
| 898 | 3300026118 | Ga0207675_101774510 | Ga0207675_1017745101 | 150 |
| 899 | 3300026121 | Ga0207683_10170578 | Ga0207683_101705782 | 150 |
| 900 | 3300026142 | Ga0207698_10075603 | Ga0207698_100756032 | 150 |
| 901 | 3300026142 | Ga0207698_10319500 | Ga0207698_103195002 | 150 |
| 902 | 3300026142 | Ga0207698_10350996 | Ga0207698_103509962 | 150 |
| 903 | 3300027296 | Ga0209389_1000239 | Ga0209389_100023924 | 150 |
| 904 | 3300027296 | Ga0209389_1000690 | Ga0209389_10006906 | 150 |
| 905 | 3300027357 | Ga0209589_1007787 | Ga0209589_100778724 | 150 |
| 906 | 3300027361 | Ga0209489_100030 | Ga0209489_100030181 | 150 |
| 907 | 3300027361 | Ga0209489_114919 | Ga0209489_1149192 | 150 |
| 908 | 3300027363 | Ga0209700_100031 | Ga0209700_10003181 | 150 |
| 909 | 3300027512 | Ga0209179_1088166 | Ga0209179_10881661 | 150 |
| 910 | 3300027671 | Ga0209588_1019963 | Ga0209588_10199632 | 150 |
| 911 | 3300027671 | Ga0209588_1037246 | Ga0209588_10372462 | 150 |
| 912 | 3300027671 | Ga0209588_1042228 | Ga0209588_10422282 | 150 |
| 913 | 3300028379 | Ga0268266_10023098 | Ga0268266_100230982 | 150 |
| 914 | 3300028379 | Ga0268266_10296513 | Ga0268266_102965132 | 150 |
| 915 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035275 | 150 |
| 916 | 3300028786 | Ga0307517_10213233 | Ga0307517_102132331 | 150 |
| 917 | 3300031616 | Ga0307508_10000021 | Ga0307508_10000021144 | 150 |
| 918 | 3300031616 | Ga0307508_10064014 | Ga0307508_100640144 | 150 |
| 919 | 3300033180 | Ga0307510_10004554 | Ga0307510_100045544 | 150 |
| 920 | 3300033180 | Ga0307510_10050493 | Ga0307510_100504932 | 150 |
| 921 | 3300033180 | Ga0307510_10170185 | Ga0307510_101701851 | 150 |
| 922 | 3300035083 | Ga0373926_0035223 | Ga0373926_0035223_517_978 | 150 |
| 923 | 3300035111 | Ga0373923_0089414 | Ga0373923_0089414_65_520 | 150 |
| 924 | 3300035113 | Ga0373936_0009414 | Ga0373936_0009414_1629_2084 | 150 |
| 925 | 3300035113 | Ga0373936_0021916 | Ga0373936_0021916_963_1424 | 150 |
| 926 | 3300035113 | Ga0373936_0054989 | Ga0373936_0054989_547_1008 | 150 |
| 927 | 3300035118 | Ga0373954_0175369 | Ga0373954_0175369_503_958 | 150 |
| 928 | 3300035118 | Ga0373954_0567197 | Ga0373954_0567197_86_541 | 150 |
| 929 | 3300035170 | Ga0373943_0353506 | Ga0373943_0353506_200_655 | 150 |
| 930 | 3300035398 | Ga0316574_0003983 | Ga0316574_0003983_6910_7371 | 150 |
| 931 | 3300035692 | Ga0373935_0042994 | Ga0373935_0042994_1548_2009 | 150 |
| 932 | 3300035695 | Ga0373927_0105328 | Ga0373927_0105328_367_828 | 150 |
| 933 | 3300035695 | Ga0373927_0517242 | Ga0373927_0517242_206_682 | 150 |
| 934 | 3300035724 | Ga0373933_0001657 | Ga0373933_0001657_4250_4705 | 150 |
| 935 | 3300035725 | Ga0373947_0096218 | Ga0373947_0096218_313_768 | 150 |
| 936 | 3300036401 | Ga0373937_0291711 | Ga0373937_0291711_874_1329 | 150 |
| 937 | 3300036458 | Ga0310112_022182 | Ga0310112_022182_392_847 | 150 |
| 938 | 3300037068 | Ga0373925_0089000 | Ga0373925_0089000_716_1177 | 150 |
| 939 | 3300037068 | Ga0373925_0459540 | Ga0373925_0459540_377_838 | 150 |
| 940 | 3300037312 | Ga0395899_0136972 | Ga0395899_0136972_874_1329 | 150 |
| 941 | 3300037418 | Ga0395900_0002922 | Ga0395900_0002922_4399_4854 | 150 |
| 942 | 3300037418 | Ga0395900_0132417 | Ga0395900_0132417_1953_2408 | 150 |
| 943 | 3300037466 | Ga0395898_0089582 | Ga0395898_0089582_346_801 | 150 |
| 944 | 3300037466 | Ga0395898_0234317 | Ga0395898_0234317_229_684 | 150 |
| 945 | 3300037471 | Ga0395905_0008568 | Ga0395905_0008568_5952_6407 | 150 |
| 946 | 3300037471 | Ga0395905_0349329 | Ga0395905_0349329_283_738 | 150 |
| 947 | 3300037471 | Ga0395905_0459564 | Ga0395905_0459564_527_982 | 150 |
| 948 | 3300039437 | Ga0436365_0712770 | Ga0436365_0712770_93_554 | 150 |
| 949 | 3300039437 | Ga0436365_1801845 | Ga0436365_1801845_74_535 | 150 |
| 950 | 3300041443 | Ga0451789_0121782 | Ga0451789_0121782_99_554 | 150 |
| 951 | 3300041456 | Ga0451795_0381612 | Ga0451795_0381612_31_486 | 150 |
| 952 | 3300041492 | Ga0451835_0222244 | Ga0451835_0222244_21_476 | 150 |
| 953 | 3300041496 | Ga0451839_0641073 | Ga0451839_0641073_133_588 | 150 |
| 954 | 3300041498 | Ga0451841_1338321 | Ga0451841_1338321_586_1041 | 150 |
| 955 | 3300041509 | Ga0451843_1523113 | Ga0451843_1523113_282_737 | 150 |
| 956 | 3300041512 | Ga0451853_4040531 | Ga0451853_4040531_696_1151 | 150 |
| 957 | 3300044658 | Ga0466972_0129894 | Ga0466972_0129894_286_741 | 150 |
| 958 | 3300044658 | Ga0466972_0139446 | Ga0466972_0139446_545_1000 | 150 |
| 959 | 3300044683 | Ga0466965_0077020 | Ga0466965_0077020_714_1169 | 150 |
| 960 | 3300044684 | Ga0466966_0000521 | Ga0466966_0000521_18225_18680 | 150 |
| 961 | 3300044693 | Ga0466961_0000366 | Ga0466961_0000366_10658_11113 | 150 |
| 962 | 3300044694 | Ga0466963_0004594 | Ga0466963_0004594_2533_2988 | 150 |
| 963 | 3300044694 | Ga0466963_0037426 | Ga0466963_0037426_1246_1707 | 150 |
| 964 | 3300044694 | Ga0466963_0090700 | Ga0466963_0090700_1184_1639 | 150 |
| 965 | 3300044719 | Ga0466971_0077492 | Ga0466971_0077492_793_1248 | 150 |
| 966 | 3300044735 | Ga0466968_0004579 | Ga0466968_0004579_2872_3327 | 150 |
| 967 | 3300044842 | Ga0466957_0269357 | Ga0466957_0269357_616_1077 | 150 |
| 968 | 3300044901 | Ga0466960_0007406 | Ga0466960_0007406_815_1270 | 150 |
| 969 | 3300044901 | Ga0466960_0089529 | Ga0466960_0089529_589_1044 | 150 |
| 970 | 3300044901 | Ga0466960_0095256 | Ga0466960_0095256_622_1077 | 150 |
| 971 | 3300044901 | Ga0466960_0199971 | Ga0466960_0199971_601_1056 | 150 |
| 972 | 3300045049 | Ga0466959_0002745 | Ga0466959_0002745_5329_5784 | 150 |
| 973 | 3300045976 | Ga0466967_0047144 | Ga0466967_0047144_2690_3145 | 150 |
| 974 | 3300045976 | Ga0466967_0047422 | Ga0466967_0047422_909_1370 | 150 |
| 975 | 3300045976 | Ga0466967_0348932 | Ga0466967_0348932_928_1389 | 150 |
| 976 | 3300046454 | Ga0495592_0122341 | Ga0495592_0122341_747_1208 | 150 |
| 977 | 3300046455 | Ga0495603_0151972 | Ga0495603_0151972_527_982 | 150 |
| 978 | 3300046457 | Ga0495590_0052445 | Ga0495590_0052445_575_1030 | 150 |
| 979 | 3300046459 | Ga0495629_0040426 | Ga0495629_0040426_1185_1640 | 150 |
| 980 | 3300046459 | Ga0495629_0198898 | Ga0495629_0198898_86_547 | 150 |
| 981 | 3300046460 | Ga0495638_0039683 | Ga0495638_0039683_1826_2281 | 150 |
| 982 | 3300046461 | Ga0495641_0041537 | Ga0495641_0041537_1504_1959 | 150 |
| 983 | 3300046462 | Ga0495651_0271890 | Ga0495651_0271890_281_736 | 150 |
| 984 | 3300046463 | Ga0495653_0073351 | Ga0495653_0073351_1317_1772 | 150 |
| 985 | 3300046463 | Ga0495653_0545348 | Ga0495653_0545348_240_695 | 150 |
| 986 | 3300046471 | Ga0495650_0100364 | Ga0495650_0100364_530_985 | 150 |
| 987 | 3300046472 | Ga0495580_0085055 | Ga0495580_0085055_186_641 | 150 |
| 988 | 3300046473 | Ga0495582_0165820 | Ga0495582_0165820_233_688 | 150 |
| 989 | 3300046474 | Ga0495605_0080479 | Ga0495605_0080479_27_482 | 150 |
| 990 | 3300046474 | Ga0495605_0134196 | Ga0495605_0134196_571_1026 | 150 |
| 991 | 3300046477 | Ga0495664_0010508 | Ga0495664_0010508_4046_4507 | 150 |
| 992 | 3300046477 | Ga0495664_0177913 | Ga0495664_0177913_297_752 | 150 |
| 993 | 3300046477 | Ga0495664_0393443 | Ga0495664_0393443_19_474 | 150 |
| 994 | 3300046499 | Ga0495594_0005644 | Ga0495594_0005644_5641_6096 | 150 |
| 995 | 3300046501 | Ga0495607_0185056 | Ga0495607_0185056_20_475 | 150 |
| 996 | 3300046501 | Ga0495607_0358055 | Ga0495607_0358055_195_650 | 150 |
| 997 | 3300046507 | Ga0495606_0072551 | Ga0495606_0072551_1332_1787 | 150 |
| 998 | 3300046507 | Ga0495606_0116087 | Ga0495606_0116087_196_651 | 150 |
| 999 | 3300046507 | Ga0495606_0188096 | Ga0495606_0188096_618_1073 | 150 |
| 1000 | 3300046511 | Ga0495608_0304897 | Ga0495608_0304897_373_828 | 150 |
| 1001 | 3300046511 | Ga0495608_0603768 | Ga0495608_0603768_50_505 | 150 |
| 1002 | 3300046512 | Ga0495610_0038221 | Ga0495610_0038221_1396_1851 | 150 |
| 1003 | 3300046512 | Ga0495610_0055240 | Ga0495610_0055240_618_1073 | 150 |
| 1004 | 3300046513 | Ga0495616_0400790 | Ga0495616_0400790_46_501 | 150 |
| 1005 | 3300046515 | Ga0495620_0167890 | Ga0495620_0167890_182_637 | 150 |
| 1006 | 3300046515 | Ga0495620_0313412 | Ga0495620_0313412_98_553 | 150 |
| 1007 | 3300046516 | Ga0495628_0033673 | Ga0495628_0033673_2283_2738 | 150 |
| 1008 | 3300046516 | Ga0495628_0852568 | Ga0495628_0852568_25_480 | 150 |
| 1009 | 3300046516 | Ga0495628_0977645 | Ga0495628_0977645_45_506 | 150 |
| 1010 | 3300046522 | Ga0495643_0090510 | Ga0495643_0090510_421_876 | 150 |
| 1011 | 3300046522 | Ga0495643_0189186 | Ga0495643_0189186_111_566 | 150 |
| 1012 | 3300046522 | Ga0495643_0269994 | Ga0495643_0269994_129_584 | 150 |
| 1013 | 3300046524 | Ga0495648_0002079 | Ga0495648_0002079_14469_14924 | 150 |
| 1014 | 3300046524 | Ga0495648_0004572 | Ga0495648_0004572_11297_11752 | 150 |
| 1015 | 3300046524 | Ga0495648_0039173 | Ga0495648_0039173_2367_2822 | 150 |
| 1016 | 3300046526 | Ga0495666_0022190 | Ga0495666_0022190_270_725 | 150 |
| 1017 | 3300046529 | Ga0495652_0037254 | Ga0495652_0037254_1352_1807 | 150 |
| 1018 | 3300046529 | Ga0495652_0120252 | Ga0495652_0120252_1505_1960 | 150 |
| 1019 | 3300046531 | Ga0495665_0007540 | Ga0495665_0007540_3594_4055 | 150 |
| 1020 | 3300046533 | Ga0495640_0039904 | Ga0495640_0039904_1166_1621 | 150 |
| 1021 | 3300046533 | Ga0495640_0505508 | Ga0495640_0505508_240_695 | 150 |
| 1022 | 3300046536 | Ga0495587_0004094 | Ga0495587_0004094_7612_8067 | 150 |
| 1023 | 3300046538 | Ga0495609_0033230 | Ga0495609_0033230_593_1048 | 150 |
| 1024 | 3300046538 | Ga0495609_0132198 | Ga0495609_0132198_377_832 | 150 |
| 1025 | 3300046542 | Ga0495597_0298355 | Ga0495597_0298355_143_598 | 150 |
| 1026 | 3300046557 | Ga0495622_0026565 | Ga0495622_0026565_1166_1621 | 150 |
| 1027 | 3300046557 | Ga0495622_0182664 | Ga0495622_0182664_256_711 | 150 |
| 1028 | 3300046559 | Ga0495667_0187515 | Ga0495667_0187515_842_1297 | 150 |
| 1029 | 3300046559 | Ga0495667_0273924 | Ga0495667_0273924_594_1049 | 150 |
| 1030 | 3300046616 | Ga0495668_0136803 | Ga0495668_0136803_294_749 | 150 |
| 1031 | 3300046616 | Ga0495668_0210384 | Ga0495668_0210384_390_845 | 150 |
| 1032 | 3300046642 | Ga0495634_0001188 | Ga0495634_0001188_20405_20860 | 150 |
| 1033 | 3300046642 | Ga0495634_0019165 | Ga0495634_0019165_3561_4016 | 150 |
| 1034 | 3300046642 | Ga0495634_0110244 | Ga0495634_0110244_416_877 | 150 |
| 1035 | 3300046648 | Ga0495611_0108056 | Ga0495611_0108056_22_477 | 150 |
| 1036 | 3300046648 | Ga0495611_0179006 | Ga0495611_0179006_486_941 | 150 |
| 1037 | 3300046648 | Ga0495611_0458921 | Ga0495611_0458921_107_562 | 150 |
| 1038 | 3300046660 | Ga0495625_0029775 | Ga0495625_0029775_1855_2310 | 150 |
| 1039 | 3300046660 | Ga0495625_0072992 | Ga0495625_0072992_807_1262 | 150 |
| 1040 | 3300046663 | Ga0495635_0002199 | Ga0495635_0002199_4798_5253 | 150 |
| 1041 | 3300046663 | Ga0495635_0116416 | Ga0495635_0116416_1185_1640 | 150 |
| 1042 | 3300046663 | Ga0495635_0162458 | Ga0495635_0162458_998_1453 | 150 |
| 1043 | 3300046665 | Ga0495661_0071787 | Ga0495661_0071787_1211_1666 | 150 |
| 1044 | 3300046674 | Ga0495588_0362169 | Ga0495588_0362169_274_729 | 150 |
| 1045 | 3300046675 | Ga0495657_0011029 | Ga0495657_0011029_676_1131 | 150 |
| 1046 | 3300046675 | Ga0495657_0157896 | Ga0495657_0157896_132_587 | 150 |
| 1047 | 3300046678 | Ga0495599_0020333 | Ga0495599_0020333_529_984 | 150 |
| 1048 | 3300046679 | Ga0495623_0555467 | Ga0495623_0555467_56_511 | 150 |
| 1049 | 3300046680 | Ga0495646_0039825 | Ga0495646_0039825_1309_1764 | 150 |
| 1050 | 3300046680 | Ga0495646_0132636 | Ga0495646_0132636_51_506 | 150 |
| 1051 | 3300046681 | Ga0495647_0556716 | Ga0495647_0556716_41_502 | 150 |
| 1052 | 3300046683 | Ga0495658_0199940 | Ga0495658_0199940_86_547 | 150 |
| 1053 | 3300046689 | Ga0495613_0074319 | Ga0495613_0074319_1297_1752 | 150 |
| 1054 | 3300046689 | Ga0495613_0093058 | Ga0495613_0093058_1063_1518 | 150 |
| 1055 | 3300046690 | Ga0495624_0021125 | Ga0495624_0021125_1837_2292 | 150 |
| 1056 | 3300046690 | Ga0495624_0057274 | Ga0495624_0057274_1083_1538 | 150 |
| 1057 | 3300046690 | Ga0495624_0157983 | Ga0495624_0157983_455_916 | 150 |
| 1058 | 3300046692 | Ga0495671_0052466 | Ga0495671_0052466_1482_1937 | 150 |
| 1059 | 3300046694 | Ga0495649_0032184 | Ga0495649_0032184_2073_2528 | 150 |
| 1060 | 3300046794 | Ga0495589_0102933 | Ga0495589_0102933_172_627 | 150 |
| 1061 | 3300046809 | Ga0495600_0012798 | Ga0495600_0012798_1934_2389 | 150 |
| 1062 | 3300046810 | Ga0495660_0213481 | Ga0495660_0213481_12_467 | 150 |
| 1063 | 3300047315 | Ga0495581_0000567 | Ga0495581_0000567_8899_9354 | 150 |
| 1064 | 3300047315 | Ga0495581_0051284 | Ga0495581_0051284_1027_1482 | 150 |
| 1065 | 3300047315 | Ga0495581_0206547 | Ga0495581_0206547_41_496 | 150 |
| 1066 | 3300047317 | Ga0495604_0002274 | Ga0495604_0002274_13384_13839 | 150 |
| 1067 | 3300047317 | Ga0495604_0043562 | Ga0495604_0043562_2090_2545 | 150 |
| 1068 | 3300047319 | Ga0495674_0313960 | Ga0495674_0313960_553_1008 | 150 |
| 1069 | 3300047320 | Ga0495672_0076176 | Ga0495672_0076176_871_1326 | 150 |
| 1070 | 3300047321 | Ga0495676_0161119 | Ga0495676_0161119_364_819 | 150 |
| 1071 | 3300047322 | Ga0495680_0001595 | Ga0495680_0001595_16317_16772 | 150 |
| 1072 | 3300047323 | Ga0495683_0215273 | Ga0495683_0215273_138_593 | 150 |
| 1073 | 3300047443 | Ga0495687_017339 | Ga0495687_017339_2841_3296 | 150 |
| 1074 | 3300047443 | Ga0495687_063407 | Ga0495687_063407_199_654 | 150 |
| 1075 | 3300047444 | Ga0495675_0017231 | Ga0495675_0017231_2182_2637 | 150 |
| 1076 | 3300047469 | Ga0495673_0021326 | Ga0495673_0021326_1645_2100 | 150 |
| 1077 | 3300047469 | Ga0495673_0058341 | Ga0495673_0058341_685_1140 | 150 |
| 1078 | 3300047469 | Ga0495673_0134074 | Ga0495673_0134074_483_938 | 150 |
| 1079 | 3300047471 | Ga0495684_0100756 | Ga0495684_0100756_122_577 | 150 |
| 1080 | 3300047673 | Ga0495593_0013868 | Ga0495593_0013868_1948_2403 | 150 |
| 1081 | 3300047673 | Ga0495593_0047886 | Ga0495593_0047886_1597_2052 | 150 |
| 1082 | 3300047673 | Ga0495593_0079851 | Ga0495593_0079851_251_712 | 150 |
| 1083 | 3300048088 | Ga0495602_0037408 | Ga0495602_0037408_2678_3133 | 150 |
| 1084 | 3300048088 | Ga0495602_0273637 | Ga0495602_0273637_248_703 | 150 |
| 1085 | 3300048904 | Ga0496101_0096933 | Ga0496101_0096933_1661_2137 | 150 |
| 1086 | 3300048904 | Ga0496101_0185444 | Ga0496101_0185444_817_1272 | 150 |
| 1087 | 3300048905 | Ga0496102_0012642 | Ga0496102_0012642_5380_5835 | 150 |
| 1088 | 3300048905 | Ga0496102_0197915 | Ga0496102_0197915_977_1453 | 150 |
| 1089 | 3300048905 | Ga0496102_0267429 | Ga0496102_0267429_493_954 | 150 |
| 1090 | 3300048905 | Ga0496102_0292351 | Ga0496102_0292351_361_816 | 150 |
| 1091 | 3300048905 | Ga0496102_0673079 | Ga0496102_0673079_487_942 | 150 |
| 1092 | 3300048905 | Ga0496102_1017614 | Ga0496102_1017614_204_686 | 150 |
| 1093 | 3300048906 | Ga0496103_0038684 | Ga0496103_0038684_557_1012 | 150 |
| 1094 | 3300048906 | Ga0496103_0052051 | Ga0496103_0052051_966_1421 | 150 |
| 1095 | 3300048907 | Ga0496104_0020012 | Ga0496104_0020012_3923_4378 | 150 |
| 1096 | 3300048907 | Ga0496104_0035023 | Ga0496104_0035023_1200_1676 | 150 |
| 1097 | 3300048907 | Ga0496104_0058432 | Ga0496104_0058432_2879_3334 | 150 |
| 1098 | 3300048907 | Ga0496104_0059878 | Ga0496104_0059878_1788_2243 | 150 |
| 1099 | 3300048907 | Ga0496104_0154652 | Ga0496104_0154652_1685_2140 | 150 |
| 1100 | 3300048907 | Ga0496104_0307686 | Ga0496104_0307686_11_466 | 150 |
| 1101 | 3300048907 | Ga0496104_1336276 | Ga0496104_1336276_70_543 | 150 |
| 1102 | 3300048908 | Ga0496105_0201571 | Ga0496105_0201571_704_1159 | 150 |
| 1103 | 3300048909 | Ga0496106_0000501 | Ga0496106_0000501_14201_14677 | 150 |
| 1104 | 3300048909 | Ga0496106_0251014 | Ga0496106_0251014_426_881 | 150 |
| 1105 | 3300048910 | Ga0496107_0006040 | Ga0496107_0006040_4079_4555 | 150 |
| 1106 | 3300048910 | Ga0496107_0068556 | Ga0496107_0068556_882_1337 | 150 |
| 1107 | 3300048911 | Ga0496108_0024615 | Ga0496108_0024615_2033_2509 | 150 |
| 1108 | 3300048911 | Ga0496108_0204531 | Ga0496108_0204531_173_628 | 150 |
| 1109 | 3300048912 | Ga0496109_0000607 | Ga0496109_0000607_13760_14236 | 150 |
| 1110 | 3300048912 | Ga0496109_0067975 | Ga0496109_0067975_1119_1574 | 150 |
| 1111 | 3300048912 | Ga0496109_0493161 | Ga0496109_0493161_180_635 | 150 |
| 1112 | 3300048913 | Ga0496110_0060742 | Ga0496110_0060742_1854_2330 | 150 |
| 1113 | 3300048913 | Ga0496110_0145032 | Ga0496110_0145032_428_883 | 150 |
| 1114 | 3300048913 | Ga0496110_0174904 | Ga0496110_0174904_55_510 | 150 |
| 1115 | 3300048914 | Ga0496111_0078080 | Ga0496111_0078080_849_1325 | 150 |
| 1116 | 3300048914 | Ga0496111_0166319 | Ga0496111_0166319_1089_1544 | 150 |
| 1117 | 3300048914 | Ga0496111_0497553 | Ga0496111_0497553_124_579 | 150 |
| 1118 | 3300048915 | Ga0496112_0025348 | Ga0496112_0025348_2691_3146 | 150 |
| 1119 | 3300048915 | Ga0496112_0065599 | Ga0496112_0065599_484_960 | 150 |
| 1120 | 3300048915 | Ga0496112_0075320 | Ga0496112_0075320_117_572 | 150 |
| 1121 | 3300048916 | Ga0496113_0016846 | Ga0496113_0016846_3322_3798 | 150 |
| 1122 | 3300048916 | Ga0496113_0079460 | Ga0496113_0079460_1805_2260 | 150 |
| 1123 | 3300048916 | Ga0496113_0217859 | Ga0496113_0217859_429_884 | 150 |
| 1124 | 3300048916 | Ga0496113_0811150 | Ga0496113_0811150_223_678 | 150 |
| 1125 | 3300048917 | Ga0496114_0083854 | Ga0496114_0083854_370_825 | 150 |
| 1126 | 3300048918 | Ga0496115_0038929 | Ga0496115_0038929_1504_1959 | 150 |
| 1127 | 3300048919 | Ga0496116_0062801 | Ga0496116_0062801_1678_2133 | 150 |
| 1128 | 3300048920 | Ga0496117_0210526 | Ga0496117_0210526_613_1068 | 150 |
| 1129 | 3300048921 | Ga0496118_0021216 | Ga0496118_0021216_25_480 | 150 |
| 1130 | 3300048921 | Ga0496118_0062071 | Ga0496118_0062071_995_1450 | 150 |
| 1131 | 3300048922 | Ga0496119_0026902 | Ga0496119_0026902_300_755 | 150 |
| 1132 | 3300048923 | Ga0496120_0029823 | Ga0496120_0029823_1710_2165 | 150 |
| 1133 | 3300048924 | Ga0496121_0000330 | Ga0496121_0000330_49400_49855 | 150 |
| 1134 | 3300048924 | Ga0496121_0026502 | Ga0496121_0026502_965_1438 | 150 |
| 1135 | 3300048924 | Ga0496121_0089878 | Ga0496121_0089878_352_807 | 150 |
| 1136 | 3300048924 | Ga0496121_0100440 | Ga0496121_0100440_793_1248 | 150 |
| 1137 | 3300048924 | Ga0496121_0431633 | Ga0496121_0431633_251_706 | 150 |
| 1138 | 3300048925 | Ga0496122_0267490 | Ga0496122_0267490_444_899 | 150 |
| 1139 | 3300048926 | Ga0496123_0124220 | Ga0496123_0124220_369_824 | 150 |
| 1140 | 3300048927 | Ga0496124_0104798 | Ga0496124_0104798_715_1170 | 150 |
| 1141 | 3300048927 | Ga0496124_0285506 | Ga0496124_0285506_75_530 | 150 |
| 1142 | 3300048928 | Ga0496125_0216754 | Ga0496125_0216754_681_1136 | 150 |
| 1143 | 3300048929 | Ga0496126_0024368 | Ga0496126_0024368_4184_4657 | 150 |
| 1144 | 3300048929 | Ga0496126_0040306 | Ga0496126_0040306_1910_2365 | 150 |
| 1145 | 3300048929 | Ga0496126_0086989 | Ga0496126_0086989_482_943 | 150 |
| 1146 | 3300048929 | Ga0496126_0316341 | Ga0496126_0316341_476_931 | 150 |
| 1147 | 3300049460 | Ga0495682_0049957 | Ga0495682_0049957_383_838 | 150 |
| 1148 | 3300049460 | Ga0495682_0058061 | Ga0495682_0058061_468_923 | 150 |
| 1149 | 3300049568 | Ga0501031_0013113 | Ga0501031_0013113_3565_4023 | 150 |
| 1150 | 3300049569 | Ga0501032_0004449 | Ga0501032_0004449_3542_4000 | 150 |
| 1151 | 3300049570 | Ga0501033_0001618 | Ga0501033_0001618_14363_14821 | 150 |
| 1152 | 3300049571 | Ga0501034_0000061 | Ga0501034_0000061_125845_126303 | 150 |
| 1153 | 3300049572 | Ga0501036_0000054 | Ga0501036_0000054_68767_69225 | 150 |
| 1154 | 3300049573 | Ga0501037_0000093 | Ga0501037_0000093_68407_68865 | 150 |
| 1155 | 3300049574 | Ga0501038_0000066 | Ga0501038_0000066_57286_57744 | 150 |
| 1156 | 3300049575 | Ga0501039_0019038 | Ga0501039_0019038_2728_3186 | 150 |
| 1157 | 3300049578 | Ga0501042_0286335 | Ga0501042_0286335_581_1039 | 150 |
| 1158 | 3300049579 | Ga0501043_0000325 | Ga0501043_0000325_14090_14548 | 150 |
| 1159 | 3300049580 | Ga0501046_0005977 | Ga0501046_0005977_5219_5677 | 150 |
| 1160 | 3300049580 | Ga0501046_0083668 | Ga0501046_0083668_1020_1493 | 150 |
| 1161 | 3300049581 | Ga0501047_0000621 | Ga0501047_0000621_12576_13034 | 150 |
| 1162 | 3300049581 | Ga0501047_0170642 | Ga0501047_0170642_929_1402 | 150 |
| 1163 | 3300049582 | Ga0501048_0001552 | Ga0501048_0001552_16956_17414 | 150 |
| 1164 | 3300049583 | Ga0501067_0000118 | Ga0501067_0000118_29326_29784 | 150 |
| 1165 | 3300049584 | Ga0501068_0000133 | Ga0501068_0000133_10623_11081 | 150 |
| 1166 | 3300049585 | Ga0501069_0053678 | Ga0501069_0053678_1229_1687 | 150 |
| 1167 | 3300049586 | Ga0501070_0002284 | Ga0501070_0002284_15457_15915 | 150 |
| 1168 | 3300049586 | Ga0501070_0055812 | Ga0501070_0055812_1995_2468 | 150 |
| 1169 | 3300049586 | Ga0501070_0337718 | Ga0501070_0337718_72_527 | 150 |
| 1170 | 3300049588 | Ga0501072_0014489 | Ga0501072_0014489_2992_3450 | 150 |
| 1171 | 3300049588 | Ga0501072_0620804 | Ga0501072_0620804_356_814 | 150 |
| 1172 | 3300049589 | Ga0501073_0002382 | Ga0501073_0002382_7988_8446 | 150 |
| 1173 | 3300049589 | Ga0501073_0104843 | Ga0501073_0104843_867_1340 | 150 |
| 1174 | 3300049590 | Ga0501074_0001116 | Ga0501074_0001116_9170_9628 | 150 |
| 1175 | 3300049590 | Ga0501074_0082760 | Ga0501074_0082760_977_1450 | 150 |
| 1176 | 3300049592 | Ga0501076_0159682 | Ga0501076_0159682_916_1374 | 150 |
| 1177 | 3300049741 | Ga0501079_0001682 | Ga0501079_0001682_681_1139 | 150 |
| 1178 | 3300049742 | Ga0501080_0001100 | Ga0501080_0001100_8583_9041 | 150 |
| 1179 | 3300049742 | Ga0501080_0128269 | Ga0501080_0128269_973_1446 | 150 |
| 1180 | 3300049744 | Ga0501083_0000331 | Ga0501083_0000331_6532_6990 | 150 |
| 1181 | 3300049744 | Ga0501083_0401067 | Ga0501083_0401067_315_788 | 150 |
| 1182 | 3300049822 | Ga0501035_0000099 | Ga0501035_0000099_104104_104562 | 150 |
| 1183 | 3300049822 | Ga0501035_0214243 | Ga0501035_0214243_559_1032 | 150 |
| 1184 | 3300049822 | Ga0501035_0333208 | Ga0501035_0333208_503_958 | 150 |
| 1185 | 3300049823 | Ga0501044_0000367 | Ga0501044_0000367_27591_28049 | 150 |
| 1186 | 3300049823 | Ga0501044_0154101 | Ga0501044_0154101_871_1344 | 150 |
| 1187 | 3300049824 | Ga0501045_0088929 | Ga0501045_0088929_698_1156 | 150 |
| 1188 | 3300050489 | nmdc:mga03683_143257_c1 | nmdc:mga03683_143257_c1_519_974 | 150 |
| 1189 | 3300050491 | nmdc:mga00v17_45090_c1 | nmdc:mga00v17_45090_c1_612_1067 | 150 |
| 1190 | 3300050492 | nmdc:mga0yw44_361482_c1 | nmdc:mga0yw44_361482_c1_385_840 | 150 |
| 1191 | 3300050492 | nmdc:mga0yw44_574553_c1 | nmdc:mga0yw44_574553_c1_251_706 | 150 |
| 1192 | 3300050492 | nmdc:mga0yw44_617652_c1 | nmdc:mga0yw44_617652_c1_154_609 | 150 |
| 1193 | 3300050492 | nmdc:mga0yw44_77229_c1 | nmdc:mga0yw44_77229_c1_772_1227 | 150 |
| 1194 | 3300050493 | nmdc:mga0k408_265081_c1 | nmdc:mga0k408_265081_c1_556_1011 | 150 |
| 1195 | 3300050493 | nmdc:mga0k408_66493_c1 | nmdc:mga0k408_66493_c1_852_1307 | 150 |
| 1196 | 3300050494 | nmdc:mga06z11_67849_c1 | nmdc:mga06z11_67849_c1_130_585 | 150 |
| 1197 | 3300050496 | nmdc:mga07m45_258218_c1 | nmdc:mga07m45_258218_c1_430_885 | 150 |
| 1198 | 3300050496 | nmdc:mga07m45_268193_c1 | nmdc:mga07m45_268193_c1_265_720 | 150 |
| 1199 | 3300050496 | nmdc:mga07m45_89974_c1 | nmdc:mga07m45_89974_c1_639_1094 | 150 |
| 1200 | 3300053077 | Ga0495601_0169277 | Ga0495601_0169277_661_1116 | 150 |
| 1201 | 3300053078 | Ga0495612_0026231 | Ga0495612_0026231_915_1376 | 150 |
| 1202 | 3300053078 | Ga0495612_0114142 | Ga0495612_0114142_65_520 | 150 |
| 1203 | 3300053078 | Ga0495612_0118165 | Ga0495612_0118165_197_652 | 150 |
| 1204 | 3300053079 | Ga0500610_0096060 | Ga0500610_0096060_516_971 | 150 |
| 1205 | 3300053080 | Ga0500635_0017606 | Ga0500635_0017606_240_695 | 150 |
| 1206 | 3300053083 | Ga0495655_0003985 | Ga0495655_0003985_348_803 | 150 |
| 1207 | 3300053085 | Ga0495619_0036177 | Ga0495619_0036177_947_1402 | 150 |
| 1208 | 3300053086 | Ga0500578_0081750 | Ga0500578_0081750_1117_1572 | 150 |
| 1209 | 3300053087 | Ga0500643_000040 | Ga0500643_000040_166299_166754 | 150 |
| 1210 | 3300053088 | Ga0500644_0082590 | Ga0500644_0082590_611_1066 | 150 |
| 1211 | 3300053090 | Ga0500646_0077478 | Ga0500646_0077478_59_514 | 150 |
| 1212 | 3300053091 | Ga0500647_0105909 | Ga0500647_0105909_207_668 | 150 |
| 1213 | 3300053093 | Ga0500651_0109234 | Ga0500651_0109234_825_1280 | 150 |
| 1214 | 3300053093 | Ga0500651_0302201 | Ga0500651_0302201_442_897 | 150 |
| 1215 | 3300053094 | Ga0500566_0000020 | Ga0500566_0000020_13788_14249 | 150 |
| 1216 | 3300053094 | Ga0500566_0000230 | Ga0500566_0000230_11296_11760 | 150 |
| 1217 | 3300053094 | Ga0500566_0106566 | Ga0500566_0106566_787_1242 | 150 |
| 1218 | 3300053095 | Ga0500640_000021 | Ga0500640_000021_12789_13250 | 150 |
| 1219 | 3300053095 | Ga0500640_052451 | Ga0500640_052451_197_652 | 150 |
| 1220 | 3300053098 | Ga0500650_0158756 | Ga0500650_0158756_156_611 | 150 |
| 1221 | 3300053102 | Ga0500554_014125 | Ga0500554_014125_1344_1799 | 150 |
| 1222 | 3300053103 | Ga0500555_002003 | Ga0500555_002003_3634_4089 | 150 |
| 1223 | 3300053104 | Ga0500556_0033670 | Ga0500556_0033670_855_1310 | 150 |
| 1224 | 3300053105 | Ga0500557_000063 | Ga0500557_000063_3629_4084 | 150 |
| 1225 | 3300053108 | Ga0500562_006548 | Ga0500562_006548_91_546 | 150 |
| 1226 | 3300053109 | Ga0500569_035310 | Ga0500569_035310_588_1043 | 150 |
| 1227 | 3300053111 | Ga0500572_000068 | Ga0500572_000068_17864_18325 | 150 |
| 1228 | 3300053111 | Ga0500572_228047 | Ga0500572_228047_24_479 | 150 |
| 1229 | 3300053115 | Ga0500591_041240 | Ga0500591_041240_1627_2088 | 150 |
| 1230 | 3300053116 | Ga0500592_004040 | Ga0500592_004040_1409_1864 | 150 |
| 1231 | 3300053119 | Ga0500595_002807 | Ga0500595_002807_5118_5573 | 150 |
| 1232 | 3300053119 | Ga0500595_009612 | Ga0500595_009612_157_612 | 150 |
| 1233 | 3300053119 | Ga0500595_040173 | Ga0500595_040173_495_950 | 150 |
| 1234 | 3300053121 | Ga0500607_068350 | Ga0500607_068350_1321_1776 | 150 |
| 1235 | 3300053122 | Ga0500608_018296 | Ga0500608_018296_813_1274 | 150 |
| 1236 | 3300053122 | Ga0500608_088864 | Ga0500608_088864_969_1424 | 150 |
| 1237 | 3300053123 | Ga0500614_000051 | Ga0500614_000051_10700_11161 | 150 |
| 1238 | 3300053123 | Ga0500614_013030 | Ga0500614_013030_711_1166 | 150 |
| 1239 | 3300053125 | Ga0500618_034285 | Ga0500618_034285_470_925 | 150 |
| 1240 | 3300053125 | Ga0500618_112380 | Ga0500618_112380_19_474 | 150 |
| 1241 | 3300053126 | Ga0500621_208198 | Ga0500621_208198_80_535 | 150 |
| 1242 | 3300053130 | Ga0500642_0001840 | Ga0500642_0001840_4209_4664 | 150 |
| 1243 | 3300053131 | Ga0500652_137450 | Ga0500652_137450_366_821 | 150 |
| 1244 | 3300053133 | Ga0500655_022750 | Ga0500655_022750_467_922 | 150 |
| 1245 | 3300053134 | Ga0500658_0044794 | Ga0500658_0044794_439_894 | 150 |
| 1246 | 3300053136 | Ga0500559_0002983 | Ga0500559_0002983_3463_3924 | 150 |
| 1247 | 3300053138 | Ga0500564_007088 | Ga0500564_007088_3286_3741 | 150 |
| 1248 | 3300053139 | Ga0500568_0003017 | Ga0500568_0003017_368_823 | 150 |
| 1249 | 3300053139 | Ga0500568_0005161 | Ga0500568_0005161_4510_4965 | 150 |
| 1250 | 3300053144 | Ga0500585_072775 | Ga0500585_072775_730_1185 | 150 |
| 1251 | 3300053148 | Ga0500590_239433 | Ga0500590_239433_85_540 | 150 |
| 1252 | 3300053150 | Ga0500603_001419 | Ga0500603_001419_3405_3860 | 150 |
| 1253 | 3300053150 | Ga0500603_001515 | Ga0500603_001515_522_983 | 150 |
| 1254 | 3300053153 | Ga0500616_0016770 | Ga0500616_0016770_1582_2037 | 150 |
| 1255 | 3300053154 | Ga0500619_057718 | Ga0500619_057718_203_658 | 150 |
| 1256 | 3300053155 | Ga0500620_010151 | Ga0500620_010151_475_930 | 150 |
| 1257 | 3300053158 | Ga0500627_0080236 | Ga0500627_0080236_683_1138 | 150 |
| 1258 | 3300053159 | Ga0500630_016613 | Ga0500630_016613_881_1342 | 150 |
| 1259 | 3300053160 | Ga0500633_0044024 | Ga0500633_0044024_506_961 | 150 |
| 1260 | 3300053162 | Ga0500638_216071 | Ga0500638_216071_241_696 | 150 |
| 1261 | 3300053162 | Ga0500638_286593 | Ga0500638_286593_142_597 | 150 |
| 1262 | 3300053163 | Ga0500639_000646 | Ga0500639_000646_3239_3700 | 150 |
| 1263 | 3300053177 | Ga0500636_0000120 | Ga0500636_0000120_23993_24448 | 150 |
| 1264 | 3300053727 | Ga0500611_006610 | Ga0500611_006610_653_1108 | 150 |
| 1265 | 3300053731 | Ga0500609_000334 | Ga0500609_000334_304_759 | 150 |
| 1266 | 3300053735 | Ga0500596_001023 | Ga0500596_001023_2397_2858 | 150 |
| 1267 | 3300053736 | Ga0500599_000648 | Ga0500599_000648_1723_2178 | 150 |
| 1268 | 3300053737 | Ga0500601_000586 | Ga0500601_000586_3339_3794 | 150 |
| 1269 | 3300054114 | Ga0501084_0020657 | Ga0501084_0020657_2248_2706 | 150 |
| 1270 | 3300055283 | Ga0500661_009211 | Ga0500661_009211_862_1317 | 150 |
| 1271 | 3300055283 | Ga0500661_022759 | Ga0500661_022759_339_800 | 150 |
| 1272 | 3300059510 | Ga0587090_040835 | Ga0587090_040835_289_744 | 150 |
| 1273 | 3300059646 | Ga0587078_058819 | Ga0587078_058819_57_512 | 150 |
| 1274 | 3300060353 | Ga0501082_0060808 | Ga0501082_0060808_2767_3225 | 150 |
| 1275 | 3300061719 | Ga0466962_0376500 | Ga0466962_0376500_87_542 | 150 |
| 1276 | 3300025949 | Ga0207667_10195106 | Ga0207667_101951062 | 151 |
| 1277 | 3300044842 | Ga0466957_0263354 | Ga0466957_0263354_363_839 | 151 |
| 1278 | 3300006931 | Ga0097620_100032736 | Ga0097620_1000327364 | 152 |
| 1279 | 3300009101 | Ga0105247_10012893 | Ga0105247_100128934 | 152 |
| 1280 | 3300009545 | Ga0105237_10210675 | Ga0105237_102106751 | 152 |
| 1281 | 3300025914 | Ga0207671_10256131 | Ga0207671_102561311 | 152 |
| 1282 | 3300026035 | Ga0207703_10212197 | Ga0207703_102121973 | 152 |
| 1283 | 3300026088 | Ga0207641_10993315 | Ga0207641_109933151 | 152 |
| 1284 | 3300048921 | Ga0496118_0471192 | Ga0496118_0471192_122_583 | 152 |
| 1285 | 3300001989 | JGI24739J22299_10005870 | JGI24739J22299_100058706 | 154 |
| 1286 | 3300001990 | JGI24737J22298_10005148 | JGI24737J22298_100051487 | 154 |
| 1287 | 3300002067 | JGI24735J21928_10153149 | JGI24735J21928_101531491 | 154 |
| 1288 | 3300005344 | Ga0070661_100905959 | Ga0070661_1009059591 | 154 |
| 1289 | 3300005455 | Ga0070663_100813350 | Ga0070663_1008133501 | 154 |
| 1290 | 3300005539 | Ga0068853_100040711 | Ga0068853_1000407112 | 154 |
| 1291 | 3300005563 | Ga0068855_100212992 | Ga0068855_1002129924 | 154 |
| 1292 | 3300005577 | Ga0068857_100064893 | Ga0068857_1000648935 | 154 |
| 1293 | 3300005578 | Ga0068854_100080974 | Ga0068854_1000809744 | 154 |
| 1294 | 3300005614 | Ga0068856_100124718 | Ga0068856_1001247182 | 154 |
| 1295 | 3300005616 | Ga0068852_100049727 | Ga0068852_1000497276 | 154 |
| 1296 | 3300005834 | Ga0068851_10167003 | Ga0068851_101670032 | 154 |
| 1297 | 3300009093 | Ga0105240_10031749 | Ga0105240_100317498 | 154 |
| 1298 | 3300009174 | Ga0105241_10876436 | Ga0105241_108764362 | 154 |
| 1299 | 3300009545 | Ga0105237_10037499 | Ga0105237_100374992 | 154 |
| 1300 | 3300009551 | Ga0105238_10008586 | Ga0105238_100085869 | 154 |
| 1301 | 3300010375 | Ga0105239_10008381 | Ga0105239_100083819 | 154 |
| 1302 | 3300025321 | Ga0207656_10184685 | Ga0207656_101846852 | 154 |
| 1303 | 3300025904 | Ga0207647_10005034 | Ga0207647_100050341 | 154 |
| 1304 | 3300025911 | Ga0207654_10958445 | Ga0207654_109584452 | 154 |
| 1305 | 3300025924 | Ga0207694_10093293 | Ga0207694_100932933 | 154 |
| 1306 | 3300025949 | Ga0207667_10050442 | Ga0207667_100504427 | 154 |
| 1307 | 3300025981 | Ga0207640_10011464 | Ga0207640_100114648 | 154 |
| 1308 | 3300026041 | Ga0207639_10120573 | Ga0207639_101205732 | 154 |
| 1309 | 3300026078 | Ga0207702_10038781 | Ga0207702_100387815 | 154 |
| 1310 | 3300026116 | Ga0207674_10007442 | Ga0207674_100074427 | 154 |
| 1311 | 3300026142 | Ga0207698_10079194 | Ga0207698_100791942 | 154 |
| 1312 | 3300039447 | Ga0436361_0940412 | Ga0436361_0940412_1622_2113 | 154 |
| 1313 | 3300001979 | JGI24740J21852_10007408 | JGI24740J21852_100074082 | 158 |
| 1314 | 3300005539 | Ga0068853_100062602 | Ga0068853_1000626024 | 158 |
| 1315 | 3300009093 | Ga0105240_10014484 | Ga0105240_1001448410 | 158 |
| 1316 | 3300009174 | Ga0105241_10016431 | Ga0105241_100164313 | 158 |
| 1317 | 3300010375 | Ga0105239_10040184 | Ga0105239_100401844 | 158 |
| 1318 | 3300025914 | Ga0207671_10162011 | Ga0207671_101620112 | 158 |
| 1319 | 3300025949 | Ga0207667_10003903 | Ga0207667_100039039 | 158 |
| 1320 | 3300026116 | Ga0207674_10037502 | Ga0207674_100375026 | 158 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uft-assembly1.cif.gz_A | crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus | 0.9866 | 2 | 141 |
| 5uft-assembly1.cif.gz_A | crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus | 0.9529 | 2 | 141 |
| 6jzv-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis | 0.9351 | 9 | 136 |
| 6a6f-assembly1.cif.gz_B | crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 | 0.9335 | 4 | 134 |
| 6jzw-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9273 | 2 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9262 | 5 | 134 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.907 | 2 | 135 | 3.90.1010.10 |
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8901 | 2 | 148 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.881 | 5 | 134 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8757 | 2 | 135 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257XGD5-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 1.003 | 42 | 143 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A3D3UGF4-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9996 | 3 | 148 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A3N1LID3-F1-model_v4 | NifU-like protein involved in Fe-S cluster formation | 0.9994 | 4 | 140 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A1X3GDK4-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.999 | 2 | 142 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A531A8H1-F1-model_v4 | Iron-sulfur cluster assembly scaffold protein | 0.9988 | 25 | 146 |
GO:0005506
GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar