F492809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1305 | 583 | 1170 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300044901|Ga0466960_0015763|Ga0466960_0015763_673_1692 |
| Length | 329 |
| Sequence | MFYDDDADLSVIQGRNVAVLGYGSQGHAHALSLRDSGVDVRVGLPEGSKSRAKAEAEGLRVLTPGEACEDHTQRKVYAEYVEPNLVDGDALFFGHGFNIRFGYIKPPAGVDVAMVAPKGPGHLVRREYSAGRGVPVLVAVENDATGKAWELALAYAKAIGGLRAGGIKTTFTEETETDLFGEQAVLCGGMSELVMKGFEVLTEAGYQPEVAYFECLHELKLIVDLMYEGGIAKQRWSVSDTAEYGDYVSGPRVIDDSVKGRMQDVLADIKSGAFAKRFIDDQDAGAPEFKALRAKGEQHPIEETGRELRKLMAWVHTDDSDYTEGTATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 5 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 6 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 7 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 8 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 9 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 10 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 11 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 12 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 13 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 14 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 15 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 16 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 17 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 18 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 19 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 20 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 21 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 22 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 23 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 24 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 25 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 26 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 27 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 28 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 29 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 30 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 31 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 32 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 33 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 34 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 35 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 36 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 37 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 38 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 39 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 40 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 41 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 42 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 43 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 44 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 45 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 46 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 47 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 48 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 49 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 50 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 51 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 52 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 53 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 54 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 55 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 56 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 57 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 58 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 59 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 60 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 61 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 62 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 63 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 64 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 65 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 66 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 67 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 68 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 69 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 70 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 71 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 72 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 73 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 74 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 75 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 76 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 77 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 78 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 79 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 80 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 81 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 82 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 83 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 84 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 85 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 86 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 87 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 88 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 89 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 90 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 91 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 92 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 93 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 94 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 95 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 96 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 97 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 98 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 99 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 100 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 101 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 102 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 103 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 104 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 105 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 106 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 107 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 108 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 109 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 110 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 111 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 112 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 113 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 114 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 115 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 116 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 117 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 118 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 119 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 120 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 121 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 122 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 123 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 124 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 125 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 126 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 127 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 128 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 129 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 130 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 131 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 132 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 133 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 134 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 135 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 138 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 139 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 141 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 145 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 147 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 164 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 169 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 170 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 175 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 177 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 178 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 180 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 181 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 186 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 188 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 189 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 191 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 192 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 193 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 194 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 195 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 196 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 197 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 198 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 199 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 200 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 201 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 202 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 203 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 204 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 206 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 207 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 208 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 209 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 210 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 214 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 215 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 216 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 217 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 218 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 219 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 220 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 221 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 222 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 223 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 224 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 226 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 227 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 244 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 258 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 259 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 260 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 261 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 262 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 263 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 264 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 265 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 266 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 267 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 268 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 333 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 337 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 338 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 339 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 340 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 341 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 342 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 343 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 344 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 345 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 346 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 347 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 348 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 349 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 350 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 351 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 352 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 353 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 354 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 355 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 356 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 357 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 358 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 359 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 360 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 361 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 362 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 363 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 364 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 365 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 366 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 367 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 368 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 369 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 370 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 371 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 372 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 373 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 374 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 375 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 376 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 377 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 378 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 379 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 380 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 382 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 383 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 384 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 385 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 386 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 387 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 388 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 389 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 390 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 391 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 392 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 393 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 394 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 395 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 396 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 397 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 398 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 399 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 400 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 401 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 402 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 403 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 404 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 405 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 406 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 407 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 408 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 409 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 410 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 411 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 412 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 413 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 414 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 415 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 416 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 417 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 418 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 419 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 420 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 421 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 422 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 423 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 424 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 425 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 426 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 427 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 428 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 429 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 430 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 476 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 478 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 479 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 480 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 481 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 482 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 483 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 486 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 487 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 488 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 489 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 490 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 491 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 492 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 493 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 494 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 495 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 496 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 497 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 498 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 499 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 500 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 501 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 502 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 519 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 537 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 538 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 539 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 540 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 541 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 544 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 545 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 550 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 554 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 555 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 556 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 557 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 558 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 559 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 560 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 561 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 562 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 564 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 572 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 573 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 574 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 575 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 576 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 577 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 578 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 579 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 580 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 581 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 582 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 583 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.74 |
| Metatranscriptomes | 1.92 |
| Isolates | 10.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 3.14 |
| Nodule | 0.15 |
| Rhizoplane | 7.59 |
| Rhizosphere | 78.16 |
| Stem | 0 |
| Stem Tuber | 0.08 |
| Unclassified | 10.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1007622 | 3300001976 | Bacteria | 1412 |
| 2 | JGI24743J22301_10013855 | 3300001991 | Bacteria | 1482 |
| 3 | JGI24743J22301_10024236 | 3300001991 | Bacteria | 1171 |
| 4 | JGI24735J21928_10007685 | 3300002067 | Bacteria | 3507 |
| 5 | JGI24751J29686_10003815 | 3300002459 | Bacteria | 3042 |
| 6 | JGI25152J39213_1000575 | 3300002773 | Bacteria | 19918 |
| 7 | JGI25151J46595_10037562 | 3300003187 | Bacteria | 1815 |
| 8 | JGI25406J46586_10001708 | 3300003203 | Bacteria | 10326 |
| 9 | Ga0006562J51391_1051343 | 3300003578 | Bacteria | 1733 |
| 10 | JGI25404J52841_10002141 | 3300003659 | Bacteria | 3677 |
| 11 | JGI25405J52794_10005273 | 3300003911 | Bacteria | 2327 |
| 12 | Ga0058863_11608832 | 3300004799 | Bacteria | 1962 |
| 13 | Ga0070658_10000309 | 3300005327 | Bacteria | 42138 |
| 14 | Ga0070658_10002686 | 3300005327 | Bacteria | 14793 |
| 15 | Ga0070658_10073343 | 3300005327 | Bacteria | 2807 |
| 16 | Ga0070683_100028369 | 3300005329 | Bacteria | 5058 |
| 17 | Ga0070683_100139069 | 3300005329 | Bacteria | 2300 |
| 18 | Ga0070683_100150733 | 3300005329 | Bacteria | 2205 |
| 19 | Ga0070683_100248569 | 3300005329 | Bacteria | 1691 |
| 20 | Ga0070690_100047382 | 3300005330 | Bacteria | 2735 |
| 21 | Ga0070690_100196382 | 3300005330 | Bacteria | 1401 |
| 22 | Ga0070690_100196649 | 3300005330 | Bacteria | 1401 |
| 23 | Ga0070670_100030908 | 3300005331 | Bacteria | 4612 |
| 24 | Ga0068869_100030699 | 3300005334 | Bacteria | 3776 |
| 25 | Ga0068869_100074482 | 3300005334 | Bacteria | 2520 |
| 26 | Ga0068869_100116718 | 3300005334 | Bacteria | 2036 |
| 27 | Ga0068869_100119246 | 3300005334 | Bacteria | 2016 |
| 28 | Ga0070666_10073082 | 3300005335 | Bacteria | 2335 |
| 29 | Ga0070680_100001094 | 3300005336 | Bacteria | 19451 |
| 30 | Ga0070680_100009182 | 3300005336 | Bacteria | 7583 |
| 31 | Ga0070680_100166353 | 3300005336 | Bacteria | 1854 |
| 32 | Ga0070682_100009892 | 3300005337 | Bacteria | 5400 |
| 33 | Ga0070682_100016882 | 3300005337 | Bacteria | 4248 |
| 34 | Ga0070682_100035642 | 3300005337 | Bacteria | 3038 |
| 35 | Ga0068868_100013718 | 3300005338 | Bacteria | 5952 |
| 36 | Ga0068868_100106370 | 3300005338 | Bacteria | 2276 |
| 37 | Ga0068868_100238572 | 3300005338 | Bacteria | 1527 |
| 38 | Ga0070660_100040808 | 3300005339 | Bacteria | 3534 |
| 39 | Ga0070660_100043804 | 3300005339 | Bacteria | 3421 |
| 40 | Ga0070660_100109366 | 3300005339 | Bacteria | 2198 |
| 41 | Ga0070689_100083548 | 3300005340 | Bacteria | 2509 |
| 42 | Ga0070691_10000722 | 3300005341 | Bacteria | 12916 |
| 43 | Ga0070687_100055685 | 3300005343 | Bacteria | 2066 |
| 44 | Ga0070687_100133163 | 3300005343 | Bacteria | 1438 |
| 45 | Ga0070661_100017686 | 3300005344 | Bacteria | 5059 |
| 46 | Ga0070661_100028126 | 3300005344 | Bacteria | 4054 |
| 47 | Ga0070692_10010386 | 3300005345 | Bacteria | 4233 |
| 48 | Ga0070692_10041235 | 3300005345 | Bacteria | 2364 |
| 49 | Ga0070692_10220521 | 3300005345 | Bacteria | 1121 |
| 50 | Ga0070669_100160437 | 3300005353 | Bacteria | 1747 |
| 51 | Ga0070675_100002908 | 3300005354 | Bacteria | 12910 |
| 52 | Ga0070675_100078035 | 3300005354 | Bacteria | 2757 |
| 53 | Ga0070671_100001146 | 3300005355 | Bacteria | 19744 |
| 54 | Ga0070671_100003146 | 3300005355 | Bacteria | 12864 |
| 55 | Ga0070671_100065944 | 3300005355 | Bacteria | 3017 |
| 56 | Ga0070671_100179731 | 3300005355 | Bacteria | 1791 |
| 57 | Ga0070673_100023874 | 3300005364 | Bacteria | 4473 |
| 58 | Ga0070673_100056671 | 3300005364 | Bacteria | 3093 |
| 59 | Ga0070673_100170107 | 3300005364 | Bacteria | 1859 |
| 60 | Ga0070659_100001204 | 3300005366 | Bacteria | 18837 |
| 61 | Ga0070659_100020947 | 3300005366 | Bacteria | 4972 |
| 62 | Ga0070659_100025947 | 3300005366 | Bacteria | 4507 |
| 63 | Ga0070659_100077895 | 3300005366 | Bacteria | 2644 |
| 64 | Ga0070659_100081076 | 3300005366 | Bacteria | 2591 |
| 65 | Ga0070667_100004070 | 3300005367 | Bacteria | 12361 |
| 66 | Ga0070667_100082228 | 3300005367 | Bacteria | 2757 |
| 67 | Ga0070709_10025240 | 3300005434 | Bacteria | 3509 |
| 68 | Ga0070714_100017121 | 3300005435 | Bacteria | 5868 |
| 69 | Ga0070714_100238264 | 3300005435 | Bacteria | 1679 |
| 70 | Ga0070710_10019318 | 3300005437 | Bacteria | 3519 |
| 71 | Ga0070701_10002525 | 3300005438 | Bacteria | 7071 |
| 72 | Ga0070701_10051383 | 3300005438 | Bacteria | 2138 |
| 73 | Ga0070701_10147943 | 3300005438 | Bacteria | 1350 |
| 74 | Ga0070711_100005401 | 3300005439 | Bacteria | 7642 |
| 75 | Ga0070711_100279880 | 3300005439 | Bacteria | 1319 |
| 76 | Ga0070705_100016616 | 3300005440 | Bacteria | 3826 |
| 77 | Ga0070700_100000088 | 3300005441 | Bacteria | 61864 |
| 78 | Ga0070700_100007467 | 3300005441 | Bacteria | 5906 |
| 79 | Ga0070700_100095974 | 3300005441 | Bacteria | 1944 |
| 80 | Ga0070700_100187527 | 3300005441 | Bacteria | 1444 |
| 81 | Ga0070694_100021669 | 3300005444 | Bacteria | 4110 |
| 82 | Ga0070663_100010451 | 3300005455 | Bacteria | 5785 |
| 83 | Ga0070663_100014373 | 3300005455 | Bacteria | 5081 |
| 84 | Ga0070663_100033401 | 3300005455 | Bacteria | 3554 |
| 85 | Ga0070663_100215202 | 3300005455 | Bacteria | 1506 |
| 86 | Ga0070678_100007800 | 3300005456 | Bacteria | 6368 |
| 87 | Ga0070678_100244261 | 3300005456 | Bacteria | 1502 |
| 88 | Ga0070662_100038941 | 3300005457 | Bacteria | 3380 |
| 89 | Ga0070681_10000009 | 3300005458 | Bacteria | 146582 |
| 90 | Ga0070681_10038502 | 3300005458 | Bacteria | 4795 |
| 91 | Ga0068867_100194089 | 3300005459 | Bacteria | 1622 |
| 92 | Ga0070685_10022702 | 3300005466 | Bacteria | 3424 |
| 93 | Ga0070685_10026552 | 3300005466 | Bacteria | 3192 |
| 94 | Ga0070706_100011209 | 3300005467 | Bacteria | 8325 |
| 95 | Ga0070706_100158430 | 3300005467 | Bacteria | 2113 |
| 96 | Ga0070707_100070629 | 3300005468 | Bacteria | 3363 |
| 97 | Ga0070698_100258403 | 3300005471 | Bacteria | 1674 |
| 98 | Ga0070679_100000163 | 3300005530 | Bacteria | 53457 |
| 99 | Ga0070679_100015824 | 3300005530 | Bacteria | 7258 |
| 100 | Ga0070679_100063514 | 3300005530 | Bacteria | 3680 |
| 101 | Ga0070684_100005110 | 3300005535 | Bacteria | 10028 |
| 102 | Ga0070697_100316455 | 3300005536 | Bacteria | 1343 |
| 103 | Ga0068853_100088383 | 3300005539 | Bacteria | 2720 |
| 104 | Ga0068853_100121875 | 3300005539 | Bacteria | 2327 |
| 105 | Ga0070672_100013603 | 3300005543 | Bacteria | 5754 |
| 106 | Ga0070672_100064485 | 3300005543 | Bacteria | 2895 |
| 107 | Ga0070686_100031912 | 3300005544 | Bacteria | 3226 |
| 108 | Ga0070695_100042770 | 3300005545 | Bacteria | 2877 |
| 109 | Ga0070695_100052078 | 3300005545 | Bacteria | 2629 |
| 110 | Ga0070696_100014280 | 3300005546 | Bacteria | 5328 |
| 111 | Ga0070693_100000949 | 3300005547 | Bacteria | 12869 |
| 112 | Ga0070693_100103768 | 3300005547 | Bacteria | 1737 |
| 113 | Ga0070665_100000754 | 3300005548 | Bacteria | 42987 |
| 114 | Ga0070665_100059982 | 3300005548 | Bacteria | 3813 |
| 115 | Ga0070665_100060493 | 3300005548 | Bacteria | 3796 |
| 116 | Ga0070704_100015340 | 3300005549 | Bacteria | 4812 |
| 117 | Ga0068855_100005880 | 3300005563 | Bacteria | 14963 |
| 118 | Ga0070664_100064900 | 3300005564 | Bacteria | 3114 |
| 119 | Ga0070664_100295548 | 3300005564 | Bacteria | 1463 |
| 120 | Ga0068854_100081701 | 3300005578 | Bacteria | 2387 |
| 121 | Ga0068854_100265214 | 3300005578 | Bacteria | 1377 |
| 122 | Ga0068856_100013598 | 3300005614 | Bacteria | 7877 |
| 123 | Ga0068856_100033582 | 3300005614 | Bacteria | 5024 |
| 124 | Ga0068856_100218892 | 3300005614 | Bacteria | 1919 |
| 125 | Ga0070702_100009584 | 3300005615 | Bacteria | 4747 |
| 126 | Ga0070702_100034700 | 3300005615 | Bacteria | 2781 |
| 127 | Ga0068852_100067530 | 3300005616 | Bacteria | 3126 |
| 128 | Ga0068859_100026493 | 3300005617 | Bacteria | 5814 |
| 129 | Ga0068859_100238647 | 3300005617 | Bacteria | 1907 |
| 130 | Ga0068864_100074023 | 3300005618 | Bacteria | 2971 |
| 131 | Ga0068864_100256773 | 3300005618 | Bacteria | 1624 |
| 132 | Ga0068866_10030200 | 3300005718 | Bacteria | 2599 |
| 133 | Ga0068866_10085278 | 3300005718 | Bacteria | 1707 |
| 134 | Ga0068861_100013361 | 3300005719 | Bacteria | 5747 |
| 135 | Ga0068861_100020576 | 3300005719 | Bacteria | 4729 |
| 136 | Ga0068861_100089040 | 3300005719 | Bacteria | 2432 |
| 137 | Ga0068861_100298318 | 3300005719 | Bacteria | 1395 |
| 138 | Ga0068851_10009913 | 3300005834 | Bacteria | 4437 |
| 139 | Ga0068851_10108839 | 3300005834 | Bacteria | 1478 |
| 140 | Ga0068870_10002118 | 3300005840 | Bacteria | 8215 |
| 141 | Ga0068870_10002617 | 3300005840 | Bacteria | 7531 |
| 142 | Ga0068863_100019674 | 3300005841 | Bacteria | 6458 |
| 143 | Ga0068863_100052256 | 3300005841 | Bacteria | 3873 |
| 144 | Ga0068863_100083924 | 3300005841 | Bacteria | 3019 |
| 145 | Ga0068858_100056766 | 3300005842 | Bacteria | 3618 |
| 146 | Ga0068858_100092490 | 3300005842 | Bacteria | 2815 |
| 147 | Ga0068858_100369729 | 3300005842 | Bacteria | 1375 |
| 148 | Ga0068860_100000134 | 3300005843 | Bacteria | 120350 |
| 149 | Ga0068860_100059370 | 3300005843 | Bacteria | 3636 |
| 150 | Ga0081455_10000873 | 3300005937 | Bacteria | 38958 |
| 151 | Ga0081455_10004022 | 3300005937 | Bacteria | 16667 |
| 152 | Ga0081455_10004927 | 3300005937 | Bacteria | 14775 |
| 153 | Ga0081455_10005694 | 3300005937 | Bacteria | 13595 |
| 154 | Ga0081455_10019705 | 3300005937 | Bacteria | 6372 |
| 155 | Ga0081455_10034182 | 3300005937 | Bacteria | 4557 |
| 156 | Ga0081455_10152458 | 3300005937 | Bacteria | 1780 |
| 157 | Ga0081538_10012412 | 3300005981 | Bacteria | 6828 |
| 158 | Ga0081538_10101111 | 3300005981 | Bacteria | 1452 |
| 159 | Ga0081540_1000292 | 3300005983 | Bacteria | 52588 |
| 160 | Ga0081540_1001174 | 3300005983 | Bacteria | 22953 |
| 161 | Ga0081540_1005619 | 3300005983 | Bacteria | 9336 |
| 162 | Ga0081539_10000100 | 3300005985 | Bacteria | 199516 |
| 163 | Ga0081539_10054195 | 3300005985 | Bacteria | 2241 |
| 164 | Ga0070717_10048671 | 3300006028 | Bacteria | 3478 |
| 165 | Ga0070717_10068708 | 3300006028 | Bacteria | 2949 |
| 166 | Ga0075365_10009182 | 3300006038 | Bacteria | 5667 |
| 167 | Ga0075365_10153811 | 3300006038 | Bacteria | 1601 |
| 168 | Ga0075368_10006588 | 3300006042 | Bacteria | 4066 |
| 169 | Ga0075363_100036812 | 3300006048 | Bacteria | 2568 |
| 170 | Ga0075364_10005914 | 3300006051 | Bacteria | 7149 |
| 171 | Ga0075364_10014457 | 3300006051 | Bacteria | 4877 |
| 172 | Ga0075364_10017613 | 3300006051 | Bacteria | 4467 |
| 173 | Ga0075364_10086870 | 3300006051 | Bacteria | 2072 |
| 174 | Ga0075432_10000164 | 3300006058 | Bacteria | 16304 |
| 175 | Ga0075432_10000498 | 3300006058 | Bacteria | 11771 |
| 176 | Ga0070715_10039103 | 3300006163 | Bacteria | 1974 |
| 177 | Ga0070716_100008168 | 3300006173 | Bacteria | 5185 |
| 178 | Ga0070712_100080245 | 3300006175 | Bacteria | 2361 |
| 179 | Ga0075367_10001210 | 3300006178 | Bacteria | 10831 |
| 180 | Ga0075369_10005604 | 3300006186 | Bacteria | 4700 |
| 181 | Ga0075370_10038470 | 3300006353 | Bacteria | 2692 |
| 182 | Ga0068871_100019328 | 3300006358 | Bacteria | 5199 |
| 183 | Ga0068871_100077986 | 3300006358 | Bacteria | 2739 |
| 184 | Ga0068871_100081612 | 3300006358 | Bacteria | 2679 |
| 185 | Ga0075428_100006874 | 3300006844 | Bacteria | 12637 |
| 186 | Ga0075428_100028171 | 3300006844 | Bacteria | 6214 |
| 187 | Ga0075428_100059055 | 3300006844 | Bacteria | 4200 |
| 188 | Ga0075428_100370281 | 3300006844 | Bacteria | 1536 |
| 189 | Ga0075430_100041963 | 3300006846 | Bacteria | 3869 |
| 190 | Ga0075431_100034795 | 3300006847 | Bacteria | 5189 |
| 191 | Ga0075431_100061483 | 3300006847 | Bacteria | 3875 |
| 192 | Ga0075431_100066647 | 3300006847 | Bacteria | 3717 |
| 193 | Ga0075431_100099008 | 3300006847 | Bacteria | 3009 |
| 194 | Ga0075433_10000748 | 3300006852 | Bacteria | 22289 |
| 195 | Ga0075433_10027215 | 3300006852 | Bacteria | 4847 |
| 196 | Ga0075433_10087726 | 3300006852 | Bacteria | 2748 |
| 197 | Ga0075434_100000896 | 3300006871 | Bacteria | 23873 |
| 198 | Ga0075434_100004650 | 3300006871 | Bacteria | 12405 |
| 199 | Ga0075434_100009071 | 3300006871 | Bacteria | 9264 |
| 200 | Ga0075434_100018451 | 3300006871 | Bacteria | 6741 |
| 201 | Ga0075434_100345699 | 3300006871 | Bacteria | 1508 |
| 202 | Ga0075429_100034994 | 3300006880 | Bacteria | 4365 |
| 203 | Ga0075429_100055734 | 3300006880 | Bacteria | 3440 |
| 204 | Ga0075436_100002562 | 3300006914 | Bacteria | 12511 |
| 205 | Ga0075436_100005264 | 3300006914 | Bacteria | 8902 |
| 206 | Ga0097620_100026493 | 3300006931 | Bacteria | 5814 |
| 207 | Ga0097620_100238649 | 3300006931 | Bacteria | 1907 |
| 208 | Ga0075435_100005715 | 3300007076 | Bacteria | 8719 |
| 209 | Ga0075435_100020996 | 3300007076 | Bacteria | 5016 |
| 210 | Ga0075435_100034802 | 3300007076 | Bacteria | 3993 |
| 211 | Ga0099795_10041210 | 3300007788 | Bacteria | 1643 |
| 212 | Ga0105251_10016765 | 3300009011 | Bacteria | 3946 |
| 213 | Ga0105244_10005231 | 3300009036 | Bacteria | 8669 |
| 214 | Ga0105244_10047450 | 3300009036 | Bacteria | 2203 |
| 215 | Ga0105244_10061431 | 3300009036 | Bacteria | 1891 |
| 216 | Ga0105244_10064894 | 3300009036 | Bacteria | 1830 |
| 217 | Ga0105240_10426751 | 3300009093 | Bacteria | 1488 |
| 218 | Ga0111539_10002559 | 3300009094 | Bacteria | 24078 |
| 219 | Ga0111539_10012865 | 3300009094 | Bacteria | 10470 |
| 220 | Ga0111539_10351066 | 3300009094 | Bacteria | 1717 |
| 221 | Ga0105245_10014876 | 3300009098 | Bacteria | 6777 |
| 222 | Ga0105245_10017525 | 3300009098 | Bacteria | 6250 |
| 223 | Ga0105245_10087733 | 3300009098 | Bacteria | 2856 |
| 224 | Ga0105245_10194539 | 3300009098 | Bacteria | 1944 |
| 225 | Ga0105247_10002264 | 3300009101 | Bacteria | 13231 |
| 226 | Ga0105247_10048148 | 3300009101 | Bacteria | 2618 |
| 227 | Ga0114129_10026014 | 3300009147 | Bacteria | 8287 |
| 228 | Ga0114129_10056113 | 3300009147 | Bacteria | 5519 |
| 229 | Ga0114129_10170614 | 3300009147 | Bacteria | 2966 |
| 230 | Ga0114129_10492590 | 3300009147 | Bacteria | 1602 |
| 231 | Ga0105243_10046912 | 3300009148 | Bacteria | 3400 |
| 232 | Ga0105243_10095924 | 3300009148 | Bacteria | 2452 |
| 233 | Ga0105243_10107450 | 3300009148 | Bacteria | 2327 |
| 234 | Ga0105243_10203358 | 3300009148 | Bacteria | 1738 |
| 235 | Ga0105241_10064959 | 3300009174 | Bacteria | 2819 |
| 236 | Ga0105241_10136457 | 3300009174 | Bacteria | 1992 |
| 237 | Ga0105242_10057689 | 3300009176 | Bacteria | 3181 |
| 238 | Ga0105242_10083798 | 3300009176 | Bacteria | 2670 |
| 239 | Ga0105242_10099973 | 3300009176 | Bacteria | 2456 |
| 240 | Ga0105242_10113311 | 3300009176 | Bacteria | 2316 |
| 241 | Ga0105248_10411453 | 3300009177 | Bacteria | 1523 |
| 242 | Ga0105237_10021220 | 3300009545 | Bacteria | 6680 |
| 243 | Ga0105237_10113707 | 3300009545 | Bacteria | 2699 |
| 244 | Ga0105238_10040892 | 3300009551 | Bacteria | 4697 |
| 245 | Ga0105238_10308362 | 3300009551 | Bacteria | 1567 |
| 246 | Ga0105238_10411887 | 3300009551 | Bacteria | 1345 |
| 247 | Ga0105249_10007742 | 3300009553 | Bacteria | 9362 |
| 248 | Ga0105249_10022176 | 3300009553 | Bacteria | 5687 |
| 249 | Ga0105239_10055480 | 3300010375 | Bacteria | 4345 |
| 250 | Ga0105239_10067538 | 3300010375 | Bacteria | 3928 |
| 251 | Ga0105239_10207288 | 3300010375 | Bacteria | 2197 |
| 252 | Ga0105239_10226594 | 3300010375 | Bacteria | 2097 |
| 253 | Ga0105239_10261107 | 3300010375 | Bacteria | 1946 |
| 254 | Ga0105239_10735706 | 3300010375 | Bacteria | 1129 |
| 255 | Ga0105246_10002299 | 3300011119 | Bacteria | 11528 |
| 256 | Ga0105246_10008058 | 3300011119 | Bacteria | 6468 |
| 257 | Ga0105246_10009194 | 3300011119 | Bacteria | 6085 |
| 258 | Ga0105246_10043828 | 3300011119 | Bacteria | 3037 |
| 259 | Ga0105246_10108764 | 3300011119 | Bacteria | 2032 |
| 260 | Ga0105246_10180093 | 3300011119 | Bacteria | 1626 |
| 261 | Ga0157339_1001910 | 3300012505 | Bacteria | 1347 |
| 262 | Ga0157373_10221661 | 3300013100 | Bacteria | 1334 |
| 263 | Ga0157371_10014805 | 3300013102 | Bacteria | 5871 |
| 264 | Ga0157371_10016243 | 3300013102 | Bacteria | 5561 |
| 265 | Ga0157371_10019134 | 3300013102 | Bacteria | 5055 |
| 266 | Ga0157371_10051718 | 3300013102 | Bacteria | 2919 |
| 267 | Ga0157371_10148938 | 3300013102 | Bacteria | 1669 |
| 268 | Ga0157370_10131468 | 3300013104 | Bacteria | 2335 |
| 269 | Ga0157370_10179700 | 3300013104 | Bacteria | 1966 |
| 270 | Ga0157369_10169565 | 3300013105 | Bacteria | 2300 |
| 271 | Ga0157369_10401755 | 3300013105 | Bacteria | 1421 |
| 272 | Ga0157378_10115467 | 3300013297 | Bacteria | 2467 |
| 273 | Ga0157378_10153763 | 3300013297 | Bacteria | 2145 |
| 274 | Ga0163162_10113028 | 3300013306 | Bacteria | 2814 |
| 275 | Ga0163162_10288370 | 3300013306 | Bacteria | 1773 |
| 276 | Ga0157372_10056369 | 3300013307 | Bacteria | 4391 |
| 277 | Ga0157372_10156843 | 3300013307 | Bacteria | 2629 |
| 278 | Ga0157372_10470680 | 3300013307 | Bacteria | 1465 |
| 279 | Ga0157375_10012428 | 3300013308 | Bacteria | 7554 |
| 280 | Ga0157375_10143155 | 3300013308 | Bacteria | 2519 |
| 281 | Ga0163163_10016279 | 3300014325 | Bacteria | 6904 |
| 282 | Ga0163163_10336166 | 3300014325 | Bacteria | 1565 |
| 283 | Ga0157380_10002258 | 3300014326 | Bacteria | 12956 |
| 284 | Ga0157380_10086145 | 3300014326 | Bacteria | 2580 |
| 285 | Ga0157377_10007380 | 3300014745 | Bacteria | 5305 |
| 286 | Ga0157377_10025279 | 3300014745 | Bacteria | 3166 |
| 287 | Ga0157377_10031358 | 3300014745 | Bacteria | 2888 |
| 288 | Ga0157379_10092311 | 3300014968 | Bacteria | 2716 |
| 289 | Ga0163161_10021892 | 3300017792 | Bacteria | 4496 |
| 290 | Ga0163161_10028584 | 3300017792 | Bacteria | 3961 |
| 291 | Ga0163161_10057846 | 3300017792 | Bacteria | 2817 |
| 292 | Ga0197907_10135013 | 3300020069 | Bacteria | 3298 |
| 293 | Ga0197907_10657334 | 3300020069 | Bacteria | 2363 |
| 294 | Ga0206356_11271902 | 3300020070 | Bacteria | 1725 |
| 295 | Ga0206351_10445551 | 3300020077 | Bacteria | 2398 |
| 296 | Ga0206350_10417353 | 3300020080 | Bacteria | 1672 |
| 297 | Ga0206354_10469986 | 3300020081 | Bacteria | 1076 |
| 298 | Ga0206354_10575016 | 3300020081 | Bacteria | 3014 |
| 299 | Ga0206354_10706613 | 3300020081 | Bacteria | 3530 |
| 300 | Ga0206354_10740334 | 3300020081 | Bacteria | 1446 |
| 301 | Ga0206353_10787144 | 3300020082 | Bacteria | 2405 |
| 302 | Ga0213876_10009192 | 3300021384 | Bacteria | 5322 |
| 303 | Ga0213875_10000250 | 3300021388 | Bacteria | 54123 |
| 304 | Ga0213875_10052106 | 3300021388 | Bacteria | 1916 |
| 305 | Ga0224712_10003694 | 3300022467 | Bacteria | 4019 |
| 306 | Ga0224712_10024184 | 3300022467 | Bacteria | 2119 |
| 307 | Ga0224712_10067806 | 3300022467 | Bacteria | 1440 |
| 308 | Ga0224712_10077659 | 3300022467 | Bacteria | 1363 |
| 309 | Ga0207425_1019477 | 3300025245 | Bacteria | 1460 |
| 310 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 311 | Ga0209025_1000112 | 3300025294 | Bacteria | 218958 |
| 312 | Ga0207697_10015293 | 3300025315 | Bacteria | 3172 |
| 313 | Ga0207656_10029262 | 3300025321 | Bacteria | 2267 |
| 314 | Ga0207655_1002765 | 3300025728 | Bacteria | 13685 |
| 315 | Ga0207655_1005169 | 3300025728 | Bacteria | 8980 |
| 316 | Ga0207655_1021225 | 3300025728 | Bacteria | 3304 |
| 317 | Ga0207653_10012153 | 3300025885 | Bacteria | 2688 |
| 318 | Ga0207653_10012992 | 3300025885 | Bacteria | 2604 |
| 319 | Ga0207692_10005860 | 3300025898 | Bacteria | 4953 |
| 320 | Ga0207692_10011599 | 3300025898 | Bacteria | 3757 |
| 321 | Ga0207692_10046842 | 3300025898 | Bacteria | 2169 |
| 322 | Ga0207692_10067367 | 3300025898 | Bacteria | 1874 |
| 323 | Ga0207642_10159351 | 3300025899 | Bacteria | 1210 |
| 324 | Ga0207710_10025344 | 3300025900 | Bacteria | 2559 |
| 325 | Ga0207710_10038286 | 3300025900 | Bacteria | 2120 |
| 326 | Ga0207688_10024354 | 3300025901 | Bacteria | 3319 |
| 327 | Ga0207688_10031128 | 3300025901 | Bacteria | 2944 |
| 328 | Ga0207680_10003699 | 3300025903 | Bacteria | 7187 |
| 329 | Ga0207680_10037859 | 3300025903 | Bacteria | 2788 |
| 330 | Ga0207647_10043315 | 3300025904 | Bacteria | 2818 |
| 331 | Ga0207647_10053815 | 3300025904 | Bacteria | 2479 |
| 332 | Ga0207647_10062551 | 3300025904 | Bacteria | 2267 |
| 333 | Ga0207685_10026716 | 3300025905 | Bacteria | 2011 |
| 334 | Ga0207685_10039928 | 3300025905 | Bacteria | 1746 |
| 335 | Ga0207699_10006159 | 3300025906 | Bacteria | 5784 |
| 336 | Ga0207699_10016027 | 3300025906 | Bacteria | 3909 |
| 337 | Ga0207699_10120558 | 3300025906 | Bacteria | 1696 |
| 338 | Ga0207645_10032358 | 3300025907 | Bacteria | 3361 |
| 339 | Ga0207645_10063793 | 3300025907 | Bacteria | 2354 |
| 340 | Ga0207643_10001031 | 3300025908 | Bacteria | 16542 |
| 341 | Ga0207705_10007997 | 3300025909 | Bacteria | 7754 |
| 342 | Ga0207705_10012346 | 3300025909 | Bacteria | 6172 |
| 343 | Ga0207684_10028995 | 3300025910 | Bacteria | 4714 |
| 344 | Ga0207684_10095023 | 3300025910 | Bacteria | 2543 |
| 345 | Ga0207654_10053213 | 3300025911 | Bacteria | 2336 |
| 346 | Ga0207654_10085923 | 3300025911 | Bacteria | 1906 |
| 347 | Ga0207707_10000240 | 3300025912 | Bacteria | 59635 |
| 348 | Ga0207707_10019141 | 3300025912 | Bacteria | 5975 |
| 349 | Ga0207707_10071304 | 3300025912 | Bacteria | 3028 |
| 350 | Ga0207671_10154310 | 3300025914 | Bacteria | 1775 |
| 351 | Ga0207693_10003490 | 3300025915 | Bacteria | 13418 |
| 352 | Ga0207693_10030756 | 3300025915 | Bacteria | 4241 |
| 353 | Ga0207663_10044916 | 3300025916 | Bacteria | 2715 |
| 354 | Ga0207660_10000327 | 3300025917 | Bacteria | 30717 |
| 355 | Ga0207660_10023557 | 3300025917 | Bacteria | 4159 |
| 356 | Ga0207662_10002366 | 3300025918 | Bacteria | 9452 |
| 357 | Ga0207662_10079527 | 3300025918 | Bacteria | 1998 |
| 358 | Ga0207662_10190397 | 3300025918 | Bacteria | 1323 |
| 359 | Ga0207657_10002812 | 3300025919 | Bacteria | 18725 |
| 360 | Ga0207657_10007056 | 3300025919 | Bacteria | 11541 |
| 361 | Ga0207657_10009292 | 3300025919 | Bacteria | 9902 |
| 362 | Ga0207657_10019848 | 3300025919 | Bacteria | 6369 |
| 363 | Ga0207657_10030946 | 3300025919 | Bacteria | 4851 |
| 364 | Ga0207649_10001439 | 3300025920 | Bacteria | 14060 |
| 365 | Ga0207649_10032099 | 3300025920 | Bacteria | 3128 |
| 366 | Ga0207652_10000227 | 3300025921 | Bacteria | 59166 |
| 367 | Ga0207652_10006279 | 3300025921 | Bacteria | 9591 |
| 368 | Ga0207652_10073146 | 3300025921 | Bacteria | 2981 |
| 369 | Ga0207652_10096765 | 3300025921 | Bacteria | 2601 |
| 370 | Ga0207652_10113906 | 3300025921 | Bacteria | 2400 |
| 371 | Ga0207694_10064012 | 3300025924 | Bacteria | 2865 |
| 372 | Ga0207694_10144753 | 3300025924 | Bacteria | 1913 |
| 373 | Ga0207694_10364629 | 3300025924 | Bacteria | 1198 |
| 374 | Ga0207650_10001708 | 3300025925 | Bacteria | 15594 |
| 375 | Ga0207659_10004891 | 3300025926 | Bacteria | 8116 |
| 376 | Ga0207659_10300439 | 3300025926 | Bacteria | 1318 |
| 377 | Ga0207659_10325030 | 3300025926 | Bacteria | 1270 |
| 378 | Ga0207687_10014575 | 3300025927 | Bacteria | 5145 |
| 379 | Ga0207687_10023909 | 3300025927 | Bacteria | 4076 |
| 380 | Ga0207687_10040646 | 3300025927 | Bacteria | 3189 |
| 381 | Ga0207687_10070184 | 3300025927 | Bacteria | 2500 |
| 382 | Ga0207687_10076337 | 3300025927 | Bacteria | 2407 |
| 383 | Ga0207687_10203325 | 3300025927 | Bacteria | 1550 |
| 384 | Ga0207664_10035384 | 3300025929 | Bacteria | 3853 |
| 385 | Ga0207664_10038026 | 3300025929 | Bacteria | 3729 |
| 386 | Ga0207664_10490346 | 3300025929 | Bacteria | 1100 |
| 387 | Ga0207644_10003724 | 3300025931 | Bacteria | 9881 |
| 388 | Ga0207644_10008552 | 3300025931 | Bacteria | 6695 |
| 389 | Ga0207644_10027123 | 3300025931 | Bacteria | 3956 |
| 390 | Ga0207690_10011953 | 3300025932 | Bacteria | 5190 |
| 391 | Ga0207706_10007413 | 3300025933 | Bacteria | 10143 |
| 392 | Ga0207706_10014789 | 3300025933 | Bacteria | 7064 |
| 393 | Ga0207706_10040185 | 3300025933 | Bacteria | 4145 |
| 394 | Ga0207686_10037556 | 3300025934 | Bacteria | 2924 |
| 395 | Ga0207709_10013649 | 3300025935 | Bacteria | 4482 |
| 396 | Ga0207709_10058260 | 3300025935 | Bacteria | 2400 |
| 397 | Ga0207670_10063797 | 3300025936 | Bacteria | 2522 |
| 398 | Ga0207704_10007814 | 3300025938 | Bacteria | 5074 |
| 399 | Ga0207665_10003841 | 3300025939 | Bacteria | 10042 |
| 400 | Ga0207665_10014554 | 3300025939 | Bacteria | 5180 |
| 401 | Ga0207691_10024380 | 3300025940 | Bacteria | 5690 |
| 402 | Ga0207691_10049725 | 3300025940 | Bacteria | 3841 |
| 403 | Ga0207711_10093727 | 3300025941 | Bacteria | 2645 |
| 404 | Ga0207689_10001114 | 3300025942 | Bacteria | 25910 |
| 405 | Ga0207689_10060265 | 3300025942 | Bacteria | 3121 |
| 406 | Ga0207689_10200272 | 3300025942 | Bacteria | 1648 |
| 407 | Ga0207661_10002442 | 3300025944 | Bacteria | 12805 |
| 408 | Ga0207661_10009201 | 3300025944 | Bacteria | 7079 |
| 409 | Ga0207661_10015456 | 3300025944 | Bacteria | 5617 |
| 410 | Ga0207661_10154062 | 3300025944 | Bacteria | 1989 |
| 411 | Ga0207661_10156161 | 3300025944 | Bacteria | 1976 |
| 412 | Ga0207661_10223447 | 3300025944 | Bacteria | 1665 |
| 413 | Ga0207679_10002060 | 3300025945 | Bacteria | 12472 |
| 414 | Ga0207679_10005100 | 3300025945 | Bacteria | 8213 |
| 415 | Ga0207679_10135983 | 3300025945 | Bacteria | 1979 |
| 416 | Ga0207667_10188103 | 3300025949 | Bacteria | 2119 |
| 417 | Ga0207712_10021186 | 3300025961 | Bacteria | 4265 |
| 418 | Ga0207712_10075019 | 3300025961 | Bacteria | 2444 |
| 419 | Ga0207712_10251047 | 3300025961 | Bacteria | 1430 |
| 420 | Ga0207668_10008633 | 3300025972 | Bacteria | 6082 |
| 421 | Ga0207668_10054162 | 3300025972 | Bacteria | 2784 |
| 422 | Ga0207668_10189738 | 3300025972 | Bacteria | 1628 |
| 423 | Ga0207640_10072221 | 3300025981 | Bacteria | 2327 |
| 424 | Ga0207640_10097199 | 3300025981 | Bacteria | 2055 |
| 425 | Ga0207640_10215362 | 3300025981 | Bacteria | 1466 |
| 426 | Ga0207658_10035711 | 3300025986 | Bacteria | 3561 |
| 427 | Ga0207658_10179438 | 3300025986 | Bacteria | 1751 |
| 428 | Ga0207658_10299763 | 3300025986 | Bacteria | 1384 |
| 429 | Ga0207677_10006208 | 3300026023 | Bacteria | 6531 |
| 430 | Ga0207677_10033552 | 3300026023 | Bacteria | 3314 |
| 431 | Ga0207677_10082792 | 3300026023 | Bacteria | 2307 |
| 432 | Ga0207677_10271124 | 3300026023 | Bacteria | 1388 |
| 433 | Ga0207703_10050431 | 3300026035 | Bacteria | 3369 |
| 434 | Ga0207639_10027963 | 3300026041 | Bacteria | 4112 |
| 435 | Ga0207639_10061069 | 3300026041 | Bacteria | 2909 |
| 436 | Ga0207639_10090405 | 3300026041 | Bacteria | 2449 |
| 437 | Ga0207639_10394033 | 3300026041 | Bacteria | 1246 |
| 438 | Ga0207678_10003260 | 3300026067 | Bacteria | 14649 |
| 439 | Ga0207678_10005283 | 3300026067 | Bacteria | 11565 |
| 440 | Ga0207678_10022460 | 3300026067 | Bacteria | 5525 |
| 441 | Ga0207678_10097563 | 3300026067 | Bacteria | 2512 |
| 442 | Ga0207708_10000079 | 3300026075 | Bacteria | 75645 |
| 443 | Ga0207708_10004147 | 3300026075 | Bacteria | 10661 |
| 444 | Ga0207708_10040962 | 3300026075 | Bacteria | 3532 |
| 445 | Ga0207708_10041659 | 3300026075 | Bacteria | 3500 |
| 446 | Ga0207708_10098638 | 3300026075 | Bacteria | 2259 |
| 447 | Ga0207702_10003467 | 3300026078 | Bacteria | 14378 |
| 448 | Ga0207702_10007249 | 3300026078 | Bacteria | 9483 |
| 449 | Ga0207702_10009020 | 3300026078 | Bacteria | 8399 |
| 450 | Ga0207702_10009804 | 3300026078 | Bacteria | 8033 |
| 451 | Ga0207702_10065014 | 3300026078 | Bacteria | 3123 |
| 452 | Ga0207702_10079263 | 3300026078 | Bacteria | 2846 |
| 453 | Ga0207702_10244375 | 3300026078 | Bacteria | 1683 |
| 454 | Ga0207641_10007288 | 3300026088 | Bacteria | 9215 |
| 455 | Ga0207641_10042624 | 3300026088 | Bacteria | 3808 |
| 456 | Ga0207641_10143157 | 3300026088 | Bacteria | 2159 |
| 457 | Ga0207648_10288414 | 3300026089 | Bacteria | 1469 |
| 458 | Ga0207676_10001689 | 3300026095 | Bacteria | 16285 |
| 459 | Ga0207676_10024112 | 3300026095 | Bacteria | 4499 |
| 460 | Ga0207674_10002289 | 3300026116 | Bacteria | 24291 |
| 461 | Ga0207675_100004892 | 3300026118 | Bacteria | 12913 |
| 462 | Ga0207675_100005587 | 3300026118 | Bacteria | 12035 |
| 463 | Ga0207675_100013049 | 3300026118 | Bacteria | 7757 |
| 464 | Ga0207675_100071254 | 3300026118 | Bacteria | 3249 |
| 465 | Ga0207675_100098146 | 3300026118 | Bacteria | 2759 |
| 466 | Ga0207675_100246196 | 3300026118 | Bacteria | 1729 |
| 467 | Ga0207683_10002016 | 3300026121 | Bacteria | 17976 |
| 468 | Ga0207683_10014903 | 3300026121 | Bacteria | 6617 |
| 469 | Ga0207683_10064724 | 3300026121 | Bacteria | 3222 |
| 470 | Ga0207698_10005452 | 3300026142 | Bacteria | 7868 |
| 471 | Ga0207698_10007141 | 3300026142 | Bacteria | 6994 |
| 472 | Ga0207698_10341715 | 3300026142 | Bacteria | 1410 |
| 473 | Ga0209813_10004368 | 3300027866 | Bacteria | 3376 |
| 474 | Ga0207428_10001703 | 3300027907 | Bacteria | 22568 |
| 475 | Ga0207428_10004857 | 3300027907 | Bacteria | 12676 |
| 476 | Ga0207428_10004938 | 3300027907 | Bacteria | 12561 |
| 477 | Ga0207428_10039060 | 3300027907 | Bacteria | 3855 |
| 478 | Ga0207428_10074534 | 3300027907 | Bacteria | 2661 |
| 479 | Ga0268266_10001751 | 3300028379 | Bacteria | 24833 |
| 480 | Ga0268266_10002253 | 3300028379 | Bacteria | 21001 |
| 481 | Ga0268266_10007568 | 3300028379 | Bacteria | 9782 |
| 482 | Ga0268266_10119528 | 3300028379 | Bacteria | 2343 |
| 483 | Ga0268265_10187757 | 3300028380 | Bacteria | 1782 |
| 484 | Ga0268264_10000206 | 3300028381 | Bacteria | 120365 |
| 485 | Ga0268264_10129225 | 3300028381 | Bacteria | 2237 |
| 486 | Ga0268264_10145684 | 3300028381 | Bacteria | 2117 |
| 487 | Ga0268264_10167270 | 3300028381 | Bacteria | 1986 |
| 488 | Ga0268264_10258154 | 3300028381 | Bacteria | 1622 |
| 489 | Ga0268264_10434983 | 3300028381 | Bacteria | 1268 |
| 490 | Ga0268264_10452264 | 3300028381 | Bacteria | 1244 |
| 491 | Ga0307515_10016003 | 3300028794 | Bacteria | 13769 |
| 492 | Ga0307515_10124905 | 3300028794 | Bacteria | 2884 |
| 493 | Ga0307515_10191725 | 3300028794 | Bacteria | 1951 |
| 494 | Ga0265338_10008883 | 3300028800 | Bacteria | 12105 |
| 495 | Ga0265338_10042643 | 3300028800 | Bacteria | 4222 |
| 496 | Ga0307511_10000622 | 3300030521 | Bacteria | 37906 |
| 497 | Ga0307512_10088690 | 3300030522 | Bacteria | 2169 |
| 498 | Ga0307513_10153391 | 3300031456 | Bacteria | 2208 |
| 499 | Ga0307408_100002497 | 3300031548 | Bacteria | 12877 |
| 500 | Ga0307408_100009663 | 3300031548 | Bacteria | 6359 |
| 501 | Ga0307408_100052016 | 3300031548 | Bacteria | 2953 |
| 502 | Ga0307408_100061215 | 3300031548 | Bacteria | 2747 |
| 503 | Ga0307408_100140928 | 3300031548 | Bacteria | 1892 |
| 504 | Ga0307408_100294609 | 3300031548 | Bacteria | 1356 |
| 505 | Ga0307514_10001799 | 3300031649 | Bacteria | 24110 |
| 506 | Ga0316576_10019948 | 3300031727 | Bacteria | 4601 |
| 507 | Ga0316576_10023650 | 3300031727 | Bacteria | 4283 |
| 508 | Ga0316578_10015874 | 3300031728 | Bacteria | 4063 |
| 509 | Ga0307405_10001256 | 3300031731 | Bacteria | 10573 |
| 510 | Ga0307405_10010328 | 3300031731 | Bacteria | 4830 |
| 511 | Ga0307405_10031204 | 3300031731 | Bacteria | 3134 |
| 512 | Ga0307405_10075773 | 3300031731 | Bacteria | 2180 |
| 513 | Ga0307405_10084320 | 3300031731 | Bacteria | 2086 |
| 514 | Ga0307405_10158654 | 3300031731 | Bacteria | 1599 |
| 515 | Ga0307405_10198357 | 3300031731 | Bacteria | 1455 |
| 516 | Ga0307405_10381310 | 3300031731 | Bacteria | 1097 |
| 517 | Ga0307413_10011099 | 3300031824 | Bacteria | 4409 |
| 518 | Ga0307413_10014122 | 3300031824 | Bacteria | 4042 |
| 519 | Ga0307410_10001264 | 3300031852 | Bacteria | 11237 |
| 520 | Ga0307410_10004512 | 3300031852 | Bacteria | 7211 |
| 521 | Ga0307410_10005638 | 3300031852 | Bacteria | 6655 |
| 522 | Ga0307410_10010737 | 3300031852 | Bacteria | 5206 |
| 523 | Ga0307410_10016997 | 3300031852 | Bacteria | 4355 |
| 524 | Ga0307410_10018609 | 3300031852 | Bacteria | 4202 |
| 525 | Ga0307410_10031345 | 3300031852 | Bacteria | 3411 |
| 526 | Ga0307410_10051718 | 3300031852 | Bacteria | 2770 |
| 527 | Ga0307410_10072631 | 3300031852 | Bacteria | 2390 |
| 528 | Ga0307410_10080637 | 3300031852 | Bacteria | 2283 |
| 529 | Ga0307410_10162348 | 3300031852 | Bacteria | 1675 |
| 530 | Ga0307410_10184428 | 3300031852 | Bacteria | 1582 |
| 531 | Ga0307410_10190154 | 3300031852 | Bacteria | 1560 |
| 532 | Ga0307410_10197945 | 3300031852 | Bacteria | 1532 |
| 533 | Ga0307410_10248195 | 3300031852 | Bacteria | 1383 |
| 534 | Ga0307410_10283180 | 3300031852 | Bacteria | 1302 |
| 535 | Ga0307406_10000595 | 3300031901 | Bacteria | 20772 |
| 536 | Ga0307406_10001047 | 3300031901 | Bacteria | 15422 |
| 537 | Ga0307406_10006377 | 3300031901 | Bacteria | 6509 |
| 538 | Ga0307406_10018591 | 3300031901 | Bacteria | 4063 |
| 539 | Ga0307406_10021269 | 3300031901 | Bacteria | 3835 |
| 540 | Ga0307406_10040156 | 3300031901 | Bacteria | 2908 |
| 541 | Ga0307406_10058828 | 3300031901 | Bacteria | 2471 |
| 542 | Ga0307406_10228694 | 3300031901 | Bacteria | 1387 |
| 543 | Ga0307407_10000253 | 3300031903 | Bacteria | 15855 |
| 544 | Ga0307407_10017546 | 3300031903 | Bacteria | 3595 |
| 545 | Ga0307407_10033253 | 3300031903 | Bacteria | 2812 |
| 546 | Ga0307407_10115344 | 3300031903 | Bacteria | 1693 |
| 547 | Ga0307412_10010395 | 3300031911 | Bacteria | 5359 |
| 548 | Ga0307412_10031033 | 3300031911 | Bacteria | 3371 |
| 549 | Ga0307412_10037420 | 3300031911 | Bacteria | 3118 |
| 550 | Ga0307412_10038661 | 3300031911 | Bacteria | 3074 |
| 551 | Ga0307412_10047335 | 3300031911 | Bacteria | 2824 |
| 552 | Ga0307412_10055274 | 3300031911 | Bacteria | 2639 |
| 553 | Ga0307409_100000147 | 3300031995 | Bacteria | 26624 |
| 554 | Ga0307409_100011956 | 3300031995 | Bacteria | 5503 |
| 555 | Ga0307409_100018062 | 3300031995 | Bacteria | 4725 |
| 556 | Ga0307409_100019463 | 3300031995 | Bacteria | 4597 |
| 557 | Ga0307409_100185049 | 3300031995 | Bacteria | 1848 |
| 558 | Ga0307409_100194383 | 3300031995 | Bacteria | 1809 |
| 559 | Ga0307409_100224661 | 3300031995 | Bacteria | 1697 |
| 560 | Ga0307409_100273292 | 3300031995 | Bacteria | 1557 |
| 561 | Ga0307409_100282245 | 3300031995 | Bacteria | 1535 |
| 562 | Ga0307416_100000096 | 3300032002 | Bacteria | 58513 |
| 563 | Ga0307416_100010393 | 3300032002 | Bacteria | 6144 |
| 564 | Ga0307416_100022433 | 3300032002 | Bacteria | 4557 |
| 565 | Ga0307416_100025175 | 3300032002 | Bacteria | 4359 |
| 566 | Ga0307416_100026971 | 3300032002 | Bacteria | 4244 |
| 567 | Ga0307416_100034413 | 3300032002 | Bacteria | 3855 |
| 568 | Ga0307416_100050287 | 3300032002 | Bacteria | 3321 |
| 569 | Ga0307416_100054738 | 3300032002 | Bacteria | 3208 |
| 570 | Ga0307416_100186731 | 3300032002 | Bacteria | 1949 |
| 571 | Ga0307416_100208289 | 3300032002 | Bacteria | 1862 |
| 572 | Ga0307416_100221178 | 3300032002 | Bacteria | 1816 |
| 573 | Ga0307416_100424631 | 3300032002 | Bacteria | 1374 |
| 574 | Ga0307414_10013682 | 3300032004 | Bacteria | 4840 |
| 575 | Ga0307414_10013769 | 3300032004 | Bacteria | 4824 |
| 576 | Ga0307414_10024990 | 3300032004 | Bacteria | 3818 |
| 577 | Ga0307414_10031963 | 3300032004 | Bacteria | 3459 |
| 578 | Ga0307414_10125226 | 3300032004 | Bacteria | 1984 |
| 579 | Ga0307414_10261254 | 3300032004 | Bacteria | 1445 |
| 580 | Ga0307411_10011885 | 3300032005 | Bacteria | 4722 |
| 581 | Ga0307411_10046650 | 3300032005 | Bacteria | 2795 |
| 582 | Ga0307411_10047739 | 3300032005 | Bacteria | 2770 |
| 583 | Ga0307411_10115608 | 3300032005 | Bacteria | 1930 |
| 584 | Ga0307415_100002035 | 3300032126 | Bacteria | 9975 |
| 585 | Ga0307415_100002748 | 3300032126 | Bacteria | 8796 |
| 586 | Ga0307415_100012020 | 3300032126 | Bacteria | 4987 |
| 587 | Ga0307415_100023785 | 3300032126 | Bacteria | 3811 |
| 588 | Ga0307415_100045786 | 3300032126 | Bacteria | 2936 |
| 589 | Ga0307415_100086212 | 3300032126 | Bacteria | 2259 |
| 590 | Ga0307415_100185743 | 3300032126 | Bacteria | 1635 |
| 591 | Ga0307415_100239930 | 3300032126 | Bacteria | 1465 |
| 592 | Ga0307415_100253936 | 3300032126 | Bacteria | 1430 |
| 593 | Ga0307510_10051130 | 3300033180 | Bacteria | 4374 |
| 594 | Ga0307510_10273201 | 3300033180 | Bacteria | 1165 |
| 595 | Ga0373930_0003603 | 3300034816 | Bacteria | 2469 |
| 596 | Ga0373938_0032708 | 3300034957 | Bacteria | 1121 |
| 597 | Ga0373926_0019149 | 3300035083 | Bacteria | 2359 |
| 598 | Ga0373928_0027634 | 3300035084 | Bacteria | 1236 |
| 599 | Ga0373934_0005656 | 3300035086 | Bacteria | 4629 |
| 600 | Ga0373934_0010153 | 3300035086 | Bacteria | 3534 |
| 601 | Ga0373951_0011909 | 3300035091 | Bacteria | 1956 |
| 602 | Ga0373952_0015890 | 3300035092 | Bacteria | 1524 |
| 603 | Ga0373923_0076069 | 3300035111 | Bacteria | 1449 |
| 604 | Ga0373936_0095722 | 3300035113 | Bacteria | 1248 |
| 605 | Ga0373939_0026490 | 3300035114 | Bacteria | 1635 |
| 606 | Ga0373945_0009239 | 3300035116 | Bacteria | 3226 |
| 607 | Ga0373953_0027907 | 3300035117 | Bacteria | 2172 |
| 608 | Ga0373953_0031275 | 3300035117 | Bacteria | 2069 |
| 609 | Ga0373954_0065345 | 3300035118 | Bacteria | 1721 |
| 610 | Ga0373956_0017640 | 3300035119 | Bacteria | 3012 |
| 611 | Ga0373956_0091858 | 3300035119 | Bacteria | 1401 |
| 612 | Ga0373946_0037040 | 3300035171 | Bacteria | 1981 |
| 613 | Ga0373955_0036062 | 3300035172 | Bacteria | 2622 |
| 614 | Ga0373955_0071321 | 3300035172 | Bacteria | 1943 |
| 615 | Ga0373955_0126488 | 3300035172 | Bacteria | 1489 |
| 616 | Ga0373942_0021099 | 3300035207 | Bacteria | 1641 |
| 617 | Ga0373961_0018750 | 3300035241 | Bacteria | 1810 |
| 618 | Ga0373962_0004504 | 3300035242 | Bacteria | 3370 |
| 619 | Ga0373962_0043489 | 3300035242 | Bacteria | 1273 |
| 620 | Ga0373924_0005264 | 3300035410 | Bacteria | 4573 |
| 621 | Ga0373924_0100898 | 3300035410 | Bacteria | 1241 |
| 622 | Ga0373935_0045918 | 3300035692 | Bacteria | 2757 |
| 623 | Ga0373927_0021229 | 3300035695 | Bacteria | 4254 |
| 624 | Ga0373933_0007620 | 3300035724 | Bacteria | 5909 |
| 625 | Ga0373937_0017333 | 3300036401 | Bacteria | 6415 |
| 626 | Ga0373937_0022991 | 3300036401 | Bacteria | 5606 |
| 627 | Ga0373937_0036984 | 3300036401 | Bacteria | 4448 |
| 628 | Ga0316584_0056317 | 3300036712 | Bacteria | 2943 |
| 629 | Ga0373925_0001809 | 3300037068 | Bacteria | 17846 |
| 630 | Ga0373925_0043453 | 3300037068 | Bacteria | 3335 |
| 631 | Ga0373925_0099419 | 3300037068 | Bacteria | 2234 |
| 632 | Ga0373925_0242548 | 3300037068 | Bacteria | 1444 |
| 633 | Ga0395899_0003411 | 3300037312 | Bacteria | 12611 |
| 634 | Ga0395899_0184421 | 3300037312 | Bacteria | 1463 |
| 635 | Ga0395900_0014998 | 3300037418 | Bacteria | 7898 |
| 636 | Ga0395900_0028142 | 3300037418 | Bacteria | 5756 |
| 637 | Ga0395900_0078843 | 3300037418 | Bacteria | 3384 |
| 638 | Ga0395900_0270917 | 3300037418 | Bacteria | 1692 |
| 639 | Ga0395898_0031104 | 3300037466 | Bacteria | 5338 |
| 640 | Ga0395898_0033898 | 3300037466 | Bacteria | 5092 |
| 641 | Ga0395898_0039158 | 3300037466 | Bacteria | 4693 |
| 642 | Ga0395898_0053847 | 3300037466 | Bacteria | 3928 |
| 643 | Ga0395898_0077491 | 3300037466 | Bacteria | 3209 |
| 644 | Ga0395905_0021363 | 3300037471 | Bacteria | 6121 |
| 645 | Ga0395905_0408883 | 3300037471 | Bacteria | 1252 |
| 646 | Ga0436364_0132104 | 3300037853 | Bacteria | 4671 |
| 647 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 648 | Ga0436364_1090900 | 3300037853 | Bacteria | 1236 |
| 649 | Ga0436364_1282665 | 3300037853 | Bacteria | 3935 |
| 650 | Ga0436364_1519328 | 3300037853 | Bacteria | 8051 |
| 651 | Ga0395901_0003177 | 3300038443 | Bacteria | 16531 |
| 652 | Ga0395901_0014684 | 3300038443 | Bacteria | 7959 |
| 653 | Ga0395901_0017075 | 3300038443 | Bacteria | 7399 |
| 654 | Ga0395901_0068803 | 3300038443 | Bacteria | 3688 |
| 655 | Ga0395901_0071769 | 3300038443 | Bacteria | 3609 |
| 656 | Ga0395901_0145868 | 3300038443 | Bacteria | 2487 |
| 657 | Ga0436365_0073587 | 3300039437 | Bacteria | 3071 |
| 658 | Ga0436365_1172453 | 3300039437 | Bacteria | 1220 |
| 659 | Ga0436365_1403056 | 3300039437 | Bacteria | 1364 |
| 660 | Ga0436363_0081723 | 3300039450 | Bacteria | 1198 |
| 661 | Ga0436363_1665714 | 3300039450 | Bacteria | 1758 |
| 662 | Ga0436362_0714019 | 3300039453 | Bacteria | 1326 |
| 663 | Ga0439436_0008336 | 3300041404 | Bacteria | 3183 |
| 664 | Ga0439439_0000161 | 3300041406 | Bacteria | 9930 |
| 665 | Ga0439461_0005937 | 3300041410 | Bacteria | 2108 |
| 666 | Ga0439466_0005934 | 3300041411 | Bacteria | 4647 |
| 667 | Ga0439465_0020465 | 3300041413 | Bacteria | 2073 |
| 668 | Ga0439433_0002516 | 3300041999 | Bacteria | 3892 |
| 669 | Ga0439442_000029 | 3300042002 | Bacteria | 33495 |
| 670 | Ga0439432_003644 | 3300042006 | Bacteria | 5692 |
| 671 | Ga0439449_0000228 | 3300042007 | Bacteria | 20163 |
| 672 | Ga0439449_0012024 | 3300042007 | Bacteria | 3252 |
| 673 | Ga0439452_007360 | 3300042010 | Bacteria | 3376 |
| 674 | Ga0439455_0025867 | 3300042012 | Bacteria | 1429 |
| 675 | Ga0439457_003434 | 3300042014 | Bacteria | 4306 |
| 676 | Ga0439463_049367 | 3300042016 | Bacteria | 1073 |
| 677 | Ga0450919_000141 | 3300042121 | Bacteria | 7493 |
| 678 | Ga0450920_000615 | 3300042122 | Bacteria | 5679 |
| 679 | Ga0450900_003192 | 3300042136 | Bacteria | 1804 |
| 680 | Ga0450907_000142 | 3300042146 | Bacteria | 27461 |
| 681 | Ga0450907_007996 | 3300042146 | Bacteria | 1761 |
| 682 | Ga0450908_000689 | 3300042184 | Bacteria | 6481 |
| 683 | Ga0450908_006101 | 3300042184 | Bacteria | 2298 |
| 684 | Ga0450909_000040 | 3300042185 | Bacteria | 10739 |
| 685 | Ga0439434_0000010 | 3300042435 | Bacteria | 48982 |
| 686 | Ga0439444_0003764 | 3300042437 | Bacteria | 2163 |
| 687 | Ga0439459_0001201 | 3300042438 | Bacteria | 3777 |
| 688 | Ga0439464_0018006 | 3300042439 | Bacteria | 1920 |
| 689 | Ga0450918_001024 | 3300042531 | Bacteria | 5789 |
| 690 | Ga0439440_0046954 | 3300042993 | Bacteria | 1068 |
| 691 | Ga0466969_0021281 | 3300044656 | Bacteria | 3354 |
| 692 | Ga0466972_0004035 | 3300044658 | Bacteria | 7321 |
| 693 | Ga0466972_0009892 | 3300044658 | Bacteria | 4786 |
| 694 | Ga0466965_0000871 | 3300044683 | Bacteria | 11501 |
| 695 | Ga0466965_0007131 | 3300044683 | Bacteria | 5117 |
| 696 | Ga0466965_0009613 | 3300044683 | Bacteria | 4497 |
| 697 | Ga0466965_0161680 | 3300044683 | Bacteria | 1174 |
| 698 | Ga0466966_0014054 | 3300044684 | Bacteria | 5300 |
| 699 | Ga0466966_0050102 | 3300044684 | Bacteria | 2657 |
| 700 | Ga0466966_0099830 | 3300044684 | Bacteria | 1796 |
| 701 | Ga0466961_0012501 | 3300044693 | Bacteria | 5434 |
| 702 | Ga0466961_0059196 | 3300044693 | Bacteria | 2436 |
| 703 | Ga0466961_0062550 | 3300044693 | Bacteria | 2365 |
| 704 | Ga0466961_0148278 | 3300044693 | Bacteria | 1466 |
| 705 | Ga0466961_0195877 | 3300044693 | Bacteria | 1251 |
| 706 | Ga0466963_0013798 | 3300044694 | Bacteria | 4972 |
| 707 | Ga0466963_0031995 | 3300044694 | Bacteria | 3403 |
| 708 | Ga0466963_0135378 | 3300044694 | Bacteria | 1704 |
| 709 | Ga0466963_0135649 | 3300044694 | Bacteria | 1703 |
| 710 | Ga0466963_0170616 | 3300044694 | Bacteria | 1516 |
| 711 | Ga0466963_0184063 | 3300044694 | Bacteria | 1459 |
| 712 | Ga0466963_0202789 | 3300044694 | Bacteria | 1387 |
| 713 | Ga0466963_0249901 | 3300044694 | Bacteria | 1244 |
| 714 | Ga0466964_0008788 | 3300044706 | Bacteria | 3797 |
| 715 | Ga0466964_0035553 | 3300044706 | Bacteria | 1993 |
| 716 | Ga0466970_0000150 | 3300044765 | Bacteria | 32514 |
| 717 | Ga0466970_0007824 | 3300044765 | Bacteria | 5366 |
| 718 | Ga0466970_0008844 | 3300044765 | Bacteria | 5075 |
| 719 | Ga0466970_0023143 | 3300044765 | Bacteria | 3243 |
| 720 | Ga0466957_0066658 | 3300044842 | Bacteria | 2220 |
| 721 | Ga0466960_0000282 | 3300044901 | Bacteria | 17703 |
| 722 | Ga0466960_0005943 | 3300044901 | Bacteria | 4868 |
| 723 | Ga0466960_0015763 | 3300044901 | Bacteria | 3265 |
| 724 | Ga0466960_0024185 | 3300044901 | Bacteria | 2738 |
| 725 | Ga0466960_0050805 | 3300044901 | Bacteria | 2000 |
| 726 | Ga0466960_0149300 | 3300044901 | Bacteria | 1247 |
| 727 | Ga0466959_0012810 | 3300045049 | Bacteria | 6067 |
| 728 | Ga0466959_0065780 | 3300045049 | Bacteria | 2631 |
| 729 | Ga0466959_0068943 | 3300045049 | Bacteria | 2562 |
| 730 | Ga0466959_0121312 | 3300045049 | Bacteria | 1858 |
| 731 | Ga0466959_0150714 | 3300045049 | Bacteria | 1639 |
| 732 | Ga0466959_0152888 | 3300045049 | Bacteria | 1625 |
| 733 | Ga0466959_0180620 | 3300045049 | Bacteria | 1476 |
| 734 | Ga0466958_0007658 | 3300045836 | Bacteria | 5953 |
| 735 | Ga0466958_0011282 | 3300045836 | Bacteria | 5031 |
| 736 | Ga0466958_0045020 | 3300045836 | Bacteria | 2661 |
| 737 | Ga0466958_0058386 | 3300045836 | Bacteria | 2346 |
| 738 | Ga0466958_0104555 | 3300045836 | Bacteria | 1764 |
| 739 | Ga0466958_0130492 | 3300045836 | Bacteria | 1578 |
| 740 | Ga0466967_0007515 | 3300045976 | Bacteria | 7870 |
| 741 | Ga0466967_0009740 | 3300045976 | Bacteria | 7158 |
| 742 | Ga0466967_0010973 | 3300045976 | Bacteria | 6830 |
| 743 | Ga0466967_0012807 | 3300045976 | Bacteria | 6443 |
| 744 | Ga0466967_0064319 | 3300045976 | Bacteria | 3262 |
| 745 | Ga0466967_0069869 | 3300045976 | Bacteria | 3140 |
| 746 | Ga0466967_0090733 | 3300045976 | Bacteria | 2776 |
| 747 | Ga0466967_0181913 | 3300045976 | Bacteria | 1983 |
| 748 | Ga0466967_0218983 | 3300045976 | Bacteria | 1808 |
| 749 | Ga0466967_0468838 | 3300045976 | Bacteria | 1232 |
| 750 | Ga0466967_0483104 | 3300045976 | Bacteria | 1214 |
| 751 | Ga0495627_002964 | 3300046453 | Bacteria | 7781 |
| 752 | Ga0495592_0030345 | 3300046454 | Bacteria | 4090 |
| 753 | Ga0495592_0038595 | 3300046454 | Bacteria | 3592 |
| 754 | Ga0495592_0236637 | 3300046454 | Bacteria | 1213 |
| 755 | Ga0495629_0002738 | 3300046459 | Bacteria | 13485 |
| 756 | Ga0495641_0003000 | 3300046461 | Bacteria | 12951 |
| 757 | Ga0495651_0125577 | 3300046462 | Bacteria | 1879 |
| 758 | Ga0495651_0127886 | 3300046462 | Bacteria | 1858 |
| 759 | Ga0495653_0017203 | 3300046463 | Bacteria | 5879 |
| 760 | Ga0495650_0065073 | 3300046471 | Bacteria | 1448 |
| 761 | Ga0495580_0002952 | 3300046472 | Bacteria | 14598 |
| 762 | Ga0495580_0016727 | 3300046472 | Bacteria | 5504 |
| 763 | Ga0495580_0035290 | 3300046472 | Bacteria | 3596 |
| 764 | Ga0495639_0000642 | 3300046475 | Bacteria | 16098 |
| 765 | Ga0495639_0054817 | 3300046475 | Bacteria | 1817 |
| 766 | Ga0495662_0010364 | 3300046476 | Bacteria | 4566 |
| 767 | Ga0495664_0058920 | 3300046477 | Bacteria | 2285 |
| 768 | Ga0495594_0043628 | 3300046499 | Bacteria | 2458 |
| 769 | Ga0495608_0024284 | 3300046511 | Bacteria | 4147 |
| 770 | Ga0495608_0044518 | 3300046511 | Bacteria | 2962 |
| 771 | Ga0495608_0069970 | 3300046511 | Bacteria | 2290 |
| 772 | Ga0495620_0025413 | 3300046515 | Bacteria | 2802 |
| 773 | Ga0495628_0057436 | 3300046516 | Bacteria | 3061 |
| 774 | Ga0495628_0148649 | 3300046516 | Bacteria | 1785 |
| 775 | Ga0495631_0081177 | 3300046518 | Bacteria | 1399 |
| 776 | Ga0495666_0037827 | 3300046526 | Bacteria | 2346 |
| 777 | Ga0495642_0025176 | 3300046528 | Bacteria | 2357 |
| 778 | Ga0495652_0032726 | 3300046529 | Bacteria | 4544 |
| 779 | Ga0495652_0040565 | 3300046529 | Bacteria | 4023 |
| 780 | Ga0495665_0011398 | 3300046531 | Bacteria | 4810 |
| 781 | Ga0495586_0080314 | 3300046535 | Bacteria | 1791 |
| 782 | Ga0495587_0033362 | 3300046536 | Bacteria | 3108 |
| 783 | Ga0495587_0053737 | 3300046536 | Bacteria | 2374 |
| 784 | Ga0495645_0005099 | 3300046543 | Bacteria | 9002 |
| 785 | Ga0495645_0044610 | 3300046543 | Bacteria | 3233 |
| 786 | Ga0495645_0045334 | 3300046543 | Bacteria | 3208 |
| 787 | Ga0495645_0165100 | 3300046543 | Bacteria | 1528 |
| 788 | Ga0495667_0004412 | 3300046559 | Bacteria | 9489 |
| 789 | Ga0495667_0015217 | 3300046559 | Bacteria | 5193 |
| 790 | Ga0495667_0134413 | 3300046559 | Bacteria | 1595 |
| 791 | Ga0495625_0253701 | 3300046660 | Bacteria | 1141 |
| 792 | Ga0495635_0021655 | 3300046663 | Bacteria | 4481 |
| 793 | Ga0495588_0098597 | 3300046674 | Bacteria | 1534 |
| 794 | Ga0495588_0099233 | 3300046674 | Bacteria | 1529 |
| 795 | Ga0495657_0009553 | 3300046675 | Bacteria | 7349 |
| 796 | Ga0495657_0030812 | 3300046675 | Bacteria | 3753 |
| 797 | Ga0495657_0083948 | 3300046675 | Bacteria | 2055 |
| 798 | Ga0495646_0017982 | 3300046680 | Bacteria | 4478 |
| 799 | Ga0495646_0141249 | 3300046680 | Bacteria | 1346 |
| 800 | Ga0495647_0015235 | 3300046681 | Bacteria | 2691 |
| 801 | Ga0495613_0110432 | 3300046689 | Bacteria | 1981 |
| 802 | Ga0495624_0033375 | 3300046690 | Bacteria | 3333 |
| 803 | Ga0495624_0101773 | 3300046690 | Bacteria | 1769 |
| 804 | Ga0495670_0133957 | 3300046691 | Bacteria | 1293 |
| 805 | Ga0495670_0143316 | 3300046691 | Bacteria | 1250 |
| 806 | Ga0495600_0029094 | 3300046809 | Bacteria | 3576 |
| 807 | Ga0495600_0040078 | 3300046809 | Bacteria | 3050 |
| 808 | Ga0495600_0095292 | 3300046809 | Bacteria | 1940 |
| 809 | Ga0495600_0141232 | 3300046809 | Bacteria | 1562 |
| 810 | Ga0495581_0003879 | 3300047315 | Bacteria | 8593 |
| 811 | Ga0495581_0027345 | 3300047315 | Bacteria | 3307 |
| 812 | Ga0495581_0067330 | 3300047315 | Bacteria | 2071 |
| 813 | Ga0495604_0015370 | 3300047317 | Bacteria | 6108 |
| 814 | Ga0495604_0069493 | 3300047317 | Bacteria | 2669 |
| 815 | Ga0495674_0106280 | 3300047319 | Bacteria | 2384 |
| 816 | Ga0495674_0184210 | 3300047319 | Bacteria | 1737 |
| 817 | Ga0495674_0288944 | 3300047319 | Bacteria | 1341 |
| 818 | Ga0495676_0038360 | 3300047321 | Bacteria | 3978 |
| 819 | Ga0495680_0027796 | 3300047322 | Bacteria | 4641 |
| 820 | Ga0495680_0088467 | 3300047322 | Bacteria | 2327 |
| 821 | Ga0495680_0162550 | 3300047322 | Bacteria | 1620 |
| 822 | Ga0495680_0271420 | 3300047322 | Bacteria | 1197 |
| 823 | Ga0495675_0016883 | 3300047444 | Bacteria | 4618 |
| 824 | Ga0495675_0057352 | 3300047444 | Bacteria | 2469 |
| 825 | Ga0495675_0144771 | 3300047444 | Bacteria | 1471 |
| 826 | Ga0495685_059617 | 3300047447 | Bacteria | 1288 |
| 827 | Ga0495681_0043752 | 3300047470 | Bacteria | 2157 |
| 828 | Ga0495684_0064419 | 3300047471 | Bacteria | 2785 |
| 829 | Ga0495684_0072610 | 3300047471 | Bacteria | 2614 |
| 830 | Ga0495684_0155255 | 3300047471 | Bacteria | 1709 |
| 831 | Ga0495602_0038750 | 3300048088 | Bacteria | 4400 |
| 832 | Ga0495602_0146120 | 3300048088 | Bacteria | 1865 |
| 833 | Ga0495614_0044160 | 3300048089 | Bacteria | 1911 |
| 834 | Ga0496100_0004473 | 3300048903 | Bacteria | 7417 |
| 835 | Ga0496100_0094009 | 3300048903 | Bacteria | 2052 |
| 836 | Ga0496101_0001474 | 3300048904 | Bacteria | 14059 |
| 837 | Ga0496101_0020193 | 3300048904 | Bacteria | 4555 |
| 838 | Ga0496101_0031996 | 3300048904 | Bacteria | 3700 |
| 839 | Ga0496101_0060077 | 3300048904 | Bacteria | 2757 |
| 840 | Ga0496101_0138647 | 3300048904 | Bacteria | 1852 |
| 841 | Ga0496101_0222963 | 3300048904 | Bacteria | 1463 |
| 842 | Ga0496102_0000408 | 3300048905 | Bacteria | 49838 |
| 843 | Ga0496102_0004562 | 3300048905 | Bacteria | 11702 |
| 844 | Ga0496102_0014349 | 3300048905 | Bacteria | 6883 |
| 845 | Ga0496102_0020875 | 3300048905 | Bacteria | 5789 |
| 846 | Ga0496102_0064776 | 3300048905 | Bacteria | 3348 |
| 847 | Ga0496102_0130357 | 3300048905 | Bacteria | 2353 |
| 848 | Ga0496102_0193159 | 3300048905 | Bacteria | 1918 |
| 849 | Ga0496102_0295322 | 3300048905 | Bacteria | 1527 |
| 850 | Ga0496103_0000422 | 3300048906 | Bacteria | 37002 |
| 851 | Ga0496103_0023773 | 3300048906 | Bacteria | 3695 |
| 852 | Ga0496103_0038436 | 3300048906 | Bacteria | 2936 |
| 853 | Ga0496103_0077445 | 3300048906 | Bacteria | 2087 |
| 854 | Ga0496104_0002039 | 3300048907 | Bacteria | 17538 |
| 855 | Ga0496104_0003015 | 3300048907 | Bacteria | 14505 |
| 856 | Ga0496104_0003968 | 3300048907 | Bacteria | 12807 |
| 857 | Ga0496104_0011156 | 3300048907 | Bacteria | 8040 |
| 858 | Ga0496104_0013081 | 3300048907 | Bacteria | 7476 |
| 859 | Ga0496104_0021678 | 3300048907 | Bacteria | 5900 |
| 860 | Ga0496104_0030331 | 3300048907 | Bacteria | 5024 |
| 861 | Ga0496104_0224854 | 3300048907 | Bacteria | 1789 |
| 862 | Ga0496105_0004304 | 3300048908 | Bacteria | 10719 |
| 863 | Ga0496105_0004398 | 3300048908 | Bacteria | 10607 |
| 864 | Ga0496105_0015525 | 3300048908 | Bacteria | 6071 |
| 865 | Ga0496105_0033168 | 3300048908 | Bacteria | 4239 |
| 866 | Ga0496105_0034871 | 3300048908 | Bacteria | 4140 |
| 867 | Ga0496105_0078654 | 3300048908 | Bacteria | 2723 |
| 868 | Ga0496105_0102644 | 3300048908 | Bacteria | 2361 |
| 869 | Ga0496105_0302508 | 3300048908 | Bacteria | 1285 |
| 870 | Ga0496106_0005256 | 3300048909 | Bacteria | 9594 |
| 871 | Ga0496106_0010733 | 3300048909 | Bacteria | 6770 |
| 872 | Ga0496106_0025161 | 3300048909 | Bacteria | 4428 |
| 873 | Ga0496106_0052916 | 3300048909 | Bacteria | 3065 |
| 874 | Ga0496106_0245883 | 3300048909 | Bacteria | 1429 |
| 875 | Ga0496107_0034654 | 3300048910 | Bacteria | 3616 |
| 876 | Ga0496107_0046180 | 3300048910 | Bacteria | 3134 |
| 877 | Ga0496107_0068600 | 3300048910 | Bacteria | 2573 |
| 878 | Ga0496107_0152770 | 3300048910 | Bacteria | 1708 |
| 879 | Ga0496108_0003215 | 3300048911 | Bacteria | 13140 |
| 880 | Ga0496108_0005025 | 3300048911 | Bacteria | 10686 |
| 881 | Ga0496108_0021705 | 3300048911 | Bacteria | 5279 |
| 882 | Ga0496108_0027927 | 3300048911 | Bacteria | 4665 |
| 883 | Ga0496108_0043434 | 3300048911 | Bacteria | 3754 |
| 884 | Ga0496108_0073731 | 3300048911 | Bacteria | 2881 |
| 885 | Ga0496108_0102973 | 3300048911 | Bacteria | 2436 |
| 886 | Ga0496108_0109788 | 3300048911 | Bacteria | 2357 |
| 887 | Ga0496108_0119346 | 3300048911 | Bacteria | 2261 |
| 888 | Ga0496109_0006631 | 3300048912 | Bacteria | 9749 |
| 889 | Ga0496109_0013084 | 3300048912 | Bacteria | 7177 |
| 890 | Ga0496109_0017008 | 3300048912 | Bacteria | 6365 |
| 891 | Ga0496109_0021560 | 3300048912 | Bacteria | 5698 |
| 892 | Ga0496109_0022687 | 3300048912 | Bacteria | 5560 |
| 893 | Ga0496109_0026938 | 3300048912 | Bacteria | 5127 |
| 894 | Ga0496109_0064608 | 3300048912 | Bacteria | 3349 |
| 895 | Ga0496109_0228185 | 3300048912 | Bacteria | 1751 |
| 896 | Ga0496109_0308943 | 3300048912 | Bacteria | 1492 |
| 897 | Ga0496110_0000297 | 3300048913 | Bacteria | 32605 |
| 898 | Ga0496110_0005654 | 3300048913 | Bacteria | 9809 |
| 899 | Ga0496110_0009807 | 3300048913 | Bacteria | 7757 |
| 900 | Ga0496110_0051624 | 3300048913 | Bacteria | 3613 |
| 901 | Ga0496110_0158383 | 3300048913 | Bacteria | 2052 |
| 902 | Ga0496110_0393181 | 3300048913 | Bacteria | 1264 |
| 903 | Ga0496111_0001007 | 3300048914 | Bacteria | 15451 |
| 904 | Ga0496111_0005756 | 3300048914 | Bacteria | 7999 |
| 905 | Ga0496111_0014929 | 3300048914 | Bacteria | 5319 |
| 906 | Ga0496111_0034702 | 3300048914 | Bacteria | 3602 |
| 907 | Ga0496111_0087583 | 3300048914 | Bacteria | 2279 |
| 908 | Ga0496111_0190053 | 3300048914 | Bacteria | 1526 |
| 909 | Ga0496112_0002386 | 3300048915 | Bacteria | 15114 |
| 910 | Ga0496112_0014634 | 3300048915 | Bacteria | 7290 |
| 911 | Ga0496112_0023182 | 3300048915 | Bacteria | 5925 |
| 912 | Ga0496112_0049018 | 3300048915 | Bacteria | 4139 |
| 913 | Ga0496112_0068652 | 3300048915 | Bacteria | 3500 |
| 914 | Ga0496112_0101250 | 3300048915 | Bacteria | 2851 |
| 915 | Ga0496112_0220395 | 3300048915 | Bacteria | 1853 |
| 916 | Ga0496113_0031268 | 3300048916 | Bacteria | 3862 |
| 917 | Ga0496113_0045275 | 3300048916 | Bacteria | 3263 |
| 918 | Ga0496113_0167675 | 3300048916 | Bacteria | 1738 |
| 919 | Ga0496113_0245628 | 3300048916 | Bacteria | 1428 |
| 920 | Ga0496113_0253032 | 3300048916 | Bacteria | 1406 |
| 921 | Ga0496114_0005860 | 3300048917 | Bacteria | 9651 |
| 922 | Ga0496114_0043680 | 3300048917 | Bacteria | 3716 |
| 923 | Ga0496114_0056947 | 3300048917 | Bacteria | 3263 |
| 924 | Ga0496114_0098187 | 3300048917 | Bacteria | 2496 |
| 925 | Ga0496114_0189083 | 3300048917 | Bacteria | 1801 |
| 926 | Ga0496114_0191105 | 3300048917 | Bacteria | 1791 |
| 927 | Ga0496114_0252825 | 3300048917 | Bacteria | 1551 |
| 928 | Ga0496114_0259367 | 3300048917 | Bacteria | 1530 |
| 929 | Ga0496115_0004879 | 3300048918 | Bacteria | 9736 |
| 930 | Ga0496115_0028842 | 3300048918 | Bacteria | 4353 |
| 931 | Ga0496115_0095728 | 3300048918 | Bacteria | 2430 |
| 932 | Ga0496115_0106044 | 3300048918 | Bacteria | 2307 |
| 933 | Ga0496116_0000688 | 3300048919 | Bacteria | 43887 |
| 934 | Ga0496116_0016328 | 3300048919 | Bacteria | 5811 |
| 935 | Ga0496117_0000053 | 3300048920 | Bacteria | 279396 |
| 936 | Ga0496117_0000615 | 3300048920 | Bacteria | 57676 |
| 937 | Ga0496117_0001799 | 3300048920 | Bacteria | 29138 |
| 938 | Ga0496117_0022343 | 3300048920 | Bacteria | 5077 |
| 939 | Ga0496118_0001711 | 3300048921 | Bacteria | 32018 |
| 940 | Ga0496118_0020800 | 3300048921 | Bacteria | 5807 |
| 941 | Ga0496119_0004593 | 3300048922 | Bacteria | 13637 |
| 942 | Ga0496119_0006393 | 3300048922 | Bacteria | 10950 |
| 943 | Ga0496119_0007748 | 3300048922 | Bacteria | 9590 |
| 944 | Ga0496119_0011021 | 3300048922 | Bacteria | 7537 |
| 945 | Ga0496119_0019949 | 3300048922 | Bacteria | 4910 |
| 946 | Ga0496119_0074968 | 3300048922 | Bacteria | 1968 |
| 947 | Ga0496120_0001595 | 3300048923 | Bacteria | 26374 |
| 948 | Ga0496120_0002066 | 3300048923 | Bacteria | 21596 |
| 949 | Ga0496120_0003326 | 3300048923 | Bacteria | 14773 |
| 950 | Ga0496120_0004880 | 3300048923 | Bacteria | 10930 |
| 951 | Ga0496121_0007937 | 3300048924 | Bacteria | 12683 |
| 952 | Ga0496122_0000031 | 3300048925 | Bacteria | 329726 |
| 953 | Ga0496122_0004958 | 3300048925 | Bacteria | 16126 |
| 954 | Ga0496122_0042957 | 3300048925 | Bacteria | 3548 |
| 955 | Ga0496122_0048019 | 3300048925 | Bacteria | 3288 |
| 956 | Ga0496122_0192961 | 3300048925 | Bacteria | 1200 |
| 957 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 958 | Ga0496123_0003480 | 3300048926 | Bacteria | 17593 |
| 959 | Ga0496123_0018843 | 3300048926 | Bacteria | 5468 |
| 960 | Ga0496123_0052050 | 3300048926 | Bacteria | 2721 |
| 961 | Ga0496124_0013716 | 3300048927 | Bacteria | 7890 |
| 962 | Ga0496124_0019590 | 3300048927 | Bacteria | 6288 |
| 963 | Ga0496124_0021487 | 3300048927 | Bacteria | 5945 |
| 964 | Ga0496124_0066258 | 3300048927 | Bacteria | 3008 |
| 965 | Ga0496125_0000077 | 3300048928 | Bacteria | 232629 |
| 966 | Ga0496125_0010943 | 3300048928 | Bacteria | 9117 |
| 967 | Ga0496125_0022776 | 3300048928 | Bacteria | 5807 |
| 968 | Ga0496125_0024822 | 3300048928 | Bacteria | 5502 |
| 969 | Ga0496125_0057287 | 3300048928 | Bacteria | 3157 |
| 970 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 971 | Ga0496126_0001071 | 3300048929 | Bacteria | 46057 |
| 972 | Ga0496126_0002399 | 3300048929 | Bacteria | 25438 |
| 973 | Ga0496126_0019364 | 3300048929 | Bacteria | 6704 |
| 974 | Ga0496126_0092532 | 3300048929 | Bacteria | 2656 |
| 975 | Ga0496126_0136302 | 3300048929 | Bacteria | 2117 |
| 976 | Ga0496126_0144272 | 3300048929 | Bacteria | 2047 |
| 977 | Ga0496126_0344362 | 3300048929 | Bacteria | 1220 |
| 978 | Ga0501309_001974 | 3300049129 | Bacteria | 2136 |
| 979 | Ga0501321_005252 | 3300049537 | Bacteria | 1273 |
| 980 | Ga0501031_0001624 | 3300049568 | Bacteria | 14068 |
| 981 | Ga0501031_0023230 | 3300049568 | Bacteria | 4042 |
| 982 | Ga0501032_0000056 | 3300049569 | Bacteria | 98236 |
| 983 | Ga0501032_0001570 | 3300049569 | Bacteria | 18219 |
| 984 | Ga0501032_0013108 | 3300049569 | Bacteria | 5905 |
| 985 | Ga0501032_0017506 | 3300049569 | Bacteria | 5031 |
| 986 | Ga0501033_0001130 | 3300049570 | Bacteria | 24171 |
| 987 | Ga0501033_0154960 | 3300049570 | Bacteria | 1651 |
| 988 | Ga0501033_0168797 | 3300049570 | Bacteria | 1572 |
| 989 | Ga0501034_0000123 | 3300049571 | Bacteria | 143688 |
| 990 | Ga0501034_0001982 | 3300049571 | Bacteria | 25917 |
| 991 | Ga0501034_0004224 | 3300049571 | Bacteria | 16040 |
| 992 | Ga0501034_0012389 | 3300049571 | Bacteria | 8808 |
| 993 | Ga0501034_0016472 | 3300049571 | Bacteria | 7586 |
| 994 | Ga0501034_0089184 | 3300049571 | Bacteria | 3082 |
| 995 | Ga0501036_0000057 | 3300049572 | Bacteria | 72542 |
| 996 | Ga0501036_0013945 | 3300049572 | Bacteria | 6684 |
| 997 | Ga0501036_0159175 | 3300049572 | Bacteria | 1904 |
| 998 | Ga0501037_0000361 | 3300049573 | Bacteria | 38179 |
| 999 | Ga0501037_0001615 | 3300049573 | Bacteria | 16386 |
| 1000 | Ga0501037_0028153 | 3300049573 | Bacteria | 4151 |
| 1001 | Ga0501037_0270618 | 3300049573 | Bacteria | 1185 |
| 1002 | Ga0501038_0011612 | 3300049574 | Bacteria | 8035 |
| 1003 | Ga0501038_0016515 | 3300049574 | Bacteria | 6690 |
| 1004 | Ga0501038_0026722 | 3300049574 | Bacteria | 5139 |
| 1005 | Ga0501038_0030042 | 3300049574 | Bacteria | 4811 |
| 1006 | Ga0501038_0030340 | 3300049574 | Bacteria | 4785 |
| 1007 | Ga0501038_0291179 | 3300049574 | Bacteria | 1283 |
| 1008 | Ga0501039_0000623 | 3300049575 | Bacteria | 25628 |
| 1009 | Ga0501039_0007694 | 3300049575 | Bacteria | 8226 |
| 1010 | Ga0501039_0109137 | 3300049575 | Bacteria | 2163 |
| 1011 | Ga0501039_0333854 | 3300049575 | Bacteria | 1191 |
| 1012 | Ga0501040_0055813 | 3300049576 | Bacteria | 2709 |
| 1013 | Ga0501040_0070019 | 3300049576 | Bacteria | 2420 |
| 1014 | Ga0501040_0088206 | 3300049576 | Bacteria | 2154 |
| 1015 | Ga0501041_0022715 | 3300049577 | Bacteria | 3757 |
| 1016 | Ga0501041_0025945 | 3300049577 | Bacteria | 3523 |
| 1017 | Ga0501042_0016724 | 3300049578 | Bacteria | 5042 |
| 1018 | Ga0501042_0028001 | 3300049578 | Bacteria | 3966 |
| 1019 | Ga0501042_0067894 | 3300049578 | Bacteria | 2549 |
| 1020 | Ga0501042_0273113 | 3300049578 | Bacteria | 1220 |
| 1021 | Ga0501043_0000755 | 3300049579 | Bacteria | 28766 |
| 1022 | Ga0501043_0004811 | 3300049579 | Bacteria | 10930 |
| 1023 | Ga0501043_0010156 | 3300049579 | Bacteria | 7380 |
| 1024 | Ga0501043_0017886 | 3300049579 | Bacteria | 5558 |
| 1025 | Ga0501043_0035628 | 3300049579 | Bacteria | 3914 |
| 1026 | Ga0501043_0042257 | 3300049579 | Bacteria | 3582 |
| 1027 | Ga0501043_0071250 | 3300049579 | Bacteria | 2730 |
| 1028 | Ga0501043_0265204 | 3300049579 | Bacteria | 1320 |
| 1029 | Ga0501043_0336930 | 3300049579 | Bacteria | 1148 |
| 1030 | Ga0501046_0000701 | 3300049580 | Bacteria | 32353 |
| 1031 | Ga0501046_0192666 | 3300049580 | Bacteria | 1520 |
| 1032 | Ga0501047_0006801 | 3300049581 | Bacteria | 10744 |
| 1033 | Ga0501047_0017379 | 3300049581 | Bacteria | 6888 |
| 1034 | Ga0501047_0134926 | 3300049581 | Bacteria | 2348 |
| 1035 | Ga0501047_0204694 | 3300049581 | Bacteria | 1833 |
| 1036 | Ga0501048_0000016 | 3300049582 | Bacteria | 72612 |
| 1037 | Ga0501048_0013474 | 3300049582 | Bacteria | 6068 |
| 1038 | Ga0501048_0033844 | 3300049582 | Bacteria | 3690 |
| 1039 | Ga0501067_0000461 | 3300049583 | Bacteria | 22155 |
| 1040 | Ga0501067_0001018 | 3300049583 | Bacteria | 15074 |
| 1041 | Ga0501067_0001635 | 3300049583 | Bacteria | 12307 |
| 1042 | Ga0501067_0118438 | 3300049583 | Bacteria | 1473 |
| 1043 | Ga0501067_0137762 | 3300049583 | Bacteria | 1359 |
| 1044 | Ga0501068_0001742 | 3300049584 | Bacteria | 11572 |
| 1045 | Ga0501068_0001917 | 3300049584 | Bacteria | 11062 |
| 1046 | Ga0501068_0099491 | 3300049584 | Bacteria | 1801 |
| 1047 | Ga0501069_0020666 | 3300049585 | Bacteria | 3568 |
| 1048 | Ga0501069_0098350 | 3300049585 | Bacteria | 1660 |
| 1049 | Ga0501069_0098864 | 3300049585 | Bacteria | 1655 |
| 1050 | Ga0501070_0001031 | 3300049586 | Bacteria | 25041 |
| 1051 | Ga0501070_0001292 | 3300049586 | Bacteria | 22464 |
| 1052 | Ga0501070_0001455 | 3300049586 | Bacteria | 21188 |
| 1053 | Ga0501070_0009235 | 3300049586 | Bacteria | 8338 |
| 1054 | Ga0501070_0018043 | 3300049586 | Bacteria | 5921 |
| 1055 | Ga0501070_0023464 | 3300049586 | Bacteria | 5167 |
| 1056 | Ga0501070_0133352 | 3300049586 | Bacteria | 2051 |
| 1057 | Ga0501070_0161322 | 3300049586 | Bacteria | 1848 |
| 1058 | Ga0501070_0262492 | 3300049586 | Bacteria | 1411 |
| 1059 | Ga0501071_0011824 | 3300049587 | Bacteria | 5891 |
| 1060 | Ga0501071_0050268 | 3300049587 | Bacteria | 3003 |
| 1061 | Ga0501071_0101472 | 3300049587 | Bacteria | 2121 |
| 1062 | Ga0501071_0109033 | 3300049587 | Bacteria | 2045 |
| 1063 | Ga0501072_0006559 | 3300049588 | Bacteria | 8861 |
| 1064 | Ga0501072_0025460 | 3300049588 | Bacteria | 4609 |
| 1065 | Ga0501073_0000057 | 3300049589 | Bacteria | 70842 |
| 1066 | Ga0501073_0003609 | 3300049589 | Bacteria | 11634 |
| 1067 | Ga0501073_0003614 | 3300049589 | Bacteria | 11629 |
| 1068 | Ga0501073_0004931 | 3300049589 | Bacteria | 10017 |
| 1069 | Ga0501073_0036440 | 3300049589 | Bacteria | 3495 |
| 1070 | Ga0501074_0000074 | 3300049590 | Bacteria | 48322 |
| 1071 | Ga0501074_0001017 | 3300049590 | Bacteria | 18243 |
| 1072 | Ga0501074_0001632 | 3300049590 | Bacteria | 15208 |
| 1073 | Ga0501074_0047572 | 3300049590 | Bacteria | 3100 |
| 1074 | Ga0501074_0063848 | 3300049590 | Bacteria | 2652 |
| 1075 | Ga0501074_0087027 | 3300049590 | Bacteria | 2238 |
| 1076 | Ga0501074_0167389 | 3300049590 | Bacteria | 1569 |
| 1077 | Ga0501075_0272855 | 3300049591 | Bacteria | 1289 |
| 1078 | Ga0501076_0030665 | 3300049592 | Bacteria | 4189 |
| 1079 | Ga0501076_0108016 | 3300049592 | Bacteria | 2247 |
| 1080 | Ga0501077_0003022 | 3300049593 | Bacteria | 10084 |
| 1081 | Ga0501077_0025215 | 3300049593 | Bacteria | 3777 |
| 1082 | Ga0501077_0181309 | 3300049593 | Bacteria | 1338 |
| 1083 | Ga0501079_0023792 | 3300049741 | Bacteria | 4700 |
| 1084 | Ga0501079_0032323 | 3300049741 | Bacteria | 4023 |
| 1085 | Ga0501079_0075822 | 3300049741 | Bacteria | 2601 |
| 1086 | Ga0501079_0076125 | 3300049741 | Bacteria | 2596 |
| 1087 | Ga0501080_0006051 | 3300049742 | Bacteria | 10847 |
| 1088 | Ga0501080_0006298 | 3300049742 | Bacteria | 10649 |
| 1089 | Ga0501083_0008878 | 3300049744 | Bacteria | 7098 |
| 1090 | Ga0501083_0155829 | 3300049744 | Bacteria | 1495 |
| 1091 | Ga0501035_0000262 | 3300049822 | Bacteria | 62472 |
| 1092 | Ga0501044_0000312 | 3300049823 | Bacteria | 61322 |
| 1093 | Ga0501044_0044754 | 3300049823 | Bacteria | 4591 |
| 1094 | Ga0501044_0054391 | 3300049823 | Bacteria | 4115 |
| 1095 | Ga0501044_0120336 | 3300049823 | Bacteria | 2627 |
| 1096 | Ga0501045_0028523 | 3300049824 | Bacteria | 4027 |
| 1097 | Ga0501045_0194993 | 3300049824 | Bacteria | 1509 |
| 1098 | nmdc:mga00v17_32273_c1 | 3300050491 | Bacteria | 3095 |
| 1099 | nmdc:mga00v17_4765_c1 | 3300050491 | Bacteria | 7100 |
| 1100 | nmdc:mga00v17_9707_c1 | 3300050491 | Bacteria | 5222 |
| 1101 | nmdc:mga0yw44_39792_c1 | 3300050492 | Bacteria | 2790 |
| 1102 | nmdc:mga0yw44_52592_c1 | 3300050492 | Bacteria | 2470 |
| 1103 | nmdc:mga0yw44_6861_c1 | 3300050492 | Bacteria | 5542 |
| 1104 | nmdc:mga0yw44_80156_c1 | 3300050492 | Bacteria | 2044 |
| 1105 | nmdc:mga06z11_4715_c1 | 3300050494 | Bacteria | 5389 |
| 1106 | nmdc:mga04h51_6087_c1 | 3300050495 | Bacteria | 3110 |
| 1107 | nmdc:mga07m45_28725_c1 | 3300050496 | Bacteria | 3070 |
| 1108 | nmdc:mga05p37_338571_c1 | 3300050507 | Bacteria | 1775 |
| 1109 | nmdc:mga05p37_7095_c1 | 3300050507 | Bacteria | 13210 |
| 1110 | nmdc:mga09592_13573_c1 | 3300050508 | Bacteria | 6654 |
| 1111 | nmdc:mga09592_41710_c1 | 3300050508 | Bacteria | 3859 |
| 1112 | nmdc:mga06r32_428085_c1 | 3300050510 | Bacteria | 1304 |
| 1113 | nmdc:mga06r32_56136_c1 | 3300050510 | Bacteria | 3779 |
| 1114 | nmdc:mga08y16_457300_c1 | 3300050511 | Bacteria | 1301 |
| 1115 | nmdc:mga08y16_6424_c1 | 3300050511 | Bacteria | 12323 |
| 1116 | nmdc:mga08y16_74363_c1 | 3300050511 | Bacteria | 3541 |
| 1117 | nmdc:mga08y16_8872_c1 | 3300050511 | Bacteria | 10557 |
| 1118 | nmdc:mga0n895_108726_c1 | 3300050512 | Bacteria | 2788 |
| 1119 | nmdc:mga0n895_116830_c1 | 3300050512 | Bacteria | 2687 |
| 1120 | nmdc:mga0n895_6711_c1 | 3300050512 | Bacteria | 9809 |
| 1121 | nmdc:mga0n895_84901_c1 | 3300050512 | Bacteria | 3160 |
| 1122 | nmdc:mga0rr50_53529_c1 | 3300050513 | Bacteria | 3003 |
| 1123 | nmdc:mga0rr50_7151_c1 | 3300050513 | Bacteria | 6858 |
| 1124 | nmdc:mga08x19_3108_c1 | 3300050514 | Bacteria | 9980 |
| 1125 | nmdc:mga08x19_4601_c1 | 3300050514 | Bacteria | 8191 |
| 1126 | nmdc:mga0a205_227483_c1 | 3300050515 | Bacteria | 1749 |
| 1127 | nmdc:mga0a205_6472_c1 | 3300050515 | Bacteria | 10589 |
| 1128 | nmdc:mga0a205_9144_c1 | 3300050515 | Bacteria | 9046 |
| 1129 | nmdc:mga0sz30_4016_c1 | 3300050516 | Bacteria | 5298 |
| 1130 | nmdc:mga0sz30_9709_c1 | 3300050516 | Bacteria | 3669 |
| 1131 | Ga0495601_0007162 | 3300053077 | Bacteria | 6542 |
| 1132 | Ga0495601_0029504 | 3300053077 | Bacteria | 3403 |
| 1133 | Ga0495612_0005163 | 3300053078 | Bacteria | 5397 |
| 1134 | Ga0495619_0031806 | 3300053085 | Bacteria | 3420 |
| 1135 | Ga0495619_0120140 | 3300053085 | Bacteria | 1801 |
| 1136 | Ga0495619_0231224 | 3300053085 | Bacteria | 1281 |
| 1137 | Ga0500643_000285 | 3300053087 | Bacteria | 43666 |
| 1138 | Ga0500641_0000475 | 3300053096 | Bacteria | 14614 |
| 1139 | Ga0500556_0000168 | 3300053104 | Bacteria | 53779 |
| 1140 | Ga0500562_001203 | 3300053108 | Bacteria | 6367 |
| 1141 | Ga0500593_000819 | 3300053117 | Bacteria | 11629 |
| 1142 | Ga0500655_002809 | 3300053133 | Bacteria | 3162 |
| 1143 | Ga0500559_0000104 | 3300053136 | Bacteria | 65891 |
| 1144 | Ga0500559_0000159 | 3300053136 | Bacteria | 53218 |
| 1145 | Ga0500568_0001269 | 3300053139 | Bacteria | 16659 |
| 1146 | Ga0500568_0022590 | 3300053139 | Bacteria | 2688 |
| 1147 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 1148 | Ga0500573_0037461 | 3300053140 | Bacteria | 2802 |
| 1149 | Ga0501084_0000906 | 3300054114 | Bacteria | 22888 |
| 1150 | Ga0501084_0024881 | 3300054114 | Bacteria | 4996 |
| 1151 | Ga0501084_0137696 | 3300054114 | Bacteria | 2055 |
| 1152 | Ga0501084_0209122 | 3300054114 | Bacteria | 1646 |
| 1153 | Ga0590075_025006 | 3300059424 | Bacteria | 1500 |
| 1154 | Ga0587070_010073 | 3300059491 | Bacteria | 1383 |
| 1155 | Ga0587086_003661 | 3300059507 | Bacteria | 1560 |
| 1156 | Ga0587090_000017 | 3300059510 | Bacteria | 8349 |
| 1157 | Ga0587091_018730 | 3300059511 | Bacteria | 1182 |
| 1158 | Ga0587098_000970 | 3300059604 | Bacteria | 2043 |
| 1159 | Ga0587072_000124 | 3300059643 | Bacteria | 6356 |
| 1160 | Ga0587079_002236 | 3300059647 | Bacteria | 2337 |
| 1161 | Ga0501082_0010928 | 3300060353 | Bacteria | 7813 |
| 1162 | Ga0501082_0036004 | 3300060353 | Bacteria | 4265 |
| 1163 | Ga0501082_0090617 | 3300060353 | Bacteria | 2640 |
| 1164 | Ga0501082_0230152 | 3300060353 | Bacteria | 1613 |
| 1165 | Ga0466962_0005614 | 3300061719 | Bacteria | 6025 |
| 1166 | Ga0466962_0024254 | 3300061719 | Bacteria | 2914 |
| 1167 | Ga0466962_0045609 | 3300061719 | Bacteria | 2095 |
| 1168 | Ga0466962_0141248 | 3300061719 | Bacteria | 1166 |
| 1169 | Ga0530510_0039300 | 3300061734 | Bacteria | 3415 |
| 1170 | Ga0530510_0079212 | 3300061734 | Bacteria | 2389 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0090733 | Ga0466967_0090733_1852_2766 | 276 |
| 2 | 3300049823 | Ga0501044_0054391 | Ga0501044_0054391_10_918 | 276 |
| 3 | 3300048916 | Ga0496113_0045275 | Ga0496113_0045275_762_1682 | 281 |
| 4 | 3300031727 | Ga0316576_10023650 | Ga0316576_100236503 | 282 |
| 5 | 3300031731 | Ga0307405_10084320 | Ga0307405_100843202 | 283 |
| 6 | 3300053096 | Ga0500641_0000475 | Ga0500641_0000475_2773_3798 | 293 |
| 7 | 3300049586 | Ga0501070_0018043 | Ga0501070_0018043_4097_5065 | 296 |
| 8 | 3300025926 | Ga0207659_10325030 | Ga0207659_103250301 | 297 |
| 9 | 3300005983 | Ga0081540_1001174 | Ga0081540_10011749 | 299 |
| 10 | 3300053140 | Ga0500573_0000001 | Ga0500573_0000001_190019_191044 | 299 |
| 11 | 3300031852 | Ga0307410_10197945 | Ga0307410_101979451 | 301 |
| 12 | 3300032002 | Ga0307416_100221178 | Ga0307416_1002211781 | 301 |
| 13 | 3300028800 | Ga0265338_10042643 | Ga0265338_100426432 | 302 |
| 14 | 3300049537 | Ga0501321_005252 | Ga0501321_005252_206_1234 | 302 |
| 15 | 3300028800 | Ga0265338_10008883 | Ga0265338_100088833 | 303 |
| 16 | 3300042016 | Ga0439463_049367 | Ga0439463_049367_11_1000 | 303 |
| 17 | 3300042437 | Ga0439444_0003764 | Ga0439444_0003764_101_1090 | 303 |
| 18 | 3300044901 | Ga0466960_0015763 | Ga0466960_0015763_673_1692 | 303 |
| 19 | 3300048904 | Ga0496101_0222963 | Ga0496101_0222963_55_1074 | 303 |
| 20 | 3300048907 | Ga0496104_0003968 | Ga0496104_0003968_3544_4563 | 303 |
| 21 | 3300048908 | Ga0496105_0034871 | Ga0496105_0034871_1161_2180 | 303 |
| 22 | 3300048911 | Ga0496108_0102973 | Ga0496108_0102973_540_1559 | 303 |
| 23 | 3300048912 | Ga0496109_0064608 | Ga0496109_0064608_2074_3093 | 303 |
| 24 | 3300048918 | Ga0496115_0004879 | Ga0496115_0004879_3812_4831 | 303 |
| 25 | 3300037418 | Ga0395900_0078843 | Ga0395900_0078843_1684_2703 | 304 |
| 26 | 3300044656 | Ga0466969_0021281 | Ga0466969_0021281_2220_3239 | 304 |
| 27 | 3300044684 | Ga0466966_0050102 | Ga0466966_0050102_835_1854 | 304 |
| 28 | 3300044694 | Ga0466963_0170616 | Ga0466963_0170616_89_1108 | 304 |
| 29 | 3300045049 | Ga0466959_0152888 | Ga0466959_0152888_237_1256 | 304 |
| 30 | 3300046559 | Ga0495667_0134413 | Ga0495667_0134413_484_1503 | 304 |
| 31 | 3300048912 | Ga0496109_0022687 | Ga0496109_0022687_778_1797 | 304 |
| 32 | 3300048916 | Ga0496113_0167675 | Ga0496113_0167675_252_1271 | 304 |
| 33 | 3300053085 | Ga0495619_0120140 | Ga0495619_0120140_205_1224 | 304 |
| 34 | 3300061719 | Ga0466962_0045609 | Ga0466962_0045609_1052_2071 | 304 |
| 35 | iso_pu_bacteria | 2675903060 | 2676488975 | 304 |
| 36 | iso_pu_bacteria | 2884693830 | 2884702582 | 304 |
| 37 | iso_pu_bacteria | 2895427314 | 2895429357 | 304 |
| 38 | iso_pu_bacteria | 2895442618 | 2895452082 | 304 |
| 39 | 3300037466 | Ga0395898_0053847 | Ga0395898_0053847_1207_2226 | 305 |
| 40 | iso_pu_bacteria | 2873314349 | 2873317219 | 305 |
| 41 | iso_pu_bacteria | 8055066027 | 8055071709 | 305 |
| 42 | 3300005366 | Ga0070659_100077895 | Ga0070659_1000778952 | 306 |
| 43 | 3300025919 | Ga0207657_10002812 | Ga0207657_1000281213 | 306 |
| 44 | 3300025932 | Ga0207690_10011953 | Ga0207690_100119534 | 306 |
| 45 | 3300031852 | Ga0307410_10248195 | Ga0307410_102481952 | 306 |
| 46 | 3300045976 | Ga0466967_0009740 | Ga0466967_0009740_1206_2186 | 306 |
| 47 | iso_pu_bacteria | 2643221678 | 2644437877 | 306 |
| 48 | 3300009176 | Ga0105242_10113311 | Ga0105242_101133112 | 307 |
| 49 | 3300014325 | Ga0163163_10016279 | Ga0163163_100162793 | 307 |
| 50 | 3300039437 | Ga0436365_1172453 | Ga0436365_1172453_106_1095 | 307 |
| 51 | 3300048905 | Ga0496102_0130357 | Ga0496102_0130357_386_1375 | 307 |
| 52 | 3300048907 | Ga0496104_0021678 | Ga0496104_0021678_2828_3817 | 307 |
| 53 | 3300048908 | Ga0496105_0302508 | Ga0496105_0302508_97_1086 | 307 |
| 54 | 3300048909 | Ga0496106_0052916 | Ga0496106_0052916_65_1054 | 307 |
| 55 | 3300048912 | Ga0496109_0013084 | Ga0496109_0013084_2825_3814 | 307 |
| 56 | 3300048915 | Ga0496112_0023182 | Ga0496112_0023182_4043_5032 | 307 |
| 57 | iso_pu_bacteria | 2856741275 | 2856745492 | 307 |
| 58 | iso_pu_bacteria | 2866552031 | 2866552752 | 307 |
| 59 | iso_pu_bacteria | 2891395885 | 2891397979 | 307 |
| 60 | iso_pu_bacteria | 2891554331 | 2891559642 | 307 |
| 61 | iso_pu_bacteria | 2891562705 | 2891567573 | 307 |
| 62 | iso_pu_bacteria | 8056207758 | 8056211903 | 307 |
| 63 | 3300006038 | Ga0075365_10153811 | Ga0075365_101538112 | 308 |
| 64 | 3300009147 | Ga0114129_10492590 | Ga0114129_104925902 | 308 |
| 65 | 3300031727 | Ga0316576_10019948 | Ga0316576_100199484 | 308 |
| 66 | 3300031728 | Ga0316578_10015874 | Ga0316578_100158742 | 308 |
| 67 | 3300036712 | Ga0316584_0056317 | Ga0316584_0056317_1833_2861 | 308 |
| 68 | 3300037466 | Ga0395898_0031104 | Ga0395898_0031104_1382_2371 | 308 |
| 69 | 3300038443 | Ga0395901_0003177 | Ga0395901_0003177_7289_8278 | 308 |
| 70 | 3300049571 | Ga0501034_0012389 | Ga0501034_0012389_5417_6412 | 308 |
| 71 | 3300049574 | Ga0501038_0011612 | Ga0501038_0011612_2387_3382 | 308 |
| 72 | 3300049578 | Ga0501042_0067894 | Ga0501042_0067894_209_1204 | 308 |
| 73 | 3300049579 | Ga0501043_0004811 | Ga0501043_0004811_6704_7699 | 308 |
| 74 | 3300049581 | Ga0501047_0134926 | Ga0501047_0134926_1150_2145 | 308 |
| 75 | 3300049582 | Ga0501048_0033844 | Ga0501048_0033844_1994_2989 | 308 |
| 76 | 3300049589 | Ga0501073_0036440 | Ga0501073_0036440_89_1084 | 308 |
| 77 | 3300050492 | nmdc:mga0yw44_80156_c1 | nmdc:mga0yw44_80156_c1_54_1046 | 308 |
| 78 | 3300005366 | Ga0070659_100001204 | Ga0070659_1000012043 | 309 |
| 79 | 3300005467 | Ga0070706_100011209 | Ga0070706_1000112094 | 309 |
| 80 | 3300005544 | Ga0070686_100031912 | Ga0070686_1000319123 | 309 |
| 81 | 3300013102 | Ga0157371_10014805 | Ga0157371_100148053 | 309 |
| 82 | 3300022467 | Ga0224712_10003694 | Ga0224712_100036944 | 309 |
| 83 | 3300050510 | nmdc:mga06r32_428085_c1 | nmdc:mga06r32_428085_c1_153_1148 | 309 |
| 84 | iso_pu_bacteria | 2558860112 | 2558910794 | 309 |
| 85 | iso_pu_bacteria | 2816332119 | 2816427423 | 309 |
| 86 | 3300003659 | JGI25404J52841_10002141 | JGI25404J52841_100021413 | 310 |
| 87 | 3300005327 | Ga0070658_10000309 | Ga0070658_1000030910 | 310 |
| 88 | 3300005327 | Ga0070658_10002686 | Ga0070658_100026866 | 310 |
| 89 | 3300005327 | Ga0070658_10073343 | Ga0070658_100733432 | 310 |
| 90 | 3300005329 | Ga0070683_100028369 | Ga0070683_1000283694 | 310 |
| 91 | 3300005330 | Ga0070690_100196382 | Ga0070690_1001963822 | 310 |
| 92 | 3300005334 | Ga0068869_100116718 | Ga0068869_1001167182 | 310 |
| 93 | 3300005336 | Ga0070680_100166353 | Ga0070680_1001663532 | 310 |
| 94 | 3300005340 | Ga0070689_100083548 | Ga0070689_1000835482 | 310 |
| 95 | 3300005343 | Ga0070687_100055685 | Ga0070687_1000556852 | 310 |
| 96 | 3300005344 | Ga0070661_100017686 | Ga0070661_1000176862 | 310 |
| 97 | 3300005345 | Ga0070692_10220521 | Ga0070692_102205211 | 310 |
| 98 | 3300005353 | Ga0070669_100160437 | Ga0070669_1001604371 | 310 |
| 99 | 3300005354 | Ga0070675_100078035 | Ga0070675_1000780353 | 310 |
| 100 | 3300005364 | Ga0070673_100023874 | Ga0070673_1000238744 | 310 |
| 101 | 3300005366 | Ga0070659_100081076 | Ga0070659_1000810763 | 310 |
| 102 | 3300005438 | Ga0070701_10051383 | Ga0070701_100513832 | 310 |
| 103 | 3300005455 | Ga0070663_100010451 | Ga0070663_1000104514 | 310 |
| 104 | 3300005459 | Ga0068867_100194089 | Ga0068867_1001940891 | 310 |
| 105 | 3300005467 | Ga0070706_100158430 | Ga0070706_1001584302 | 310 |
| 106 | 3300005468 | Ga0070707_100070629 | Ga0070707_1000706293 | 310 |
| 107 | 3300005530 | Ga0070679_100063514 | Ga0070679_1000635143 | 310 |
| 108 | 3300005535 | Ga0070684_100005110 | Ga0070684_1000051102 | 310 |
| 109 | 3300005536 | Ga0070697_100316455 | Ga0070697_1003164552 | 310 |
| 110 | 3300005543 | Ga0070672_100064485 | Ga0070672_1000644853 | 310 |
| 111 | 3300005545 | Ga0070695_100052078 | Ga0070695_1000520781 | 310 |
| 112 | 3300005546 | Ga0070696_100014280 | Ga0070696_1000142803 | 310 |
| 113 | 3300005564 | Ga0070664_100064900 | Ga0070664_1000649003 | 310 |
| 114 | 3300005615 | Ga0070702_100009584 | Ga0070702_1000095842 | 310 |
| 115 | 3300005616 | Ga0068852_100067530 | Ga0068852_1000675303 | 310 |
| 116 | 3300005617 | Ga0068859_100026493 | Ga0068859_1000264935 | 310 |
| 117 | 3300005618 | Ga0068864_100074023 | Ga0068864_1000740232 | 310 |
| 118 | 3300005718 | Ga0068866_10085278 | Ga0068866_100852783 | 310 |
| 119 | 3300005719 | Ga0068861_100020576 | Ga0068861_1000205763 | 310 |
| 120 | 3300005841 | Ga0068863_100083924 | Ga0068863_1000839242 | 310 |
| 121 | 3300005842 | Ga0068858_100092490 | Ga0068858_1000924903 | 310 |
| 122 | 3300005983 | Ga0081540_1000292 | Ga0081540_100029240 | 310 |
| 123 | 3300006358 | Ga0068871_100081612 | Ga0068871_1000816122 | 310 |
| 124 | 3300006871 | Ga0075434_100345699 | Ga0075434_1003456992 | 310 |
| 125 | 3300006931 | Ga0097620_100026493 | Ga0097620_1000264935 | 310 |
| 126 | 3300007788 | Ga0099795_10041210 | Ga0099795_100412101 | 310 |
| 127 | 3300009011 | Ga0105251_10016765 | Ga0105251_100167653 | 310 |
| 128 | 3300009036 | Ga0105244_10064894 | Ga0105244_100648941 | 310 |
| 129 | 3300009093 | Ga0105240_10426751 | Ga0105240_104267512 | 310 |
| 130 | 3300009148 | Ga0105243_10046912 | Ga0105243_100469122 | 310 |
| 131 | 3300009174 | Ga0105241_10136457 | Ga0105241_101364572 | 310 |
| 132 | 3300009545 | Ga0105237_10021220 | Ga0105237_100212203 | 310 |
| 133 | 3300010375 | Ga0105239_10261107 | Ga0105239_102611073 | 310 |
| 134 | 3300011119 | Ga0105246_10180093 | Ga0105246_101800932 | 310 |
| 135 | 3300012505 | Ga0157339_1001910 | Ga0157339_10019101 | 310 |
| 136 | 3300013102 | Ga0157371_10019134 | Ga0157371_100191344 | 310 |
| 137 | 3300013104 | Ga0157370_10179700 | Ga0157370_101797003 | 310 |
| 138 | 3300013306 | Ga0163162_10288370 | Ga0163162_102883702 | 310 |
| 139 | 3300014325 | Ga0163163_10336166 | Ga0163163_103361662 | 310 |
| 140 | 3300014326 | Ga0157380_10086145 | Ga0157380_100861453 | 310 |
| 141 | 3300014745 | Ga0157377_10031358 | Ga0157377_100313582 | 310 |
| 142 | 3300017792 | Ga0163161_10057846 | Ga0163161_100578463 | 310 |
| 143 | 3300020070 | Ga0206356_11271902 | Ga0206356_112719022 | 310 |
| 144 | 3300020077 | Ga0206351_10445551 | Ga0206351_104455513 | 310 |
| 145 | 3300020080 | Ga0206350_10417353 | Ga0206350_104173533 | 310 |
| 146 | 3300020081 | Ga0206354_10706613 | Ga0206354_107066132 | 310 |
| 147 | 3300020082 | Ga0206353_10787144 | Ga0206353_107871442 | 310 |
| 148 | 3300021388 | Ga0213875_10000250 | Ga0213875_1000025029 | 310 |
| 149 | 3300021388 | Ga0213875_10052106 | Ga0213875_100521062 | 310 |
| 150 | 3300022467 | Ga0224712_10067806 | Ga0224712_100678061 | 310 |
| 151 | 3300025885 | Ga0207653_10012153 | Ga0207653_100121532 | 310 |
| 152 | 3300025898 | Ga0207692_10011599 | Ga0207692_100115993 | 310 |
| 153 | 3300025900 | Ga0207710_10038286 | Ga0207710_100382863 | 310 |
| 154 | 3300025901 | Ga0207688_10024354 | Ga0207688_100243543 | 310 |
| 155 | 3300025904 | Ga0207647_10062551 | Ga0207647_100625513 | 310 |
| 156 | 3300025906 | Ga0207699_10016027 | Ga0207699_100160272 | 310 |
| 157 | 3300025906 | Ga0207699_10120558 | Ga0207699_101205582 | 310 |
| 158 | 3300025907 | Ga0207645_10032358 | Ga0207645_100323583 | 310 |
| 159 | 3300025909 | Ga0207705_10007997 | Ga0207705_100079972 | 310 |
| 160 | 3300025909 | Ga0207705_10012346 | Ga0207705_100123462 | 310 |
| 161 | 3300025910 | Ga0207684_10028995 | Ga0207684_100289951 | 310 |
| 162 | 3300025911 | Ga0207654_10085923 | Ga0207654_100859232 | 310 |
| 163 | 3300025918 | Ga0207662_10002366 | Ga0207662_100023669 | 310 |
| 164 | 3300025919 | Ga0207657_10009292 | Ga0207657_100092925 | 310 |
| 165 | 3300025920 | Ga0207649_10032099 | Ga0207649_100320993 | 310 |
| 166 | 3300025921 | Ga0207652_10096765 | Ga0207652_100967652 | 310 |
| 167 | 3300025924 | Ga0207694_10064012 | Ga0207694_100640123 | 310 |
| 168 | 3300025926 | Ga0207659_10300439 | Ga0207659_103004392 | 310 |
| 169 | 3300025927 | Ga0207687_10203325 | Ga0207687_102033251 | 310 |
| 170 | 3300025929 | Ga0207664_10038026 | Ga0207664_100380263 | 310 |
| 171 | 3300025936 | Ga0207670_10063797 | Ga0207670_100637972 | 310 |
| 172 | 3300025940 | Ga0207691_10049725 | Ga0207691_100497253 | 310 |
| 173 | 3300025942 | Ga0207689_10060265 | Ga0207689_100602653 | 310 |
| 174 | 3300025944 | Ga0207661_10156161 | Ga0207661_101561611 | 310 |
| 175 | 3300025945 | Ga0207679_10135983 | Ga0207679_101359832 | 310 |
| 176 | 3300025949 | Ga0207667_10188103 | Ga0207667_101881032 | 310 |
| 177 | 3300025961 | Ga0207712_10075019 | Ga0207712_100750192 | 310 |
| 178 | 3300025972 | Ga0207668_10189738 | Ga0207668_101897382 | 310 |
| 179 | 3300025986 | Ga0207658_10299763 | Ga0207658_102997632 | 310 |
| 180 | 3300026023 | Ga0207677_10271124 | Ga0207677_102711242 | 310 |
| 181 | 3300026041 | Ga0207639_10061069 | Ga0207639_100610693 | 310 |
| 182 | 3300026067 | Ga0207678_10003260 | Ga0207678_1000326010 | 310 |
| 183 | 3300026075 | Ga0207708_10098638 | Ga0207708_100986383 | 310 |
| 184 | 3300026078 | Ga0207702_10009020 | Ga0207702_100090205 | 310 |
| 185 | 3300026088 | Ga0207641_10143157 | Ga0207641_101431572 | 310 |
| 186 | 3300026116 | Ga0207674_10002289 | Ga0207674_1000228917 | 310 |
| 187 | 3300026118 | Ga0207675_100013049 | Ga0207675_1000130492 | 310 |
| 188 | 3300026121 | Ga0207683_10014903 | Ga0207683_100149036 | 310 |
| 189 | 3300026142 | Ga0207698_10341715 | Ga0207698_103417152 | 310 |
| 190 | 3300028379 | Ga0268266_10119528 | Ga0268266_101195282 | 310 |
| 191 | 3300028380 | Ga0268265_10187757 | Ga0268265_101877572 | 310 |
| 192 | 3300028381 | Ga0268264_10145684 | Ga0268264_101456842 | 310 |
| 193 | 3300034816 | Ga0373930_0003603 | Ga0373930_0003603_1147_2145 | 310 |
| 194 | 3300035083 | Ga0373926_0019149 | Ga0373926_0019149_839_1837 | 310 |
| 195 | 3300035084 | Ga0373928_0027634 | Ga0373928_0027634_94_1092 | 310 |
| 196 | 3300035086 | Ga0373934_0005656 | Ga0373934_0005656_2382_3380 | 310 |
| 197 | 3300035092 | Ga0373952_0015890 | Ga0373952_0015890_489_1487 | 310 |
| 198 | 3300035113 | Ga0373936_0095722 | Ga0373936_0095722_185_1183 | 310 |
| 199 | 3300035116 | Ga0373945_0009239 | Ga0373945_0009239_605_1603 | 310 |
| 200 | 3300035117 | Ga0373953_0027907 | Ga0373953_0027907_208_1206 | 310 |
| 201 | 3300035117 | Ga0373953_0031275 | Ga0373953_0031275_1008_2006 | 310 |
| 202 | 3300035118 | Ga0373954_0065345 | Ga0373954_0065345_487_1485 | 310 |
| 203 | 3300035119 | Ga0373956_0091858 | Ga0373956_0091858_177_1175 | 310 |
| 204 | 3300035172 | Ga0373955_0036062 | Ga0373955_0036062_1305_2303 | 310 |
| 205 | 3300035172 | Ga0373955_0071321 | Ga0373955_0071321_856_1854 | 310 |
| 206 | 3300035242 | Ga0373962_0043489 | Ga0373962_0043489_259_1257 | 310 |
| 207 | 3300035410 | Ga0373924_0005264 | Ga0373924_0005264_223_1221 | 310 |
| 208 | 3300035410 | Ga0373924_0100898 | Ga0373924_0100898_48_1046 | 310 |
| 209 | 3300035692 | Ga0373935_0045918 | Ga0373935_0045918_1497_2495 | 310 |
| 210 | 3300035695 | Ga0373927_0021229 | Ga0373927_0021229_3161_4159 | 310 |
| 211 | 3300035724 | Ga0373933_0007620 | Ga0373933_0007620_197_1195 | 310 |
| 212 | 3300036401 | Ga0373937_0022991 | Ga0373937_0022991_4213_5211 | 310 |
| 213 | 3300037068 | Ga0373925_0242548 | Ga0373925_0242548_104_1102 | 310 |
| 214 | 3300037853 | Ga0436364_0287407 | Ga0436364_0287407_88040_89041 | 310 |
| 215 | 3300037853 | Ga0436364_1090900 | Ga0436364_1090900_169_1167 | 310 |
| 216 | 3300037853 | Ga0436364_1282665 | Ga0436364_1282665_1199_2197 | 310 |
| 217 | 3300039437 | Ga0436365_0073587 | Ga0436365_0073587_1874_2872 | 310 |
| 218 | 3300039450 | Ga0436363_1665714 | Ga0436363_1665714_621_1619 | 310 |
| 219 | 3300039453 | Ga0436362_0714019 | Ga0436362_0714019_54_1052 | 310 |
| 220 | 3300044684 | Ga0466966_0099830 | Ga0466966_0099830_354_1346 | 310 |
| 221 | 3300044694 | Ga0466963_0135649 | Ga0466963_0135649_434_1429 | 310 |
| 222 | 3300045049 | Ga0466959_0065780 | Ga0466959_0065780_1501_2493 | 310 |
| 223 | 3300045976 | Ga0466967_0181913 | Ga0466967_0181913_752_1744 | 310 |
| 224 | 3300046454 | Ga0495592_0038595 | Ga0495592_0038595_391_1389 | 310 |
| 225 | 3300046459 | Ga0495629_0002738 | Ga0495629_0002738_377_1375 | 310 |
| 226 | 3300046461 | Ga0495641_0003000 | Ga0495641_0003000_10644_11642 | 310 |
| 227 | 3300046462 | Ga0495651_0127886 | Ga0495651_0127886_644_1642 | 310 |
| 228 | 3300046472 | Ga0495580_0016727 | Ga0495580_0016727_2116_3114 | 310 |
| 229 | 3300046475 | Ga0495639_0054817 | Ga0495639_0054817_429_1427 | 310 |
| 230 | 3300046476 | Ga0495662_0010364 | Ga0495662_0010364_390_1388 | 310 |
| 231 | 3300046499 | Ga0495594_0043628 | Ga0495594_0043628_652_1650 | 310 |
| 232 | 3300046511 | Ga0495608_0024284 | Ga0495608_0024284_1825_2823 | 310 |
| 233 | 3300046511 | Ga0495608_0069970 | Ga0495608_0069970_987_1985 | 310 |
| 234 | 3300046526 | Ga0495666_0037827 | Ga0495666_0037827_1013_2011 | 310 |
| 235 | 3300046535 | Ga0495586_0080314 | Ga0495586_0080314_132_1130 | 310 |
| 236 | 3300046536 | Ga0495587_0033362 | Ga0495587_0033362_629_1627 | 310 |
| 237 | 3300046543 | Ga0495645_0044610 | Ga0495645_0044610_598_1596 | 310 |
| 238 | 3300046559 | Ga0495667_0015217 | Ga0495667_0015217_391_1389 | 310 |
| 239 | 3300046663 | Ga0495635_0021655 | Ga0495635_0021655_3276_4274 | 310 |
| 240 | 3300046674 | Ga0495588_0099233 | Ga0495588_0099233_148_1146 | 310 |
| 241 | 3300046675 | Ga0495657_0009553 | Ga0495657_0009553_1705_2703 | 310 |
| 242 | 3300046675 | Ga0495657_0083948 | Ga0495657_0083948_954_1952 | 310 |
| 243 | 3300046680 | Ga0495646_0017982 | Ga0495646_0017982_3161_4159 | 310 |
| 244 | 3300046681 | Ga0495647_0015235 | Ga0495647_0015235_1411_2409 | 310 |
| 245 | 3300046689 | Ga0495613_0110432 | Ga0495613_0110432_395_1393 | 310 |
| 246 | 3300046690 | Ga0495624_0033375 | Ga0495624_0033375_1324_2322 | 310 |
| 247 | 3300046809 | Ga0495600_0040078 | Ga0495600_0040078_385_1383 | 310 |
| 248 | 3300046809 | Ga0495600_0095292 | Ga0495600_0095292_891_1889 | 310 |
| 249 | 3300047315 | Ga0495581_0003879 | Ga0495581_0003879_550_1548 | 310 |
| 250 | 3300047317 | Ga0495604_0069493 | Ga0495604_0069493_573_1571 | 310 |
| 251 | 3300047319 | Ga0495674_0184210 | Ga0495674_0184210_263_1261 | 310 |
| 252 | 3300047321 | Ga0495676_0038360 | Ga0495676_0038360_422_1420 | 310 |
| 253 | 3300047322 | Ga0495680_0027796 | Ga0495680_0027796_3247_4245 | 310 |
| 254 | 3300047322 | Ga0495680_0271420 | Ga0495680_0271420_104_1102 | 310 |
| 255 | 3300047444 | Ga0495675_0016883 | Ga0495675_0016883_291_1289 | 310 |
| 256 | 3300047444 | Ga0495675_0144771 | Ga0495675_0144771_425_1423 | 310 |
| 257 | 3300047471 | Ga0495684_0064419 | Ga0495684_0064419_1183_2181 | 310 |
| 258 | 3300047471 | Ga0495684_0072610 | Ga0495684_0072610_1434_2432 | 310 |
| 259 | 3300048088 | Ga0495602_0146120 | Ga0495602_0146120_844_1842 | 310 |
| 260 | 3300048089 | Ga0495614_0044160 | Ga0495614_0044160_839_1837 | 310 |
| 261 | 3300048904 | Ga0496101_0031996 | Ga0496101_0031996_2377_3375 | 310 |
| 262 | 3300048906 | Ga0496103_0038436 | Ga0496103_0038436_466_1464 | 310 |
| 263 | 3300048908 | Ga0496105_0033168 | Ga0496105_0033168_3224_4222 | 310 |
| 264 | 3300048909 | Ga0496106_0245883 | Ga0496106_0245883_419_1417 | 310 |
| 265 | 3300048911 | Ga0496108_0073731 | Ga0496108_0073731_168_1166 | 310 |
| 266 | 3300048913 | Ga0496110_0051624 | Ga0496110_0051624_115_1113 | 310 |
| 267 | 3300048914 | Ga0496111_0034702 | Ga0496111_0034702_2302_3300 | 310 |
| 268 | 3300048916 | Ga0496113_0253032 | Ga0496113_0253032_271_1269 | 310 |
| 269 | 3300049570 | Ga0501033_0168797 | Ga0501033_0168797_274_1272 | 310 |
| 270 | 3300049574 | Ga0501038_0291179 | Ga0501038_0291179_209_1207 | 310 |
| 271 | 3300049576 | Ga0501040_0088206 | Ga0501040_0088206_225_1223 | 310 |
| 272 | 3300049577 | Ga0501041_0025945 | Ga0501041_0025945_88_1086 | 310 |
| 273 | 3300049578 | Ga0501042_0028001 | Ga0501042_0028001_2881_3879 | 310 |
| 274 | 3300049579 | Ga0501043_0336930 | Ga0501043_0336930_34_1032 | 310 |
| 275 | 3300049586 | Ga0501070_0009235 | Ga0501070_0009235_2064_3062 | 310 |
| 276 | 3300049587 | Ga0501071_0109033 | Ga0501071_0109033_896_1894 | 310 |
| 277 | 3300049590 | Ga0501074_0167389 | Ga0501074_0167389_126_1124 | 310 |
| 278 | 3300049591 | Ga0501075_0272855 | Ga0501075_0272855_89_1087 | 310 |
| 279 | 3300049592 | Ga0501076_0108016 | Ga0501076_0108016_314_1312 | 310 |
| 280 | 3300049593 | Ga0501077_0181309 | Ga0501077_0181309_279_1277 | 310 |
| 281 | 3300049741 | Ga0501079_0076125 | Ga0501079_0076125_1147_2145 | 310 |
| 282 | 3300049824 | Ga0501045_0194993 | Ga0501045_0194993_380_1378 | 310 |
| 283 | 3300050512 | nmdc:mga0n895_84901_c1 | nmdc:mga0n895_84901_c1_907_1905 | 310 |
| 284 | 3300050515 | nmdc:mga0a205_227483_c1 | nmdc:mga0a205_227483_c1_67_1065 | 310 |
| 285 | 3300053077 | Ga0495601_0007162 | Ga0495601_0007162_3157_4155 | 310 |
| 286 | 3300053078 | Ga0495612_0005163 | Ga0495612_0005163_1047_2045 | 310 |
| 287 | 3300053085 | Ga0495619_0031806 | Ga0495619_0031806_577_1575 | 310 |
| 288 | 3300054114 | Ga0501084_0209122 | Ga0501084_0209122_118_1116 | 310 |
| 289 | 3300060353 | Ga0501082_0090617 | Ga0501082_0090617_329_1327 | 310 |
| 290 | 3300061734 | Ga0530510_0039300 | Ga0530510_0039300_225_1223 | 310 |
| 291 | iso_pu_bacteria | 2816332139 | 2816505010 | 310 |
| 292 | iso_pu_bacteria | 2870782633 | 2870784786 | 310 |
| 293 | iso_pu_bacteria | 2915358134 | 2915358812 | 310 |
| 294 | iso_pu_bacteria | 8054472261 | 8054476740 | 310 |
| 295 | 3300004799 | Ga0058863_11608832 | Ga0058863_116088322 | 311 |
| 296 | 3300005329 | Ga0070683_100150733 | Ga0070683_1001507333 | 311 |
| 297 | 3300005336 | Ga0070680_100001094 | Ga0070680_1000010946 | 311 |
| 298 | 3300005458 | Ga0070681_10000009 | Ga0070681_1000000927 | 311 |
| 299 | 3300005530 | Ga0070679_100000163 | Ga0070679_10000016311 | 311 |
| 300 | 3300005842 | Ga0068858_100369729 | Ga0068858_1003697292 | 311 |
| 301 | 3300009098 | Ga0105245_10017525 | Ga0105245_100175253 | 311 |
| 302 | 3300009148 | Ga0105243_10107450 | Ga0105243_101074502 | 311 |
| 303 | 3300009176 | Ga0105242_10057689 | Ga0105242_100576892 | 311 |
| 304 | 3300009177 | Ga0105248_10411453 | Ga0105248_104114532 | 311 |
| 305 | 3300013100 | Ga0157373_10221661 | Ga0157373_102216611 | 311 |
| 306 | 3300025912 | Ga0207707_10000240 | Ga0207707_1000024028 | 311 |
| 307 | 3300025917 | Ga0207660_10000327 | Ga0207660_1000032720 | 311 |
| 308 | 3300025921 | Ga0207652_10000227 | Ga0207652_1000022728 | 311 |
| 309 | 3300025927 | Ga0207687_10070184 | Ga0207687_100701843 | 311 |
| 310 | 3300025944 | Ga0207661_10015456 | Ga0207661_100154563 | 311 |
| 311 | 3300025944 | Ga0207661_10154062 | Ga0207661_101540623 | 311 |
| 312 | 3300026089 | Ga0207648_10288414 | Ga0207648_102884142 | 311 |
| 313 | 3300037471 | Ga0395905_0408883 | Ga0395905_0408883_48_1052 | 311 |
| 314 | 3300045049 | Ga0466959_0121312 | Ga0466959_0121312_77_1084 | 311 |
| 315 | iso_pu_bacteria | 2585428094 | 2587863171 | 311 |
| 316 | iso_pu_bacteria | 2585428157 | 2588108899 | 311 |
| 317 | iso_pu_bacteria | 2622736605 | 2623501203 | 311 |
| 318 | iso_pu_bacteria | 2643221566 | 2643848646 | 311 |
| 319 | iso_pu_bacteria | 2643221575 | 2643885753 | 311 |
| 320 | iso_pu_bacteria | 2643221597 | 2643996145 | 311 |
| 321 | iso_pu_bacteria | 2643221635 | 2644198652 | 311 |
| 322 | iso_pu_bacteria | 2643221649 | 2644277258 | 311 |
| 323 | iso_pu_bacteria | 2643221681 | 2644457617 | 311 |
| 324 | iso_pu_bacteria | 2643221697 | 2644537959 | 311 |
| 325 | iso_pu_bacteria | 2643221961 | 2645720223 | 311 |
| 326 | iso_pu_bacteria | 2690315906 | 2691514407 | 311 |
| 327 | iso_pu_bacteria | 2757320536 | 2758226391 | 311 |
| 328 | iso_pu_bacteria | 2773857758 | 2774380127 | 311 |
| 329 | iso_pu_bacteria | 2773857759 | 2774384239 | 311 |
| 330 | iso_pu_bacteria | 2773857763 | 2774399195 | 311 |
| 331 | iso_pu_bacteria | 2775506735 | 2775655262 | 311 |
| 332 | iso_pu_bacteria | 2808606306 | 2808630943 | 311 |
| 333 | iso_pu_bacteria | 2808606357 | 2808827490 | 311 |
| 334 | iso_pu_bacteria | 2808606360 | 2808852857 | 311 |
| 335 | iso_pu_bacteria | 2808606366 | 2808878694 | 311 |
| 336 | iso_pu_bacteria | 2808606368 | 2808885858 | 311 |
| 337 | iso_pu_bacteria | 2808606370 | 2808891726 | 311 |
| 338 | iso_pu_bacteria | 2808606371 | 2808896854 | 311 |
| 339 | iso_pu_bacteria | 2811994871 | 2812320725 | 311 |
| 340 | iso_pu_bacteria | 2811994872 | 2812323533 | 311 |
| 341 | iso_pu_bacteria | 2816332305 | 2817508916 | 311 |
| 342 | iso_pu_bacteria | 2833709550 | 2833711228 | 311 |
| 343 | iso_pu_bacteria | 2839986021 | 2839989363 | 311 |
| 344 | iso_pu_bacteria | 2844849076 | 2844849349 | 311 |
| 345 | iso_pu_bacteria | 2852643534 | 2852646198 | 311 |
| 346 | iso_pu_bacteria | 2852677369 | 2852679889 | 311 |
| 347 | iso_pu_bacteria | 2857720070 | 2857720077 | 311 |
| 348 | iso_pu_bacteria | 2857733635 | 2857736506 | 311 |
| 349 | iso_pu_bacteria | 2857737099 | 2857740165 | 311 |
| 350 | iso_pu_bacteria | 2857740372 | 2857741529 | 311 |
| 351 | iso_pu_bacteria | 2870628048 | 2870630598 | 311 |
| 352 | iso_pu_bacteria | 2904497146 | 2904500061 | 311 |
| 353 | iso_pu_bacteria | 2904509784 | 2904511743 | 311 |
| 354 | iso_pu_bacteria | 2904776348 | 2904776426 | 311 |
| 355 | iso_pu_bacteria | 2908678064 | 2908680665 | 311 |
| 356 | iso_pu_bacteria | 2910809715 | 2910813558 | 311 |
| 357 | iso_pu_bacteria | 2919034639 | 2919037555 | 311 |
| 358 | iso_pu_bacteria | 2919059106 | 2919063271 | 311 |
| 359 | iso_pu_bacteria | 2919069694 | 2919071778 | 311 |
| 360 | iso_pu_bacteria | 2919391150 | 2919391221 | 311 |
| 361 | iso_pu_bacteria | 2919538618 | 2919541942 | 311 |
| 362 | iso_pu_bacteria | 2928090899 | 2928092093 | 311 |
| 363 | iso_pu_bacteria | 2932426870 | 2932429043 | 311 |
| 364 | iso_pu_bacteria | 2932431166 | 2932432808 | 311 |
| 365 | iso_pu_bacteria | 2933418574 | 2933421213 | 311 |
| 366 | iso_pu_bacteria | 2939647034 | 2939649070 | 311 |
| 367 | iso_pu_bacteria | 2939674588 | 2939676264 | 311 |
| 368 | iso_pu_bacteria | 2945916053 | 2945918485 | 311 |
| 369 | iso_pu_bacteria | 2945920336 | 2945921232 | 311 |
| 370 | iso_pu_bacteria | 2945956166 | 2945959639 | 311 |
| 371 | iso_pu_bacteria | 2946024296 | 2946026230 | 311 |
| 372 | iso_pu_bacteria | 2946037020 | 2946038525 | 311 |
| 373 | iso_pu_bacteria | 2946059875 | 2946062344 | 311 |
| 374 | iso_pu_bacteria | 2953998280 | 2953999798 | 311 |
| 375 | iso_pu_bacteria | 2966921586 | 2966923999 | 311 |
| 376 | iso_pu_bacteria | 2974294766 | 2974297415 | 311 |
| 377 | iso_pu_bacteria | 2974302888 | 2974306512 | 311 |
| 378 | iso_pu_bacteria | 2974324384 | 2974326348 | 311 |
| 379 | iso_pu_bacteria | 2977228692 | 2977231661 | 311 |
| 380 | iso_pu_bacteria | 2977236895 | 2977237015 | 311 |
| 381 | iso_pu_bacteria | 2977251589 | 2977254177 | 311 |
| 382 | iso_pu_bacteria | 2977264416 | 2977266883 | 311 |
| 383 | iso_pu_bacteria | 2984542743 | 2984545192 | 311 |
| 384 | iso_pu_bacteria | 2984580707 | 2984581142 | 311 |
| 385 | iso_pu_bacteria | 2995726249 | 2995727499 | 311 |
| 386 | iso_pu_bacteria | 8002811521 | 8002813825 | 311 |
| 387 | iso_pu_bacteria | 8016254467 | 8016257294 | 311 |
| 388 | iso_pu_bacteria | 8045830549 | 8045831834 | 311 |
| 389 | iso_pu_bacteria | 8055034563 | 8055035566 | 311 |
| 390 | iso_pu_bacteria | 8055037949 | 8055038039 | 311 |
| 391 | 3300005339 | Ga0070660_100043804 | Ga0070660_1000438045 | 312 |
| 392 | 3300005435 | Ga0070714_100238264 | Ga0070714_1002382642 | 312 |
| 393 | 3300005471 | Ga0070698_100258403 | Ga0070698_1002584031 | 312 |
| 394 | 3300005981 | Ga0081538_10101111 | Ga0081538_101011112 | 312 |
| 395 | 3300009036 | Ga0105244_10005231 | Ga0105244_100052314 | 312 |
| 396 | 3300009036 | Ga0105244_10047450 | Ga0105244_100474502 | 312 |
| 397 | 3300011119 | Ga0105246_10008058 | Ga0105246_100080584 | 312 |
| 398 | 3300011119 | Ga0105246_10009194 | Ga0105246_100091944 | 312 |
| 399 | 3300013105 | Ga0157369_10169565 | Ga0157369_101695651 | 312 |
| 400 | 3300013105 | Ga0157369_10401755 | Ga0157369_104017552 | 312 |
| 401 | 3300013297 | Ga0157378_10153763 | Ga0157378_101537632 | 312 |
| 402 | 3300013307 | Ga0157372_10470680 | Ga0157372_104706801 | 312 |
| 403 | 3300022467 | Ga0224712_10077659 | Ga0224712_100776592 | 312 |
| 404 | 3300025245 | Ga0207425_1019477 | Ga0207425_10194771 | 312 |
| 405 | 3300025728 | Ga0207655_1021225 | Ga0207655_10212251 | 312 |
| 406 | 3300025912 | Ga0207707_10071304 | Ga0207707_100713042 | 312 |
| 407 | 3300025919 | Ga0207657_10030946 | Ga0207657_100309465 | 312 |
| 408 | 3300025921 | Ga0207652_10073146 | Ga0207652_100731462 | 312 |
| 409 | 3300027907 | Ga0207428_10039060 | Ga0207428_100390603 | 312 |
| 410 | 3300031548 | Ga0307408_100061215 | Ga0307408_1000612152 | 312 |
| 411 | 3300031548 | Ga0307408_100294609 | Ga0307408_1002946092 | 312 |
| 412 | 3300031731 | Ga0307405_10031204 | Ga0307405_100312042 | 312 |
| 413 | 3300031731 | Ga0307405_10198357 | Ga0307405_101983571 | 312 |
| 414 | 3300031824 | Ga0307413_10014122 | Ga0307413_100141222 | 312 |
| 415 | 3300031852 | Ga0307410_10004512 | Ga0307410_100045123 | 312 |
| 416 | 3300031852 | Ga0307410_10010737 | Ga0307410_100107374 | 312 |
| 417 | 3300031903 | Ga0307407_10033253 | Ga0307407_100332531 | 312 |
| 418 | 3300031911 | Ga0307412_10047335 | Ga0307412_100473353 | 312 |
| 419 | 3300031995 | Ga0307409_100011956 | Ga0307409_1000119562 | 312 |
| 420 | 3300031995 | Ga0307409_100224661 | Ga0307409_1002246612 | 312 |
| 421 | 3300031995 | Ga0307409_100273292 | Ga0307409_1002732921 | 312 |
| 422 | 3300032002 | Ga0307416_100034413 | Ga0307416_1000344133 | 312 |
| 423 | 3300032126 | Ga0307415_100023785 | Ga0307415_1000237853 | 312 |
| 424 | 3300032126 | Ga0307415_100086212 | Ga0307415_1000862122 | 312 |
| 425 | 3300032126 | Ga0307415_100253936 | Ga0307415_1002539362 | 312 |
| 426 | 3300035172 | Ga0373955_0126488 | Ga0373955_0126488_152_1156 | 312 |
| 427 | 3300037068 | Ga0373925_0043453 | Ga0373925_0043453_1095_2099 | 312 |
| 428 | 3300037312 | Ga0395899_0003411 | Ga0395899_0003411_8320_9336 | 312 |
| 429 | 3300037312 | Ga0395899_0184421 | Ga0395899_0184421_262_1278 | 312 |
| 430 | 3300037418 | Ga0395900_0014998 | Ga0395900_0014998_5454_6470 | 312 |
| 431 | 3300037418 | Ga0395900_0270917 | Ga0395900_0270917_477_1493 | 312 |
| 432 | 3300037466 | Ga0395898_0033898 | Ga0395898_0033898_2098_3114 | 312 |
| 433 | 3300037466 | Ga0395898_0039158 | Ga0395898_0039158_1440_2456 | 312 |
| 434 | 3300037466 | Ga0395898_0077491 | Ga0395898_0077491_663_1679 | 312 |
| 435 | 3300038443 | Ga0395901_0014684 | Ga0395901_0014684_3436_4452 | 312 |
| 436 | 3300038443 | Ga0395901_0017075 | Ga0395901_0017075_2684_3700 | 312 |
| 437 | 3300038443 | Ga0395901_0071769 | Ga0395901_0071769_221_1234 | 312 |
| 438 | 3300041404 | Ga0439436_0008336 | Ga0439436_0008336_733_1749 | 312 |
| 439 | 3300041406 | Ga0439439_0000161 | Ga0439439_0000161_4375_5391 | 312 |
| 440 | 3300041410 | Ga0439461_0005937 | Ga0439461_0005937_90_1106 | 312 |
| 441 | 3300041411 | Ga0439466_0005934 | Ga0439466_0005934_2458_3474 | 312 |
| 442 | 3300041413 | Ga0439465_0020465 | Ga0439465_0020465_1035_2051 | 312 |
| 443 | 3300041999 | Ga0439433_0002516 | Ga0439433_0002516_869_1885 | 312 |
| 444 | 3300042002 | Ga0439442_000029 | Ga0439442_000029_19752_20768 | 312 |
| 445 | 3300042006 | Ga0439432_003644 | Ga0439432_003644_742_1758 | 312 |
| 446 | 3300042007 | Ga0439449_0000228 | Ga0439449_0000228_4920_5936 | 312 |
| 447 | 3300042007 | Ga0439449_0012024 | Ga0439449_0012024_1706_2722 | 312 |
| 448 | 3300042010 | Ga0439452_007360 | Ga0439452_007360_1162_2178 | 312 |
| 449 | 3300042014 | Ga0439457_003434 | Ga0439457_003434_1951_2967 | 312 |
| 450 | 3300042121 | Ga0450919_000141 | Ga0450919_000141_5887_6903 | 312 |
| 451 | 3300042122 | Ga0450920_000615 | Ga0450920_000615_1923_2939 | 312 |
| 452 | 3300042146 | Ga0450907_000142 | Ga0450907_000142_5922_6938 | 312 |
| 453 | 3300042146 | Ga0450907_007996 | Ga0450907_007996_531_1547 | 312 |
| 454 | 3300042184 | Ga0450908_000689 | Ga0450908_000689_5231_6247 | 312 |
| 455 | 3300042184 | Ga0450908_006101 | Ga0450908_006101_734_1750 | 312 |
| 456 | 3300042185 | Ga0450909_000040 | Ga0450909_000040_3704_4720 | 312 |
| 457 | 3300042435 | Ga0439434_0000010 | Ga0439434_0000010_28164_29180 | 312 |
| 458 | 3300042531 | Ga0450918_001024 | Ga0450918_001024_2616_3632 | 312 |
| 459 | 3300044765 | Ga0466970_0008844 | Ga0466970_0008844_3739_4758 | 312 |
| 460 | 3300046454 | Ga0495592_0030345 | Ga0495592_0030345_3034_4038 | 312 |
| 461 | 3300046472 | Ga0495580_0002952 | Ga0495580_0002952_11859_12875 | 312 |
| 462 | 3300046472 | Ga0495580_0035290 | Ga0495580_0035290_350_1366 | 312 |
| 463 | 3300046475 | Ga0495639_0000642 | Ga0495639_0000642_10557_11573 | 312 |
| 464 | 3300046516 | Ga0495628_0148649 | Ga0495628_0148649_193_1197 | 312 |
| 465 | 3300046528 | Ga0495642_0025176 | Ga0495642_0025176_398_1414 | 312 |
| 466 | 3300046531 | Ga0495665_0011398 | Ga0495665_0011398_1363_2379 | 312 |
| 467 | 3300046543 | Ga0495645_0005099 | Ga0495645_0005099_3615_4631 | 312 |
| 468 | 3300046543 | Ga0495645_0165100 | Ga0495645_0165100_180_1196 | 312 |
| 469 | 3300046674 | Ga0495588_0098597 | Ga0495588_0098597_306_1322 | 312 |
| 470 | 3300046675 | Ga0495657_0030812 | Ga0495657_0030812_2094_3110 | 312 |
| 471 | 3300046691 | Ga0495670_0143316 | Ga0495670_0143316_179_1195 | 312 |
| 472 | 3300046809 | Ga0495600_0029094 | Ga0495600_0029094_2216_3232 | 312 |
| 473 | 3300047315 | Ga0495581_0027345 | Ga0495581_0027345_347_1363 | 312 |
| 474 | 3300047315 | Ga0495581_0067330 | Ga0495581_0067330_523_1539 | 312 |
| 475 | 3300047319 | Ga0495674_0106280 | Ga0495674_0106280_438_1454 | 312 |
| 476 | 3300047322 | Ga0495680_0088467 | Ga0495680_0088467_126_1130 | 312 |
| 477 | 3300047470 | Ga0495681_0043752 | Ga0495681_0043752_381_1397 | 312 |
| 478 | 3300047471 | Ga0495684_0155255 | Ga0495684_0155255_265_1281 | 312 |
| 479 | 3300048905 | Ga0496102_0014349 | Ga0496102_0014349_3106_4122 | 312 |
| 480 | 3300048905 | Ga0496102_0193159 | Ga0496102_0193159_233_1249 | 312 |
| 481 | 3300048905 | Ga0496102_0295322 | Ga0496102_0295322_303_1319 | 312 |
| 482 | 3300048906 | Ga0496103_0023773 | Ga0496103_0023773_436_1452 | 312 |
| 483 | 3300048913 | Ga0496110_0158383 | Ga0496110_0158383_621_1637 | 312 |
| 484 | 3300048915 | Ga0496112_0014634 | Ga0496112_0014634_3078_4094 | 312 |
| 485 | 3300049129 | Ga0501309_001974 | Ga0501309_001974_179_1195 | 312 |
| 486 | 3300049569 | Ga0501032_0001570 | Ga0501032_0001570_8396_9412 | 312 |
| 487 | 3300049571 | Ga0501034_0000123 | Ga0501034_0000123_21714_22730 | 312 |
| 488 | 3300049573 | Ga0501037_0001615 | Ga0501037_0001615_13876_14892 | 312 |
| 489 | 3300049573 | Ga0501037_0270618 | Ga0501037_0270618_60_1076 | 312 |
| 490 | 3300049574 | Ga0501038_0030340 | Ga0501038_0030340_3656_4672 | 312 |
| 491 | 3300049579 | Ga0501043_0010156 | Ga0501043_0010156_3116_4132 | 312 |
| 492 | 3300049579 | Ga0501043_0017886 | Ga0501043_0017886_992_2008 | 312 |
| 493 | 3300049579 | Ga0501043_0071250 | Ga0501043_0071250_403_1419 | 312 |
| 494 | 3300049583 | Ga0501067_0137762 | Ga0501067_0137762_265_1281 | 312 |
| 495 | 3300049590 | Ga0501074_0063848 | Ga0501074_0063848_706_1704 | 312 |
| 496 | 3300049823 | Ga0501044_0044754 | Ga0501044_0044754_2845_3861 | 312 |
| 497 | 3300054114 | Ga0501084_0137696 | Ga0501084_0137696_731_1744 | 312 |
| 498 | 3300059643 | Ga0587072_000124 | Ga0587072_000124_1509_2525 | 312 |
| 499 | 3300060353 | Ga0501082_0230152 | Ga0501082_0230152_542_1552 | 312 |
| 500 | iso_pu_bacteria | 2515154155 | 2515853581 | 312 |
| 501 | iso_pu_bacteria | 2643221542 | 2643733945 | 312 |
| 502 | iso_pu_bacteria | 2643221546 | 2643752766 | 312 |
| 503 | iso_pu_bacteria | 2643221553 | 2643785482 | 312 |
| 504 | iso_pu_bacteria | 2643221613 | 2644084643 | 312 |
| 505 | iso_pu_bacteria | 2643221630 | 2644170526 | 312 |
| 506 | iso_pu_bacteria | 2643221721 | 2644667255 | 312 |
| 507 | iso_pu_bacteria | 2643221724 | 2644679896 | 312 |
| 508 | iso_pu_bacteria | 2675903058 | 2676478506 | 312 |
| 509 | iso_pu_bacteria | 2728369276 | 2729909007 | 312 |
| 510 | iso_pu_bacteria | 2728369380 | 2730229362 | 312 |
| 511 | iso_pu_bacteria | 2747842429 | 2747953131 | 312 |
| 512 | iso_pu_bacteria | 2799112218 | 2799185273 | 312 |
| 513 | iso_pu_bacteria | 2808606447 | 2809227641 | 312 |
| 514 | iso_pu_bacteria | 2827628540 | 2827629566 | 312 |
| 515 | iso_pu_bacteria | 2848551377 | 2848552751 | 312 |
| 516 | iso_pu_bacteria | 2852632344 | 2852634406 | 312 |
| 517 | iso_pu_bacteria | 2852646457 | 2852647070 | 312 |
| 518 | iso_pu_bacteria | 2852663356 | 2852664939 | 312 |
| 519 | iso_pu_bacteria | 2857723135 | 2857723529 | 312 |
| 520 | iso_pu_bacteria | 2919395869 | 2919396321 | 312 |
| 521 | iso_pu_bacteria | 2935890801 | 2935894345 | 312 |
| 522 | iso_pu_bacteria | 2945968032 | 2945971526 | 312 |
| 523 | iso_pu_bacteria | 2946033335 | 2946034058 | 312 |
| 524 | iso_pu_bacteria | 2946041624 | 2946043906 | 312 |
| 525 | iso_pu_bacteria | 2946080515 | 2946081212 | 312 |
| 526 | iso_pu_bacteria | 8004182704 | 8004185417 | 312 |
| 527 | iso_pu_bacteria | 8054609563 | 8054610907 | 312 |
| 528 | iso_pu_bacteria | 8054609563 | 8054612425 | 312 |
| 529 | 3300005439 | Ga0070711_100279880 | Ga0070711_1002798801 | 313 |
| 530 | 3300005614 | Ga0068856_100013598 | Ga0068856_1000135983 | 313 |
| 531 | 3300005937 | Ga0081455_10004927 | Ga0081455_100049272 | 313 |
| 532 | 3300005937 | Ga0081455_10034182 | Ga0081455_100341823 | 313 |
| 533 | 3300005937 | Ga0081455_10152458 | Ga0081455_101524582 | 313 |
| 534 | 3300006844 | Ga0075428_100028171 | Ga0075428_1000281712 | 313 |
| 535 | 3300006880 | Ga0075429_100055734 | Ga0075429_1000557341 | 313 |
| 536 | 3300006914 | Ga0075436_100002562 | Ga0075436_1000025628 | 313 |
| 537 | 3300009094 | Ga0111539_10002559 | Ga0111539_100025594 | 313 |
| 538 | 3300009094 | Ga0111539_10351066 | Ga0111539_103510662 | 313 |
| 539 | 3300009098 | Ga0105245_10087733 | Ga0105245_100877333 | 313 |
| 540 | 3300009147 | Ga0114129_10056113 | Ga0114129_100561134 | 313 |
| 541 | 3300009147 | Ga0114129_10170614 | Ga0114129_101706143 | 313 |
| 542 | 3300009148 | Ga0105243_10203358 | Ga0105243_102033581 | 313 |
| 543 | 3300009551 | Ga0105238_10308362 | Ga0105238_103083621 | 313 |
| 544 | 3300011119 | Ga0105246_10043828 | Ga0105246_100438283 | 313 |
| 545 | 3300013102 | Ga0157371_10051718 | Ga0157371_100517183 | 313 |
| 546 | 3300013307 | Ga0157372_10156843 | Ga0157372_101568433 | 313 |
| 547 | 3300014326 | Ga0157380_10002258 | Ga0157380_100022583 | 313 |
| 548 | 3300025898 | Ga0207692_10005860 | Ga0207692_100058602 | 313 |
| 549 | 3300025904 | Ga0207647_10053815 | Ga0207647_100538152 | 313 |
| 550 | 3300025905 | Ga0207685_10039928 | Ga0207685_100399282 | 313 |
| 551 | 3300025906 | Ga0207699_10006159 | Ga0207699_100061594 | 313 |
| 552 | 3300025915 | Ga0207693_10030756 | Ga0207693_100307562 | 313 |
| 553 | 3300025916 | Ga0207663_10044916 | Ga0207663_100449163 | 313 |
| 554 | 3300025929 | Ga0207664_10035384 | Ga0207664_100353842 | 313 |
| 555 | 3300025939 | Ga0207665_10014554 | Ga0207665_100145543 | 313 |
| 556 | 3300026078 | Ga0207702_10009804 | Ga0207702_100098043 | 313 |
| 557 | 3300031456 | Ga0307513_10153391 | Ga0307513_101533911 | 313 |
| 558 | 3300031731 | Ga0307405_10075773 | Ga0307405_100757732 | 313 |
| 559 | 3300031852 | Ga0307410_10051718 | Ga0307410_100517181 | 313 |
| 560 | 3300031901 | Ga0307406_10021269 | Ga0307406_100212693 | 313 |
| 561 | 3300031995 | Ga0307409_100019463 | Ga0307409_1000194635 | 313 |
| 562 | 3300032004 | Ga0307414_10013769 | Ga0307414_100137695 | 313 |
| 563 | 3300032004 | Ga0307414_10024990 | Ga0307414_100249901 | 313 |
| 564 | 3300033180 | Ga0307510_10273201 | Ga0307510_102732011 | 313 |
| 565 | 3300036401 | Ga0373937_0036984 | Ga0373937_0036984_2586_3599 | 313 |
| 566 | 3300037068 | Ga0373925_0001809 | Ga0373925_0001809_83_1096 | 313 |
| 567 | 3300037068 | Ga0373925_0099419 | Ga0373925_0099419_954_1967 | 313 |
| 568 | 3300038443 | Ga0395901_0068803 | Ga0395901_0068803_1880_2899 | 313 |
| 569 | 3300039437 | Ga0436365_1403056 | Ga0436365_1403056_37_1038 | 313 |
| 570 | 3300042012 | Ga0439455_0025867 | Ga0439455_0025867_64_1083 | 313 |
| 571 | 3300042438 | Ga0439459_0001201 | Ga0439459_0001201_1924_2943 | 313 |
| 572 | 3300042439 | Ga0439464_0018006 | Ga0439464_0018006_58_1077 | 313 |
| 573 | 3300042993 | Ga0439440_0046954 | Ga0439440_0046954_37_1056 | 313 |
| 574 | 3300044706 | Ga0466964_0008788 | Ga0466964_0008788_799_1818 | 313 |
| 575 | 3300044901 | Ga0466960_0005943 | Ga0466960_0005943_3032_4051 | 313 |
| 576 | 3300044901 | Ga0466960_0050805 | Ga0466960_0050805_779_1798 | 313 |
| 577 | 3300045836 | Ga0466958_0011282 | Ga0466958_0011282_448_1449 | 313 |
| 578 | 3300045976 | Ga0466967_0012807 | Ga0466967_0012807_555_1574 | 313 |
| 579 | 3300045976 | Ga0466967_0218983 | Ga0466967_0218983_188_1210 | 313 |
| 580 | 3300045976 | Ga0466967_0483104 | Ga0466967_0483104_152_1171 | 313 |
| 581 | 3300046454 | Ga0495592_0236637 | Ga0495592_0236637_60_1073 | 313 |
| 582 | 3300046462 | Ga0495651_0125577 | Ga0495651_0125577_822_1835 | 313 |
| 583 | 3300046463 | Ga0495653_0017203 | Ga0495653_0017203_2968_3987 | 313 |
| 584 | 3300046477 | Ga0495664_0058920 | Ga0495664_0058920_1234_2253 | 313 |
| 585 | 3300046515 | Ga0495620_0025413 | Ga0495620_0025413_1282_2301 | 313 |
| 586 | 3300046516 | Ga0495628_0057436 | Ga0495628_0057436_239_1252 | 313 |
| 587 | 3300046518 | Ga0495631_0081177 | Ga0495631_0081177_154_1173 | 313 |
| 588 | 3300046529 | Ga0495652_0040565 | Ga0495652_0040565_1186_2199 | 313 |
| 589 | 3300046543 | Ga0495645_0045334 | Ga0495645_0045334_573_1586 | 313 |
| 590 | 3300046660 | Ga0495625_0253701 | Ga0495625_0253701_57_1076 | 313 |
| 591 | 3300046680 | Ga0495646_0141249 | Ga0495646_0141249_27_1040 | 313 |
| 592 | 3300046691 | Ga0495670_0133957 | Ga0495670_0133957_50_1069 | 313 |
| 593 | 3300046809 | Ga0495600_0141232 | Ga0495600_0141232_41_1054 | 313 |
| 594 | 3300047319 | Ga0495674_0288944 | Ga0495674_0288944_257_1270 | 313 |
| 595 | 3300047322 | Ga0495680_0162550 | Ga0495680_0162550_535_1548 | 313 |
| 596 | 3300048904 | Ga0496101_0138647 | Ga0496101_0138647_793_1812 | 313 |
| 597 | 3300048905 | Ga0496102_0020875 | Ga0496102_0020875_2712_3731 | 313 |
| 598 | 3300048907 | Ga0496104_0003015 | Ga0496104_0003015_6701_7711 | 313 |
| 599 | 3300048909 | Ga0496106_0005256 | Ga0496106_0005256_4843_5862 | 313 |
| 600 | 3300048909 | Ga0496106_0025161 | Ga0496106_0025161_2825_3844 | 313 |
| 601 | 3300048910 | Ga0496107_0068600 | Ga0496107_0068600_1201_2220 | 313 |
| 602 | 3300048911 | Ga0496108_0119346 | Ga0496108_0119346_606_1616 | 313 |
| 603 | 3300048912 | Ga0496109_0006631 | Ga0496109_0006631_2287_3297 | 313 |
| 604 | 3300048912 | Ga0496109_0228185 | Ga0496109_0228185_620_1639 | 313 |
| 605 | 3300048912 | Ga0496109_0308943 | Ga0496109_0308943_302_1321 | 313 |
| 606 | 3300048913 | Ga0496110_0393181 | Ga0496110_0393181_39_1058 | 313 |
| 607 | 3300048915 | Ga0496112_0002386 | Ga0496112_0002386_7123_8133 | 313 |
| 608 | 3300048917 | Ga0496114_0005860 | Ga0496114_0005860_7059_8078 | 313 |
| 609 | 3300048917 | Ga0496114_0191105 | Ga0496114_0191105_732_1751 | 313 |
| 610 | 3300048917 | Ga0496114_0252825 | Ga0496114_0252825_324_1334 | 313 |
| 611 | 3300048917 | Ga0496114_0259367 | Ga0496114_0259367_246_1250 | 313 |
| 612 | 3300048918 | Ga0496115_0028842 | Ga0496115_0028842_76_1080 | 313 |
| 613 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_654728_655747 | 313 |
| 614 | 3300048929 | Ga0496126_0144272 | Ga0496126_0144272_768_1772 | 313 |
| 615 | 3300049568 | Ga0501031_0001624 | Ga0501031_0001624_349_1368 | 313 |
| 616 | 3300049569 | Ga0501032_0000056 | Ga0501032_0000056_71757_72776 | 313 |
| 617 | 3300049569 | Ga0501032_0017506 | Ga0501032_0017506_1195_2214 | 313 |
| 618 | 3300049570 | Ga0501033_0001130 | Ga0501033_0001130_14833_15852 | 313 |
| 619 | 3300049570 | Ga0501033_0154960 | Ga0501033_0154960_194_1213 | 313 |
| 620 | 3300049571 | Ga0501034_0001982 | Ga0501034_0001982_12701_13720 | 313 |
| 621 | 3300049571 | Ga0501034_0004224 | Ga0501034_0004224_10709_11728 | 313 |
| 622 | 3300049571 | Ga0501034_0016472 | Ga0501034_0016472_6045_7064 | 313 |
| 623 | 3300049571 | Ga0501034_0089184 | Ga0501034_0089184_475_1494 | 313 |
| 624 | 3300049572 | Ga0501036_0000057 | Ga0501036_0000057_39112_40131 | 313 |
| 625 | 3300049572 | Ga0501036_0013945 | Ga0501036_0013945_2641_3660 | 313 |
| 626 | 3300049573 | Ga0501037_0000361 | Ga0501037_0000361_2014_3033 | 313 |
| 627 | 3300049573 | Ga0501037_0028153 | Ga0501037_0028153_1737_2756 | 313 |
| 628 | 3300049574 | Ga0501038_0016515 | Ga0501038_0016515_202_1221 | 313 |
| 629 | 3300049574 | Ga0501038_0030042 | Ga0501038_0030042_2965_3984 | 313 |
| 630 | 3300049575 | Ga0501039_0000623 | Ga0501039_0000623_12394_13413 | 313 |
| 631 | 3300049575 | Ga0501039_0007694 | Ga0501039_0007694_4628_5647 | 313 |
| 632 | 3300049575 | Ga0501039_0333854 | Ga0501039_0333854_146_1168 | 313 |
| 633 | 3300049576 | Ga0501040_0055813 | Ga0501040_0055813_1142_2161 | 313 |
| 634 | 3300049576 | Ga0501040_0070019 | Ga0501040_0070019_564_1586 | 313 |
| 635 | 3300049577 | Ga0501041_0022715 | Ga0501041_0022715_411_1430 | 313 |
| 636 | 3300049578 | Ga0501042_0016724 | Ga0501042_0016724_2600_3619 | 313 |
| 637 | 3300049578 | Ga0501042_0273113 | Ga0501042_0273113_134_1153 | 313 |
| 638 | 3300049579 | Ga0501043_0000755 | Ga0501043_0000755_11888_12907 | 313 |
| 639 | 3300049579 | Ga0501043_0042257 | Ga0501043_0042257_1846_2865 | 313 |
| 640 | 3300049579 | Ga0501043_0265204 | Ga0501043_0265204_59_1078 | 313 |
| 641 | 3300049580 | Ga0501046_0000701 | Ga0501046_0000701_5886_6905 | 313 |
| 642 | 3300049581 | Ga0501047_0006801 | Ga0501047_0006801_2014_3033 | 313 |
| 643 | 3300049582 | Ga0501048_0000016 | Ga0501048_0000016_63332_64351 | 313 |
| 644 | 3300049583 | Ga0501067_0000461 | Ga0501067_0000461_6721_7740 | 313 |
| 645 | 3300049583 | Ga0501067_0001018 | Ga0501067_0001018_6268_7287 | 313 |
| 646 | 3300049583 | Ga0501067_0001635 | Ga0501067_0001635_6074_7093 | 313 |
| 647 | 3300049583 | Ga0501067_0118438 | Ga0501067_0118438_319_1338 | 313 |
| 648 | 3300049584 | Ga0501068_0001742 | Ga0501068_0001742_5238_6257 | 313 |
| 649 | 3300049584 | Ga0501068_0001917 | Ga0501068_0001917_9611_10630 | 313 |
| 650 | 3300049584 | Ga0501068_0099491 | Ga0501068_0099491_734_1753 | 313 |
| 651 | 3300049585 | Ga0501069_0020666 | Ga0501069_0020666_669_1688 | 313 |
| 652 | 3300049585 | Ga0501069_0098350 | Ga0501069_0098350_233_1252 | 313 |
| 653 | 3300049585 | Ga0501069_0098864 | Ga0501069_0098864_623_1642 | 313 |
| 654 | 3300049586 | Ga0501070_0001031 | Ga0501070_0001031_10960_11979 | 313 |
| 655 | 3300049586 | Ga0501070_0001292 | Ga0501070_0001292_13606_14625 | 313 |
| 656 | 3300049586 | Ga0501070_0001455 | Ga0501070_0001455_2808_3827 | 313 |
| 657 | 3300049586 | Ga0501070_0023464 | Ga0501070_0023464_193_1212 | 313 |
| 658 | 3300049586 | Ga0501070_0161322 | Ga0501070_0161322_41_1045 | 313 |
| 659 | 3300049586 | Ga0501070_0262492 | Ga0501070_0262492_174_1193 | 313 |
| 660 | 3300049587 | Ga0501071_0011824 | Ga0501071_0011824_2289_3308 | 313 |
| 661 | 3300049587 | Ga0501071_0050268 | Ga0501071_0050268_1874_2893 | 313 |
| 662 | 3300049587 | Ga0501071_0101472 | Ga0501071_0101472_1008_2027 | 313 |
| 663 | 3300049588 | Ga0501072_0006559 | Ga0501072_0006559_5088_6107 | 313 |
| 664 | 3300049588 | Ga0501072_0025460 | Ga0501072_0025460_2240_3259 | 313 |
| 665 | 3300049589 | Ga0501073_0003609 | Ga0501073_0003609_7788_8807 | 313 |
| 666 | 3300049589 | Ga0501073_0003614 | Ga0501073_0003614_3828_4847 | 313 |
| 667 | 3300049589 | Ga0501073_0004931 | Ga0501073_0004931_8088_9107 | 313 |
| 668 | 3300049590 | Ga0501074_0000074 | Ga0501074_0000074_47117_48136 | 313 |
| 669 | 3300049590 | Ga0501074_0001017 | Ga0501074_0001017_14602_15621 | 313 |
| 670 | 3300049590 | Ga0501074_0001632 | Ga0501074_0001632_7899_8918 | 313 |
| 671 | 3300049590 | Ga0501074_0047572 | Ga0501074_0047572_1325_2344 | 313 |
| 672 | 3300049590 | Ga0501074_0087027 | Ga0501074_0087027_154_1173 | 313 |
| 673 | 3300049592 | Ga0501076_0030665 | Ga0501076_0030665_2628_3647 | 313 |
| 674 | 3300049593 | Ga0501077_0003022 | Ga0501077_0003022_1157_2176 | 313 |
| 675 | 3300049593 | Ga0501077_0025215 | Ga0501077_0025215_828_1847 | 313 |
| 676 | 3300049741 | Ga0501079_0023792 | Ga0501079_0023792_2691_3710 | 313 |
| 677 | 3300049741 | Ga0501079_0032323 | Ga0501079_0032323_2561_3580 | 313 |
| 678 | 3300049741 | Ga0501079_0075822 | Ga0501079_0075822_1023_2042 | 313 |
| 679 | 3300049742 | Ga0501080_0006051 | Ga0501080_0006051_6034_7053 | 313 |
| 680 | 3300049742 | Ga0501080_0006298 | Ga0501080_0006298_9282_10301 | 313 |
| 681 | 3300049744 | Ga0501083_0008878 | Ga0501083_0008878_5842_6861 | 313 |
| 682 | 3300049744 | Ga0501083_0155829 | Ga0501083_0155829_223_1242 | 313 |
| 683 | 3300049822 | Ga0501035_0000262 | Ga0501035_0000262_50437_51456 | 313 |
| 684 | 3300049823 | Ga0501044_0000312 | Ga0501044_0000312_6983_8002 | 313 |
| 685 | 3300049824 | Ga0501045_0028523 | Ga0501045_0028523_2593_3612 | 313 |
| 686 | 3300050508 | nmdc:mga09592_13573_c1 | nmdc:mga09592_13573_c1_74_1093 | 313 |
| 687 | 3300050511 | nmdc:mga08y16_6424_c1 | nmdc:mga08y16_6424_c1_5367_6386 | 313 |
| 688 | 3300050511 | nmdc:mga08y16_74363_c1 | nmdc:mga08y16_74363_c1_36_1055 | 313 |
| 689 | 3300050512 | nmdc:mga0n895_6711_c1 | nmdc:mga0n895_6711_c1_2854_3873 | 313 |
| 690 | 3300050513 | nmdc:mga0rr50_53529_c1 | nmdc:mga0rr50_53529_c1_338_1357 | 313 |
| 691 | 3300050514 | nmdc:mga08x19_4601_c1 | nmdc:mga08x19_4601_c1_5917_6936 | 313 |
| 692 | 3300050515 | nmdc:mga0a205_6472_c1 | nmdc:mga0a205_6472_c1_2949_3968 | 313 |
| 693 | 3300053077 | Ga0495601_0029504 | Ga0495601_0029504_2334_3353 | 313 |
| 694 | 3300053085 | Ga0495619_0231224 | Ga0495619_0231224_115_1134 | 313 |
| 695 | 3300054114 | Ga0501084_0000906 | Ga0501084_0000906_13706_14725 | 313 |
| 696 | 3300054114 | Ga0501084_0024881 | Ga0501084_0024881_3016_4035 | 313 |
| 697 | 3300060353 | Ga0501082_0036004 | Ga0501082_0036004_1803_2822 | 313 |
| 698 | 3300061734 | Ga0530510_0079212 | Ga0530510_0079212_543_1562 | 313 |
| 699 | iso_pu_bacteria | 2731639228 | 2731908564 | 313 |
| 700 | iso_pu_bacteria | 2751185734 | 2753070651 | 313 |
| 701 | iso_pu_bacteria | 2795385470 | 2795784179 | 313 |
| 702 | iso_pu_bacteria | 2808606522 | 2809592253 | 313 |
| 703 | iso_pu_bacteria | 2866612099 | 2866616539 | 313 |
| 704 | iso_pu_bacteria | 2870721527 | 2870726791 | 313 |
| 705 | iso_pu_bacteria | 2883821847 | 2883825180 | 313 |
| 706 | iso_pu_bacteria | 2891326441 | 2891326685 | 313 |
| 707 | iso_pu_bacteria | 2899359706 | 2899362166 | 313 |
| 708 | iso_pu_bacteria | 2899370129 | 2899372642 | 313 |
| 709 | 3300005355 | Ga0070671_100001146 | Ga0070671_10000114613 | 314 |
| 710 | 3300005547 | Ga0070693_100103768 | Ga0070693_1001037681 | 314 |
| 711 | 3300005617 | Ga0068859_100238647 | Ga0068859_1002386472 | 314 |
| 712 | 3300005834 | Ga0068851_10108839 | Ga0068851_101088392 | 314 |
| 713 | 3300005841 | Ga0068863_100052256 | Ga0068863_1000522562 | 314 |
| 714 | 3300006931 | Ga0097620_100238649 | Ga0097620_1002386492 | 314 |
| 715 | 3300013102 | Ga0157371_10148938 | Ga0157371_101489382 | 314 |
| 716 | 3300025927 | Ga0207687_10076337 | Ga0207687_100763371 | 314 |
| 717 | 3300025931 | Ga0207644_10003724 | Ga0207644_100037247 | 314 |
| 718 | 3300026088 | Ga0207641_10042624 | Ga0207641_100426243 | 314 |
| 719 | 3300028379 | Ga0268266_10002253 | Ga0268266_1000225314 | 314 |
| 720 | 3300028381 | Ga0268264_10167270 | Ga0268264_101672702 | 314 |
| 721 | 3300037418 | Ga0395900_0028142 | Ga0395900_0028142_2510_3514 | 314 |
| 722 | 3300044658 | Ga0466972_0009892 | Ga0466972_0009892_63_1067 | 314 |
| 723 | 3300044683 | Ga0466965_0009613 | Ga0466965_0009613_758_1762 | 314 |
| 724 | 3300044765 | Ga0466970_0023143 | Ga0466970_0023143_750_1754 | 314 |
| 725 | 3300044901 | Ga0466960_0000282 | Ga0466960_0000282_5367_6371 | 314 |
| 726 | 3300045836 | Ga0466958_0058386 | Ga0466958_0058386_230_1234 | 314 |
| 727 | 3300048903 | Ga0496100_0004473 | Ga0496100_0004473_4029_5033 | 314 |
| 728 | 3300048904 | Ga0496101_0001474 | Ga0496101_0001474_5859_6863 | 314 |
| 729 | 3300048905 | Ga0496102_0000408 | Ga0496102_0000408_27733_28737 | 314 |
| 730 | 3300048906 | Ga0496103_0000422 | Ga0496103_0000422_14897_15901 | 314 |
| 731 | 3300048908 | Ga0496105_0015525 | Ga0496105_0015525_4189_5193 | 314 |
| 732 | 3300048910 | Ga0496107_0034654 | Ga0496107_0034654_2366_3370 | 314 |
| 733 | 3300048911 | Ga0496108_0109788 | Ga0496108_0109788_38_1042 | 314 |
| 734 | 3300048919 | Ga0496116_0000688 | Ga0496116_0000688_21100_22104 | 314 |
| 735 | 3300048920 | Ga0496117_0000615 | Ga0496117_0000615_27725_28729 | 314 |
| 736 | 3300048921 | Ga0496118_0001711 | Ga0496118_0001711_9897_10901 | 314 |
| 737 | 3300048922 | Ga0496119_0019949 | Ga0496119_0019949_855_1859 | 314 |
| 738 | 3300048923 | Ga0496120_0003326 | Ga0496120_0003326_3876_4880 | 314 |
| 739 | 3300048924 | Ga0496121_0007937 | Ga0496121_0007937_2445_3449 | 314 |
| 740 | 3300048925 | Ga0496122_0192961 | Ga0496122_0192961_96_1100 | 314 |
| 741 | 3300048927 | Ga0496124_0021487 | Ga0496124_0021487_3487_4491 | 314 |
| 742 | 3300048928 | Ga0496125_0057287 | Ga0496125_0057287_313_1317 | 314 |
| 743 | 3300048929 | Ga0496126_0001071 | Ga0496126_0001071_27723_28727 | 314 |
| 744 | 3300050511 | nmdc:mga08y16_457300_c1 | nmdc:mga08y16_457300_c1_237_1241 | 314 |
| 745 | 3300002773 | JGI25152J39213_1000575 | JGI25152J39213_10005759 | 315 |
| 746 | 3300003187 | JGI25151J46595_10037562 | JGI25151J46595_100375622 | 315 |
| 747 | 3300003578 | Ga0006562J51391_1051343 | Ga0006562J51391_10513431 | 315 |
| 748 | 3300006038 | Ga0075365_10009182 | Ga0075365_100091825 | 315 |
| 749 | 3300006042 | Ga0075368_10006588 | Ga0075368_100065884 | 315 |
| 750 | 3300006048 | Ga0075363_100036812 | Ga0075363_1000368121 | 315 |
| 751 | 3300006051 | Ga0075364_10005914 | Ga0075364_100059143 | 315 |
| 752 | 3300006051 | Ga0075364_10014457 | Ga0075364_100144572 | 315 |
| 753 | 3300006051 | Ga0075364_10086870 | Ga0075364_100868702 | 315 |
| 754 | 3300006178 | Ga0075367_10001210 | Ga0075367_100012101 | 315 |
| 755 | 3300006186 | Ga0075369_10005604 | Ga0075369_100056043 | 315 |
| 756 | 3300006353 | Ga0075370_10038470 | Ga0075370_100384703 | 315 |
| 757 | 3300009036 | Ga0105244_10061431 | Ga0105244_100614312 | 315 |
| 758 | 3300020069 | Ga0197907_10135013 | Ga0197907_101350134 | 315 |
| 759 | 3300020081 | Ga0206354_10469986 | Ga0206354_104699861 | 315 |
| 760 | 3300020081 | Ga0206354_10575016 | Ga0206354_105750163 | 315 |
| 761 | 3300025258 | Ga0209129_1000028 | Ga0209129_1000028117 | 315 |
| 762 | 3300025294 | Ga0209025_1000112 | Ga0209025_100011225 | 315 |
| 763 | 3300025315 | Ga0207697_10015293 | Ga0207697_100152933 | 315 |
| 764 | 3300025728 | Ga0207655_1002765 | Ga0207655_10027659 | 315 |
| 765 | 3300025728 | Ga0207655_1005169 | Ga0207655_10051696 | 315 |
| 766 | 3300025898 | Ga0207692_10067367 | Ga0207692_100673672 | 315 |
| 767 | 3300025921 | Ga0207652_10113906 | Ga0207652_101139062 | 315 |
| 768 | 3300025927 | Ga0207687_10040646 | Ga0207687_100406463 | 315 |
| 769 | 3300027866 | Ga0209813_10004368 | Ga0209813_100043683 | 315 |
| 770 | 3300028381 | Ga0268264_10258154 | Ga0268264_102581542 | 315 |
| 771 | 3300028794 | Ga0307515_10124905 | Ga0307515_101249052 | 315 |
| 772 | 3300028794 | Ga0307515_10191725 | Ga0307515_101917252 | 315 |
| 773 | 3300031548 | Ga0307408_100002497 | Ga0307408_1000024978 | 315 |
| 774 | 3300031548 | Ga0307408_100052016 | Ga0307408_1000520162 | 315 |
| 775 | 3300031548 | Ga0307408_100140928 | Ga0307408_1001409281 | 315 |
| 776 | 3300031649 | Ga0307514_10001799 | Ga0307514_100017993 | 315 |
| 777 | 3300031731 | Ga0307405_10010328 | Ga0307405_100103283 | 315 |
| 778 | 3300031731 | Ga0307405_10158654 | Ga0307405_101586542 | 315 |
| 779 | 3300031731 | Ga0307405_10381310 | Ga0307405_103813101 | 315 |
| 780 | 3300031852 | Ga0307410_10016997 | Ga0307410_100169974 | 315 |
| 781 | 3300031852 | Ga0307410_10072631 | Ga0307410_100726312 | 315 |
| 782 | 3300031852 | Ga0307410_10080637 | Ga0307410_100806372 | 315 |
| 783 | 3300031852 | Ga0307410_10162348 | Ga0307410_101623482 | 315 |
| 784 | 3300031852 | Ga0307410_10184428 | Ga0307410_101844281 | 315 |
| 785 | 3300031852 | Ga0307410_10190154 | Ga0307410_101901542 | 315 |
| 786 | 3300031901 | Ga0307406_10000595 | Ga0307406_1000059517 | 315 |
| 787 | 3300031901 | Ga0307406_10228694 | Ga0307406_102286942 | 315 |
| 788 | 3300031903 | Ga0307407_10017546 | Ga0307407_100175464 | 315 |
| 789 | 3300031903 | Ga0307407_10115344 | Ga0307407_101153441 | 315 |
| 790 | 3300031911 | Ga0307412_10031033 | Ga0307412_100310332 | 315 |
| 791 | 3300031911 | Ga0307412_10038661 | Ga0307412_100386611 | 315 |
| 792 | 3300031911 | Ga0307412_10055274 | Ga0307412_100552741 | 315 |
| 793 | 3300031995 | Ga0307409_100185049 | Ga0307409_1001850493 | 315 |
| 794 | 3300031995 | Ga0307409_100282245 | Ga0307409_1002822452 | 315 |
| 795 | 3300032002 | Ga0307416_100010393 | Ga0307416_1000103933 | 315 |
| 796 | 3300032002 | Ga0307416_100025175 | Ga0307416_1000251753 | 315 |
| 797 | 3300032002 | Ga0307416_100050287 | Ga0307416_1000502873 | 315 |
| 798 | 3300032002 | Ga0307416_100054738 | Ga0307416_1000547383 | 315 |
| 799 | 3300032002 | Ga0307416_100208289 | Ga0307416_1002082891 | 315 |
| 800 | 3300032002 | Ga0307416_100424631 | Ga0307416_1004246311 | 315 |
| 801 | 3300032004 | Ga0307414_10031963 | Ga0307414_100319632 | 315 |
| 802 | 3300032004 | Ga0307414_10261254 | Ga0307414_102612542 | 315 |
| 803 | 3300032005 | Ga0307411_10115608 | Ga0307411_101156083 | 315 |
| 804 | 3300032126 | Ga0307415_100045786 | Ga0307415_1000457863 | 315 |
| 805 | 3300032126 | Ga0307415_100239930 | Ga0307415_1002399302 | 315 |
| 806 | 3300035086 | Ga0373934_0010153 | Ga0373934_0010153_2220_3233 | 315 |
| 807 | 3300035111 | Ga0373923_0076069 | Ga0373923_0076069_399_1412 | 315 |
| 808 | 3300035119 | Ga0373956_0017640 | Ga0373956_0017640_562_1575 | 315 |
| 809 | 3300036401 | Ga0373937_0017333 | Ga0373937_0017333_750_1763 | 315 |
| 810 | 3300039450 | Ga0436363_0081723 | Ga0436363_0081723_56_1066 | 315 |
| 811 | 3300042136 | Ga0450900_003192 | Ga0450900_003192_13_1038 | 315 |
| 812 | 3300044658 | Ga0466972_0004035 | Ga0466972_0004035_1419_2441 | 315 |
| 813 | 3300044683 | Ga0466965_0000871 | Ga0466965_0000871_2213_3238 | 315 |
| 814 | 3300044683 | Ga0466965_0007131 | Ga0466965_0007131_706_1731 | 315 |
| 815 | 3300044694 | Ga0466963_0013798 | Ga0466963_0013798_433_1461 | 315 |
| 816 | 3300044901 | Ga0466960_0149300 | Ga0466960_0149300_198_1226 | 315 |
| 817 | 3300046471 | Ga0495650_0065073 | Ga0495650_0065073_128_1153 | 315 |
| 818 | 3300046511 | Ga0495608_0044518 | Ga0495608_0044518_516_1529 | 315 |
| 819 | 3300046529 | Ga0495652_0032726 | Ga0495652_0032726_2993_4006 | 315 |
| 820 | 3300046536 | Ga0495587_0053737 | Ga0495587_0053737_1321_2334 | 315 |
| 821 | 3300046559 | Ga0495667_0004412 | Ga0495667_0004412_5521_6534 | 315 |
| 822 | 3300047317 | Ga0495604_0015370 | Ga0495604_0015370_4620_5633 | 315 |
| 823 | 3300047444 | Ga0495675_0057352 | Ga0495675_0057352_1182_2195 | 315 |
| 824 | 3300047447 | Ga0495685_059617 | Ga0495685_059617_230_1258 | 315 |
| 825 | 3300048088 | Ga0495602_0038750 | Ga0495602_0038750_1146_2159 | 315 |
| 826 | 3300048904 | Ga0496101_0020193 | Ga0496101_0020193_1381_2406 | 315 |
| 827 | 3300048905 | Ga0496102_0064776 | Ga0496102_0064776_1869_2894 | 315 |
| 828 | 3300048907 | Ga0496104_0011156 | Ga0496104_0011156_4250_5275 | 315 |
| 829 | 3300048907 | Ga0496104_0030331 | Ga0496104_0030331_3593_4621 | 315 |
| 830 | 3300048907 | Ga0496104_0224854 | Ga0496104_0224854_131_1156 | 315 |
| 831 | 3300048908 | Ga0496105_0004398 | Ga0496105_0004398_3543_4571 | 315 |
| 832 | 3300048908 | Ga0496105_0102644 | Ga0496105_0102644_935_1960 | 315 |
| 833 | 3300048910 | Ga0496107_0152770 | Ga0496107_0152770_656_1681 | 315 |
| 834 | 3300048911 | Ga0496108_0021705 | Ga0496108_0021705_499_1524 | 315 |
| 835 | 3300048911 | Ga0496108_0027927 | Ga0496108_0027927_2303_3331 | 315 |
| 836 | 3300048912 | Ga0496109_0021560 | Ga0496109_0021560_1148_2176 | 315 |
| 837 | 3300048913 | Ga0496110_0000297 | Ga0496110_0000297_27080_28108 | 315 |
| 838 | 3300048914 | Ga0496111_0005756 | Ga0496111_0005756_3449_4477 | 315 |
| 839 | 3300048914 | Ga0496111_0087583 | Ga0496111_0087583_36_1061 | 315 |
| 840 | 3300048915 | Ga0496112_0101250 | Ga0496112_0101250_702_1730 | 315 |
| 841 | 3300048915 | Ga0496112_0220395 | Ga0496112_0220395_600_1625 | 315 |
| 842 | 3300048916 | Ga0496113_0031268 | Ga0496113_0031268_2650_3678 | 315 |
| 843 | 3300048916 | Ga0496113_0245628 | Ga0496113_0245628_305_1330 | 315 |
| 844 | 3300048917 | Ga0496114_0043680 | Ga0496114_0043680_1950_2978 | 315 |
| 845 | 3300048917 | Ga0496114_0098187 | Ga0496114_0098187_1458_2483 | 315 |
| 846 | 3300048918 | Ga0496115_0095728 | Ga0496115_0095728_1332_2357 | 315 |
| 847 | 3300048919 | Ga0496116_0016328 | Ga0496116_0016328_1686_2711 | 315 |
| 848 | 3300048920 | Ga0496117_0000053 | Ga0496117_0000053_50437_51462 | 315 |
| 849 | 3300048920 | Ga0496117_0022343 | Ga0496117_0022343_35_1060 | 315 |
| 850 | 3300048922 | Ga0496119_0004593 | Ga0496119_0004593_9687_10712 | 315 |
| 851 | 3300048922 | Ga0496119_0006393 | Ga0496119_0006393_8583_9608 | 315 |
| 852 | 3300048922 | Ga0496119_0007748 | Ga0496119_0007748_8358_9383 | 315 |
| 853 | 3300048922 | Ga0496119_0011021 | Ga0496119_0011021_4666_5691 | 315 |
| 854 | 3300048922 | Ga0496119_0074968 | Ga0496119_0074968_236_1261 | 315 |
| 855 | 3300048923 | Ga0496120_0001595 | Ga0496120_0001595_11802_12827 | 315 |
| 856 | 3300048923 | Ga0496120_0002066 | Ga0496120_0002066_10889_11914 | 315 |
| 857 | 3300048923 | Ga0496120_0004880 | Ga0496120_0004880_7490_8515 | 315 |
| 858 | 3300048925 | Ga0496122_0000031 | Ga0496122_0000031_211408_212433 | 315 |
| 859 | 3300048925 | Ga0496122_0004958 | Ga0496122_0004958_9928_10953 | 315 |
| 860 | 3300048925 | Ga0496122_0048019 | Ga0496122_0048019_2244_3269 | 315 |
| 861 | 3300048926 | Ga0496123_0000013 | Ga0496123_0000013_211418_212443 | 315 |
| 862 | 3300048926 | Ga0496123_0003480 | Ga0496123_0003480_4684_5709 | 315 |
| 863 | 3300048926 | Ga0496123_0018843 | Ga0496123_0018843_1887_2912 | 315 |
| 864 | 3300048926 | Ga0496123_0052050 | Ga0496123_0052050_165_1190 | 315 |
| 865 | 3300048927 | Ga0496124_0019590 | Ga0496124_0019590_3241_4266 | 315 |
| 866 | 3300048927 | Ga0496124_0066258 | Ga0496124_0066258_604_1629 | 315 |
| 867 | 3300048928 | Ga0496125_0000077 | Ga0496125_0000077_95148_96173 | 315 |
| 868 | 3300048928 | Ga0496125_0010943 | Ga0496125_0010943_5388_6413 | 315 |
| 869 | 3300048928 | Ga0496125_0024822 | Ga0496125_0024822_3344_4369 | 315 |
| 870 | 3300048929 | Ga0496126_0002399 | Ga0496126_0002399_6536_7561 | 315 |
| 871 | 3300048929 | Ga0496126_0092532 | Ga0496126_0092532_1040_2065 | 315 |
| 872 | 3300049572 | Ga0501036_0159175 | Ga0501036_0159175_224_1249 | 315 |
| 873 | 3300049575 | Ga0501039_0109137 | Ga0501039_0109137_640_1665 | 315 |
| 874 | 3300049581 | Ga0501047_0204694 | Ga0501047_0204694_379_1404 | 315 |
| 875 | 3300049586 | Ga0501070_0133352 | Ga0501070_0133352_612_1637 | 315 |
| 876 | 3300049589 | Ga0501073_0000057 | Ga0501073_0000057_23162_24187 | 315 |
| 877 | 3300049823 | Ga0501044_0120336 | Ga0501044_0120336_1247_2272 | 315 |
| 878 | 3300050491 | nmdc:mga00v17_32273_c1 | nmdc:mga00v17_32273_c1_387_1412 | 315 |
| 879 | 3300050491 | nmdc:mga00v17_4765_c1 | nmdc:mga00v17_4765_c1_5243_6268 | 315 |
| 880 | 3300050492 | nmdc:mga0yw44_39792_c1 | nmdc:mga0yw44_39792_c1_1268_2293 | 315 |
| 881 | 3300050492 | nmdc:mga0yw44_52592_c1 | nmdc:mga0yw44_52592_c1_316_1341 | 315 |
| 882 | 3300050492 | nmdc:mga0yw44_6861_c1 | nmdc:mga0yw44_6861_c1_3886_4911 | 315 |
| 883 | 3300050494 | nmdc:mga06z11_4715_c1 | nmdc:mga06z11_4715_c1_840_1865 | 315 |
| 884 | 3300050495 | nmdc:mga04h51_6087_c1 | nmdc:mga04h51_6087_c1_58_1083 | 315 |
| 885 | 3300050496 | nmdc:mga07m45_28725_c1 | nmdc:mga07m45_28725_c1_1376_2401 | 315 |
| 886 | 3300050516 | nmdc:mga0sz30_4016_c1 | nmdc:mga0sz30_4016_c1_3148_4173 | 315 |
| 887 | 3300050516 | nmdc:mga0sz30_9709_c1 | nmdc:mga0sz30_9709_c1_818_1843 | 315 |
| 888 | 3300053104 | Ga0500556_0000168 | Ga0500556_0000168_28327_29352 | 315 |
| 889 | 3300053108 | Ga0500562_001203 | Ga0500562_001203_2168_3193 | 315 |
| 890 | 3300053117 | Ga0500593_000819 | Ga0500593_000819_5326_6351 | 315 |
| 891 | 3300053133 | Ga0500655_002809 | Ga0500655_002809_1333_2358 | 315 |
| 892 | 3300053136 | Ga0500559_0000104 | Ga0500559_0000104_30145_31170 | 315 |
| 893 | 3300053136 | Ga0500559_0000159 | Ga0500559_0000159_33516_34541 | 315 |
| 894 | 3300053139 | Ga0500568_0001269 | Ga0500568_0001269_2225_3250 | 315 |
| 895 | 3300053139 | Ga0500568_0022590 | Ga0500568_0022590_580_1605 | 315 |
| 896 | 3300053140 | Ga0500573_0037461 | Ga0500573_0037461_241_1266 | 315 |
| 897 | 3300059424 | Ga0590075_025006 | Ga0590075_025006_437_1462 | 315 |
| 898 | 3300059507 | Ga0587086_003661 | Ga0587086_003661_509_1534 | 315 |
| 899 | 3300059510 | Ga0587090_000017 | Ga0587090_000017_5045_6070 | 315 |
| 900 | 3300059511 | Ga0587091_018730 | Ga0587091_018730_140_1165 | 315 |
| 901 | 3300059604 | Ga0587098_000970 | Ga0587098_000970_967_1992 | 315 |
| 902 | 3300059647 | Ga0587079_002236 | Ga0587079_002236_167_1192 | 315 |
| 903 | 3300001991 | JGI24743J22301_10024236 | JGI24743J22301_100242361 | 316 |
| 904 | 3300003203 | JGI25406J46586_10001708 | JGI25406J46586_100017084 | 316 |
| 905 | 3300005329 | Ga0070683_100139069 | Ga0070683_1001390692 | 316 |
| 906 | 3300005329 | Ga0070683_100248569 | Ga0070683_1002485692 | 316 |
| 907 | 3300005345 | Ga0070692_10041235 | Ga0070692_100412352 | 316 |
| 908 | 3300005367 | Ga0070667_100082228 | Ga0070667_1000822281 | 316 |
| 909 | 3300005435 | Ga0070714_100017121 | Ga0070714_1000171212 | 316 |
| 910 | 3300005438 | Ga0070701_10002525 | Ga0070701_100025256 | 316 |
| 911 | 3300005441 | Ga0070700_100007467 | Ga0070700_1000074673 | 316 |
| 912 | 3300005455 | Ga0070663_100215202 | Ga0070663_1002152021 | 316 |
| 913 | 3300005456 | Ga0070678_100244261 | Ga0070678_1002442612 | 316 |
| 914 | 3300005466 | Ga0070685_10022702 | Ga0070685_100227023 | 316 |
| 915 | 3300005539 | Ga0068853_100121875 | Ga0068853_1001218752 | 316 |
| 916 | 3300005543 | Ga0070672_100013603 | Ga0070672_1000136034 | 316 |
| 917 | 3300005719 | Ga0068861_100089040 | Ga0068861_1000890403 | 316 |
| 918 | 3300005840 | Ga0068870_10002617 | Ga0068870_100026176 | 316 |
| 919 | 3300005985 | Ga0081539_10000100 | Ga0081539_10000100125 | 316 |
| 920 | 3300005985 | Ga0081539_10054195 | Ga0081539_100541952 | 316 |
| 921 | 3300006051 | Ga0075364_10017613 | Ga0075364_100176132 | 316 |
| 922 | 3300025935 | Ga0207709_10013649 | Ga0207709_100136492 | 316 |
| 923 | 3300025938 | Ga0207704_10007814 | Ga0207704_100078144 | 316 |
| 924 | 3300025944 | Ga0207661_10009201 | Ga0207661_100092015 | 316 |
| 925 | 3300025944 | Ga0207661_10223447 | Ga0207661_102234472 | 316 |
| 926 | 3300025945 | Ga0207679_10005100 | Ga0207679_100051003 | 316 |
| 927 | 3300025981 | Ga0207640_10097199 | Ga0207640_100971993 | 316 |
| 928 | 3300025986 | Ga0207658_10179438 | Ga0207658_101794383 | 316 |
| 929 | 3300026075 | Ga0207708_10004147 | Ga0207708_100041476 | 316 |
| 930 | 3300026118 | Ga0207675_100004892 | Ga0207675_10000489214 | 316 |
| 931 | 3300026142 | Ga0207698_10007141 | Ga0207698_100071415 | 316 |
| 932 | 3300028379 | Ga0268266_10001751 | Ga0268266_1000175122 | 316 |
| 933 | 3300031852 | Ga0307410_10018609 | Ga0307410_100186092 | 316 |
| 934 | 3300031852 | Ga0307410_10031345 | Ga0307410_100313453 | 316 |
| 935 | 3300031901 | Ga0307406_10006377 | Ga0307406_100063772 | 316 |
| 936 | 3300031911 | Ga0307412_10037420 | Ga0307412_100374201 | 316 |
| 937 | 3300031995 | Ga0307409_100018062 | Ga0307409_1000180622 | 316 |
| 938 | 3300032002 | Ga0307416_100022433 | Ga0307416_1000224333 | 316 |
| 939 | 3300032002 | Ga0307416_100186731 | Ga0307416_1001867312 | 316 |
| 940 | 3300032004 | Ga0307414_10013682 | Ga0307414_100136822 | 316 |
| 941 | 3300032004 | Ga0307414_10125226 | Ga0307414_101252262 | 316 |
| 942 | 3300032005 | Ga0307411_10047739 | Ga0307411_100477392 | 316 |
| 943 | 3300032126 | Ga0307415_100002035 | Ga0307415_1000020355 | 316 |
| 944 | 3300032126 | Ga0307415_100012020 | Ga0307415_1000120204 | 316 |
| 945 | 3300044694 | Ga0466963_0135378 | Ga0466963_0135378_652_1686 | 316 |
| 946 | 3300044765 | Ga0466970_0000150 | Ga0466970_0000150_16428_17504 | 316 |
| 947 | 3300046453 | Ga0495627_002964 | Ga0495627_002964_497_1525 | 316 |
| 948 | 3300048917 | Ga0496114_0056947 | Ga0496114_0056947_1339_2367 | 316 |
| 949 | 3300048920 | Ga0496117_0001799 | Ga0496117_0001799_17951_18979 | 316 |
| 950 | 3300048921 | Ga0496118_0020800 | Ga0496118_0020800_1526_2554 | 316 |
| 951 | 3300048925 | Ga0496122_0042957 | Ga0496122_0042957_14_1042 | 316 |
| 952 | 3300048927 | Ga0496124_0013716 | Ga0496124_0013716_5308_6393 | 316 |
| 953 | 3300048928 | Ga0496125_0022776 | Ga0496125_0022776_65_1093 | 316 |
| 954 | 3300048929 | Ga0496126_0019364 | Ga0496126_0019364_2431_3459 | 316 |
| 955 | 3300048929 | Ga0496126_0136302 | Ga0496126_0136302_724_1788 | 316 |
| 956 | 3300048929 | Ga0496126_0344362 | Ga0496126_0344362_75_1103 | 316 |
| 957 | 3300050491 | nmdc:mga00v17_9707_c1 | nmdc:mga00v17_9707_c1_1500_2528 | 316 |
| 958 | 3300053087 | Ga0500643_000285 | Ga0500643_000285_8029_9057 | 316 |
| 959 | 3300059491 | Ga0587070_010073 | Ga0587070_010073_339_1370 | 316 |
| 960 | 3300060353 | Ga0501082_0010928 | Ga0501082_0010928_6210_7238 | 316 |
| 961 | iso_pu_bacteria | 2643221962 | 2645723160 | 316 |
| 962 | 3300001976 | JGI24752J21851_1007622 | JGI24752J21851_10076221 | 317 |
| 963 | 3300001991 | JGI24743J22301_10013855 | JGI24743J22301_100138552 | 317 |
| 964 | 3300002067 | JGI24735J21928_10007685 | JGI24735J21928_100076853 | 317 |
| 965 | 3300002459 | JGI24751J29686_10003815 | JGI24751J29686_100038153 | 317 |
| 966 | 3300003911 | JGI25405J52794_10005273 | JGI25405J52794_100052731 | 317 |
| 967 | 3300005330 | Ga0070690_100047382 | Ga0070690_1000473821 | 317 |
| 968 | 3300005330 | Ga0070690_100196649 | Ga0070690_1001966492 | 317 |
| 969 | 3300005331 | Ga0070670_100030908 | Ga0070670_1000309083 | 317 |
| 970 | 3300005334 | Ga0068869_100030699 | Ga0068869_1000306993 | 317 |
| 971 | 3300005334 | Ga0068869_100074482 | Ga0068869_1000744822 | 317 |
| 972 | 3300005334 | Ga0068869_100119246 | Ga0068869_1001192462 | 317 |
| 973 | 3300005335 | Ga0070666_10073082 | Ga0070666_100730822 | 317 |
| 974 | 3300005336 | Ga0070680_100009182 | Ga0070680_1000091823 | 317 |
| 975 | 3300005337 | Ga0070682_100009892 | Ga0070682_1000098923 | 317 |
| 976 | 3300005337 | Ga0070682_100016882 | Ga0070682_1000168823 | 317 |
| 977 | 3300005337 | Ga0070682_100035642 | Ga0070682_1000356422 | 317 |
| 978 | 3300005338 | Ga0068868_100013718 | Ga0068868_1000137184 | 317 |
| 979 | 3300005338 | Ga0068868_100106370 | Ga0068868_1001063702 | 317 |
| 980 | 3300005338 | Ga0068868_100238572 | Ga0068868_1002385722 | 317 |
| 981 | 3300005339 | Ga0070660_100040808 | Ga0070660_1000408082 | 317 |
| 982 | 3300005339 | Ga0070660_100109366 | Ga0070660_1001093661 | 317 |
| 983 | 3300005341 | Ga0070691_10000722 | Ga0070691_1000072212 | 317 |
| 984 | 3300005343 | Ga0070687_100133163 | Ga0070687_1001331632 | 317 |
| 985 | 3300005344 | Ga0070661_100028126 | Ga0070661_1000281262 | 317 |
| 986 | 3300005345 | Ga0070692_10010386 | Ga0070692_100103864 | 317 |
| 987 | 3300005354 | Ga0070675_100002908 | Ga0070675_1000029089 | 317 |
| 988 | 3300005355 | Ga0070671_100003146 | Ga0070671_1000031463 | 317 |
| 989 | 3300005355 | Ga0070671_100065944 | Ga0070671_1000659442 | 317 |
| 990 | 3300005355 | Ga0070671_100179731 | Ga0070671_1001797312 | 317 |
| 991 | 3300005364 | Ga0070673_100056671 | Ga0070673_1000566712 | 317 |
| 992 | 3300005364 | Ga0070673_100170107 | Ga0070673_1001701071 | 317 |
| 993 | 3300005366 | Ga0070659_100020947 | Ga0070659_1000209474 | 317 |
| 994 | 3300005366 | Ga0070659_100025947 | Ga0070659_1000259474 | 317 |
| 995 | 3300005367 | Ga0070667_100004070 | Ga0070667_1000040703 | 317 |
| 996 | 3300005434 | Ga0070709_10025240 | Ga0070709_100252403 | 317 |
| 997 | 3300005437 | Ga0070710_10019318 | Ga0070710_100193184 | 317 |
| 998 | 3300005438 | Ga0070701_10147943 | Ga0070701_101479432 | 317 |
| 999 | 3300005439 | Ga0070711_100005401 | Ga0070711_1000054013 | 317 |
| 1000 | 3300005440 | Ga0070705_100016616 | Ga0070705_1000166164 | 317 |
| 1001 | 3300005441 | Ga0070700_100000088 | Ga0070700_10000008830 | 317 |
| 1002 | 3300005441 | Ga0070700_100095974 | Ga0070700_1000959742 | 317 |
| 1003 | 3300005441 | Ga0070700_100187527 | Ga0070700_1001875271 | 317 |
| 1004 | 3300005444 | Ga0070694_100021669 | Ga0070694_1000216693 | 317 |
| 1005 | 3300005455 | Ga0070663_100014373 | Ga0070663_1000143733 | 317 |
| 1006 | 3300005455 | Ga0070663_100033401 | Ga0070663_1000334013 | 317 |
| 1007 | 3300005456 | Ga0070678_100007800 | Ga0070678_1000078005 | 317 |
| 1008 | 3300005457 | Ga0070662_100038941 | Ga0070662_1000389412 | 317 |
| 1009 | 3300005458 | Ga0070681_10038502 | Ga0070681_100385022 | 317 |
| 1010 | 3300005466 | Ga0070685_10026552 | Ga0070685_100265523 | 317 |
| 1011 | 3300005530 | Ga0070679_100015824 | Ga0070679_1000158245 | 317 |
| 1012 | 3300005539 | Ga0068853_100088383 | Ga0068853_1000883833 | 317 |
| 1013 | 3300005545 | Ga0070695_100042770 | Ga0070695_1000427701 | 317 |
| 1014 | 3300005547 | Ga0070693_100000949 | Ga0070693_10000094912 | 317 |
| 1015 | 3300005548 | Ga0070665_100000754 | Ga0070665_10000075432 | 317 |
| 1016 | 3300005548 | Ga0070665_100059982 | Ga0070665_1000599823 | 317 |
| 1017 | 3300005548 | Ga0070665_100060493 | Ga0070665_1000604932 | 317 |
| 1018 | 3300005549 | Ga0070704_100015340 | Ga0070704_1000153403 | 317 |
| 1019 | 3300005563 | Ga0068855_100005880 | Ga0068855_10000588016 | 317 |
| 1020 | 3300005564 | Ga0070664_100295548 | Ga0070664_1002955482 | 317 |
| 1021 | 3300005578 | Ga0068854_100081701 | Ga0068854_1000817013 | 317 |
| 1022 | 3300005578 | Ga0068854_100265214 | Ga0068854_1002652141 | 317 |
| 1023 | 3300005614 | Ga0068856_100033582 | Ga0068856_1000335823 | 317 |
| 1024 | 3300005614 | Ga0068856_100218892 | Ga0068856_1002188922 | 317 |
| 1025 | 3300005615 | Ga0070702_100034700 | Ga0070702_1000347003 | 317 |
| 1026 | 3300005618 | Ga0068864_100256773 | Ga0068864_1002567732 | 317 |
| 1027 | 3300005718 | Ga0068866_10030200 | Ga0068866_100302002 | 317 |
| 1028 | 3300005719 | Ga0068861_100013361 | Ga0068861_1000133613 | 317 |
| 1029 | 3300005719 | Ga0068861_100298318 | Ga0068861_1002983182 | 317 |
| 1030 | 3300005834 | Ga0068851_10009913 | Ga0068851_100099134 | 317 |
| 1031 | 3300005840 | Ga0068870_10002118 | Ga0068870_100021185 | 317 |
| 1032 | 3300005841 | Ga0068863_100019674 | Ga0068863_1000196742 | 317 |
| 1033 | 3300005842 | Ga0068858_100056766 | Ga0068858_1000567663 | 317 |
| 1034 | 3300005843 | Ga0068860_100000134 | Ga0068860_10000013426 | 317 |
| 1035 | 3300005843 | Ga0068860_100059370 | Ga0068860_1000593703 | 317 |
| 1036 | 3300005937 | Ga0081455_10000873 | Ga0081455_1000087313 | 317 |
| 1037 | 3300005937 | Ga0081455_10004022 | Ga0081455_1000402215 | 317 |
| 1038 | 3300005937 | Ga0081455_10005694 | Ga0081455_100056948 | 317 |
| 1039 | 3300005937 | Ga0081455_10019705 | Ga0081455_100197053 | 317 |
| 1040 | 3300005981 | Ga0081538_10012412 | Ga0081538_100124122 | 317 |
| 1041 | 3300005983 | Ga0081540_1005619 | Ga0081540_10056194 | 317 |
| 1042 | 3300006028 | Ga0070717_10048671 | Ga0070717_100486713 | 317 |
| 1043 | 3300006028 | Ga0070717_10068708 | Ga0070717_100687081 | 317 |
| 1044 | 3300006058 | Ga0075432_10000164 | Ga0075432_1000016415 | 317 |
| 1045 | 3300006058 | Ga0075432_10000498 | Ga0075432_100004987 | 317 |
| 1046 | 3300006163 | Ga0070715_10039103 | Ga0070715_100391031 | 317 |
| 1047 | 3300006173 | Ga0070716_100008168 | Ga0070716_1000081684 | 317 |
| 1048 | 3300006175 | Ga0070712_100080245 | Ga0070712_1000802453 | 317 |
| 1049 | 3300006358 | Ga0068871_100019328 | Ga0068871_1000193282 | 317 |
| 1050 | 3300006358 | Ga0068871_100077986 | Ga0068871_1000779862 | 317 |
| 1051 | 3300006844 | Ga0075428_100006874 | Ga0075428_10000687411 | 317 |
| 1052 | 3300006844 | Ga0075428_100059055 | Ga0075428_1000590555 | 317 |
| 1053 | 3300006844 | Ga0075428_100370281 | Ga0075428_1003702812 | 317 |
| 1054 | 3300006846 | Ga0075430_100041963 | Ga0075430_1000419632 | 317 |
| 1055 | 3300006847 | Ga0075431_100034795 | Ga0075431_1000347955 | 317 |
| 1056 | 3300006847 | Ga0075431_100061483 | Ga0075431_1000614833 | 317 |
| 1057 | 3300006847 | Ga0075431_100066647 | Ga0075431_1000666473 | 317 |
| 1058 | 3300006847 | Ga0075431_100099008 | Ga0075431_1000990083 | 317 |
| 1059 | 3300006852 | Ga0075433_10000748 | Ga0075433_1000074815 | 317 |
| 1060 | 3300006852 | Ga0075433_10027215 | Ga0075433_100272155 | 317 |
| 1061 | 3300006852 | Ga0075433_10087726 | Ga0075433_100877263 | 317 |
| 1062 | 3300006871 | Ga0075434_100000896 | Ga0075434_1000008964 | 317 |
| 1063 | 3300006871 | Ga0075434_100004650 | Ga0075434_1000046505 | 317 |
| 1064 | 3300006871 | Ga0075434_100009071 | Ga0075434_1000090713 | 317 |
| 1065 | 3300006871 | Ga0075434_100018451 | Ga0075434_1000184514 | 317 |
| 1066 | 3300006880 | Ga0075429_100034994 | Ga0075429_1000349943 | 317 |
| 1067 | 3300006914 | Ga0075436_100005264 | Ga0075436_1000052646 | 317 |
| 1068 | 3300007076 | Ga0075435_100005715 | Ga0075435_1000057153 | 317 |
| 1069 | 3300007076 | Ga0075435_100020996 | Ga0075435_1000209963 | 317 |
| 1070 | 3300007076 | Ga0075435_100034802 | Ga0075435_1000348021 | 317 |
| 1071 | 3300009094 | Ga0111539_10012865 | Ga0111539_100128653 | 317 |
| 1072 | 3300009098 | Ga0105245_10014876 | Ga0105245_100148762 | 317 |
| 1073 | 3300009098 | Ga0105245_10194539 | Ga0105245_101945391 | 317 |
| 1074 | 3300009101 | Ga0105247_10002264 | Ga0105247_100022645 | 317 |
| 1075 | 3300009101 | Ga0105247_10048148 | Ga0105247_100481483 | 317 |
| 1076 | 3300009147 | Ga0114129_10026014 | Ga0114129_100260142 | 317 |
| 1077 | 3300009148 | Ga0105243_10095924 | Ga0105243_100959242 | 317 |
| 1078 | 3300009174 | Ga0105241_10064959 | Ga0105241_100649592 | 317 |
| 1079 | 3300009176 | Ga0105242_10083798 | Ga0105242_100837983 | 317 |
| 1080 | 3300009176 | Ga0105242_10099973 | Ga0105242_100999732 | 317 |
| 1081 | 3300009545 | Ga0105237_10113707 | Ga0105237_101137071 | 317 |
| 1082 | 3300009551 | Ga0105238_10040892 | Ga0105238_100408921 | 317 |
| 1083 | 3300009551 | Ga0105238_10411887 | Ga0105238_104118871 | 317 |
| 1084 | 3300009553 | Ga0105249_10007742 | Ga0105249_100077423 | 317 |
| 1085 | 3300009553 | Ga0105249_10022176 | Ga0105249_100221763 | 317 |
| 1086 | 3300010375 | Ga0105239_10055480 | Ga0105239_100554804 | 317 |
| 1087 | 3300010375 | Ga0105239_10067538 | Ga0105239_100675382 | 317 |
| 1088 | 3300010375 | Ga0105239_10207288 | Ga0105239_102072881 | 317 |
| 1089 | 3300010375 | Ga0105239_10226594 | Ga0105239_102265943 | 317 |
| 1090 | 3300010375 | Ga0105239_10735706 | Ga0105239_107357061 | 317 |
| 1091 | 3300011119 | Ga0105246_10002299 | Ga0105246_100022993 | 317 |
| 1092 | 3300011119 | Ga0105246_10108764 | Ga0105246_101087642 | 317 |
| 1093 | 3300013102 | Ga0157371_10016243 | Ga0157371_100162433 | 317 |
| 1094 | 3300013104 | Ga0157370_10131468 | Ga0157370_101314682 | 317 |
| 1095 | 3300013297 | Ga0157378_10115467 | Ga0157378_101154672 | 317 |
| 1096 | 3300013306 | Ga0163162_10113028 | Ga0163162_101130283 | 317 |
| 1097 | 3300013307 | Ga0157372_10056369 | Ga0157372_100563694 | 317 |
| 1098 | 3300013308 | Ga0157375_10012428 | Ga0157375_100124284 | 317 |
| 1099 | 3300013308 | Ga0157375_10143155 | Ga0157375_101431553 | 317 |
| 1100 | 3300014745 | Ga0157377_10007380 | Ga0157377_100073804 | 317 |
| 1101 | 3300014745 | Ga0157377_10025279 | Ga0157377_100252793 | 317 |
| 1102 | 3300014968 | Ga0157379_10092311 | Ga0157379_100923113 | 317 |
| 1103 | 3300017792 | Ga0163161_10021892 | Ga0163161_100218921 | 317 |
| 1104 | 3300017792 | Ga0163161_10028584 | Ga0163161_100285842 | 317 |
| 1105 | 3300020069 | Ga0197907_10657334 | Ga0197907_106573344 | 317 |
| 1106 | 3300020081 | Ga0206354_10740334 | Ga0206354_107403342 | 317 |
| 1107 | 3300021384 | Ga0213876_10009192 | Ga0213876_100091922 | 317 |
| 1108 | 3300022467 | Ga0224712_10024184 | Ga0224712_100241841 | 317 |
| 1109 | 3300025321 | Ga0207656_10029262 | Ga0207656_100292622 | 317 |
| 1110 | 3300025885 | Ga0207653_10012992 | Ga0207653_100129923 | 317 |
| 1111 | 3300025898 | Ga0207692_10046842 | Ga0207692_100468422 | 317 |
| 1112 | 3300025899 | Ga0207642_10159351 | Ga0207642_101593511 | 317 |
| 1113 | 3300025900 | Ga0207710_10025344 | Ga0207710_100253442 | 317 |
| 1114 | 3300025901 | Ga0207688_10031128 | Ga0207688_100311282 | 317 |
| 1115 | 3300025903 | Ga0207680_10003699 | Ga0207680_100036996 | 317 |
| 1116 | 3300025903 | Ga0207680_10037859 | Ga0207680_100378592 | 317 |
| 1117 | 3300025904 | Ga0207647_10043315 | Ga0207647_100433152 | 317 |
| 1118 | 3300025905 | Ga0207685_10026716 | Ga0207685_100267161 | 317 |
| 1119 | 3300025907 | Ga0207645_10063793 | Ga0207645_100637933 | 317 |
| 1120 | 3300025908 | Ga0207643_10001031 | Ga0207643_1000103112 | 317 |
| 1121 | 3300025910 | Ga0207684_10095023 | Ga0207684_100950232 | 317 |
| 1122 | 3300025911 | Ga0207654_10053213 | Ga0207654_100532132 | 317 |
| 1123 | 3300025912 | Ga0207707_10019141 | Ga0207707_100191412 | 317 |
| 1124 | 3300025914 | Ga0207671_10154310 | Ga0207671_101543102 | 317 |
| 1125 | 3300025915 | Ga0207693_10003490 | Ga0207693_100034903 | 317 |
| 1126 | 3300025917 | Ga0207660_10023557 | Ga0207660_100235572 | 317 |
| 1127 | 3300025918 | Ga0207662_10079527 | Ga0207662_100795272 | 317 |
| 1128 | 3300025918 | Ga0207662_10190397 | Ga0207662_101903972 | 317 |
| 1129 | 3300025919 | Ga0207657_10007056 | Ga0207657_1000705612 | 317 |
| 1130 | 3300025919 | Ga0207657_10019848 | Ga0207657_100198485 | 317 |
| 1131 | 3300025920 | Ga0207649_10001439 | Ga0207649_1000143911 | 317 |
| 1132 | 3300025921 | Ga0207652_10006279 | Ga0207652_100062799 | 317 |
| 1133 | 3300025924 | Ga0207694_10144753 | Ga0207694_101447532 | 317 |
| 1134 | 3300025924 | Ga0207694_10364629 | Ga0207694_103646292 | 317 |
| 1135 | 3300025925 | Ga0207650_10001708 | Ga0207650_1000170811 | 317 |
| 1136 | 3300025926 | Ga0207659_10004891 | Ga0207659_100048917 | 317 |
| 1137 | 3300025927 | Ga0207687_10014575 | Ga0207687_100145751 | 317 |
| 1138 | 3300025927 | Ga0207687_10023909 | Ga0207687_100239094 | 317 |
| 1139 | 3300025929 | Ga0207664_10490346 | Ga0207664_104903461 | 317 |
| 1140 | 3300025931 | Ga0207644_10008552 | Ga0207644_100085525 | 317 |
| 1141 | 3300025931 | Ga0207644_10027123 | Ga0207644_100271233 | 317 |
| 1142 | 3300025933 | Ga0207706_10007413 | Ga0207706_100074135 | 317 |
| 1143 | 3300025933 | Ga0207706_10014789 | Ga0207706_100147894 | 317 |
| 1144 | 3300025933 | Ga0207706_10040185 | Ga0207706_100401853 | 317 |
| 1145 | 3300025934 | Ga0207686_10037556 | Ga0207686_100375563 | 317 |
| 1146 | 3300025935 | Ga0207709_10058260 | Ga0207709_100582601 | 317 |
| 1147 | 3300025939 | Ga0207665_10003841 | Ga0207665_100038417 | 317 |
| 1148 | 3300025940 | Ga0207691_10024380 | Ga0207691_100243803 | 317 |
| 1149 | 3300025941 | Ga0207711_10093727 | Ga0207711_100937271 | 317 |
| 1150 | 3300025942 | Ga0207689_10001114 | Ga0207689_100011147 | 317 |
| 1151 | 3300025942 | Ga0207689_10200272 | Ga0207689_102002721 | 317 |
| 1152 | 3300025944 | Ga0207661_10002442 | Ga0207661_100024428 | 317 |
| 1153 | 3300025945 | Ga0207679_10002060 | Ga0207679_100020602 | 317 |
| 1154 | 3300025961 | Ga0207712_10021186 | Ga0207712_100211862 | 317 |
| 1155 | 3300025961 | Ga0207712_10251047 | Ga0207712_102510472 | 317 |
| 1156 | 3300025972 | Ga0207668_10008633 | Ga0207668_100086334 | 317 |
| 1157 | 3300025972 | Ga0207668_10054162 | Ga0207668_100541622 | 317 |
| 1158 | 3300025981 | Ga0207640_10072221 | Ga0207640_100722213 | 317 |
| 1159 | 3300025981 | Ga0207640_10215362 | Ga0207640_102153622 | 317 |
| 1160 | 3300025986 | Ga0207658_10035711 | Ga0207658_100357112 | 317 |
| 1161 | 3300026023 | Ga0207677_10006208 | Ga0207677_100062084 | 317 |
| 1162 | 3300026023 | Ga0207677_10033552 | Ga0207677_100335523 | 317 |
| 1163 | 3300026023 | Ga0207677_10082792 | Ga0207677_100827922 | 317 |
| 1164 | 3300026035 | Ga0207703_10050431 | Ga0207703_100504313 | 317 |
| 1165 | 3300026041 | Ga0207639_10027963 | Ga0207639_100279634 | 317 |
| 1166 | 3300026041 | Ga0207639_10090405 | Ga0207639_100904053 | 317 |
| 1167 | 3300026041 | Ga0207639_10394033 | Ga0207639_103940332 | 317 |
| 1168 | 3300026067 | Ga0207678_10005283 | Ga0207678_100052835 | 317 |
| 1169 | 3300026067 | Ga0207678_10022460 | Ga0207678_100224604 | 317 |
| 1170 | 3300026067 | Ga0207678_10097563 | Ga0207678_100975632 | 317 |
| 1171 | 3300026075 | Ga0207708_10000079 | Ga0207708_1000007970 | 317 |
| 1172 | 3300026075 | Ga0207708_10040962 | Ga0207708_100409622 | 317 |
| 1173 | 3300026075 | Ga0207708_10041659 | Ga0207708_100416592 | 317 |
| 1174 | 3300026078 | Ga0207702_10003467 | Ga0207702_1000346711 | 317 |
| 1175 | 3300026078 | Ga0207702_10007249 | Ga0207702_100072495 | 317 |
| 1176 | 3300026078 | Ga0207702_10065014 | Ga0207702_100650142 | 317 |
| 1177 | 3300026078 | Ga0207702_10079263 | Ga0207702_100792633 | 317 |
| 1178 | 3300026078 | Ga0207702_10244375 | Ga0207702_102443752 | 317 |
| 1179 | 3300026088 | Ga0207641_10007288 | Ga0207641_100072885 | 317 |
| 1180 | 3300026095 | Ga0207676_10001689 | Ga0207676_1000168912 | 317 |
| 1181 | 3300026095 | Ga0207676_10024112 | Ga0207676_100241123 | 317 |
| 1182 | 3300026118 | Ga0207675_100005587 | Ga0207675_1000055874 | 317 |
| 1183 | 3300026118 | Ga0207675_100071254 | Ga0207675_1000712543 | 317 |
| 1184 | 3300026118 | Ga0207675_100098146 | Ga0207675_1000981463 | 317 |
| 1185 | 3300026118 | Ga0207675_100246196 | Ga0207675_1002461961 | 317 |
| 1186 | 3300026121 | Ga0207683_10002016 | Ga0207683_1000201614 | 317 |
| 1187 | 3300026121 | Ga0207683_10064724 | Ga0207683_100647243 | 317 |
| 1188 | 3300026142 | Ga0207698_10005452 | Ga0207698_100054524 | 317 |
| 1189 | 3300027907 | Ga0207428_10001703 | Ga0207428_1000170315 | 317 |
| 1190 | 3300027907 | Ga0207428_10004857 | Ga0207428_100048576 | 317 |
| 1191 | 3300027907 | Ga0207428_10004938 | Ga0207428_100049385 | 317 |
| 1192 | 3300027907 | Ga0207428_10074534 | Ga0207428_100745342 | 317 |
| 1193 | 3300028379 | Ga0268266_10007568 | Ga0268266_100075688 | 317 |
| 1194 | 3300028381 | Ga0268264_10000206 | Ga0268264_1000020693 | 317 |
| 1195 | 3300028381 | Ga0268264_10129225 | Ga0268264_101292252 | 317 |
| 1196 | 3300028381 | Ga0268264_10434983 | Ga0268264_104349831 | 317 |
| 1197 | 3300028381 | Ga0268264_10452264 | Ga0268264_104522642 | 317 |
| 1198 | 3300028794 | Ga0307515_10016003 | Ga0307515_100160033 | 317 |
| 1199 | 3300030521 | Ga0307511_10000622 | Ga0307511_1000062218 | 317 |
| 1200 | 3300030522 | Ga0307512_10088690 | Ga0307512_100886903 | 317 |
| 1201 | 3300031548 | Ga0307408_100009663 | Ga0307408_1000096635 | 317 |
| 1202 | 3300031731 | Ga0307405_10001256 | Ga0307405_100012564 | 317 |
| 1203 | 3300031824 | Ga0307413_10011099 | Ga0307413_100110992 | 317 |
| 1204 | 3300031852 | Ga0307410_10001264 | Ga0307410_1000126411 | 317 |
| 1205 | 3300031852 | Ga0307410_10005638 | Ga0307410_100056386 | 317 |
| 1206 | 3300031852 | Ga0307410_10283180 | Ga0307410_102831801 | 317 |
| 1207 | 3300031901 | Ga0307406_10001047 | Ga0307406_1000104712 | 317 |
| 1208 | 3300031901 | Ga0307406_10018591 | Ga0307406_100185913 | 317 |
| 1209 | 3300031901 | Ga0307406_10040156 | Ga0307406_100401563 | 317 |
| 1210 | 3300031901 | Ga0307406_10058828 | Ga0307406_100588283 | 317 |
| 1211 | 3300031903 | Ga0307407_10000253 | Ga0307407_1000025314 | 317 |
| 1212 | 3300031911 | Ga0307412_10010395 | Ga0307412_100103953 | 317 |
| 1213 | 3300031995 | Ga0307409_100000147 | Ga0307409_10000014715 | 317 |
| 1214 | 3300031995 | Ga0307409_100194383 | Ga0307409_1001943831 | 317 |
| 1215 | 3300032002 | Ga0307416_100000096 | Ga0307416_10000009612 | 317 |
| 1216 | 3300032002 | Ga0307416_100026971 | Ga0307416_1000269713 | 317 |
| 1217 | 3300032005 | Ga0307411_10011885 | Ga0307411_100118853 | 317 |
| 1218 | 3300032005 | Ga0307411_10046650 | Ga0307411_100466501 | 317 |
| 1219 | 3300032126 | Ga0307415_100002748 | Ga0307415_1000027488 | 317 |
| 1220 | 3300032126 | Ga0307415_100185743 | Ga0307415_1001857431 | 317 |
| 1221 | 3300033180 | Ga0307510_10051130 | Ga0307510_100511301 | 317 |
| 1222 | 3300034957 | Ga0373938_0032708 | Ga0373938_0032708_76_1107 | 317 |
| 1223 | 3300035091 | Ga0373951_0011909 | Ga0373951_0011909_478_1506 | 317 |
| 1224 | 3300035114 | Ga0373939_0026490 | Ga0373939_0026490_130_1158 | 317 |
| 1225 | 3300035171 | Ga0373946_0037040 | Ga0373946_0037040_869_1900 | 317 |
| 1226 | 3300035207 | Ga0373942_0021099 | Ga0373942_0021099_463_1491 | 317 |
| 1227 | 3300035241 | Ga0373961_0018750 | Ga0373961_0018750_235_1263 | 317 |
| 1228 | 3300035242 | Ga0373962_0004504 | Ga0373962_0004504_2139_3167 | 317 |
| 1229 | 3300037471 | Ga0395905_0021363 | Ga0395905_0021363_4462_5475 | 317 |
| 1230 | 3300037853 | Ga0436364_0132104 | Ga0436364_0132104_2242_3276 | 317 |
| 1231 | 3300037853 | Ga0436364_1519328 | Ga0436364_1519328_1456_2469 | 317 |
| 1232 | 3300038443 | Ga0395901_0145868 | Ga0395901_0145868_1419_2432 | 317 |
| 1233 | 3300044683 | Ga0466965_0161680 | Ga0466965_0161680_84_1130 | 317 |
| 1234 | 3300044684 | Ga0466966_0014054 | Ga0466966_0014054_1594_2622 | 317 |
| 1235 | 3300044693 | Ga0466961_0012501 | Ga0466961_0012501_1918_2931 | 317 |
| 1236 | 3300044693 | Ga0466961_0059196 | Ga0466961_0059196_1076_2107 | 317 |
| 1237 | 3300044693 | Ga0466961_0062550 | Ga0466961_0062550_312_1340 | 317 |
| 1238 | 3300044693 | Ga0466961_0148278 | Ga0466961_0148278_256_1293 | 317 |
| 1239 | 3300044693 | Ga0466961_0195877 | Ga0466961_0195877_132_1178 | 317 |
| 1240 | 3300044694 | Ga0466963_0031995 | Ga0466963_0031995_596_1624 | 317 |
| 1241 | 3300044694 | Ga0466963_0184063 | Ga0466963_0184063_351_1379 | 317 |
| 1242 | 3300044694 | Ga0466963_0202789 | Ga0466963_0202789_46_1074 | 317 |
| 1243 | 3300044694 | Ga0466963_0249901 | Ga0466963_0249901_195_1223 | 317 |
| 1244 | 3300044706 | Ga0466964_0035553 | Ga0466964_0035553_357_1385 | 317 |
| 1245 | 3300044765 | Ga0466970_0007824 | Ga0466970_0007824_42_1055 | 317 |
| 1246 | 3300044842 | Ga0466957_0066658 | Ga0466957_0066658_47_1075 | 317 |
| 1247 | 3300044901 | Ga0466960_0024185 | Ga0466960_0024185_304_1350 | 317 |
| 1248 | 3300045049 | Ga0466959_0012810 | Ga0466959_0012810_4330_5343 | 317 |
| 1249 | 3300045049 | Ga0466959_0068943 | Ga0466959_0068943_395_1423 | 317 |
| 1250 | 3300045049 | Ga0466959_0150714 | Ga0466959_0150714_397_1434 | 317 |
| 1251 | 3300045049 | Ga0466959_0180620 | Ga0466959_0180620_19_1047 | 317 |
| 1252 | 3300045836 | Ga0466958_0007658 | Ga0466958_0007658_3154_4182 | 317 |
| 1253 | 3300045836 | Ga0466958_0045020 | Ga0466958_0045020_62_1090 | 317 |
| 1254 | 3300045836 | Ga0466958_0104555 | Ga0466958_0104555_448_1485 | 317 |
| 1255 | 3300045836 | Ga0466958_0130492 | Ga0466958_0130492_497_1528 | 317 |
| 1256 | 3300045976 | Ga0466967_0007515 | Ga0466967_0007515_72_1100 | 317 |
| 1257 | 3300045976 | Ga0466967_0010973 | Ga0466967_0010973_254_1282 | 317 |
| 1258 | 3300045976 | Ga0466967_0064319 | Ga0466967_0064319_2201_3238 | 317 |
| 1259 | 3300045976 | Ga0466967_0069869 | Ga0466967_0069869_219_1247 | 317 |
| 1260 | 3300045976 | Ga0466967_0468838 | Ga0466967_0468838_51_1079 | 317 |
| 1261 | 3300046690 | Ga0495624_0101773 | Ga0495624_0101773_695_1723 | 317 |
| 1262 | 3300048903 | Ga0496100_0094009 | Ga0496100_0094009_714_1742 | 317 |
| 1263 | 3300048904 | Ga0496101_0060077 | Ga0496101_0060077_418_1446 | 317 |
| 1264 | 3300048905 | Ga0496102_0004562 | Ga0496102_0004562_8683_9696 | 317 |
| 1265 | 3300048906 | Ga0496103_0077445 | Ga0496103_0077445_581_1609 | 317 |
| 1266 | 3300048907 | Ga0496104_0002039 | Ga0496104_0002039_3538_4551 | 317 |
| 1267 | 3300048907 | Ga0496104_0013081 | Ga0496104_0013081_4950_5978 | 317 |
| 1268 | 3300048908 | Ga0496105_0004304 | Ga0496105_0004304_6036_7049 | 317 |
| 1269 | 3300048908 | Ga0496105_0078654 | Ga0496105_0078654_816_1844 | 317 |
| 1270 | 3300048909 | Ga0496106_0010733 | Ga0496106_0010733_2568_3581 | 317 |
| 1271 | 3300048910 | Ga0496107_0046180 | Ga0496107_0046180_1925_2938 | 317 |
| 1272 | 3300048911 | Ga0496108_0003215 | Ga0496108_0003215_2549_3577 | 317 |
| 1273 | 3300048911 | Ga0496108_0005025 | Ga0496108_0005025_6036_7049 | 317 |
| 1274 | 3300048911 | Ga0496108_0043434 | Ga0496108_0043434_1298_2326 | 317 |
| 1275 | 3300048912 | Ga0496109_0017008 | Ga0496109_0017008_2764_3792 | 317 |
| 1276 | 3300048912 | Ga0496109_0026938 | Ga0496109_0026938_3731_4759 | 317 |
| 1277 | 3300048913 | Ga0496110_0005654 | Ga0496110_0005654_8375_9388 | 317 |
| 1278 | 3300048913 | Ga0496110_0009807 | Ga0496110_0009807_3551_4579 | 317 |
| 1279 | 3300048914 | Ga0496111_0001007 | Ga0496111_0001007_10661_11674 | 317 |
| 1280 | 3300048914 | Ga0496111_0014929 | Ga0496111_0014929_2692_3720 | 317 |
| 1281 | 3300048914 | Ga0496111_0190053 | Ga0496111_0190053_286_1314 | 317 |
| 1282 | 3300048915 | Ga0496112_0049018 | Ga0496112_0049018_1964_2992 | 317 |
| 1283 | 3300048915 | Ga0496112_0068652 | Ga0496112_0068652_1225_2238 | 317 |
| 1284 | 3300048917 | Ga0496114_0189083 | Ga0496114_0189083_579_1592 | 317 |
| 1285 | 3300048918 | Ga0496115_0106044 | Ga0496115_0106044_1229_2257 | 317 |
| 1286 | 3300049568 | Ga0501031_0023230 | Ga0501031_0023230_2810_3841 | 317 |
| 1287 | 3300049569 | Ga0501032_0013108 | Ga0501032_0013108_1772_2803 | 317 |
| 1288 | 3300049574 | Ga0501038_0026722 | Ga0501038_0026722_14_1045 | 317 |
| 1289 | 3300049579 | Ga0501043_0035628 | Ga0501043_0035628_26_1057 | 317 |
| 1290 | 3300049580 | Ga0501046_0192666 | Ga0501046_0192666_91_1122 | 317 |
| 1291 | 3300049581 | Ga0501047_0017379 | Ga0501047_0017379_2689_3720 | 317 |
| 1292 | 3300049582 | Ga0501048_0013474 | Ga0501048_0013474_991_2022 | 317 |
| 1293 | 3300050507 | nmdc:mga05p37_338571_c1 | nmdc:mga05p37_338571_c1_398_1411 | 317 |
| 1294 | 3300050507 | nmdc:mga05p37_7095_c1 | nmdc:mga05p37_7095_c1_4830_5849 | 317 |
| 1295 | 3300050508 | nmdc:mga09592_41710_c1 | nmdc:mga09592_41710_c1_1687_2700 | 317 |
| 1296 | 3300050510 | nmdc:mga06r32_56136_c1 | nmdc:mga06r32_56136_c1_1742_2866 | 317 |
| 1297 | 3300050511 | nmdc:mga08y16_8872_c1 | nmdc:mga08y16_8872_c1_3724_4737 | 317 |
| 1298 | 3300050512 | nmdc:mga0n895_108726_c1 | nmdc:mga0n895_108726_c1_1155_2183 | 317 |
| 1299 | 3300050512 | nmdc:mga0n895_116830_c1 | nmdc:mga0n895_116830_c1_170_1183 | 317 |
| 1300 | 3300050513 | nmdc:mga0rr50_7151_c1 | nmdc:mga0rr50_7151_c1_1928_2941 | 317 |
| 1301 | 3300050514 | nmdc:mga08x19_3108_c1 | nmdc:mga08x19_3108_c1_6935_7948 | 317 |
| 1302 | 3300050515 | nmdc:mga0a205_9144_c1 | nmdc:mga0a205_9144_c1_3866_4879 | 317 |
| 1303 | 3300061719 | Ga0466962_0005614 | Ga0466962_0005614_2951_3979 | 317 |
| 1304 | 3300061719 | Ga0466962_0024254 | Ga0466962_0024254_278_1306 | 317 |
| 1305 | 3300061719 | Ga0466962_0141248 | Ga0466962_0141248_34_1062 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kpq-assembly1.cif.gz_A | crystal structure of ctde in complex with fad | 0.9648 | 19 | 46 |
| 7fgp-assembly1.cif.gz_A | crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) | 0.9574 | 19 | 46 |
| 1zx9-assembly1.cif.gz_A | crystal structure of tn501 mera | 0.9547 | 20 | 46 |
| 2ivd-assembly2.cif.gz_B | structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen | 0.9535 | 20 | 46 |
| 3i3l-assembly1.cif.gz_A | crystal structure of cmls, a flavin-dependent halogenase | 0.9405 | 19 | 46 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKJ7_1_183_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9967 | 1 | 183 | 3.40.50.720 |
| af_P9WKJ7_1_183_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9913 | 1 | 183 | 3.40.50.720 |
| 4xehA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9745 | 3 | 183 | 3.40.50.720 |
| 4xehA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9692 | 3 | 183 | 3.40.50.720 |
| af_Q54BK7_6_401_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9649 | 21 | 46 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A837GNI2-F1-model_v4 | Ketol-acid reductoisomerase (EC 1.1.1.86) | 1.003 | 6 | 78 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 |
| AF-A0A0Q0BUF5-F1-model_v4 | Ketol-acid reductoisomerase | 0.9988 | 6 | 78 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 |
| AF-A0A7X3PML5-F1-model_v4 | Ketol-acid reductoisomerase (EC 1.1.1.86) | 0.9969 | 4 | 181 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 |
| AF-A0A2E0NNX8-F1-model_v4 | deleted | 0.9968 | 6 | 87 |
|
| AF-A0A7K3B7V4-F1-model_v4 | Ketol-acid reductoisomerase | 0.9963 | 3 | 93 |
GO:0004455
GO:0005829 GO:0009097 GO:0009099 GO:0016853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar