F492809

General Info

Members Datasets Scaffolds Average Seq Length
1305 583 1170 332

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0015763|Ga0466960_0015763_673_1692
Length 329
Sequence MFYDDDADLSVIQGRNVAVLGYGSQGHAHALSLRDSGVDVRVGLPEGSKSRAKAEAEGLRVLTPGEACEDHTQRKVYAEYVEPNLVDGDALFFGHGFNIRFGYIKPPAGVDVAMVAPKGPGHLVRREYSAGRGVPVLVAVENDATGKAWELALAYAKAIGGLRAGGIKTTFTEETETDLFGEQAVLCGGMSELVMKGFEVLTEAGYQPEVAYFECLHELKLIVDLMYEGGIAKQRWSVSDTAEYGDYVSGPRVIDDSVKGRMQDVLADIKSGAFAKRFIDDQDAGAPEFKALRAKGEQHPIEETGRELRKLMAWVHTDDSDYTEGTATR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
5 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
6 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
7 2643221546 Microbacterium sp. Root53 Isolate Unclassified
8 2643221553 Microbacterium sp. Root553 Isolate Unclassified
9 2643221566 Microbacterium sp. Root166 Isolate Unclassified
10 2643221575 Microbacterium sp. Root61 Isolate Unclassified
11 2643221597 Microbacterium sp. Root180 Isolate Unclassified
12 2643221613 Oerskovia sp. Root22 Isolate Unclassified
13 2643221630 Microbacterium sp. Root322 Isolate Unclassified
14 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
15 2643221649 Leifsonia sp. Root4 Isolate Unclassified
16 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
17 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
18 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
19 2643221721 Oerskovia sp. Root918 Isolate Unclassified
20 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
21 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
22 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
23 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
24 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
25 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
26 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
27 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
28 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
29 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
30 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
31 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
32 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
33 2773857759 Microbacterium sp. 1294 Isolate Unclassified
34 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
35 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
36 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
37 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
38 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
39 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
40 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
41 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
42 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
43 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
44 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
45 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
46 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
47 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
48 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
49 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
50 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
51 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
52 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
53 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
54 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
55 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
56 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
57 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
58 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
59 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
60 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
61 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
62 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
63 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
64 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
65 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
66 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
67 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
68 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
69 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
70 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
71 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
72 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
73 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
74 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
75 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
76 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
77 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
78 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
79 2891562705 Microbispora tritici MT50 Isolate Unclassified
80 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
81 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
82 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
83 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
84 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
85 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
86 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
87 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
88 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
89 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
90 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
91 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
92 2919069694 Microbacterium sp. 1154 Isolate Unclassified
93 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
94 2919395869 Microbacterium resistens 2980 Isolate Unclassified
95 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
96 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
97 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
98 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
99 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
100 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
101 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
102 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
103 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
104 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
105 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
106 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
107 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
108 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
109 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
110 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
111 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
112 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
113 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
114 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
115 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
116 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
117 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
118 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
119 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
120 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
121 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
122 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
123 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
124 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
125 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
126 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
127 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
128 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
129 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
130 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
131 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
132 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
133 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
135 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
137 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
138 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
139 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
140 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
141 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
142 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
143 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
144 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
145 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
146 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
147 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
148 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
149 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
150 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
151 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
152 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
153 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
154 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
155 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
156 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
157 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
158 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
159 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
160 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
161 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
162 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
163 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
164 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
165 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
166 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
167 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
168 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
169 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
170 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
171 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
172 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
173 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
174 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
175 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
176 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
177 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
178 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
179 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
180 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
181 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
182 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
183 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
184 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
185 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
186 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
187 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
188 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
189 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
190 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
191 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
192 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
193 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
194 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
195 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
196 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
197 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
198 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
199 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
200 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
201 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
202 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
203 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
204 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
205 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
206 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
207 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
208 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
209 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
210 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
211 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
212 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
213 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
214 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
215 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
216 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
217 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
218 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
219 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
220 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
221 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
222 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
223 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
224 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
225 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
226 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
227 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
228 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
229 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
230 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
231 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
232 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
233 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
234 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
235 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
236 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
237 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
238 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
239 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
240 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
244 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
245 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
246 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
247 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
248 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
253 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
254 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
255 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
258 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
259 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
260 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
261 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
262 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
263 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
264 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
265 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
266 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
267 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
268 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
269 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
332 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
337 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
338 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
339 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
340 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
341 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
342 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
343 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
344 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
345 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
346 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
347 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
348 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
349 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
350 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
351 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
352 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
353 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
354 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
355 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
356 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
357 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
358 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
359 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
360 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
361 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
362 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
363 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
364 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
365 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
366 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
367 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
368 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
369 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
370 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
371 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
372 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
373 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
374 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
375 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
376 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
377 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
378 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
379 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
380 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
381 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
382 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
383 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
384 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
385 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
386 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
387 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
388 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
389 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
390 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
391 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
392 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
393 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
394 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
395 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
396 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
397 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
398 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
399 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
400 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
401 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
402 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
403 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
404 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
405 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
406 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
407 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
408 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
409 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
410 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
411 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
412 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
413 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
414 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
415 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
416 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
417 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
418 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
419 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
420 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
421 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
422 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
423 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
424 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
425 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
426 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
427 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
428 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
429 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
430 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
431 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
432 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
433 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
434 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
435 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
436 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
437 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
438 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
439 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
440 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
441 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
442 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
443 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
444 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
445 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
446 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
447 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
448 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
449 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
450 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
451 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
452 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
453 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
454 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
455 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
456 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
457 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
458 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
459 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
460 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
461 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
462 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
463 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
464 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
465 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
466 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
467 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
468 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
469 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
470 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
471 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
472 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
473 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
474 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
475 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
476 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
477 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
478 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
479 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
480 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
483 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
484 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
485 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
486 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
487 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
488 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
489 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
490 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
491 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
492 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
493 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
494 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
495 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
496 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
497 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
498 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
499 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
500 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
501 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
502 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
517 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
519 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
520 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
521 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
522 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
523 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
524 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
525 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
526 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
527 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
528 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
529 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
530 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
531 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
532 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
533 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
536 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
537 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
538 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
539 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
540 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
541 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
542 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
543 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
544 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
545 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
546 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
547 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
548 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
549 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
550 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
551 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
552 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
553 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
554 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
555 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
556 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
557 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
558 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
559 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
560 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
561 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
562 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
563 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
564 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
572 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
573 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
574 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
575 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
576 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
577 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
578 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
579 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
580 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
581 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
582 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
583 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.74
Metatranscriptomes 1.92
Isolates 10.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 3.14
Nodule 0.15
Rhizoplane 7.59
Rhizosphere 78.16
Stem 0
Stem Tuber 0.08
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1007622 3300001976 Bacteria 1412
2 JGI24743J22301_10013855 3300001991 Bacteria 1482
3 JGI24743J22301_10024236 3300001991 Bacteria 1171
4 JGI24735J21928_10007685 3300002067 Bacteria 3507
5 JGI24751J29686_10003815 3300002459 Bacteria 3042
6 JGI25152J39213_1000575 3300002773 Bacteria 19918
7 JGI25151J46595_10037562 3300003187 Bacteria 1815
8 JGI25406J46586_10001708 3300003203 Bacteria 10326
9 Ga0006562J51391_1051343 3300003578 Bacteria 1733
10 JGI25404J52841_10002141 3300003659 Bacteria 3677
11 JGI25405J52794_10005273 3300003911 Bacteria 2327
12 Ga0058863_11608832 3300004799 Bacteria 1962
13 Ga0070658_10000309 3300005327 Bacteria 42138
14 Ga0070658_10002686 3300005327 Bacteria 14793
15 Ga0070658_10073343 3300005327 Bacteria 2807
16 Ga0070683_100028369 3300005329 Bacteria 5058
17 Ga0070683_100139069 3300005329 Bacteria 2300
18 Ga0070683_100150733 3300005329 Bacteria 2205
19 Ga0070683_100248569 3300005329 Bacteria 1691
20 Ga0070690_100047382 3300005330 Bacteria 2735
21 Ga0070690_100196382 3300005330 Bacteria 1401
22 Ga0070690_100196649 3300005330 Bacteria 1401
23 Ga0070670_100030908 3300005331 Bacteria 4612
24 Ga0068869_100030699 3300005334 Bacteria 3776
25 Ga0068869_100074482 3300005334 Bacteria 2520
26 Ga0068869_100116718 3300005334 Bacteria 2036
27 Ga0068869_100119246 3300005334 Bacteria 2016
28 Ga0070666_10073082 3300005335 Bacteria 2335
29 Ga0070680_100001094 3300005336 Bacteria 19451
30 Ga0070680_100009182 3300005336 Bacteria 7583
31 Ga0070680_100166353 3300005336 Bacteria 1854
32 Ga0070682_100009892 3300005337 Bacteria 5400
33 Ga0070682_100016882 3300005337 Bacteria 4248
34 Ga0070682_100035642 3300005337 Bacteria 3038
35 Ga0068868_100013718 3300005338 Bacteria 5952
36 Ga0068868_100106370 3300005338 Bacteria 2276
37 Ga0068868_100238572 3300005338 Bacteria 1527
38 Ga0070660_100040808 3300005339 Bacteria 3534
39 Ga0070660_100043804 3300005339 Bacteria 3421
40 Ga0070660_100109366 3300005339 Bacteria 2198
41 Ga0070689_100083548 3300005340 Bacteria 2509
42 Ga0070691_10000722 3300005341 Bacteria 12916
43 Ga0070687_100055685 3300005343 Bacteria 2066
44 Ga0070687_100133163 3300005343 Bacteria 1438
45 Ga0070661_100017686 3300005344 Bacteria 5059
46 Ga0070661_100028126 3300005344 Bacteria 4054
47 Ga0070692_10010386 3300005345 Bacteria 4233
48 Ga0070692_10041235 3300005345 Bacteria 2364
49 Ga0070692_10220521 3300005345 Bacteria 1121
50 Ga0070669_100160437 3300005353 Bacteria 1747
51 Ga0070675_100002908 3300005354 Bacteria 12910
52 Ga0070675_100078035 3300005354 Bacteria 2757
53 Ga0070671_100001146 3300005355 Bacteria 19744
54 Ga0070671_100003146 3300005355 Bacteria 12864
55 Ga0070671_100065944 3300005355 Bacteria 3017
56 Ga0070671_100179731 3300005355 Bacteria 1791
57 Ga0070673_100023874 3300005364 Bacteria 4473
58 Ga0070673_100056671 3300005364 Bacteria 3093
59 Ga0070673_100170107 3300005364 Bacteria 1859
60 Ga0070659_100001204 3300005366 Bacteria 18837
61 Ga0070659_100020947 3300005366 Bacteria 4972
62 Ga0070659_100025947 3300005366 Bacteria 4507
63 Ga0070659_100077895 3300005366 Bacteria 2644
64 Ga0070659_100081076 3300005366 Bacteria 2591
65 Ga0070667_100004070 3300005367 Bacteria 12361
66 Ga0070667_100082228 3300005367 Bacteria 2757
67 Ga0070709_10025240 3300005434 Bacteria 3509
68 Ga0070714_100017121 3300005435 Bacteria 5868
69 Ga0070714_100238264 3300005435 Bacteria 1679
70 Ga0070710_10019318 3300005437 Bacteria 3519
71 Ga0070701_10002525 3300005438 Bacteria 7071
72 Ga0070701_10051383 3300005438 Bacteria 2138
73 Ga0070701_10147943 3300005438 Bacteria 1350
74 Ga0070711_100005401 3300005439 Bacteria 7642
75 Ga0070711_100279880 3300005439 Bacteria 1319
76 Ga0070705_100016616 3300005440 Bacteria 3826
77 Ga0070700_100000088 3300005441 Bacteria 61864
78 Ga0070700_100007467 3300005441 Bacteria 5906
79 Ga0070700_100095974 3300005441 Bacteria 1944
80 Ga0070700_100187527 3300005441 Bacteria 1444
81 Ga0070694_100021669 3300005444 Bacteria 4110
82 Ga0070663_100010451 3300005455 Bacteria 5785
83 Ga0070663_100014373 3300005455 Bacteria 5081
84 Ga0070663_100033401 3300005455 Bacteria 3554
85 Ga0070663_100215202 3300005455 Bacteria 1506
86 Ga0070678_100007800 3300005456 Bacteria 6368
87 Ga0070678_100244261 3300005456 Bacteria 1502
88 Ga0070662_100038941 3300005457 Bacteria 3380
89 Ga0070681_10000009 3300005458 Bacteria 146582
90 Ga0070681_10038502 3300005458 Bacteria 4795
91 Ga0068867_100194089 3300005459 Bacteria 1622
92 Ga0070685_10022702 3300005466 Bacteria 3424
93 Ga0070685_10026552 3300005466 Bacteria 3192
94 Ga0070706_100011209 3300005467 Bacteria 8325
95 Ga0070706_100158430 3300005467 Bacteria 2113
96 Ga0070707_100070629 3300005468 Bacteria 3363
97 Ga0070698_100258403 3300005471 Bacteria 1674
98 Ga0070679_100000163 3300005530 Bacteria 53457
99 Ga0070679_100015824 3300005530 Bacteria 7258
100 Ga0070679_100063514 3300005530 Bacteria 3680
101 Ga0070684_100005110 3300005535 Bacteria 10028
102 Ga0070697_100316455 3300005536 Bacteria 1343
103 Ga0068853_100088383 3300005539 Bacteria 2720
104 Ga0068853_100121875 3300005539 Bacteria 2327
105 Ga0070672_100013603 3300005543 Bacteria 5754
106 Ga0070672_100064485 3300005543 Bacteria 2895
107 Ga0070686_100031912 3300005544 Bacteria 3226
108 Ga0070695_100042770 3300005545 Bacteria 2877
109 Ga0070695_100052078 3300005545 Bacteria 2629
110 Ga0070696_100014280 3300005546 Bacteria 5328
111 Ga0070693_100000949 3300005547 Bacteria 12869
112 Ga0070693_100103768 3300005547 Bacteria 1737
113 Ga0070665_100000754 3300005548 Bacteria 42987
114 Ga0070665_100059982 3300005548 Bacteria 3813
115 Ga0070665_100060493 3300005548 Bacteria 3796
116 Ga0070704_100015340 3300005549 Bacteria 4812
117 Ga0068855_100005880 3300005563 Bacteria 14963
118 Ga0070664_100064900 3300005564 Bacteria 3114
119 Ga0070664_100295548 3300005564 Bacteria 1463
120 Ga0068854_100081701 3300005578 Bacteria 2387
121 Ga0068854_100265214 3300005578 Bacteria 1377
122 Ga0068856_100013598 3300005614 Bacteria 7877
123 Ga0068856_100033582 3300005614 Bacteria 5024
124 Ga0068856_100218892 3300005614 Bacteria 1919
125 Ga0070702_100009584 3300005615 Bacteria 4747
126 Ga0070702_100034700 3300005615 Bacteria 2781
127 Ga0068852_100067530 3300005616 Bacteria 3126
128 Ga0068859_100026493 3300005617 Bacteria 5814
129 Ga0068859_100238647 3300005617 Bacteria 1907
130 Ga0068864_100074023 3300005618 Bacteria 2971
131 Ga0068864_100256773 3300005618 Bacteria 1624
132 Ga0068866_10030200 3300005718 Bacteria 2599
133 Ga0068866_10085278 3300005718 Bacteria 1707
134 Ga0068861_100013361 3300005719 Bacteria 5747
135 Ga0068861_100020576 3300005719 Bacteria 4729
136 Ga0068861_100089040 3300005719 Bacteria 2432
137 Ga0068861_100298318 3300005719 Bacteria 1395
138 Ga0068851_10009913 3300005834 Bacteria 4437
139 Ga0068851_10108839 3300005834 Bacteria 1478
140 Ga0068870_10002118 3300005840 Bacteria 8215
141 Ga0068870_10002617 3300005840 Bacteria 7531
142 Ga0068863_100019674 3300005841 Bacteria 6458
143 Ga0068863_100052256 3300005841 Bacteria 3873
144 Ga0068863_100083924 3300005841 Bacteria 3019
145 Ga0068858_100056766 3300005842 Bacteria 3618
146 Ga0068858_100092490 3300005842 Bacteria 2815
147 Ga0068858_100369729 3300005842 Bacteria 1375
148 Ga0068860_100000134 3300005843 Bacteria 120350
149 Ga0068860_100059370 3300005843 Bacteria 3636
150 Ga0081455_10000873 3300005937 Bacteria 38958
151 Ga0081455_10004022 3300005937 Bacteria 16667
152 Ga0081455_10004927 3300005937 Bacteria 14775
153 Ga0081455_10005694 3300005937 Bacteria 13595
154 Ga0081455_10019705 3300005937 Bacteria 6372
155 Ga0081455_10034182 3300005937 Bacteria 4557
156 Ga0081455_10152458 3300005937 Bacteria 1780
157 Ga0081538_10012412 3300005981 Bacteria 6828
158 Ga0081538_10101111 3300005981 Bacteria 1452
159 Ga0081540_1000292 3300005983 Bacteria 52588
160 Ga0081540_1001174 3300005983 Bacteria 22953
161 Ga0081540_1005619 3300005983 Bacteria 9336
162 Ga0081539_10000100 3300005985 Bacteria 199516
163 Ga0081539_10054195 3300005985 Bacteria 2241
164 Ga0070717_10048671 3300006028 Bacteria 3478
165 Ga0070717_10068708 3300006028 Bacteria 2949
166 Ga0075365_10009182 3300006038 Bacteria 5667
167 Ga0075365_10153811 3300006038 Bacteria 1601
168 Ga0075368_10006588 3300006042 Bacteria 4066
169 Ga0075363_100036812 3300006048 Bacteria 2568
170 Ga0075364_10005914 3300006051 Bacteria 7149
171 Ga0075364_10014457 3300006051 Bacteria 4877
172 Ga0075364_10017613 3300006051 Bacteria 4467
173 Ga0075364_10086870 3300006051 Bacteria 2072
174 Ga0075432_10000164 3300006058 Bacteria 16304
175 Ga0075432_10000498 3300006058 Bacteria 11771
176 Ga0070715_10039103 3300006163 Bacteria 1974
177 Ga0070716_100008168 3300006173 Bacteria 5185
178 Ga0070712_100080245 3300006175 Bacteria 2361
179 Ga0075367_10001210 3300006178 Bacteria 10831
180 Ga0075369_10005604 3300006186 Bacteria 4700
181 Ga0075370_10038470 3300006353 Bacteria 2692
182 Ga0068871_100019328 3300006358 Bacteria 5199
183 Ga0068871_100077986 3300006358 Bacteria 2739
184 Ga0068871_100081612 3300006358 Bacteria 2679
185 Ga0075428_100006874 3300006844 Bacteria 12637
186 Ga0075428_100028171 3300006844 Bacteria 6214
187 Ga0075428_100059055 3300006844 Bacteria 4200
188 Ga0075428_100370281 3300006844 Bacteria 1536
189 Ga0075430_100041963 3300006846 Bacteria 3869
190 Ga0075431_100034795 3300006847 Bacteria 5189
191 Ga0075431_100061483 3300006847 Bacteria 3875
192 Ga0075431_100066647 3300006847 Bacteria 3717
193 Ga0075431_100099008 3300006847 Bacteria 3009
194 Ga0075433_10000748 3300006852 Bacteria 22289
195 Ga0075433_10027215 3300006852 Bacteria 4847
196 Ga0075433_10087726 3300006852 Bacteria 2748
197 Ga0075434_100000896 3300006871 Bacteria 23873
198 Ga0075434_100004650 3300006871 Bacteria 12405
199 Ga0075434_100009071 3300006871 Bacteria 9264
200 Ga0075434_100018451 3300006871 Bacteria 6741
201 Ga0075434_100345699 3300006871 Bacteria 1508
202 Ga0075429_100034994 3300006880 Bacteria 4365
203 Ga0075429_100055734 3300006880 Bacteria 3440
204 Ga0075436_100002562 3300006914 Bacteria 12511
205 Ga0075436_100005264 3300006914 Bacteria 8902
206 Ga0097620_100026493 3300006931 Bacteria 5814
207 Ga0097620_100238649 3300006931 Bacteria 1907
208 Ga0075435_100005715 3300007076 Bacteria 8719
209 Ga0075435_100020996 3300007076 Bacteria 5016
210 Ga0075435_100034802 3300007076 Bacteria 3993
211 Ga0099795_10041210 3300007788 Bacteria 1643
212 Ga0105251_10016765 3300009011 Bacteria 3946
213 Ga0105244_10005231 3300009036 Bacteria 8669
214 Ga0105244_10047450 3300009036 Bacteria 2203
215 Ga0105244_10061431 3300009036 Bacteria 1891
216 Ga0105244_10064894 3300009036 Bacteria 1830
217 Ga0105240_10426751 3300009093 Bacteria 1488
218 Ga0111539_10002559 3300009094 Bacteria 24078
219 Ga0111539_10012865 3300009094 Bacteria 10470
220 Ga0111539_10351066 3300009094 Bacteria 1717
221 Ga0105245_10014876 3300009098 Bacteria 6777
222 Ga0105245_10017525 3300009098 Bacteria 6250
223 Ga0105245_10087733 3300009098 Bacteria 2856
224 Ga0105245_10194539 3300009098 Bacteria 1944
225 Ga0105247_10002264 3300009101 Bacteria 13231
226 Ga0105247_10048148 3300009101 Bacteria 2618
227 Ga0114129_10026014 3300009147 Bacteria 8287
228 Ga0114129_10056113 3300009147 Bacteria 5519
229 Ga0114129_10170614 3300009147 Bacteria 2966
230 Ga0114129_10492590 3300009147 Bacteria 1602
231 Ga0105243_10046912 3300009148 Bacteria 3400
232 Ga0105243_10095924 3300009148 Bacteria 2452
233 Ga0105243_10107450 3300009148 Bacteria 2327
234 Ga0105243_10203358 3300009148 Bacteria 1738
235 Ga0105241_10064959 3300009174 Bacteria 2819
236 Ga0105241_10136457 3300009174 Bacteria 1992
237 Ga0105242_10057689 3300009176 Bacteria 3181
238 Ga0105242_10083798 3300009176 Bacteria 2670
239 Ga0105242_10099973 3300009176 Bacteria 2456
240 Ga0105242_10113311 3300009176 Bacteria 2316
241 Ga0105248_10411453 3300009177 Bacteria 1523
242 Ga0105237_10021220 3300009545 Bacteria 6680
243 Ga0105237_10113707 3300009545 Bacteria 2699
244 Ga0105238_10040892 3300009551 Bacteria 4697
245 Ga0105238_10308362 3300009551 Bacteria 1567
246 Ga0105238_10411887 3300009551 Bacteria 1345
247 Ga0105249_10007742 3300009553 Bacteria 9362
248 Ga0105249_10022176 3300009553 Bacteria 5687
249 Ga0105239_10055480 3300010375 Bacteria 4345
250 Ga0105239_10067538 3300010375 Bacteria 3928
251 Ga0105239_10207288 3300010375 Bacteria 2197
252 Ga0105239_10226594 3300010375 Bacteria 2097
253 Ga0105239_10261107 3300010375 Bacteria 1946
254 Ga0105239_10735706 3300010375 Bacteria 1129
255 Ga0105246_10002299 3300011119 Bacteria 11528
256 Ga0105246_10008058 3300011119 Bacteria 6468
257 Ga0105246_10009194 3300011119 Bacteria 6085
258 Ga0105246_10043828 3300011119 Bacteria 3037
259 Ga0105246_10108764 3300011119 Bacteria 2032
260 Ga0105246_10180093 3300011119 Bacteria 1626
261 Ga0157339_1001910 3300012505 Bacteria 1347
262 Ga0157373_10221661 3300013100 Bacteria 1334
263 Ga0157371_10014805 3300013102 Bacteria 5871
264 Ga0157371_10016243 3300013102 Bacteria 5561
265 Ga0157371_10019134 3300013102 Bacteria 5055
266 Ga0157371_10051718 3300013102 Bacteria 2919
267 Ga0157371_10148938 3300013102 Bacteria 1669
268 Ga0157370_10131468 3300013104 Bacteria 2335
269 Ga0157370_10179700 3300013104 Bacteria 1966
270 Ga0157369_10169565 3300013105 Bacteria 2300
271 Ga0157369_10401755 3300013105 Bacteria 1421
272 Ga0157378_10115467 3300013297 Bacteria 2467
273 Ga0157378_10153763 3300013297 Bacteria 2145
274 Ga0163162_10113028 3300013306 Bacteria 2814
275 Ga0163162_10288370 3300013306 Bacteria 1773
276 Ga0157372_10056369 3300013307 Bacteria 4391
277 Ga0157372_10156843 3300013307 Bacteria 2629
278 Ga0157372_10470680 3300013307 Bacteria 1465
279 Ga0157375_10012428 3300013308 Bacteria 7554
280 Ga0157375_10143155 3300013308 Bacteria 2519
281 Ga0163163_10016279 3300014325 Bacteria 6904
282 Ga0163163_10336166 3300014325 Bacteria 1565
283 Ga0157380_10002258 3300014326 Bacteria 12956
284 Ga0157380_10086145 3300014326 Bacteria 2580
285 Ga0157377_10007380 3300014745 Bacteria 5305
286 Ga0157377_10025279 3300014745 Bacteria 3166
287 Ga0157377_10031358 3300014745 Bacteria 2888
288 Ga0157379_10092311 3300014968 Bacteria 2716
289 Ga0163161_10021892 3300017792 Bacteria 4496
290 Ga0163161_10028584 3300017792 Bacteria 3961
291 Ga0163161_10057846 3300017792 Bacteria 2817
292 Ga0197907_10135013 3300020069 Bacteria 3298
293 Ga0197907_10657334 3300020069 Bacteria 2363
294 Ga0206356_11271902 3300020070 Bacteria 1725
295 Ga0206351_10445551 3300020077 Bacteria 2398
296 Ga0206350_10417353 3300020080 Bacteria 1672
297 Ga0206354_10469986 3300020081 Bacteria 1076
298 Ga0206354_10575016 3300020081 Bacteria 3014
299 Ga0206354_10706613 3300020081 Bacteria 3530
300 Ga0206354_10740334 3300020081 Bacteria 1446
301 Ga0206353_10787144 3300020082 Bacteria 2405
302 Ga0213876_10009192 3300021384 Bacteria 5322
303 Ga0213875_10000250 3300021388 Bacteria 54123
304 Ga0213875_10052106 3300021388 Bacteria 1916
305 Ga0224712_10003694 3300022467 Bacteria 4019
306 Ga0224712_10024184 3300022467 Bacteria 2119
307 Ga0224712_10067806 3300022467 Bacteria 1440
308 Ga0224712_10077659 3300022467 Bacteria 1363
309 Ga0207425_1019477 3300025245 Bacteria 1460
310 Ga0209129_1000028 3300025258 Bacteria 405451
311 Ga0209025_1000112 3300025294 Bacteria 218958
312 Ga0207697_10015293 3300025315 Bacteria 3172
313 Ga0207656_10029262 3300025321 Bacteria 2267
314 Ga0207655_1002765 3300025728 Bacteria 13685
315 Ga0207655_1005169 3300025728 Bacteria 8980
316 Ga0207655_1021225 3300025728 Bacteria 3304
317 Ga0207653_10012153 3300025885 Bacteria 2688
318 Ga0207653_10012992 3300025885 Bacteria 2604
319 Ga0207692_10005860 3300025898 Bacteria 4953
320 Ga0207692_10011599 3300025898 Bacteria 3757
321 Ga0207692_10046842 3300025898 Bacteria 2169
322 Ga0207692_10067367 3300025898 Bacteria 1874
323 Ga0207642_10159351 3300025899 Bacteria 1210
324 Ga0207710_10025344 3300025900 Bacteria 2559
325 Ga0207710_10038286 3300025900 Bacteria 2120
326 Ga0207688_10024354 3300025901 Bacteria 3319
327 Ga0207688_10031128 3300025901 Bacteria 2944
328 Ga0207680_10003699 3300025903 Bacteria 7187
329 Ga0207680_10037859 3300025903 Bacteria 2788
330 Ga0207647_10043315 3300025904 Bacteria 2818
331 Ga0207647_10053815 3300025904 Bacteria 2479
332 Ga0207647_10062551 3300025904 Bacteria 2267
333 Ga0207685_10026716 3300025905 Bacteria 2011
334 Ga0207685_10039928 3300025905 Bacteria 1746
335 Ga0207699_10006159 3300025906 Bacteria 5784
336 Ga0207699_10016027 3300025906 Bacteria 3909
337 Ga0207699_10120558 3300025906 Bacteria 1696
338 Ga0207645_10032358 3300025907 Bacteria 3361
339 Ga0207645_10063793 3300025907 Bacteria 2354
340 Ga0207643_10001031 3300025908 Bacteria 16542
341 Ga0207705_10007997 3300025909 Bacteria 7754
342 Ga0207705_10012346 3300025909 Bacteria 6172
343 Ga0207684_10028995 3300025910 Bacteria 4714
344 Ga0207684_10095023 3300025910 Bacteria 2543
345 Ga0207654_10053213 3300025911 Bacteria 2336
346 Ga0207654_10085923 3300025911 Bacteria 1906
347 Ga0207707_10000240 3300025912 Bacteria 59635
348 Ga0207707_10019141 3300025912 Bacteria 5975
349 Ga0207707_10071304 3300025912 Bacteria 3028
350 Ga0207671_10154310 3300025914 Bacteria 1775
351 Ga0207693_10003490 3300025915 Bacteria 13418
352 Ga0207693_10030756 3300025915 Bacteria 4241
353 Ga0207663_10044916 3300025916 Bacteria 2715
354 Ga0207660_10000327 3300025917 Bacteria 30717
355 Ga0207660_10023557 3300025917 Bacteria 4159
356 Ga0207662_10002366 3300025918 Bacteria 9452
357 Ga0207662_10079527 3300025918 Bacteria 1998
358 Ga0207662_10190397 3300025918 Bacteria 1323
359 Ga0207657_10002812 3300025919 Bacteria 18725
360 Ga0207657_10007056 3300025919 Bacteria 11541
361 Ga0207657_10009292 3300025919 Bacteria 9902
362 Ga0207657_10019848 3300025919 Bacteria 6369
363 Ga0207657_10030946 3300025919 Bacteria 4851
364 Ga0207649_10001439 3300025920 Bacteria 14060
365 Ga0207649_10032099 3300025920 Bacteria 3128
366 Ga0207652_10000227 3300025921 Bacteria 59166
367 Ga0207652_10006279 3300025921 Bacteria 9591
368 Ga0207652_10073146 3300025921 Bacteria 2981
369 Ga0207652_10096765 3300025921 Bacteria 2601
370 Ga0207652_10113906 3300025921 Bacteria 2400
371 Ga0207694_10064012 3300025924 Bacteria 2865
372 Ga0207694_10144753 3300025924 Bacteria 1913
373 Ga0207694_10364629 3300025924 Bacteria 1198
374 Ga0207650_10001708 3300025925 Bacteria 15594
375 Ga0207659_10004891 3300025926 Bacteria 8116
376 Ga0207659_10300439 3300025926 Bacteria 1318
377 Ga0207659_10325030 3300025926 Bacteria 1270
378 Ga0207687_10014575 3300025927 Bacteria 5145
379 Ga0207687_10023909 3300025927 Bacteria 4076
380 Ga0207687_10040646 3300025927 Bacteria 3189
381 Ga0207687_10070184 3300025927 Bacteria 2500
382 Ga0207687_10076337 3300025927 Bacteria 2407
383 Ga0207687_10203325 3300025927 Bacteria 1550
384 Ga0207664_10035384 3300025929 Bacteria 3853
385 Ga0207664_10038026 3300025929 Bacteria 3729
386 Ga0207664_10490346 3300025929 Bacteria 1100
387 Ga0207644_10003724 3300025931 Bacteria 9881
388 Ga0207644_10008552 3300025931 Bacteria 6695
389 Ga0207644_10027123 3300025931 Bacteria 3956
390 Ga0207690_10011953 3300025932 Bacteria 5190
391 Ga0207706_10007413 3300025933 Bacteria 10143
392 Ga0207706_10014789 3300025933 Bacteria 7064
393 Ga0207706_10040185 3300025933 Bacteria 4145
394 Ga0207686_10037556 3300025934 Bacteria 2924
395 Ga0207709_10013649 3300025935 Bacteria 4482
396 Ga0207709_10058260 3300025935 Bacteria 2400
397 Ga0207670_10063797 3300025936 Bacteria 2522
398 Ga0207704_10007814 3300025938 Bacteria 5074
399 Ga0207665_10003841 3300025939 Bacteria 10042
400 Ga0207665_10014554 3300025939 Bacteria 5180
401 Ga0207691_10024380 3300025940 Bacteria 5690
402 Ga0207691_10049725 3300025940 Bacteria 3841
403 Ga0207711_10093727 3300025941 Bacteria 2645
404 Ga0207689_10001114 3300025942 Bacteria 25910
405 Ga0207689_10060265 3300025942 Bacteria 3121
406 Ga0207689_10200272 3300025942 Bacteria 1648
407 Ga0207661_10002442 3300025944 Bacteria 12805
408 Ga0207661_10009201 3300025944 Bacteria 7079
409 Ga0207661_10015456 3300025944 Bacteria 5617
410 Ga0207661_10154062 3300025944 Bacteria 1989
411 Ga0207661_10156161 3300025944 Bacteria 1976
412 Ga0207661_10223447 3300025944 Bacteria 1665
413 Ga0207679_10002060 3300025945 Bacteria 12472
414 Ga0207679_10005100 3300025945 Bacteria 8213
415 Ga0207679_10135983 3300025945 Bacteria 1979
416 Ga0207667_10188103 3300025949 Bacteria 2119
417 Ga0207712_10021186 3300025961 Bacteria 4265
418 Ga0207712_10075019 3300025961 Bacteria 2444
419 Ga0207712_10251047 3300025961 Bacteria 1430
420 Ga0207668_10008633 3300025972 Bacteria 6082
421 Ga0207668_10054162 3300025972 Bacteria 2784
422 Ga0207668_10189738 3300025972 Bacteria 1628
423 Ga0207640_10072221 3300025981 Bacteria 2327
424 Ga0207640_10097199 3300025981 Bacteria 2055
425 Ga0207640_10215362 3300025981 Bacteria 1466
426 Ga0207658_10035711 3300025986 Bacteria 3561
427 Ga0207658_10179438 3300025986 Bacteria 1751
428 Ga0207658_10299763 3300025986 Bacteria 1384
429 Ga0207677_10006208 3300026023 Bacteria 6531
430 Ga0207677_10033552 3300026023 Bacteria 3314
431 Ga0207677_10082792 3300026023 Bacteria 2307
432 Ga0207677_10271124 3300026023 Bacteria 1388
433 Ga0207703_10050431 3300026035 Bacteria 3369
434 Ga0207639_10027963 3300026041 Bacteria 4112
435 Ga0207639_10061069 3300026041 Bacteria 2909
436 Ga0207639_10090405 3300026041 Bacteria 2449
437 Ga0207639_10394033 3300026041 Bacteria 1246
438 Ga0207678_10003260 3300026067 Bacteria 14649
439 Ga0207678_10005283 3300026067 Bacteria 11565
440 Ga0207678_10022460 3300026067 Bacteria 5525
441 Ga0207678_10097563 3300026067 Bacteria 2512
442 Ga0207708_10000079 3300026075 Bacteria 75645
443 Ga0207708_10004147 3300026075 Bacteria 10661
444 Ga0207708_10040962 3300026075 Bacteria 3532
445 Ga0207708_10041659 3300026075 Bacteria 3500
446 Ga0207708_10098638 3300026075 Bacteria 2259
447 Ga0207702_10003467 3300026078 Bacteria 14378
448 Ga0207702_10007249 3300026078 Bacteria 9483
449 Ga0207702_10009020 3300026078 Bacteria 8399
450 Ga0207702_10009804 3300026078 Bacteria 8033
451 Ga0207702_10065014 3300026078 Bacteria 3123
452 Ga0207702_10079263 3300026078 Bacteria 2846
453 Ga0207702_10244375 3300026078 Bacteria 1683
454 Ga0207641_10007288 3300026088 Bacteria 9215
455 Ga0207641_10042624 3300026088 Bacteria 3808
456 Ga0207641_10143157 3300026088 Bacteria 2159
457 Ga0207648_10288414 3300026089 Bacteria 1469
458 Ga0207676_10001689 3300026095 Bacteria 16285
459 Ga0207676_10024112 3300026095 Bacteria 4499
460 Ga0207674_10002289 3300026116 Bacteria 24291
461 Ga0207675_100004892 3300026118 Bacteria 12913
462 Ga0207675_100005587 3300026118 Bacteria 12035
463 Ga0207675_100013049 3300026118 Bacteria 7757
464 Ga0207675_100071254 3300026118 Bacteria 3249
465 Ga0207675_100098146 3300026118 Bacteria 2759
466 Ga0207675_100246196 3300026118 Bacteria 1729
467 Ga0207683_10002016 3300026121 Bacteria 17976
468 Ga0207683_10014903 3300026121 Bacteria 6617
469 Ga0207683_10064724 3300026121 Bacteria 3222
470 Ga0207698_10005452 3300026142 Bacteria 7868
471 Ga0207698_10007141 3300026142 Bacteria 6994
472 Ga0207698_10341715 3300026142 Bacteria 1410
473 Ga0209813_10004368 3300027866 Bacteria 3376
474 Ga0207428_10001703 3300027907 Bacteria 22568
475 Ga0207428_10004857 3300027907 Bacteria 12676
476 Ga0207428_10004938 3300027907 Bacteria 12561
477 Ga0207428_10039060 3300027907 Bacteria 3855
478 Ga0207428_10074534 3300027907 Bacteria 2661
479 Ga0268266_10001751 3300028379 Bacteria 24833
480 Ga0268266_10002253 3300028379 Bacteria 21001
481 Ga0268266_10007568 3300028379 Bacteria 9782
482 Ga0268266_10119528 3300028379 Bacteria 2343
483 Ga0268265_10187757 3300028380 Bacteria 1782
484 Ga0268264_10000206 3300028381 Bacteria 120365
485 Ga0268264_10129225 3300028381 Bacteria 2237
486 Ga0268264_10145684 3300028381 Bacteria 2117
487 Ga0268264_10167270 3300028381 Bacteria 1986
488 Ga0268264_10258154 3300028381 Bacteria 1622
489 Ga0268264_10434983 3300028381 Bacteria 1268
490 Ga0268264_10452264 3300028381 Bacteria 1244
491 Ga0307515_10016003 3300028794 Bacteria 13769
492 Ga0307515_10124905 3300028794 Bacteria 2884
493 Ga0307515_10191725 3300028794 Bacteria 1951
494 Ga0265338_10008883 3300028800 Bacteria 12105
495 Ga0265338_10042643 3300028800 Bacteria 4222
496 Ga0307511_10000622 3300030521 Bacteria 37906
497 Ga0307512_10088690 3300030522 Bacteria 2169
498 Ga0307513_10153391 3300031456 Bacteria 2208
499 Ga0307408_100002497 3300031548 Bacteria 12877
500 Ga0307408_100009663 3300031548 Bacteria 6359
501 Ga0307408_100052016 3300031548 Bacteria 2953
502 Ga0307408_100061215 3300031548 Bacteria 2747
503 Ga0307408_100140928 3300031548 Bacteria 1892
504 Ga0307408_100294609 3300031548 Bacteria 1356
505 Ga0307514_10001799 3300031649 Bacteria 24110
506 Ga0316576_10019948 3300031727 Bacteria 4601
507 Ga0316576_10023650 3300031727 Bacteria 4283
508 Ga0316578_10015874 3300031728 Bacteria 4063
509 Ga0307405_10001256 3300031731 Bacteria 10573
510 Ga0307405_10010328 3300031731 Bacteria 4830
511 Ga0307405_10031204 3300031731 Bacteria 3134
512 Ga0307405_10075773 3300031731 Bacteria 2180
513 Ga0307405_10084320 3300031731 Bacteria 2086
514 Ga0307405_10158654 3300031731 Bacteria 1599
515 Ga0307405_10198357 3300031731 Bacteria 1455
516 Ga0307405_10381310 3300031731 Bacteria 1097
517 Ga0307413_10011099 3300031824 Bacteria 4409
518 Ga0307413_10014122 3300031824 Bacteria 4042
519 Ga0307410_10001264 3300031852 Bacteria 11237
520 Ga0307410_10004512 3300031852 Bacteria 7211
521 Ga0307410_10005638 3300031852 Bacteria 6655
522 Ga0307410_10010737 3300031852 Bacteria 5206
523 Ga0307410_10016997 3300031852 Bacteria 4355
524 Ga0307410_10018609 3300031852 Bacteria 4202
525 Ga0307410_10031345 3300031852 Bacteria 3411
526 Ga0307410_10051718 3300031852 Bacteria 2770
527 Ga0307410_10072631 3300031852 Bacteria 2390
528 Ga0307410_10080637 3300031852 Bacteria 2283
529 Ga0307410_10162348 3300031852 Bacteria 1675
530 Ga0307410_10184428 3300031852 Bacteria 1582
531 Ga0307410_10190154 3300031852 Bacteria 1560
532 Ga0307410_10197945 3300031852 Bacteria 1532
533 Ga0307410_10248195 3300031852 Bacteria 1383
534 Ga0307410_10283180 3300031852 Bacteria 1302
535 Ga0307406_10000595 3300031901 Bacteria 20772
536 Ga0307406_10001047 3300031901 Bacteria 15422
537 Ga0307406_10006377 3300031901 Bacteria 6509
538 Ga0307406_10018591 3300031901 Bacteria 4063
539 Ga0307406_10021269 3300031901 Bacteria 3835
540 Ga0307406_10040156 3300031901 Bacteria 2908
541 Ga0307406_10058828 3300031901 Bacteria 2471
542 Ga0307406_10228694 3300031901 Bacteria 1387
543 Ga0307407_10000253 3300031903 Bacteria 15855
544 Ga0307407_10017546 3300031903 Bacteria 3595
545 Ga0307407_10033253 3300031903 Bacteria 2812
546 Ga0307407_10115344 3300031903 Bacteria 1693
547 Ga0307412_10010395 3300031911 Bacteria 5359
548 Ga0307412_10031033 3300031911 Bacteria 3371
549 Ga0307412_10037420 3300031911 Bacteria 3118
550 Ga0307412_10038661 3300031911 Bacteria 3074
551 Ga0307412_10047335 3300031911 Bacteria 2824
552 Ga0307412_10055274 3300031911 Bacteria 2639
553 Ga0307409_100000147 3300031995 Bacteria 26624
554 Ga0307409_100011956 3300031995 Bacteria 5503
555 Ga0307409_100018062 3300031995 Bacteria 4725
556 Ga0307409_100019463 3300031995 Bacteria 4597
557 Ga0307409_100185049 3300031995 Bacteria 1848
558 Ga0307409_100194383 3300031995 Bacteria 1809
559 Ga0307409_100224661 3300031995 Bacteria 1697
560 Ga0307409_100273292 3300031995 Bacteria 1557
561 Ga0307409_100282245 3300031995 Bacteria 1535
562 Ga0307416_100000096 3300032002 Bacteria 58513
563 Ga0307416_100010393 3300032002 Bacteria 6144
564 Ga0307416_100022433 3300032002 Bacteria 4557
565 Ga0307416_100025175 3300032002 Bacteria 4359
566 Ga0307416_100026971 3300032002 Bacteria 4244
567 Ga0307416_100034413 3300032002 Bacteria 3855
568 Ga0307416_100050287 3300032002 Bacteria 3321
569 Ga0307416_100054738 3300032002 Bacteria 3208
570 Ga0307416_100186731 3300032002 Bacteria 1949
571 Ga0307416_100208289 3300032002 Bacteria 1862
572 Ga0307416_100221178 3300032002 Bacteria 1816
573 Ga0307416_100424631 3300032002 Bacteria 1374
574 Ga0307414_10013682 3300032004 Bacteria 4840
575 Ga0307414_10013769 3300032004 Bacteria 4824
576 Ga0307414_10024990 3300032004 Bacteria 3818
577 Ga0307414_10031963 3300032004 Bacteria 3459
578 Ga0307414_10125226 3300032004 Bacteria 1984
579 Ga0307414_10261254 3300032004 Bacteria 1445
580 Ga0307411_10011885 3300032005 Bacteria 4722
581 Ga0307411_10046650 3300032005 Bacteria 2795
582 Ga0307411_10047739 3300032005 Bacteria 2770
583 Ga0307411_10115608 3300032005 Bacteria 1930
584 Ga0307415_100002035 3300032126 Bacteria 9975
585 Ga0307415_100002748 3300032126 Bacteria 8796
586 Ga0307415_100012020 3300032126 Bacteria 4987
587 Ga0307415_100023785 3300032126 Bacteria 3811
588 Ga0307415_100045786 3300032126 Bacteria 2936
589 Ga0307415_100086212 3300032126 Bacteria 2259
590 Ga0307415_100185743 3300032126 Bacteria 1635
591 Ga0307415_100239930 3300032126 Bacteria 1465
592 Ga0307415_100253936 3300032126 Bacteria 1430
593 Ga0307510_10051130 3300033180 Bacteria 4374
594 Ga0307510_10273201 3300033180 Bacteria 1165
595 Ga0373930_0003603 3300034816 Bacteria 2469
596 Ga0373938_0032708 3300034957 Bacteria 1121
597 Ga0373926_0019149 3300035083 Bacteria 2359
598 Ga0373928_0027634 3300035084 Bacteria 1236
599 Ga0373934_0005656 3300035086 Bacteria 4629
600 Ga0373934_0010153 3300035086 Bacteria 3534
601 Ga0373951_0011909 3300035091 Bacteria 1956
602 Ga0373952_0015890 3300035092 Bacteria 1524
603 Ga0373923_0076069 3300035111 Bacteria 1449
604 Ga0373936_0095722 3300035113 Bacteria 1248
605 Ga0373939_0026490 3300035114 Bacteria 1635
606 Ga0373945_0009239 3300035116 Bacteria 3226
607 Ga0373953_0027907 3300035117 Bacteria 2172
608 Ga0373953_0031275 3300035117 Bacteria 2069
609 Ga0373954_0065345 3300035118 Bacteria 1721
610 Ga0373956_0017640 3300035119 Bacteria 3012
611 Ga0373956_0091858 3300035119 Bacteria 1401
612 Ga0373946_0037040 3300035171 Bacteria 1981
613 Ga0373955_0036062 3300035172 Bacteria 2622
614 Ga0373955_0071321 3300035172 Bacteria 1943
615 Ga0373955_0126488 3300035172 Bacteria 1489
616 Ga0373942_0021099 3300035207 Bacteria 1641
617 Ga0373961_0018750 3300035241 Bacteria 1810
618 Ga0373962_0004504 3300035242 Bacteria 3370
619 Ga0373962_0043489 3300035242 Bacteria 1273
620 Ga0373924_0005264 3300035410 Bacteria 4573
621 Ga0373924_0100898 3300035410 Bacteria 1241
622 Ga0373935_0045918 3300035692 Bacteria 2757
623 Ga0373927_0021229 3300035695 Bacteria 4254
624 Ga0373933_0007620 3300035724 Bacteria 5909
625 Ga0373937_0017333 3300036401 Bacteria 6415
626 Ga0373937_0022991 3300036401 Bacteria 5606
627 Ga0373937_0036984 3300036401 Bacteria 4448
628 Ga0316584_0056317 3300036712 Bacteria 2943
629 Ga0373925_0001809 3300037068 Bacteria 17846
630 Ga0373925_0043453 3300037068 Bacteria 3335
631 Ga0373925_0099419 3300037068 Bacteria 2234
632 Ga0373925_0242548 3300037068 Bacteria 1444
633 Ga0395899_0003411 3300037312 Bacteria 12611
634 Ga0395899_0184421 3300037312 Bacteria 1463
635 Ga0395900_0014998 3300037418 Bacteria 7898
636 Ga0395900_0028142 3300037418 Bacteria 5756
637 Ga0395900_0078843 3300037418 Bacteria 3384
638 Ga0395900_0270917 3300037418 Bacteria 1692
639 Ga0395898_0031104 3300037466 Bacteria 5338
640 Ga0395898_0033898 3300037466 Bacteria 5092
641 Ga0395898_0039158 3300037466 Bacteria 4693
642 Ga0395898_0053847 3300037466 Bacteria 3928
643 Ga0395898_0077491 3300037466 Bacteria 3209
644 Ga0395905_0021363 3300037471 Bacteria 6121
645 Ga0395905_0408883 3300037471 Bacteria 1252
646 Ga0436364_0132104 3300037853 Bacteria 4671
647 Ga0436364_0287407 3300037853 Bacteria 132611
648 Ga0436364_1090900 3300037853 Bacteria 1236
649 Ga0436364_1282665 3300037853 Bacteria 3935
650 Ga0436364_1519328 3300037853 Bacteria 8051
651 Ga0395901_0003177 3300038443 Bacteria 16531
652 Ga0395901_0014684 3300038443 Bacteria 7959
653 Ga0395901_0017075 3300038443 Bacteria 7399
654 Ga0395901_0068803 3300038443 Bacteria 3688
655 Ga0395901_0071769 3300038443 Bacteria 3609
656 Ga0395901_0145868 3300038443 Bacteria 2487
657 Ga0436365_0073587 3300039437 Bacteria 3071
658 Ga0436365_1172453 3300039437 Bacteria 1220
659 Ga0436365_1403056 3300039437 Bacteria 1364
660 Ga0436363_0081723 3300039450 Bacteria 1198
661 Ga0436363_1665714 3300039450 Bacteria 1758
662 Ga0436362_0714019 3300039453 Bacteria 1326
663 Ga0439436_0008336 3300041404 Bacteria 3183
664 Ga0439439_0000161 3300041406 Bacteria 9930
665 Ga0439461_0005937 3300041410 Bacteria 2108
666 Ga0439466_0005934 3300041411 Bacteria 4647
667 Ga0439465_0020465 3300041413 Bacteria 2073
668 Ga0439433_0002516 3300041999 Bacteria 3892
669 Ga0439442_000029 3300042002 Bacteria 33495
670 Ga0439432_003644 3300042006 Bacteria 5692
671 Ga0439449_0000228 3300042007 Bacteria 20163
672 Ga0439449_0012024 3300042007 Bacteria 3252
673 Ga0439452_007360 3300042010 Bacteria 3376
674 Ga0439455_0025867 3300042012 Bacteria 1429
675 Ga0439457_003434 3300042014 Bacteria 4306
676 Ga0439463_049367 3300042016 Bacteria 1073
677 Ga0450919_000141 3300042121 Bacteria 7493
678 Ga0450920_000615 3300042122 Bacteria 5679
679 Ga0450900_003192 3300042136 Bacteria 1804
680 Ga0450907_000142 3300042146 Bacteria 27461
681 Ga0450907_007996 3300042146 Bacteria 1761
682 Ga0450908_000689 3300042184 Bacteria 6481
683 Ga0450908_006101 3300042184 Bacteria 2298
684 Ga0450909_000040 3300042185 Bacteria 10739
685 Ga0439434_0000010 3300042435 Bacteria 48982
686 Ga0439444_0003764 3300042437 Bacteria 2163
687 Ga0439459_0001201 3300042438 Bacteria 3777
688 Ga0439464_0018006 3300042439 Bacteria 1920
689 Ga0450918_001024 3300042531 Bacteria 5789
690 Ga0439440_0046954 3300042993 Bacteria 1068
691 Ga0466969_0021281 3300044656 Bacteria 3354
692 Ga0466972_0004035 3300044658 Bacteria 7321
693 Ga0466972_0009892 3300044658 Bacteria 4786
694 Ga0466965_0000871 3300044683 Bacteria 11501
695 Ga0466965_0007131 3300044683 Bacteria 5117
696 Ga0466965_0009613 3300044683 Bacteria 4497
697 Ga0466965_0161680 3300044683 Bacteria 1174
698 Ga0466966_0014054 3300044684 Bacteria 5300
699 Ga0466966_0050102 3300044684 Bacteria 2657
700 Ga0466966_0099830 3300044684 Bacteria 1796
701 Ga0466961_0012501 3300044693 Bacteria 5434
702 Ga0466961_0059196 3300044693 Bacteria 2436
703 Ga0466961_0062550 3300044693 Bacteria 2365
704 Ga0466961_0148278 3300044693 Bacteria 1466
705 Ga0466961_0195877 3300044693 Bacteria 1251
706 Ga0466963_0013798 3300044694 Bacteria 4972
707 Ga0466963_0031995 3300044694 Bacteria 3403
708 Ga0466963_0135378 3300044694 Bacteria 1704
709 Ga0466963_0135649 3300044694 Bacteria 1703
710 Ga0466963_0170616 3300044694 Bacteria 1516
711 Ga0466963_0184063 3300044694 Bacteria 1459
712 Ga0466963_0202789 3300044694 Bacteria 1387
713 Ga0466963_0249901 3300044694 Bacteria 1244
714 Ga0466964_0008788 3300044706 Bacteria 3797
715 Ga0466964_0035553 3300044706 Bacteria 1993
716 Ga0466970_0000150 3300044765 Bacteria 32514
717 Ga0466970_0007824 3300044765 Bacteria 5366
718 Ga0466970_0008844 3300044765 Bacteria 5075
719 Ga0466970_0023143 3300044765 Bacteria 3243
720 Ga0466957_0066658 3300044842 Bacteria 2220
721 Ga0466960_0000282 3300044901 Bacteria 17703
722 Ga0466960_0005943 3300044901 Bacteria 4868
723 Ga0466960_0015763 3300044901 Bacteria 3265
724 Ga0466960_0024185 3300044901 Bacteria 2738
725 Ga0466960_0050805 3300044901 Bacteria 2000
726 Ga0466960_0149300 3300044901 Bacteria 1247
727 Ga0466959_0012810 3300045049 Bacteria 6067
728 Ga0466959_0065780 3300045049 Bacteria 2631
729 Ga0466959_0068943 3300045049 Bacteria 2562
730 Ga0466959_0121312 3300045049 Bacteria 1858
731 Ga0466959_0150714 3300045049 Bacteria 1639
732 Ga0466959_0152888 3300045049 Bacteria 1625
733 Ga0466959_0180620 3300045049 Bacteria 1476
734 Ga0466958_0007658 3300045836 Bacteria 5953
735 Ga0466958_0011282 3300045836 Bacteria 5031
736 Ga0466958_0045020 3300045836 Bacteria 2661
737 Ga0466958_0058386 3300045836 Bacteria 2346
738 Ga0466958_0104555 3300045836 Bacteria 1764
739 Ga0466958_0130492 3300045836 Bacteria 1578
740 Ga0466967_0007515 3300045976 Bacteria 7870
741 Ga0466967_0009740 3300045976 Bacteria 7158
742 Ga0466967_0010973 3300045976 Bacteria 6830
743 Ga0466967_0012807 3300045976 Bacteria 6443
744 Ga0466967_0064319 3300045976 Bacteria 3262
745 Ga0466967_0069869 3300045976 Bacteria 3140
746 Ga0466967_0090733 3300045976 Bacteria 2776
747 Ga0466967_0181913 3300045976 Bacteria 1983
748 Ga0466967_0218983 3300045976 Bacteria 1808
749 Ga0466967_0468838 3300045976 Bacteria 1232
750 Ga0466967_0483104 3300045976 Bacteria 1214
751 Ga0495627_002964 3300046453 Bacteria 7781
752 Ga0495592_0030345 3300046454 Bacteria 4090
753 Ga0495592_0038595 3300046454 Bacteria 3592
754 Ga0495592_0236637 3300046454 Bacteria 1213
755 Ga0495629_0002738 3300046459 Bacteria 13485
756 Ga0495641_0003000 3300046461 Bacteria 12951
757 Ga0495651_0125577 3300046462 Bacteria 1879
758 Ga0495651_0127886 3300046462 Bacteria 1858
759 Ga0495653_0017203 3300046463 Bacteria 5879
760 Ga0495650_0065073 3300046471 Bacteria 1448
761 Ga0495580_0002952 3300046472 Bacteria 14598
762 Ga0495580_0016727 3300046472 Bacteria 5504
763 Ga0495580_0035290 3300046472 Bacteria 3596
764 Ga0495639_0000642 3300046475 Bacteria 16098
765 Ga0495639_0054817 3300046475 Bacteria 1817
766 Ga0495662_0010364 3300046476 Bacteria 4566
767 Ga0495664_0058920 3300046477 Bacteria 2285
768 Ga0495594_0043628 3300046499 Bacteria 2458
769 Ga0495608_0024284 3300046511 Bacteria 4147
770 Ga0495608_0044518 3300046511 Bacteria 2962
771 Ga0495608_0069970 3300046511 Bacteria 2290
772 Ga0495620_0025413 3300046515 Bacteria 2802
773 Ga0495628_0057436 3300046516 Bacteria 3061
774 Ga0495628_0148649 3300046516 Bacteria 1785
775 Ga0495631_0081177 3300046518 Bacteria 1399
776 Ga0495666_0037827 3300046526 Bacteria 2346
777 Ga0495642_0025176 3300046528 Bacteria 2357
778 Ga0495652_0032726 3300046529 Bacteria 4544
779 Ga0495652_0040565 3300046529 Bacteria 4023
780 Ga0495665_0011398 3300046531 Bacteria 4810
781 Ga0495586_0080314 3300046535 Bacteria 1791
782 Ga0495587_0033362 3300046536 Bacteria 3108
783 Ga0495587_0053737 3300046536 Bacteria 2374
784 Ga0495645_0005099 3300046543 Bacteria 9002
785 Ga0495645_0044610 3300046543 Bacteria 3233
786 Ga0495645_0045334 3300046543 Bacteria 3208
787 Ga0495645_0165100 3300046543 Bacteria 1528
788 Ga0495667_0004412 3300046559 Bacteria 9489
789 Ga0495667_0015217 3300046559 Bacteria 5193
790 Ga0495667_0134413 3300046559 Bacteria 1595
791 Ga0495625_0253701 3300046660 Bacteria 1141
792 Ga0495635_0021655 3300046663 Bacteria 4481
793 Ga0495588_0098597 3300046674 Bacteria 1534
794 Ga0495588_0099233 3300046674 Bacteria 1529
795 Ga0495657_0009553 3300046675 Bacteria 7349
796 Ga0495657_0030812 3300046675 Bacteria 3753
797 Ga0495657_0083948 3300046675 Bacteria 2055
798 Ga0495646_0017982 3300046680 Bacteria 4478
799 Ga0495646_0141249 3300046680 Bacteria 1346
800 Ga0495647_0015235 3300046681 Bacteria 2691
801 Ga0495613_0110432 3300046689 Bacteria 1981
802 Ga0495624_0033375 3300046690 Bacteria 3333
803 Ga0495624_0101773 3300046690 Bacteria 1769
804 Ga0495670_0133957 3300046691 Bacteria 1293
805 Ga0495670_0143316 3300046691 Bacteria 1250
806 Ga0495600_0029094 3300046809 Bacteria 3576
807 Ga0495600_0040078 3300046809 Bacteria 3050
808 Ga0495600_0095292 3300046809 Bacteria 1940
809 Ga0495600_0141232 3300046809 Bacteria 1562
810 Ga0495581_0003879 3300047315 Bacteria 8593
811 Ga0495581_0027345 3300047315 Bacteria 3307
812 Ga0495581_0067330 3300047315 Bacteria 2071
813 Ga0495604_0015370 3300047317 Bacteria 6108
814 Ga0495604_0069493 3300047317 Bacteria 2669
815 Ga0495674_0106280 3300047319 Bacteria 2384
816 Ga0495674_0184210 3300047319 Bacteria 1737
817 Ga0495674_0288944 3300047319 Bacteria 1341
818 Ga0495676_0038360 3300047321 Bacteria 3978
819 Ga0495680_0027796 3300047322 Bacteria 4641
820 Ga0495680_0088467 3300047322 Bacteria 2327
821 Ga0495680_0162550 3300047322 Bacteria 1620
822 Ga0495680_0271420 3300047322 Bacteria 1197
823 Ga0495675_0016883 3300047444 Bacteria 4618
824 Ga0495675_0057352 3300047444 Bacteria 2469
825 Ga0495675_0144771 3300047444 Bacteria 1471
826 Ga0495685_059617 3300047447 Bacteria 1288
827 Ga0495681_0043752 3300047470 Bacteria 2157
828 Ga0495684_0064419 3300047471 Bacteria 2785
829 Ga0495684_0072610 3300047471 Bacteria 2614
830 Ga0495684_0155255 3300047471 Bacteria 1709
831 Ga0495602_0038750 3300048088 Bacteria 4400
832 Ga0495602_0146120 3300048088 Bacteria 1865
833 Ga0495614_0044160 3300048089 Bacteria 1911
834 Ga0496100_0004473 3300048903 Bacteria 7417
835 Ga0496100_0094009 3300048903 Bacteria 2052
836 Ga0496101_0001474 3300048904 Bacteria 14059
837 Ga0496101_0020193 3300048904 Bacteria 4555
838 Ga0496101_0031996 3300048904 Bacteria 3700
839 Ga0496101_0060077 3300048904 Bacteria 2757
840 Ga0496101_0138647 3300048904 Bacteria 1852
841 Ga0496101_0222963 3300048904 Bacteria 1463
842 Ga0496102_0000408 3300048905 Bacteria 49838
843 Ga0496102_0004562 3300048905 Bacteria 11702
844 Ga0496102_0014349 3300048905 Bacteria 6883
845 Ga0496102_0020875 3300048905 Bacteria 5789
846 Ga0496102_0064776 3300048905 Bacteria 3348
847 Ga0496102_0130357 3300048905 Bacteria 2353
848 Ga0496102_0193159 3300048905 Bacteria 1918
849 Ga0496102_0295322 3300048905 Bacteria 1527
850 Ga0496103_0000422 3300048906 Bacteria 37002
851 Ga0496103_0023773 3300048906 Bacteria 3695
852 Ga0496103_0038436 3300048906 Bacteria 2936
853 Ga0496103_0077445 3300048906 Bacteria 2087
854 Ga0496104_0002039 3300048907 Bacteria 17538
855 Ga0496104_0003015 3300048907 Bacteria 14505
856 Ga0496104_0003968 3300048907 Bacteria 12807
857 Ga0496104_0011156 3300048907 Bacteria 8040
858 Ga0496104_0013081 3300048907 Bacteria 7476
859 Ga0496104_0021678 3300048907 Bacteria 5900
860 Ga0496104_0030331 3300048907 Bacteria 5024
861 Ga0496104_0224854 3300048907 Bacteria 1789
862 Ga0496105_0004304 3300048908 Bacteria 10719
863 Ga0496105_0004398 3300048908 Bacteria 10607
864 Ga0496105_0015525 3300048908 Bacteria 6071
865 Ga0496105_0033168 3300048908 Bacteria 4239
866 Ga0496105_0034871 3300048908 Bacteria 4140
867 Ga0496105_0078654 3300048908 Bacteria 2723
868 Ga0496105_0102644 3300048908 Bacteria 2361
869 Ga0496105_0302508 3300048908 Bacteria 1285
870 Ga0496106_0005256 3300048909 Bacteria 9594
871 Ga0496106_0010733 3300048909 Bacteria 6770
872 Ga0496106_0025161 3300048909 Bacteria 4428
873 Ga0496106_0052916 3300048909 Bacteria 3065
874 Ga0496106_0245883 3300048909 Bacteria 1429
875 Ga0496107_0034654 3300048910 Bacteria 3616
876 Ga0496107_0046180 3300048910 Bacteria 3134
877 Ga0496107_0068600 3300048910 Bacteria 2573
878 Ga0496107_0152770 3300048910 Bacteria 1708
879 Ga0496108_0003215 3300048911 Bacteria 13140
880 Ga0496108_0005025 3300048911 Bacteria 10686
881 Ga0496108_0021705 3300048911 Bacteria 5279
882 Ga0496108_0027927 3300048911 Bacteria 4665
883 Ga0496108_0043434 3300048911 Bacteria 3754
884 Ga0496108_0073731 3300048911 Bacteria 2881
885 Ga0496108_0102973 3300048911 Bacteria 2436
886 Ga0496108_0109788 3300048911 Bacteria 2357
887 Ga0496108_0119346 3300048911 Bacteria 2261
888 Ga0496109_0006631 3300048912 Bacteria 9749
889 Ga0496109_0013084 3300048912 Bacteria 7177
890 Ga0496109_0017008 3300048912 Bacteria 6365
891 Ga0496109_0021560 3300048912 Bacteria 5698
892 Ga0496109_0022687 3300048912 Bacteria 5560
893 Ga0496109_0026938 3300048912 Bacteria 5127
894 Ga0496109_0064608 3300048912 Bacteria 3349
895 Ga0496109_0228185 3300048912 Bacteria 1751
896 Ga0496109_0308943 3300048912 Bacteria 1492
897 Ga0496110_0000297 3300048913 Bacteria 32605
898 Ga0496110_0005654 3300048913 Bacteria 9809
899 Ga0496110_0009807 3300048913 Bacteria 7757
900 Ga0496110_0051624 3300048913 Bacteria 3613
901 Ga0496110_0158383 3300048913 Bacteria 2052
902 Ga0496110_0393181 3300048913 Bacteria 1264
903 Ga0496111_0001007 3300048914 Bacteria 15451
904 Ga0496111_0005756 3300048914 Bacteria 7999
905 Ga0496111_0014929 3300048914 Bacteria 5319
906 Ga0496111_0034702 3300048914 Bacteria 3602
907 Ga0496111_0087583 3300048914 Bacteria 2279
908 Ga0496111_0190053 3300048914 Bacteria 1526
909 Ga0496112_0002386 3300048915 Bacteria 15114
910 Ga0496112_0014634 3300048915 Bacteria 7290
911 Ga0496112_0023182 3300048915 Bacteria 5925
912 Ga0496112_0049018 3300048915 Bacteria 4139
913 Ga0496112_0068652 3300048915 Bacteria 3500
914 Ga0496112_0101250 3300048915 Bacteria 2851
915 Ga0496112_0220395 3300048915 Bacteria 1853
916 Ga0496113_0031268 3300048916 Bacteria 3862
917 Ga0496113_0045275 3300048916 Bacteria 3263
918 Ga0496113_0167675 3300048916 Bacteria 1738
919 Ga0496113_0245628 3300048916 Bacteria 1428
920 Ga0496113_0253032 3300048916 Bacteria 1406
921 Ga0496114_0005860 3300048917 Bacteria 9651
922 Ga0496114_0043680 3300048917 Bacteria 3716
923 Ga0496114_0056947 3300048917 Bacteria 3263
924 Ga0496114_0098187 3300048917 Bacteria 2496
925 Ga0496114_0189083 3300048917 Bacteria 1801
926 Ga0496114_0191105 3300048917 Bacteria 1791
927 Ga0496114_0252825 3300048917 Bacteria 1551
928 Ga0496114_0259367 3300048917 Bacteria 1530
929 Ga0496115_0004879 3300048918 Bacteria 9736
930 Ga0496115_0028842 3300048918 Bacteria 4353
931 Ga0496115_0095728 3300048918 Bacteria 2430
932 Ga0496115_0106044 3300048918 Bacteria 2307
933 Ga0496116_0000688 3300048919 Bacteria 43887
934 Ga0496116_0016328 3300048919 Bacteria 5811
935 Ga0496117_0000053 3300048920 Bacteria 279396
936 Ga0496117_0000615 3300048920 Bacteria 57676
937 Ga0496117_0001799 3300048920 Bacteria 29138
938 Ga0496117_0022343 3300048920 Bacteria 5077
939 Ga0496118_0001711 3300048921 Bacteria 32018
940 Ga0496118_0020800 3300048921 Bacteria 5807
941 Ga0496119_0004593 3300048922 Bacteria 13637
942 Ga0496119_0006393 3300048922 Bacteria 10950
943 Ga0496119_0007748 3300048922 Bacteria 9590
944 Ga0496119_0011021 3300048922 Bacteria 7537
945 Ga0496119_0019949 3300048922 Bacteria 4910
946 Ga0496119_0074968 3300048922 Bacteria 1968
947 Ga0496120_0001595 3300048923 Bacteria 26374
948 Ga0496120_0002066 3300048923 Bacteria 21596
949 Ga0496120_0003326 3300048923 Bacteria 14773
950 Ga0496120_0004880 3300048923 Bacteria 10930
951 Ga0496121_0007937 3300048924 Bacteria 12683
952 Ga0496122_0000031 3300048925 Bacteria 329726
953 Ga0496122_0004958 3300048925 Bacteria 16126
954 Ga0496122_0042957 3300048925 Bacteria 3548
955 Ga0496122_0048019 3300048925 Bacteria 3288
956 Ga0496122_0192961 3300048925 Bacteria 1200
957 Ga0496123_0000013 3300048926 Bacteria 439694
958 Ga0496123_0003480 3300048926 Bacteria 17593
959 Ga0496123_0018843 3300048926 Bacteria 5468
960 Ga0496123_0052050 3300048926 Bacteria 2721
961 Ga0496124_0013716 3300048927 Bacteria 7890
962 Ga0496124_0019590 3300048927 Bacteria 6288
963 Ga0496124_0021487 3300048927 Bacteria 5945
964 Ga0496124_0066258 3300048927 Bacteria 3008
965 Ga0496125_0000077 3300048928 Bacteria 232629
966 Ga0496125_0010943 3300048928 Bacteria 9117
967 Ga0496125_0022776 3300048928 Bacteria 5807
968 Ga0496125_0024822 3300048928 Bacteria 5502
969 Ga0496125_0057287 3300048928 Bacteria 3157
970 Ga0496126_0000006 3300048929 Bacteria 798804
971 Ga0496126_0001071 3300048929 Bacteria 46057
972 Ga0496126_0002399 3300048929 Bacteria 25438
973 Ga0496126_0019364 3300048929 Bacteria 6704
974 Ga0496126_0092532 3300048929 Bacteria 2656
975 Ga0496126_0136302 3300048929 Bacteria 2117
976 Ga0496126_0144272 3300048929 Bacteria 2047
977 Ga0496126_0344362 3300048929 Bacteria 1220
978 Ga0501309_001974 3300049129 Bacteria 2136
979 Ga0501321_005252 3300049537 Bacteria 1273
980 Ga0501031_0001624 3300049568 Bacteria 14068
981 Ga0501031_0023230 3300049568 Bacteria 4042
982 Ga0501032_0000056 3300049569 Bacteria 98236
983 Ga0501032_0001570 3300049569 Bacteria 18219
984 Ga0501032_0013108 3300049569 Bacteria 5905
985 Ga0501032_0017506 3300049569 Bacteria 5031
986 Ga0501033_0001130 3300049570 Bacteria 24171
987 Ga0501033_0154960 3300049570 Bacteria 1651
988 Ga0501033_0168797 3300049570 Bacteria 1572
989 Ga0501034_0000123 3300049571 Bacteria 143688
990 Ga0501034_0001982 3300049571 Bacteria 25917
991 Ga0501034_0004224 3300049571 Bacteria 16040
992 Ga0501034_0012389 3300049571 Bacteria 8808
993 Ga0501034_0016472 3300049571 Bacteria 7586
994 Ga0501034_0089184 3300049571 Bacteria 3082
995 Ga0501036_0000057 3300049572 Bacteria 72542
996 Ga0501036_0013945 3300049572 Bacteria 6684
997 Ga0501036_0159175 3300049572 Bacteria 1904
998 Ga0501037_0000361 3300049573 Bacteria 38179
999 Ga0501037_0001615 3300049573 Bacteria 16386
1000 Ga0501037_0028153 3300049573 Bacteria 4151
1001 Ga0501037_0270618 3300049573 Bacteria 1185
1002 Ga0501038_0011612 3300049574 Bacteria 8035
1003 Ga0501038_0016515 3300049574 Bacteria 6690
1004 Ga0501038_0026722 3300049574 Bacteria 5139
1005 Ga0501038_0030042 3300049574 Bacteria 4811
1006 Ga0501038_0030340 3300049574 Bacteria 4785
1007 Ga0501038_0291179 3300049574 Bacteria 1283
1008 Ga0501039_0000623 3300049575 Bacteria 25628
1009 Ga0501039_0007694 3300049575 Bacteria 8226
1010 Ga0501039_0109137 3300049575 Bacteria 2163
1011 Ga0501039_0333854 3300049575 Bacteria 1191
1012 Ga0501040_0055813 3300049576 Bacteria 2709
1013 Ga0501040_0070019 3300049576 Bacteria 2420
1014 Ga0501040_0088206 3300049576 Bacteria 2154
1015 Ga0501041_0022715 3300049577 Bacteria 3757
1016 Ga0501041_0025945 3300049577 Bacteria 3523
1017 Ga0501042_0016724 3300049578 Bacteria 5042
1018 Ga0501042_0028001 3300049578 Bacteria 3966
1019 Ga0501042_0067894 3300049578 Bacteria 2549
1020 Ga0501042_0273113 3300049578 Bacteria 1220
1021 Ga0501043_0000755 3300049579 Bacteria 28766
1022 Ga0501043_0004811 3300049579 Bacteria 10930
1023 Ga0501043_0010156 3300049579 Bacteria 7380
1024 Ga0501043_0017886 3300049579 Bacteria 5558
1025 Ga0501043_0035628 3300049579 Bacteria 3914
1026 Ga0501043_0042257 3300049579 Bacteria 3582
1027 Ga0501043_0071250 3300049579 Bacteria 2730
1028 Ga0501043_0265204 3300049579 Bacteria 1320
1029 Ga0501043_0336930 3300049579 Bacteria 1148
1030 Ga0501046_0000701 3300049580 Bacteria 32353
1031 Ga0501046_0192666 3300049580 Bacteria 1520
1032 Ga0501047_0006801 3300049581 Bacteria 10744
1033 Ga0501047_0017379 3300049581 Bacteria 6888
1034 Ga0501047_0134926 3300049581 Bacteria 2348
1035 Ga0501047_0204694 3300049581 Bacteria 1833
1036 Ga0501048_0000016 3300049582 Bacteria 72612
1037 Ga0501048_0013474 3300049582 Bacteria 6068
1038 Ga0501048_0033844 3300049582 Bacteria 3690
1039 Ga0501067_0000461 3300049583 Bacteria 22155
1040 Ga0501067_0001018 3300049583 Bacteria 15074
1041 Ga0501067_0001635 3300049583 Bacteria 12307
1042 Ga0501067_0118438 3300049583 Bacteria 1473
1043 Ga0501067_0137762 3300049583 Bacteria 1359
1044 Ga0501068_0001742 3300049584 Bacteria 11572
1045 Ga0501068_0001917 3300049584 Bacteria 11062
1046 Ga0501068_0099491 3300049584 Bacteria 1801
1047 Ga0501069_0020666 3300049585 Bacteria 3568
1048 Ga0501069_0098350 3300049585 Bacteria 1660
1049 Ga0501069_0098864 3300049585 Bacteria 1655
1050 Ga0501070_0001031 3300049586 Bacteria 25041
1051 Ga0501070_0001292 3300049586 Bacteria 22464
1052 Ga0501070_0001455 3300049586 Bacteria 21188
1053 Ga0501070_0009235 3300049586 Bacteria 8338
1054 Ga0501070_0018043 3300049586 Bacteria 5921
1055 Ga0501070_0023464 3300049586 Bacteria 5167
1056 Ga0501070_0133352 3300049586 Bacteria 2051
1057 Ga0501070_0161322 3300049586 Bacteria 1848
1058 Ga0501070_0262492 3300049586 Bacteria 1411
1059 Ga0501071_0011824 3300049587 Bacteria 5891
1060 Ga0501071_0050268 3300049587 Bacteria 3003
1061 Ga0501071_0101472 3300049587 Bacteria 2121
1062 Ga0501071_0109033 3300049587 Bacteria 2045
1063 Ga0501072_0006559 3300049588 Bacteria 8861
1064 Ga0501072_0025460 3300049588 Bacteria 4609
1065 Ga0501073_0000057 3300049589 Bacteria 70842
1066 Ga0501073_0003609 3300049589 Bacteria 11634
1067 Ga0501073_0003614 3300049589 Bacteria 11629
1068 Ga0501073_0004931 3300049589 Bacteria 10017
1069 Ga0501073_0036440 3300049589 Bacteria 3495
1070 Ga0501074_0000074 3300049590 Bacteria 48322
1071 Ga0501074_0001017 3300049590 Bacteria 18243
1072 Ga0501074_0001632 3300049590 Bacteria 15208
1073 Ga0501074_0047572 3300049590 Bacteria 3100
1074 Ga0501074_0063848 3300049590 Bacteria 2652
1075 Ga0501074_0087027 3300049590 Bacteria 2238
1076 Ga0501074_0167389 3300049590 Bacteria 1569
1077 Ga0501075_0272855 3300049591 Bacteria 1289
1078 Ga0501076_0030665 3300049592 Bacteria 4189
1079 Ga0501076_0108016 3300049592 Bacteria 2247
1080 Ga0501077_0003022 3300049593 Bacteria 10084
1081 Ga0501077_0025215 3300049593 Bacteria 3777
1082 Ga0501077_0181309 3300049593 Bacteria 1338
1083 Ga0501079_0023792 3300049741 Bacteria 4700
1084 Ga0501079_0032323 3300049741 Bacteria 4023
1085 Ga0501079_0075822 3300049741 Bacteria 2601
1086 Ga0501079_0076125 3300049741 Bacteria 2596
1087 Ga0501080_0006051 3300049742 Bacteria 10847
1088 Ga0501080_0006298 3300049742 Bacteria 10649
1089 Ga0501083_0008878 3300049744 Bacteria 7098
1090 Ga0501083_0155829 3300049744 Bacteria 1495
1091 Ga0501035_0000262 3300049822 Bacteria 62472
1092 Ga0501044_0000312 3300049823 Bacteria 61322
1093 Ga0501044_0044754 3300049823 Bacteria 4591
1094 Ga0501044_0054391 3300049823 Bacteria 4115
1095 Ga0501044_0120336 3300049823 Bacteria 2627
1096 Ga0501045_0028523 3300049824 Bacteria 4027
1097 Ga0501045_0194993 3300049824 Bacteria 1509
1098 nmdc:mga00v17_32273_c1 3300050491 Bacteria 3095
1099 nmdc:mga00v17_4765_c1 3300050491 Bacteria 7100
1100 nmdc:mga00v17_9707_c1 3300050491 Bacteria 5222
1101 nmdc:mga0yw44_39792_c1 3300050492 Bacteria 2790
1102 nmdc:mga0yw44_52592_c1 3300050492 Bacteria 2470
1103 nmdc:mga0yw44_6861_c1 3300050492 Bacteria 5542
1104 nmdc:mga0yw44_80156_c1 3300050492 Bacteria 2044
1105 nmdc:mga06z11_4715_c1 3300050494 Bacteria 5389
1106 nmdc:mga04h51_6087_c1 3300050495 Bacteria 3110
1107 nmdc:mga07m45_28725_c1 3300050496 Bacteria 3070
1108 nmdc:mga05p37_338571_c1 3300050507 Bacteria 1775
1109 nmdc:mga05p37_7095_c1 3300050507 Bacteria 13210
1110 nmdc:mga09592_13573_c1 3300050508 Bacteria 6654
1111 nmdc:mga09592_41710_c1 3300050508 Bacteria 3859
1112 nmdc:mga06r32_428085_c1 3300050510 Bacteria 1304
1113 nmdc:mga06r32_56136_c1 3300050510 Bacteria 3779
1114 nmdc:mga08y16_457300_c1 3300050511 Bacteria 1301
1115 nmdc:mga08y16_6424_c1 3300050511 Bacteria 12323
1116 nmdc:mga08y16_74363_c1 3300050511 Bacteria 3541
1117 nmdc:mga08y16_8872_c1 3300050511 Bacteria 10557
1118 nmdc:mga0n895_108726_c1 3300050512 Bacteria 2788
1119 nmdc:mga0n895_116830_c1 3300050512 Bacteria 2687
1120 nmdc:mga0n895_6711_c1 3300050512 Bacteria 9809
1121 nmdc:mga0n895_84901_c1 3300050512 Bacteria 3160
1122 nmdc:mga0rr50_53529_c1 3300050513 Bacteria 3003
1123 nmdc:mga0rr50_7151_c1 3300050513 Bacteria 6858
1124 nmdc:mga08x19_3108_c1 3300050514 Bacteria 9980
1125 nmdc:mga08x19_4601_c1 3300050514 Bacteria 8191
1126 nmdc:mga0a205_227483_c1 3300050515 Bacteria 1749
1127 nmdc:mga0a205_6472_c1 3300050515 Bacteria 10589
1128 nmdc:mga0a205_9144_c1 3300050515 Bacteria 9046
1129 nmdc:mga0sz30_4016_c1 3300050516 Bacteria 5298
1130 nmdc:mga0sz30_9709_c1 3300050516 Bacteria 3669
1131 Ga0495601_0007162 3300053077 Bacteria 6542
1132 Ga0495601_0029504 3300053077 Bacteria 3403
1133 Ga0495612_0005163 3300053078 Bacteria 5397
1134 Ga0495619_0031806 3300053085 Bacteria 3420
1135 Ga0495619_0120140 3300053085 Bacteria 1801
1136 Ga0495619_0231224 3300053085 Bacteria 1281
1137 Ga0500643_000285 3300053087 Bacteria 43666
1138 Ga0500641_0000475 3300053096 Bacteria 14614
1139 Ga0500556_0000168 3300053104 Bacteria 53779
1140 Ga0500562_001203 3300053108 Bacteria 6367
1141 Ga0500593_000819 3300053117 Bacteria 11629
1142 Ga0500655_002809 3300053133 Bacteria 3162
1143 Ga0500559_0000104 3300053136 Bacteria 65891
1144 Ga0500559_0000159 3300053136 Bacteria 53218
1145 Ga0500568_0001269 3300053139 Bacteria 16659
1146 Ga0500568_0022590 3300053139 Bacteria 2688
1147 Ga0500573_0000001 3300053140 Bacteria 436394
1148 Ga0500573_0037461 3300053140 Bacteria 2802
1149 Ga0501084_0000906 3300054114 Bacteria 22888
1150 Ga0501084_0024881 3300054114 Bacteria 4996
1151 Ga0501084_0137696 3300054114 Bacteria 2055
1152 Ga0501084_0209122 3300054114 Bacteria 1646
1153 Ga0590075_025006 3300059424 Bacteria 1500
1154 Ga0587070_010073 3300059491 Bacteria 1383
1155 Ga0587086_003661 3300059507 Bacteria 1560
1156 Ga0587090_000017 3300059510 Bacteria 8349
1157 Ga0587091_018730 3300059511 Bacteria 1182
1158 Ga0587098_000970 3300059604 Bacteria 2043
1159 Ga0587072_000124 3300059643 Bacteria 6356
1160 Ga0587079_002236 3300059647 Bacteria 2337
1161 Ga0501082_0010928 3300060353 Bacteria 7813
1162 Ga0501082_0036004 3300060353 Bacteria 4265
1163 Ga0501082_0090617 3300060353 Bacteria 2640
1164 Ga0501082_0230152 3300060353 Bacteria 1613
1165 Ga0466962_0005614 3300061719 Bacteria 6025
1166 Ga0466962_0024254 3300061719 Bacteria 2914
1167 Ga0466962_0045609 3300061719 Bacteria 2095
1168 Ga0466962_0141248 3300061719 Bacteria 1166
1169 Ga0530510_0039300 3300061734 Bacteria 3415
1170 Ga0530510_0079212 3300061734 Bacteria 2389

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0090733 Ga0466967_0090733_1852_2766 276
2 3300049823 Ga0501044_0054391 Ga0501044_0054391_10_918 276
3 3300048916 Ga0496113_0045275 Ga0496113_0045275_762_1682 281
4 3300031727 Ga0316576_10023650 Ga0316576_100236503 282
5 3300031731 Ga0307405_10084320 Ga0307405_100843202 283
6 3300053096 Ga0500641_0000475 Ga0500641_0000475_2773_3798 293
7 3300049586 Ga0501070_0018043 Ga0501070_0018043_4097_5065 296
8 3300025926 Ga0207659_10325030 Ga0207659_103250301 297
9 3300005983 Ga0081540_1001174 Ga0081540_10011749 299
10 3300053140 Ga0500573_0000001 Ga0500573_0000001_190019_191044 299
11 3300031852 Ga0307410_10197945 Ga0307410_101979451 301
12 3300032002 Ga0307416_100221178 Ga0307416_1002211781 301
13 3300028800 Ga0265338_10042643 Ga0265338_100426432 302
14 3300049537 Ga0501321_005252 Ga0501321_005252_206_1234 302
15 3300028800 Ga0265338_10008883 Ga0265338_100088833 303
16 3300042016 Ga0439463_049367 Ga0439463_049367_11_1000 303
17 3300042437 Ga0439444_0003764 Ga0439444_0003764_101_1090 303
18 3300044901 Ga0466960_0015763 Ga0466960_0015763_673_1692 303
19 3300048904 Ga0496101_0222963 Ga0496101_0222963_55_1074 303
20 3300048907 Ga0496104_0003968 Ga0496104_0003968_3544_4563 303
21 3300048908 Ga0496105_0034871 Ga0496105_0034871_1161_2180 303
22 3300048911 Ga0496108_0102973 Ga0496108_0102973_540_1559 303
23 3300048912 Ga0496109_0064608 Ga0496109_0064608_2074_3093 303
24 3300048918 Ga0496115_0004879 Ga0496115_0004879_3812_4831 303
25 3300037418 Ga0395900_0078843 Ga0395900_0078843_1684_2703 304
26 3300044656 Ga0466969_0021281 Ga0466969_0021281_2220_3239 304
27 3300044684 Ga0466966_0050102 Ga0466966_0050102_835_1854 304
28 3300044694 Ga0466963_0170616 Ga0466963_0170616_89_1108 304
29 3300045049 Ga0466959_0152888 Ga0466959_0152888_237_1256 304
30 3300046559 Ga0495667_0134413 Ga0495667_0134413_484_1503 304
31 3300048912 Ga0496109_0022687 Ga0496109_0022687_778_1797 304
32 3300048916 Ga0496113_0167675 Ga0496113_0167675_252_1271 304
33 3300053085 Ga0495619_0120140 Ga0495619_0120140_205_1224 304
34 3300061719 Ga0466962_0045609 Ga0466962_0045609_1052_2071 304
35 iso_pu_bacteria 2675903060 2676488975 304
36 iso_pu_bacteria 2884693830 2884702582 304
37 iso_pu_bacteria 2895427314 2895429357 304
38 iso_pu_bacteria 2895442618 2895452082 304
39 3300037466 Ga0395898_0053847 Ga0395898_0053847_1207_2226 305
40 iso_pu_bacteria 2873314349 2873317219 305
41 iso_pu_bacteria 8055066027 8055071709 305
42 3300005366 Ga0070659_100077895 Ga0070659_1000778952 306
43 3300025919 Ga0207657_10002812 Ga0207657_1000281213 306
44 3300025932 Ga0207690_10011953 Ga0207690_100119534 306
45 3300031852 Ga0307410_10248195 Ga0307410_102481952 306
46 3300045976 Ga0466967_0009740 Ga0466967_0009740_1206_2186 306
47 iso_pu_bacteria 2643221678 2644437877 306
48 3300009176 Ga0105242_10113311 Ga0105242_101133112 307
49 3300014325 Ga0163163_10016279 Ga0163163_100162793 307
50 3300039437 Ga0436365_1172453 Ga0436365_1172453_106_1095 307
51 3300048905 Ga0496102_0130357 Ga0496102_0130357_386_1375 307
52 3300048907 Ga0496104_0021678 Ga0496104_0021678_2828_3817 307
53 3300048908 Ga0496105_0302508 Ga0496105_0302508_97_1086 307
54 3300048909 Ga0496106_0052916 Ga0496106_0052916_65_1054 307
55 3300048912 Ga0496109_0013084 Ga0496109_0013084_2825_3814 307
56 3300048915 Ga0496112_0023182 Ga0496112_0023182_4043_5032 307
57 iso_pu_bacteria 2856741275 2856745492 307
58 iso_pu_bacteria 2866552031 2866552752 307
59 iso_pu_bacteria 2891395885 2891397979 307
60 iso_pu_bacteria 2891554331 2891559642 307
61 iso_pu_bacteria 2891562705 2891567573 307
62 iso_pu_bacteria 8056207758 8056211903 307
63 3300006038 Ga0075365_10153811 Ga0075365_101538112 308
64 3300009147 Ga0114129_10492590 Ga0114129_104925902 308
65 3300031727 Ga0316576_10019948 Ga0316576_100199484 308
66 3300031728 Ga0316578_10015874 Ga0316578_100158742 308
67 3300036712 Ga0316584_0056317 Ga0316584_0056317_1833_2861 308
68 3300037466 Ga0395898_0031104 Ga0395898_0031104_1382_2371 308
69 3300038443 Ga0395901_0003177 Ga0395901_0003177_7289_8278 308
70 3300049571 Ga0501034_0012389 Ga0501034_0012389_5417_6412 308
71 3300049574 Ga0501038_0011612 Ga0501038_0011612_2387_3382 308
72 3300049578 Ga0501042_0067894 Ga0501042_0067894_209_1204 308
73 3300049579 Ga0501043_0004811 Ga0501043_0004811_6704_7699 308
74 3300049581 Ga0501047_0134926 Ga0501047_0134926_1150_2145 308
75 3300049582 Ga0501048_0033844 Ga0501048_0033844_1994_2989 308
76 3300049589 Ga0501073_0036440 Ga0501073_0036440_89_1084 308
77 3300050492 nmdc:mga0yw44_80156_c1 nmdc:mga0yw44_80156_c1_54_1046 308
78 3300005366 Ga0070659_100001204 Ga0070659_1000012043 309
79 3300005467 Ga0070706_100011209 Ga0070706_1000112094 309
80 3300005544 Ga0070686_100031912 Ga0070686_1000319123 309
81 3300013102 Ga0157371_10014805 Ga0157371_100148053 309
82 3300022467 Ga0224712_10003694 Ga0224712_100036944 309
83 3300050510 nmdc:mga06r32_428085_c1 nmdc:mga06r32_428085_c1_153_1148 309
84 iso_pu_bacteria 2558860112 2558910794 309
85 iso_pu_bacteria 2816332119 2816427423 309
86 3300003659 JGI25404J52841_10002141 JGI25404J52841_100021413 310
87 3300005327 Ga0070658_10000309 Ga0070658_1000030910 310
88 3300005327 Ga0070658_10002686 Ga0070658_100026866 310
89 3300005327 Ga0070658_10073343 Ga0070658_100733432 310
90 3300005329 Ga0070683_100028369 Ga0070683_1000283694 310
91 3300005330 Ga0070690_100196382 Ga0070690_1001963822 310
92 3300005334 Ga0068869_100116718 Ga0068869_1001167182 310
93 3300005336 Ga0070680_100166353 Ga0070680_1001663532 310
94 3300005340 Ga0070689_100083548 Ga0070689_1000835482 310
95 3300005343 Ga0070687_100055685 Ga0070687_1000556852 310
96 3300005344 Ga0070661_100017686 Ga0070661_1000176862 310
97 3300005345 Ga0070692_10220521 Ga0070692_102205211 310
98 3300005353 Ga0070669_100160437 Ga0070669_1001604371 310
99 3300005354 Ga0070675_100078035 Ga0070675_1000780353 310
100 3300005364 Ga0070673_100023874 Ga0070673_1000238744 310
101 3300005366 Ga0070659_100081076 Ga0070659_1000810763 310
102 3300005438 Ga0070701_10051383 Ga0070701_100513832 310
103 3300005455 Ga0070663_100010451 Ga0070663_1000104514 310
104 3300005459 Ga0068867_100194089 Ga0068867_1001940891 310
105 3300005467 Ga0070706_100158430 Ga0070706_1001584302 310
106 3300005468 Ga0070707_100070629 Ga0070707_1000706293 310
107 3300005530 Ga0070679_100063514 Ga0070679_1000635143 310
108 3300005535 Ga0070684_100005110 Ga0070684_1000051102 310
109 3300005536 Ga0070697_100316455 Ga0070697_1003164552 310
110 3300005543 Ga0070672_100064485 Ga0070672_1000644853 310
111 3300005545 Ga0070695_100052078 Ga0070695_1000520781 310
112 3300005546 Ga0070696_100014280 Ga0070696_1000142803 310
113 3300005564 Ga0070664_100064900 Ga0070664_1000649003 310
114 3300005615 Ga0070702_100009584 Ga0070702_1000095842 310
115 3300005616 Ga0068852_100067530 Ga0068852_1000675303 310
116 3300005617 Ga0068859_100026493 Ga0068859_1000264935 310
117 3300005618 Ga0068864_100074023 Ga0068864_1000740232 310
118 3300005718 Ga0068866_10085278 Ga0068866_100852783 310
119 3300005719 Ga0068861_100020576 Ga0068861_1000205763 310
120 3300005841 Ga0068863_100083924 Ga0068863_1000839242 310
121 3300005842 Ga0068858_100092490 Ga0068858_1000924903 310
122 3300005983 Ga0081540_1000292 Ga0081540_100029240 310
123 3300006358 Ga0068871_100081612 Ga0068871_1000816122 310
124 3300006871 Ga0075434_100345699 Ga0075434_1003456992 310
125 3300006931 Ga0097620_100026493 Ga0097620_1000264935 310
126 3300007788 Ga0099795_10041210 Ga0099795_100412101 310
127 3300009011 Ga0105251_10016765 Ga0105251_100167653 310
128 3300009036 Ga0105244_10064894 Ga0105244_100648941 310
129 3300009093 Ga0105240_10426751 Ga0105240_104267512 310
130 3300009148 Ga0105243_10046912 Ga0105243_100469122 310
131 3300009174 Ga0105241_10136457 Ga0105241_101364572 310
132 3300009545 Ga0105237_10021220 Ga0105237_100212203 310
133 3300010375 Ga0105239_10261107 Ga0105239_102611073 310
134 3300011119 Ga0105246_10180093 Ga0105246_101800932 310
135 3300012505 Ga0157339_1001910 Ga0157339_10019101 310
136 3300013102 Ga0157371_10019134 Ga0157371_100191344 310
137 3300013104 Ga0157370_10179700 Ga0157370_101797003 310
138 3300013306 Ga0163162_10288370 Ga0163162_102883702 310
139 3300014325 Ga0163163_10336166 Ga0163163_103361662 310
140 3300014326 Ga0157380_10086145 Ga0157380_100861453 310
141 3300014745 Ga0157377_10031358 Ga0157377_100313582 310
142 3300017792 Ga0163161_10057846 Ga0163161_100578463 310
143 3300020070 Ga0206356_11271902 Ga0206356_112719022 310
144 3300020077 Ga0206351_10445551 Ga0206351_104455513 310
145 3300020080 Ga0206350_10417353 Ga0206350_104173533 310
146 3300020081 Ga0206354_10706613 Ga0206354_107066132 310
147 3300020082 Ga0206353_10787144 Ga0206353_107871442 310
148 3300021388 Ga0213875_10000250 Ga0213875_1000025029 310
149 3300021388 Ga0213875_10052106 Ga0213875_100521062 310
150 3300022467 Ga0224712_10067806 Ga0224712_100678061 310
151 3300025885 Ga0207653_10012153 Ga0207653_100121532 310
152 3300025898 Ga0207692_10011599 Ga0207692_100115993 310
153 3300025900 Ga0207710_10038286 Ga0207710_100382863 310
154 3300025901 Ga0207688_10024354 Ga0207688_100243543 310
155 3300025904 Ga0207647_10062551 Ga0207647_100625513 310
156 3300025906 Ga0207699_10016027 Ga0207699_100160272 310
157 3300025906 Ga0207699_10120558 Ga0207699_101205582 310
158 3300025907 Ga0207645_10032358 Ga0207645_100323583 310
159 3300025909 Ga0207705_10007997 Ga0207705_100079972 310
160 3300025909 Ga0207705_10012346 Ga0207705_100123462 310
161 3300025910 Ga0207684_10028995 Ga0207684_100289951 310
162 3300025911 Ga0207654_10085923 Ga0207654_100859232 310
163 3300025918 Ga0207662_10002366 Ga0207662_100023669 310
164 3300025919 Ga0207657_10009292 Ga0207657_100092925 310
165 3300025920 Ga0207649_10032099 Ga0207649_100320993 310
166 3300025921 Ga0207652_10096765 Ga0207652_100967652 310
167 3300025924 Ga0207694_10064012 Ga0207694_100640123 310
168 3300025926 Ga0207659_10300439 Ga0207659_103004392 310
169 3300025927 Ga0207687_10203325 Ga0207687_102033251 310
170 3300025929 Ga0207664_10038026 Ga0207664_100380263 310
171 3300025936 Ga0207670_10063797 Ga0207670_100637972 310
172 3300025940 Ga0207691_10049725 Ga0207691_100497253 310
173 3300025942 Ga0207689_10060265 Ga0207689_100602653 310
174 3300025944 Ga0207661_10156161 Ga0207661_101561611 310
175 3300025945 Ga0207679_10135983 Ga0207679_101359832 310
176 3300025949 Ga0207667_10188103 Ga0207667_101881032 310
177 3300025961 Ga0207712_10075019 Ga0207712_100750192 310
178 3300025972 Ga0207668_10189738 Ga0207668_101897382 310
179 3300025986 Ga0207658_10299763 Ga0207658_102997632 310
180 3300026023 Ga0207677_10271124 Ga0207677_102711242 310
181 3300026041 Ga0207639_10061069 Ga0207639_100610693 310
182 3300026067 Ga0207678_10003260 Ga0207678_1000326010 310
183 3300026075 Ga0207708_10098638 Ga0207708_100986383 310
184 3300026078 Ga0207702_10009020 Ga0207702_100090205 310
185 3300026088 Ga0207641_10143157 Ga0207641_101431572 310
186 3300026116 Ga0207674_10002289 Ga0207674_1000228917 310
187 3300026118 Ga0207675_100013049 Ga0207675_1000130492 310
188 3300026121 Ga0207683_10014903 Ga0207683_100149036 310
189 3300026142 Ga0207698_10341715 Ga0207698_103417152 310
190 3300028379 Ga0268266_10119528 Ga0268266_101195282 310
191 3300028380 Ga0268265_10187757 Ga0268265_101877572 310
192 3300028381 Ga0268264_10145684 Ga0268264_101456842 310
193 3300034816 Ga0373930_0003603 Ga0373930_0003603_1147_2145 310
194 3300035083 Ga0373926_0019149 Ga0373926_0019149_839_1837 310
195 3300035084 Ga0373928_0027634 Ga0373928_0027634_94_1092 310
196 3300035086 Ga0373934_0005656 Ga0373934_0005656_2382_3380 310
197 3300035092 Ga0373952_0015890 Ga0373952_0015890_489_1487 310
198 3300035113 Ga0373936_0095722 Ga0373936_0095722_185_1183 310
199 3300035116 Ga0373945_0009239 Ga0373945_0009239_605_1603 310
200 3300035117 Ga0373953_0027907 Ga0373953_0027907_208_1206 310
201 3300035117 Ga0373953_0031275 Ga0373953_0031275_1008_2006 310
202 3300035118 Ga0373954_0065345 Ga0373954_0065345_487_1485 310
203 3300035119 Ga0373956_0091858 Ga0373956_0091858_177_1175 310
204 3300035172 Ga0373955_0036062 Ga0373955_0036062_1305_2303 310
205 3300035172 Ga0373955_0071321 Ga0373955_0071321_856_1854 310
206 3300035242 Ga0373962_0043489 Ga0373962_0043489_259_1257 310
207 3300035410 Ga0373924_0005264 Ga0373924_0005264_223_1221 310
208 3300035410 Ga0373924_0100898 Ga0373924_0100898_48_1046 310
209 3300035692 Ga0373935_0045918 Ga0373935_0045918_1497_2495 310
210 3300035695 Ga0373927_0021229 Ga0373927_0021229_3161_4159 310
211 3300035724 Ga0373933_0007620 Ga0373933_0007620_197_1195 310
212 3300036401 Ga0373937_0022991 Ga0373937_0022991_4213_5211 310
213 3300037068 Ga0373925_0242548 Ga0373925_0242548_104_1102 310
214 3300037853 Ga0436364_0287407 Ga0436364_0287407_88040_89041 310
215 3300037853 Ga0436364_1090900 Ga0436364_1090900_169_1167 310
216 3300037853 Ga0436364_1282665 Ga0436364_1282665_1199_2197 310
217 3300039437 Ga0436365_0073587 Ga0436365_0073587_1874_2872 310
218 3300039450 Ga0436363_1665714 Ga0436363_1665714_621_1619 310
219 3300039453 Ga0436362_0714019 Ga0436362_0714019_54_1052 310
220 3300044684 Ga0466966_0099830 Ga0466966_0099830_354_1346 310
221 3300044694 Ga0466963_0135649 Ga0466963_0135649_434_1429 310
222 3300045049 Ga0466959_0065780 Ga0466959_0065780_1501_2493 310
223 3300045976 Ga0466967_0181913 Ga0466967_0181913_752_1744 310
224 3300046454 Ga0495592_0038595 Ga0495592_0038595_391_1389 310
225 3300046459 Ga0495629_0002738 Ga0495629_0002738_377_1375 310
226 3300046461 Ga0495641_0003000 Ga0495641_0003000_10644_11642 310
227 3300046462 Ga0495651_0127886 Ga0495651_0127886_644_1642 310
228 3300046472 Ga0495580_0016727 Ga0495580_0016727_2116_3114 310
229 3300046475 Ga0495639_0054817 Ga0495639_0054817_429_1427 310
230 3300046476 Ga0495662_0010364 Ga0495662_0010364_390_1388 310
231 3300046499 Ga0495594_0043628 Ga0495594_0043628_652_1650 310
232 3300046511 Ga0495608_0024284 Ga0495608_0024284_1825_2823 310
233 3300046511 Ga0495608_0069970 Ga0495608_0069970_987_1985 310
234 3300046526 Ga0495666_0037827 Ga0495666_0037827_1013_2011 310
235 3300046535 Ga0495586_0080314 Ga0495586_0080314_132_1130 310
236 3300046536 Ga0495587_0033362 Ga0495587_0033362_629_1627 310
237 3300046543 Ga0495645_0044610 Ga0495645_0044610_598_1596 310
238 3300046559 Ga0495667_0015217 Ga0495667_0015217_391_1389 310
239 3300046663 Ga0495635_0021655 Ga0495635_0021655_3276_4274 310
240 3300046674 Ga0495588_0099233 Ga0495588_0099233_148_1146 310
241 3300046675 Ga0495657_0009553 Ga0495657_0009553_1705_2703 310
242 3300046675 Ga0495657_0083948 Ga0495657_0083948_954_1952 310
243 3300046680 Ga0495646_0017982 Ga0495646_0017982_3161_4159 310
244 3300046681 Ga0495647_0015235 Ga0495647_0015235_1411_2409 310
245 3300046689 Ga0495613_0110432 Ga0495613_0110432_395_1393 310
246 3300046690 Ga0495624_0033375 Ga0495624_0033375_1324_2322 310
247 3300046809 Ga0495600_0040078 Ga0495600_0040078_385_1383 310
248 3300046809 Ga0495600_0095292 Ga0495600_0095292_891_1889 310
249 3300047315 Ga0495581_0003879 Ga0495581_0003879_550_1548 310
250 3300047317 Ga0495604_0069493 Ga0495604_0069493_573_1571 310
251 3300047319 Ga0495674_0184210 Ga0495674_0184210_263_1261 310
252 3300047321 Ga0495676_0038360 Ga0495676_0038360_422_1420 310
253 3300047322 Ga0495680_0027796 Ga0495680_0027796_3247_4245 310
254 3300047322 Ga0495680_0271420 Ga0495680_0271420_104_1102 310
255 3300047444 Ga0495675_0016883 Ga0495675_0016883_291_1289 310
256 3300047444 Ga0495675_0144771 Ga0495675_0144771_425_1423 310
257 3300047471 Ga0495684_0064419 Ga0495684_0064419_1183_2181 310
258 3300047471 Ga0495684_0072610 Ga0495684_0072610_1434_2432 310
259 3300048088 Ga0495602_0146120 Ga0495602_0146120_844_1842 310
260 3300048089 Ga0495614_0044160 Ga0495614_0044160_839_1837 310
261 3300048904 Ga0496101_0031996 Ga0496101_0031996_2377_3375 310
262 3300048906 Ga0496103_0038436 Ga0496103_0038436_466_1464 310
263 3300048908 Ga0496105_0033168 Ga0496105_0033168_3224_4222 310
264 3300048909 Ga0496106_0245883 Ga0496106_0245883_419_1417 310
265 3300048911 Ga0496108_0073731 Ga0496108_0073731_168_1166 310
266 3300048913 Ga0496110_0051624 Ga0496110_0051624_115_1113 310
267 3300048914 Ga0496111_0034702 Ga0496111_0034702_2302_3300 310
268 3300048916 Ga0496113_0253032 Ga0496113_0253032_271_1269 310
269 3300049570 Ga0501033_0168797 Ga0501033_0168797_274_1272 310
270 3300049574 Ga0501038_0291179 Ga0501038_0291179_209_1207 310
271 3300049576 Ga0501040_0088206 Ga0501040_0088206_225_1223 310
272 3300049577 Ga0501041_0025945 Ga0501041_0025945_88_1086 310
273 3300049578 Ga0501042_0028001 Ga0501042_0028001_2881_3879 310
274 3300049579 Ga0501043_0336930 Ga0501043_0336930_34_1032 310
275 3300049586 Ga0501070_0009235 Ga0501070_0009235_2064_3062 310
276 3300049587 Ga0501071_0109033 Ga0501071_0109033_896_1894 310
277 3300049590 Ga0501074_0167389 Ga0501074_0167389_126_1124 310
278 3300049591 Ga0501075_0272855 Ga0501075_0272855_89_1087 310
279 3300049592 Ga0501076_0108016 Ga0501076_0108016_314_1312 310
280 3300049593 Ga0501077_0181309 Ga0501077_0181309_279_1277 310
281 3300049741 Ga0501079_0076125 Ga0501079_0076125_1147_2145 310
282 3300049824 Ga0501045_0194993 Ga0501045_0194993_380_1378 310
283 3300050512 nmdc:mga0n895_84901_c1 nmdc:mga0n895_84901_c1_907_1905 310
284 3300050515 nmdc:mga0a205_227483_c1 nmdc:mga0a205_227483_c1_67_1065 310
285 3300053077 Ga0495601_0007162 Ga0495601_0007162_3157_4155 310
286 3300053078 Ga0495612_0005163 Ga0495612_0005163_1047_2045 310
287 3300053085 Ga0495619_0031806 Ga0495619_0031806_577_1575 310
288 3300054114 Ga0501084_0209122 Ga0501084_0209122_118_1116 310
289 3300060353 Ga0501082_0090617 Ga0501082_0090617_329_1327 310
290 3300061734 Ga0530510_0039300 Ga0530510_0039300_225_1223 310
291 iso_pu_bacteria 2816332139 2816505010 310
292 iso_pu_bacteria 2870782633 2870784786 310
293 iso_pu_bacteria 2915358134 2915358812 310
294 iso_pu_bacteria 8054472261 8054476740 310
295 3300004799 Ga0058863_11608832 Ga0058863_116088322 311
296 3300005329 Ga0070683_100150733 Ga0070683_1001507333 311
297 3300005336 Ga0070680_100001094 Ga0070680_1000010946 311
298 3300005458 Ga0070681_10000009 Ga0070681_1000000927 311
299 3300005530 Ga0070679_100000163 Ga0070679_10000016311 311
300 3300005842 Ga0068858_100369729 Ga0068858_1003697292 311
301 3300009098 Ga0105245_10017525 Ga0105245_100175253 311
302 3300009148 Ga0105243_10107450 Ga0105243_101074502 311
303 3300009176 Ga0105242_10057689 Ga0105242_100576892 311
304 3300009177 Ga0105248_10411453 Ga0105248_104114532 311
305 3300013100 Ga0157373_10221661 Ga0157373_102216611 311
306 3300025912 Ga0207707_10000240 Ga0207707_1000024028 311
307 3300025917 Ga0207660_10000327 Ga0207660_1000032720 311
308 3300025921 Ga0207652_10000227 Ga0207652_1000022728 311
309 3300025927 Ga0207687_10070184 Ga0207687_100701843 311
310 3300025944 Ga0207661_10015456 Ga0207661_100154563 311
311 3300025944 Ga0207661_10154062 Ga0207661_101540623 311
312 3300026089 Ga0207648_10288414 Ga0207648_102884142 311
313 3300037471 Ga0395905_0408883 Ga0395905_0408883_48_1052 311
314 3300045049 Ga0466959_0121312 Ga0466959_0121312_77_1084 311
315 iso_pu_bacteria 2585428094 2587863171 311
316 iso_pu_bacteria 2585428157 2588108899 311
317 iso_pu_bacteria 2622736605 2623501203 311
318 iso_pu_bacteria 2643221566 2643848646 311
319 iso_pu_bacteria 2643221575 2643885753 311
320 iso_pu_bacteria 2643221597 2643996145 311
321 iso_pu_bacteria 2643221635 2644198652 311
322 iso_pu_bacteria 2643221649 2644277258 311
323 iso_pu_bacteria 2643221681 2644457617 311
324 iso_pu_bacteria 2643221697 2644537959 311
325 iso_pu_bacteria 2643221961 2645720223 311
326 iso_pu_bacteria 2690315906 2691514407 311
327 iso_pu_bacteria 2757320536 2758226391 311
328 iso_pu_bacteria 2773857758 2774380127 311
329 iso_pu_bacteria 2773857759 2774384239 311
330 iso_pu_bacteria 2773857763 2774399195 311
331 iso_pu_bacteria 2775506735 2775655262 311
332 iso_pu_bacteria 2808606306 2808630943 311
333 iso_pu_bacteria 2808606357 2808827490 311
334 iso_pu_bacteria 2808606360 2808852857 311
335 iso_pu_bacteria 2808606366 2808878694 311
336 iso_pu_bacteria 2808606368 2808885858 311
337 iso_pu_bacteria 2808606370 2808891726 311
338 iso_pu_bacteria 2808606371 2808896854 311
339 iso_pu_bacteria 2811994871 2812320725 311
340 iso_pu_bacteria 2811994872 2812323533 311
341 iso_pu_bacteria 2816332305 2817508916 311
342 iso_pu_bacteria 2833709550 2833711228 311
343 iso_pu_bacteria 2839986021 2839989363 311
344 iso_pu_bacteria 2844849076 2844849349 311
345 iso_pu_bacteria 2852643534 2852646198 311
346 iso_pu_bacteria 2852677369 2852679889 311
347 iso_pu_bacteria 2857720070 2857720077 311
348 iso_pu_bacteria 2857733635 2857736506 311
349 iso_pu_bacteria 2857737099 2857740165 311
350 iso_pu_bacteria 2857740372 2857741529 311
351 iso_pu_bacteria 2870628048 2870630598 311
352 iso_pu_bacteria 2904497146 2904500061 311
353 iso_pu_bacteria 2904509784 2904511743 311
354 iso_pu_bacteria 2904776348 2904776426 311
355 iso_pu_bacteria 2908678064 2908680665 311
356 iso_pu_bacteria 2910809715 2910813558 311
357 iso_pu_bacteria 2919034639 2919037555 311
358 iso_pu_bacteria 2919059106 2919063271 311
359 iso_pu_bacteria 2919069694 2919071778 311
360 iso_pu_bacteria 2919391150 2919391221 311
361 iso_pu_bacteria 2919538618 2919541942 311
362 iso_pu_bacteria 2928090899 2928092093 311
363 iso_pu_bacteria 2932426870 2932429043 311
364 iso_pu_bacteria 2932431166 2932432808 311
365 iso_pu_bacteria 2933418574 2933421213 311
366 iso_pu_bacteria 2939647034 2939649070 311
367 iso_pu_bacteria 2939674588 2939676264 311
368 iso_pu_bacteria 2945916053 2945918485 311
369 iso_pu_bacteria 2945920336 2945921232 311
370 iso_pu_bacteria 2945956166 2945959639 311
371 iso_pu_bacteria 2946024296 2946026230 311
372 iso_pu_bacteria 2946037020 2946038525 311
373 iso_pu_bacteria 2946059875 2946062344 311
374 iso_pu_bacteria 2953998280 2953999798 311
375 iso_pu_bacteria 2966921586 2966923999 311
376 iso_pu_bacteria 2974294766 2974297415 311
377 iso_pu_bacteria 2974302888 2974306512 311
378 iso_pu_bacteria 2974324384 2974326348 311
379 iso_pu_bacteria 2977228692 2977231661 311
380 iso_pu_bacteria 2977236895 2977237015 311
381 iso_pu_bacteria 2977251589 2977254177 311
382 iso_pu_bacteria 2977264416 2977266883 311
383 iso_pu_bacteria 2984542743 2984545192 311
384 iso_pu_bacteria 2984580707 2984581142 311
385 iso_pu_bacteria 2995726249 2995727499 311
386 iso_pu_bacteria 8002811521 8002813825 311
387 iso_pu_bacteria 8016254467 8016257294 311
388 iso_pu_bacteria 8045830549 8045831834 311
389 iso_pu_bacteria 8055034563 8055035566 311
390 iso_pu_bacteria 8055037949 8055038039 311
391 3300005339 Ga0070660_100043804 Ga0070660_1000438045 312
392 3300005435 Ga0070714_100238264 Ga0070714_1002382642 312
393 3300005471 Ga0070698_100258403 Ga0070698_1002584031 312
394 3300005981 Ga0081538_10101111 Ga0081538_101011112 312
395 3300009036 Ga0105244_10005231 Ga0105244_100052314 312
396 3300009036 Ga0105244_10047450 Ga0105244_100474502 312
397 3300011119 Ga0105246_10008058 Ga0105246_100080584 312
398 3300011119 Ga0105246_10009194 Ga0105246_100091944 312
399 3300013105 Ga0157369_10169565 Ga0157369_101695651 312
400 3300013105 Ga0157369_10401755 Ga0157369_104017552 312
401 3300013297 Ga0157378_10153763 Ga0157378_101537632 312
402 3300013307 Ga0157372_10470680 Ga0157372_104706801 312
403 3300022467 Ga0224712_10077659 Ga0224712_100776592 312
404 3300025245 Ga0207425_1019477 Ga0207425_10194771 312
405 3300025728 Ga0207655_1021225 Ga0207655_10212251 312
406 3300025912 Ga0207707_10071304 Ga0207707_100713042 312
407 3300025919 Ga0207657_10030946 Ga0207657_100309465 312
408 3300025921 Ga0207652_10073146 Ga0207652_100731462 312
409 3300027907 Ga0207428_10039060 Ga0207428_100390603 312
410 3300031548 Ga0307408_100061215 Ga0307408_1000612152 312
411 3300031548 Ga0307408_100294609 Ga0307408_1002946092 312
412 3300031731 Ga0307405_10031204 Ga0307405_100312042 312
413 3300031731 Ga0307405_10198357 Ga0307405_101983571 312
414 3300031824 Ga0307413_10014122 Ga0307413_100141222 312
415 3300031852 Ga0307410_10004512 Ga0307410_100045123 312
416 3300031852 Ga0307410_10010737 Ga0307410_100107374 312
417 3300031903 Ga0307407_10033253 Ga0307407_100332531 312
418 3300031911 Ga0307412_10047335 Ga0307412_100473353 312
419 3300031995 Ga0307409_100011956 Ga0307409_1000119562 312
420 3300031995 Ga0307409_100224661 Ga0307409_1002246612 312
421 3300031995 Ga0307409_100273292 Ga0307409_1002732921 312
422 3300032002 Ga0307416_100034413 Ga0307416_1000344133 312
423 3300032126 Ga0307415_100023785 Ga0307415_1000237853 312
424 3300032126 Ga0307415_100086212 Ga0307415_1000862122 312
425 3300032126 Ga0307415_100253936 Ga0307415_1002539362 312
426 3300035172 Ga0373955_0126488 Ga0373955_0126488_152_1156 312
427 3300037068 Ga0373925_0043453 Ga0373925_0043453_1095_2099 312
428 3300037312 Ga0395899_0003411 Ga0395899_0003411_8320_9336 312
429 3300037312 Ga0395899_0184421 Ga0395899_0184421_262_1278 312
430 3300037418 Ga0395900_0014998 Ga0395900_0014998_5454_6470 312
431 3300037418 Ga0395900_0270917 Ga0395900_0270917_477_1493 312
432 3300037466 Ga0395898_0033898 Ga0395898_0033898_2098_3114 312
433 3300037466 Ga0395898_0039158 Ga0395898_0039158_1440_2456 312
434 3300037466 Ga0395898_0077491 Ga0395898_0077491_663_1679 312
435 3300038443 Ga0395901_0014684 Ga0395901_0014684_3436_4452 312
436 3300038443 Ga0395901_0017075 Ga0395901_0017075_2684_3700 312
437 3300038443 Ga0395901_0071769 Ga0395901_0071769_221_1234 312
438 3300041404 Ga0439436_0008336 Ga0439436_0008336_733_1749 312
439 3300041406 Ga0439439_0000161 Ga0439439_0000161_4375_5391 312
440 3300041410 Ga0439461_0005937 Ga0439461_0005937_90_1106 312
441 3300041411 Ga0439466_0005934 Ga0439466_0005934_2458_3474 312
442 3300041413 Ga0439465_0020465 Ga0439465_0020465_1035_2051 312
443 3300041999 Ga0439433_0002516 Ga0439433_0002516_869_1885 312
444 3300042002 Ga0439442_000029 Ga0439442_000029_19752_20768 312
445 3300042006 Ga0439432_003644 Ga0439432_003644_742_1758 312
446 3300042007 Ga0439449_0000228 Ga0439449_0000228_4920_5936 312
447 3300042007 Ga0439449_0012024 Ga0439449_0012024_1706_2722 312
448 3300042010 Ga0439452_007360 Ga0439452_007360_1162_2178 312
449 3300042014 Ga0439457_003434 Ga0439457_003434_1951_2967 312
450 3300042121 Ga0450919_000141 Ga0450919_000141_5887_6903 312
451 3300042122 Ga0450920_000615 Ga0450920_000615_1923_2939 312
452 3300042146 Ga0450907_000142 Ga0450907_000142_5922_6938 312
453 3300042146 Ga0450907_007996 Ga0450907_007996_531_1547 312
454 3300042184 Ga0450908_000689 Ga0450908_000689_5231_6247 312
455 3300042184 Ga0450908_006101 Ga0450908_006101_734_1750 312
456 3300042185 Ga0450909_000040 Ga0450909_000040_3704_4720 312
457 3300042435 Ga0439434_0000010 Ga0439434_0000010_28164_29180 312
458 3300042531 Ga0450918_001024 Ga0450918_001024_2616_3632 312
459 3300044765 Ga0466970_0008844 Ga0466970_0008844_3739_4758 312
460 3300046454 Ga0495592_0030345 Ga0495592_0030345_3034_4038 312
461 3300046472 Ga0495580_0002952 Ga0495580_0002952_11859_12875 312
462 3300046472 Ga0495580_0035290 Ga0495580_0035290_350_1366 312
463 3300046475 Ga0495639_0000642 Ga0495639_0000642_10557_11573 312
464 3300046516 Ga0495628_0148649 Ga0495628_0148649_193_1197 312
465 3300046528 Ga0495642_0025176 Ga0495642_0025176_398_1414 312
466 3300046531 Ga0495665_0011398 Ga0495665_0011398_1363_2379 312
467 3300046543 Ga0495645_0005099 Ga0495645_0005099_3615_4631 312
468 3300046543 Ga0495645_0165100 Ga0495645_0165100_180_1196 312
469 3300046674 Ga0495588_0098597 Ga0495588_0098597_306_1322 312
470 3300046675 Ga0495657_0030812 Ga0495657_0030812_2094_3110 312
471 3300046691 Ga0495670_0143316 Ga0495670_0143316_179_1195 312
472 3300046809 Ga0495600_0029094 Ga0495600_0029094_2216_3232 312
473 3300047315 Ga0495581_0027345 Ga0495581_0027345_347_1363 312
474 3300047315 Ga0495581_0067330 Ga0495581_0067330_523_1539 312
475 3300047319 Ga0495674_0106280 Ga0495674_0106280_438_1454 312
476 3300047322 Ga0495680_0088467 Ga0495680_0088467_126_1130 312
477 3300047470 Ga0495681_0043752 Ga0495681_0043752_381_1397 312
478 3300047471 Ga0495684_0155255 Ga0495684_0155255_265_1281 312
479 3300048905 Ga0496102_0014349 Ga0496102_0014349_3106_4122 312
480 3300048905 Ga0496102_0193159 Ga0496102_0193159_233_1249 312
481 3300048905 Ga0496102_0295322 Ga0496102_0295322_303_1319 312
482 3300048906 Ga0496103_0023773 Ga0496103_0023773_436_1452 312
483 3300048913 Ga0496110_0158383 Ga0496110_0158383_621_1637 312
484 3300048915 Ga0496112_0014634 Ga0496112_0014634_3078_4094 312
485 3300049129 Ga0501309_001974 Ga0501309_001974_179_1195 312
486 3300049569 Ga0501032_0001570 Ga0501032_0001570_8396_9412 312
487 3300049571 Ga0501034_0000123 Ga0501034_0000123_21714_22730 312
488 3300049573 Ga0501037_0001615 Ga0501037_0001615_13876_14892 312
489 3300049573 Ga0501037_0270618 Ga0501037_0270618_60_1076 312
490 3300049574 Ga0501038_0030340 Ga0501038_0030340_3656_4672 312
491 3300049579 Ga0501043_0010156 Ga0501043_0010156_3116_4132 312
492 3300049579 Ga0501043_0017886 Ga0501043_0017886_992_2008 312
493 3300049579 Ga0501043_0071250 Ga0501043_0071250_403_1419 312
494 3300049583 Ga0501067_0137762 Ga0501067_0137762_265_1281 312
495 3300049590 Ga0501074_0063848 Ga0501074_0063848_706_1704 312
496 3300049823 Ga0501044_0044754 Ga0501044_0044754_2845_3861 312
497 3300054114 Ga0501084_0137696 Ga0501084_0137696_731_1744 312
498 3300059643 Ga0587072_000124 Ga0587072_000124_1509_2525 312
499 3300060353 Ga0501082_0230152 Ga0501082_0230152_542_1552 312
500 iso_pu_bacteria 2515154155 2515853581 312
501 iso_pu_bacteria 2643221542 2643733945 312
502 iso_pu_bacteria 2643221546 2643752766 312
503 iso_pu_bacteria 2643221553 2643785482 312
504 iso_pu_bacteria 2643221613 2644084643 312
505 iso_pu_bacteria 2643221630 2644170526 312
506 iso_pu_bacteria 2643221721 2644667255 312
507 iso_pu_bacteria 2643221724 2644679896 312
508 iso_pu_bacteria 2675903058 2676478506 312
509 iso_pu_bacteria 2728369276 2729909007 312
510 iso_pu_bacteria 2728369380 2730229362 312
511 iso_pu_bacteria 2747842429 2747953131 312
512 iso_pu_bacteria 2799112218 2799185273 312
513 iso_pu_bacteria 2808606447 2809227641 312
514 iso_pu_bacteria 2827628540 2827629566 312
515 iso_pu_bacteria 2848551377 2848552751 312
516 iso_pu_bacteria 2852632344 2852634406 312
517 iso_pu_bacteria 2852646457 2852647070 312
518 iso_pu_bacteria 2852663356 2852664939 312
519 iso_pu_bacteria 2857723135 2857723529 312
520 iso_pu_bacteria 2919395869 2919396321 312
521 iso_pu_bacteria 2935890801 2935894345 312
522 iso_pu_bacteria 2945968032 2945971526 312
523 iso_pu_bacteria 2946033335 2946034058 312
524 iso_pu_bacteria 2946041624 2946043906 312
525 iso_pu_bacteria 2946080515 2946081212 312
526 iso_pu_bacteria 8004182704 8004185417 312
527 iso_pu_bacteria 8054609563 8054610907 312
528 iso_pu_bacteria 8054609563 8054612425 312
529 3300005439 Ga0070711_100279880 Ga0070711_1002798801 313
530 3300005614 Ga0068856_100013598 Ga0068856_1000135983 313
531 3300005937 Ga0081455_10004927 Ga0081455_100049272 313
532 3300005937 Ga0081455_10034182 Ga0081455_100341823 313
533 3300005937 Ga0081455_10152458 Ga0081455_101524582 313
534 3300006844 Ga0075428_100028171 Ga0075428_1000281712 313
535 3300006880 Ga0075429_100055734 Ga0075429_1000557341 313
536 3300006914 Ga0075436_100002562 Ga0075436_1000025628 313
537 3300009094 Ga0111539_10002559 Ga0111539_100025594 313
538 3300009094 Ga0111539_10351066 Ga0111539_103510662 313
539 3300009098 Ga0105245_10087733 Ga0105245_100877333 313
540 3300009147 Ga0114129_10056113 Ga0114129_100561134 313
541 3300009147 Ga0114129_10170614 Ga0114129_101706143 313
542 3300009148 Ga0105243_10203358 Ga0105243_102033581 313
543 3300009551 Ga0105238_10308362 Ga0105238_103083621 313
544 3300011119 Ga0105246_10043828 Ga0105246_100438283 313
545 3300013102 Ga0157371_10051718 Ga0157371_100517183 313
546 3300013307 Ga0157372_10156843 Ga0157372_101568433 313
547 3300014326 Ga0157380_10002258 Ga0157380_100022583 313
548 3300025898 Ga0207692_10005860 Ga0207692_100058602 313
549 3300025904 Ga0207647_10053815 Ga0207647_100538152 313
550 3300025905 Ga0207685_10039928 Ga0207685_100399282 313
551 3300025906 Ga0207699_10006159 Ga0207699_100061594 313
552 3300025915 Ga0207693_10030756 Ga0207693_100307562 313
553 3300025916 Ga0207663_10044916 Ga0207663_100449163 313
554 3300025929 Ga0207664_10035384 Ga0207664_100353842 313
555 3300025939 Ga0207665_10014554 Ga0207665_100145543 313
556 3300026078 Ga0207702_10009804 Ga0207702_100098043 313
557 3300031456 Ga0307513_10153391 Ga0307513_101533911 313
558 3300031731 Ga0307405_10075773 Ga0307405_100757732 313
559 3300031852 Ga0307410_10051718 Ga0307410_100517181 313
560 3300031901 Ga0307406_10021269 Ga0307406_100212693 313
561 3300031995 Ga0307409_100019463 Ga0307409_1000194635 313
562 3300032004 Ga0307414_10013769 Ga0307414_100137695 313
563 3300032004 Ga0307414_10024990 Ga0307414_100249901 313
564 3300033180 Ga0307510_10273201 Ga0307510_102732011 313
565 3300036401 Ga0373937_0036984 Ga0373937_0036984_2586_3599 313
566 3300037068 Ga0373925_0001809 Ga0373925_0001809_83_1096 313
567 3300037068 Ga0373925_0099419 Ga0373925_0099419_954_1967 313
568 3300038443 Ga0395901_0068803 Ga0395901_0068803_1880_2899 313
569 3300039437 Ga0436365_1403056 Ga0436365_1403056_37_1038 313
570 3300042012 Ga0439455_0025867 Ga0439455_0025867_64_1083 313
571 3300042438 Ga0439459_0001201 Ga0439459_0001201_1924_2943 313
572 3300042439 Ga0439464_0018006 Ga0439464_0018006_58_1077 313
573 3300042993 Ga0439440_0046954 Ga0439440_0046954_37_1056 313
574 3300044706 Ga0466964_0008788 Ga0466964_0008788_799_1818 313
575 3300044901 Ga0466960_0005943 Ga0466960_0005943_3032_4051 313
576 3300044901 Ga0466960_0050805 Ga0466960_0050805_779_1798 313
577 3300045836 Ga0466958_0011282 Ga0466958_0011282_448_1449 313
578 3300045976 Ga0466967_0012807 Ga0466967_0012807_555_1574 313
579 3300045976 Ga0466967_0218983 Ga0466967_0218983_188_1210 313
580 3300045976 Ga0466967_0483104 Ga0466967_0483104_152_1171 313
581 3300046454 Ga0495592_0236637 Ga0495592_0236637_60_1073 313
582 3300046462 Ga0495651_0125577 Ga0495651_0125577_822_1835 313
583 3300046463 Ga0495653_0017203 Ga0495653_0017203_2968_3987 313
584 3300046477 Ga0495664_0058920 Ga0495664_0058920_1234_2253 313
585 3300046515 Ga0495620_0025413 Ga0495620_0025413_1282_2301 313
586 3300046516 Ga0495628_0057436 Ga0495628_0057436_239_1252 313
587 3300046518 Ga0495631_0081177 Ga0495631_0081177_154_1173 313
588 3300046529 Ga0495652_0040565 Ga0495652_0040565_1186_2199 313
589 3300046543 Ga0495645_0045334 Ga0495645_0045334_573_1586 313
590 3300046660 Ga0495625_0253701 Ga0495625_0253701_57_1076 313
591 3300046680 Ga0495646_0141249 Ga0495646_0141249_27_1040 313
592 3300046691 Ga0495670_0133957 Ga0495670_0133957_50_1069 313
593 3300046809 Ga0495600_0141232 Ga0495600_0141232_41_1054 313
594 3300047319 Ga0495674_0288944 Ga0495674_0288944_257_1270 313
595 3300047322 Ga0495680_0162550 Ga0495680_0162550_535_1548 313
596 3300048904 Ga0496101_0138647 Ga0496101_0138647_793_1812 313
597 3300048905 Ga0496102_0020875 Ga0496102_0020875_2712_3731 313
598 3300048907 Ga0496104_0003015 Ga0496104_0003015_6701_7711 313
599 3300048909 Ga0496106_0005256 Ga0496106_0005256_4843_5862 313
600 3300048909 Ga0496106_0025161 Ga0496106_0025161_2825_3844 313
601 3300048910 Ga0496107_0068600 Ga0496107_0068600_1201_2220 313
602 3300048911 Ga0496108_0119346 Ga0496108_0119346_606_1616 313
603 3300048912 Ga0496109_0006631 Ga0496109_0006631_2287_3297 313
604 3300048912 Ga0496109_0228185 Ga0496109_0228185_620_1639 313
605 3300048912 Ga0496109_0308943 Ga0496109_0308943_302_1321 313
606 3300048913 Ga0496110_0393181 Ga0496110_0393181_39_1058 313
607 3300048915 Ga0496112_0002386 Ga0496112_0002386_7123_8133 313
608 3300048917 Ga0496114_0005860 Ga0496114_0005860_7059_8078 313
609 3300048917 Ga0496114_0191105 Ga0496114_0191105_732_1751 313
610 3300048917 Ga0496114_0252825 Ga0496114_0252825_324_1334 313
611 3300048917 Ga0496114_0259367 Ga0496114_0259367_246_1250 313
612 3300048918 Ga0496115_0028842 Ga0496115_0028842_76_1080 313
613 3300048929 Ga0496126_0000006 Ga0496126_0000006_654728_655747 313
614 3300048929 Ga0496126_0144272 Ga0496126_0144272_768_1772 313
615 3300049568 Ga0501031_0001624 Ga0501031_0001624_349_1368 313
616 3300049569 Ga0501032_0000056 Ga0501032_0000056_71757_72776 313
617 3300049569 Ga0501032_0017506 Ga0501032_0017506_1195_2214 313
618 3300049570 Ga0501033_0001130 Ga0501033_0001130_14833_15852 313
619 3300049570 Ga0501033_0154960 Ga0501033_0154960_194_1213 313
620 3300049571 Ga0501034_0001982 Ga0501034_0001982_12701_13720 313
621 3300049571 Ga0501034_0004224 Ga0501034_0004224_10709_11728 313
622 3300049571 Ga0501034_0016472 Ga0501034_0016472_6045_7064 313
623 3300049571 Ga0501034_0089184 Ga0501034_0089184_475_1494 313
624 3300049572 Ga0501036_0000057 Ga0501036_0000057_39112_40131 313
625 3300049572 Ga0501036_0013945 Ga0501036_0013945_2641_3660 313
626 3300049573 Ga0501037_0000361 Ga0501037_0000361_2014_3033 313
627 3300049573 Ga0501037_0028153 Ga0501037_0028153_1737_2756 313
628 3300049574 Ga0501038_0016515 Ga0501038_0016515_202_1221 313
629 3300049574 Ga0501038_0030042 Ga0501038_0030042_2965_3984 313
630 3300049575 Ga0501039_0000623 Ga0501039_0000623_12394_13413 313
631 3300049575 Ga0501039_0007694 Ga0501039_0007694_4628_5647 313
632 3300049575 Ga0501039_0333854 Ga0501039_0333854_146_1168 313
633 3300049576 Ga0501040_0055813 Ga0501040_0055813_1142_2161 313
634 3300049576 Ga0501040_0070019 Ga0501040_0070019_564_1586 313
635 3300049577 Ga0501041_0022715 Ga0501041_0022715_411_1430 313
636 3300049578 Ga0501042_0016724 Ga0501042_0016724_2600_3619 313
637 3300049578 Ga0501042_0273113 Ga0501042_0273113_134_1153 313
638 3300049579 Ga0501043_0000755 Ga0501043_0000755_11888_12907 313
639 3300049579 Ga0501043_0042257 Ga0501043_0042257_1846_2865 313
640 3300049579 Ga0501043_0265204 Ga0501043_0265204_59_1078 313
641 3300049580 Ga0501046_0000701 Ga0501046_0000701_5886_6905 313
642 3300049581 Ga0501047_0006801 Ga0501047_0006801_2014_3033 313
643 3300049582 Ga0501048_0000016 Ga0501048_0000016_63332_64351 313
644 3300049583 Ga0501067_0000461 Ga0501067_0000461_6721_7740 313
645 3300049583 Ga0501067_0001018 Ga0501067_0001018_6268_7287 313
646 3300049583 Ga0501067_0001635 Ga0501067_0001635_6074_7093 313
647 3300049583 Ga0501067_0118438 Ga0501067_0118438_319_1338 313
648 3300049584 Ga0501068_0001742 Ga0501068_0001742_5238_6257 313
649 3300049584 Ga0501068_0001917 Ga0501068_0001917_9611_10630 313
650 3300049584 Ga0501068_0099491 Ga0501068_0099491_734_1753 313
651 3300049585 Ga0501069_0020666 Ga0501069_0020666_669_1688 313
652 3300049585 Ga0501069_0098350 Ga0501069_0098350_233_1252 313
653 3300049585 Ga0501069_0098864 Ga0501069_0098864_623_1642 313
654 3300049586 Ga0501070_0001031 Ga0501070_0001031_10960_11979 313
655 3300049586 Ga0501070_0001292 Ga0501070_0001292_13606_14625 313
656 3300049586 Ga0501070_0001455 Ga0501070_0001455_2808_3827 313
657 3300049586 Ga0501070_0023464 Ga0501070_0023464_193_1212 313
658 3300049586 Ga0501070_0161322 Ga0501070_0161322_41_1045 313
659 3300049586 Ga0501070_0262492 Ga0501070_0262492_174_1193 313
660 3300049587 Ga0501071_0011824 Ga0501071_0011824_2289_3308 313
661 3300049587 Ga0501071_0050268 Ga0501071_0050268_1874_2893 313
662 3300049587 Ga0501071_0101472 Ga0501071_0101472_1008_2027 313
663 3300049588 Ga0501072_0006559 Ga0501072_0006559_5088_6107 313
664 3300049588 Ga0501072_0025460 Ga0501072_0025460_2240_3259 313
665 3300049589 Ga0501073_0003609 Ga0501073_0003609_7788_8807 313
666 3300049589 Ga0501073_0003614 Ga0501073_0003614_3828_4847 313
667 3300049589 Ga0501073_0004931 Ga0501073_0004931_8088_9107 313
668 3300049590 Ga0501074_0000074 Ga0501074_0000074_47117_48136 313
669 3300049590 Ga0501074_0001017 Ga0501074_0001017_14602_15621 313
670 3300049590 Ga0501074_0001632 Ga0501074_0001632_7899_8918 313
671 3300049590 Ga0501074_0047572 Ga0501074_0047572_1325_2344 313
672 3300049590 Ga0501074_0087027 Ga0501074_0087027_154_1173 313
673 3300049592 Ga0501076_0030665 Ga0501076_0030665_2628_3647 313
674 3300049593 Ga0501077_0003022 Ga0501077_0003022_1157_2176 313
675 3300049593 Ga0501077_0025215 Ga0501077_0025215_828_1847 313
676 3300049741 Ga0501079_0023792 Ga0501079_0023792_2691_3710 313
677 3300049741 Ga0501079_0032323 Ga0501079_0032323_2561_3580 313
678 3300049741 Ga0501079_0075822 Ga0501079_0075822_1023_2042 313
679 3300049742 Ga0501080_0006051 Ga0501080_0006051_6034_7053 313
680 3300049742 Ga0501080_0006298 Ga0501080_0006298_9282_10301 313
681 3300049744 Ga0501083_0008878 Ga0501083_0008878_5842_6861 313
682 3300049744 Ga0501083_0155829 Ga0501083_0155829_223_1242 313
683 3300049822 Ga0501035_0000262 Ga0501035_0000262_50437_51456 313
684 3300049823 Ga0501044_0000312 Ga0501044_0000312_6983_8002 313
685 3300049824 Ga0501045_0028523 Ga0501045_0028523_2593_3612 313
686 3300050508 nmdc:mga09592_13573_c1 nmdc:mga09592_13573_c1_74_1093 313
687 3300050511 nmdc:mga08y16_6424_c1 nmdc:mga08y16_6424_c1_5367_6386 313
688 3300050511 nmdc:mga08y16_74363_c1 nmdc:mga08y16_74363_c1_36_1055 313
689 3300050512 nmdc:mga0n895_6711_c1 nmdc:mga0n895_6711_c1_2854_3873 313
690 3300050513 nmdc:mga0rr50_53529_c1 nmdc:mga0rr50_53529_c1_338_1357 313
691 3300050514 nmdc:mga08x19_4601_c1 nmdc:mga08x19_4601_c1_5917_6936 313
692 3300050515 nmdc:mga0a205_6472_c1 nmdc:mga0a205_6472_c1_2949_3968 313
693 3300053077 Ga0495601_0029504 Ga0495601_0029504_2334_3353 313
694 3300053085 Ga0495619_0231224 Ga0495619_0231224_115_1134 313
695 3300054114 Ga0501084_0000906 Ga0501084_0000906_13706_14725 313
696 3300054114 Ga0501084_0024881 Ga0501084_0024881_3016_4035 313
697 3300060353 Ga0501082_0036004 Ga0501082_0036004_1803_2822 313
698 3300061734 Ga0530510_0079212 Ga0530510_0079212_543_1562 313
699 iso_pu_bacteria 2731639228 2731908564 313
700 iso_pu_bacteria 2751185734 2753070651 313
701 iso_pu_bacteria 2795385470 2795784179 313
702 iso_pu_bacteria 2808606522 2809592253 313
703 iso_pu_bacteria 2866612099 2866616539 313
704 iso_pu_bacteria 2870721527 2870726791 313
705 iso_pu_bacteria 2883821847 2883825180 313
706 iso_pu_bacteria 2891326441 2891326685 313
707 iso_pu_bacteria 2899359706 2899362166 313
708 iso_pu_bacteria 2899370129 2899372642 313
709 3300005355 Ga0070671_100001146 Ga0070671_10000114613 314
710 3300005547 Ga0070693_100103768 Ga0070693_1001037681 314
711 3300005617 Ga0068859_100238647 Ga0068859_1002386472 314
712 3300005834 Ga0068851_10108839 Ga0068851_101088392 314
713 3300005841 Ga0068863_100052256 Ga0068863_1000522562 314
714 3300006931 Ga0097620_100238649 Ga0097620_1002386492 314
715 3300013102 Ga0157371_10148938 Ga0157371_101489382 314
716 3300025927 Ga0207687_10076337 Ga0207687_100763371 314
717 3300025931 Ga0207644_10003724 Ga0207644_100037247 314
718 3300026088 Ga0207641_10042624 Ga0207641_100426243 314
719 3300028379 Ga0268266_10002253 Ga0268266_1000225314 314
720 3300028381 Ga0268264_10167270 Ga0268264_101672702 314
721 3300037418 Ga0395900_0028142 Ga0395900_0028142_2510_3514 314
722 3300044658 Ga0466972_0009892 Ga0466972_0009892_63_1067 314
723 3300044683 Ga0466965_0009613 Ga0466965_0009613_758_1762 314
724 3300044765 Ga0466970_0023143 Ga0466970_0023143_750_1754 314
725 3300044901 Ga0466960_0000282 Ga0466960_0000282_5367_6371 314
726 3300045836 Ga0466958_0058386 Ga0466958_0058386_230_1234 314
727 3300048903 Ga0496100_0004473 Ga0496100_0004473_4029_5033 314
728 3300048904 Ga0496101_0001474 Ga0496101_0001474_5859_6863 314
729 3300048905 Ga0496102_0000408 Ga0496102_0000408_27733_28737 314
730 3300048906 Ga0496103_0000422 Ga0496103_0000422_14897_15901 314
731 3300048908 Ga0496105_0015525 Ga0496105_0015525_4189_5193 314
732 3300048910 Ga0496107_0034654 Ga0496107_0034654_2366_3370 314
733 3300048911 Ga0496108_0109788 Ga0496108_0109788_38_1042 314
734 3300048919 Ga0496116_0000688 Ga0496116_0000688_21100_22104 314
735 3300048920 Ga0496117_0000615 Ga0496117_0000615_27725_28729 314
736 3300048921 Ga0496118_0001711 Ga0496118_0001711_9897_10901 314
737 3300048922 Ga0496119_0019949 Ga0496119_0019949_855_1859 314
738 3300048923 Ga0496120_0003326 Ga0496120_0003326_3876_4880 314
739 3300048924 Ga0496121_0007937 Ga0496121_0007937_2445_3449 314
740 3300048925 Ga0496122_0192961 Ga0496122_0192961_96_1100 314
741 3300048927 Ga0496124_0021487 Ga0496124_0021487_3487_4491 314
742 3300048928 Ga0496125_0057287 Ga0496125_0057287_313_1317 314
743 3300048929 Ga0496126_0001071 Ga0496126_0001071_27723_28727 314
744 3300050511 nmdc:mga08y16_457300_c1 nmdc:mga08y16_457300_c1_237_1241 314
745 3300002773 JGI25152J39213_1000575 JGI25152J39213_10005759 315
746 3300003187 JGI25151J46595_10037562 JGI25151J46595_100375622 315
747 3300003578 Ga0006562J51391_1051343 Ga0006562J51391_10513431 315
748 3300006038 Ga0075365_10009182 Ga0075365_100091825 315
749 3300006042 Ga0075368_10006588 Ga0075368_100065884 315
750 3300006048 Ga0075363_100036812 Ga0075363_1000368121 315
751 3300006051 Ga0075364_10005914 Ga0075364_100059143 315
752 3300006051 Ga0075364_10014457 Ga0075364_100144572 315
753 3300006051 Ga0075364_10086870 Ga0075364_100868702 315
754 3300006178 Ga0075367_10001210 Ga0075367_100012101 315
755 3300006186 Ga0075369_10005604 Ga0075369_100056043 315
756 3300006353 Ga0075370_10038470 Ga0075370_100384703 315
757 3300009036 Ga0105244_10061431 Ga0105244_100614312 315
758 3300020069 Ga0197907_10135013 Ga0197907_101350134 315
759 3300020081 Ga0206354_10469986 Ga0206354_104699861 315
760 3300020081 Ga0206354_10575016 Ga0206354_105750163 315
761 3300025258 Ga0209129_1000028 Ga0209129_1000028117 315
762 3300025294 Ga0209025_1000112 Ga0209025_100011225 315
763 3300025315 Ga0207697_10015293 Ga0207697_100152933 315
764 3300025728 Ga0207655_1002765 Ga0207655_10027659 315
765 3300025728 Ga0207655_1005169 Ga0207655_10051696 315
766 3300025898 Ga0207692_10067367 Ga0207692_100673672 315
767 3300025921 Ga0207652_10113906 Ga0207652_101139062 315
768 3300025927 Ga0207687_10040646 Ga0207687_100406463 315
769 3300027866 Ga0209813_10004368 Ga0209813_100043683 315
770 3300028381 Ga0268264_10258154 Ga0268264_102581542 315
771 3300028794 Ga0307515_10124905 Ga0307515_101249052 315
772 3300028794 Ga0307515_10191725 Ga0307515_101917252 315
773 3300031548 Ga0307408_100002497 Ga0307408_1000024978 315
774 3300031548 Ga0307408_100052016 Ga0307408_1000520162 315
775 3300031548 Ga0307408_100140928 Ga0307408_1001409281 315
776 3300031649 Ga0307514_10001799 Ga0307514_100017993 315
777 3300031731 Ga0307405_10010328 Ga0307405_100103283 315
778 3300031731 Ga0307405_10158654 Ga0307405_101586542 315
779 3300031731 Ga0307405_10381310 Ga0307405_103813101 315
780 3300031852 Ga0307410_10016997 Ga0307410_100169974 315
781 3300031852 Ga0307410_10072631 Ga0307410_100726312 315
782 3300031852 Ga0307410_10080637 Ga0307410_100806372 315
783 3300031852 Ga0307410_10162348 Ga0307410_101623482 315
784 3300031852 Ga0307410_10184428 Ga0307410_101844281 315
785 3300031852 Ga0307410_10190154 Ga0307410_101901542 315
786 3300031901 Ga0307406_10000595 Ga0307406_1000059517 315
787 3300031901 Ga0307406_10228694 Ga0307406_102286942 315
788 3300031903 Ga0307407_10017546 Ga0307407_100175464 315
789 3300031903 Ga0307407_10115344 Ga0307407_101153441 315
790 3300031911 Ga0307412_10031033 Ga0307412_100310332 315
791 3300031911 Ga0307412_10038661 Ga0307412_100386611 315
792 3300031911 Ga0307412_10055274 Ga0307412_100552741 315
793 3300031995 Ga0307409_100185049 Ga0307409_1001850493 315
794 3300031995 Ga0307409_100282245 Ga0307409_1002822452 315
795 3300032002 Ga0307416_100010393 Ga0307416_1000103933 315
796 3300032002 Ga0307416_100025175 Ga0307416_1000251753 315
797 3300032002 Ga0307416_100050287 Ga0307416_1000502873 315
798 3300032002 Ga0307416_100054738 Ga0307416_1000547383 315
799 3300032002 Ga0307416_100208289 Ga0307416_1002082891 315
800 3300032002 Ga0307416_100424631 Ga0307416_1004246311 315
801 3300032004 Ga0307414_10031963 Ga0307414_100319632 315
802 3300032004 Ga0307414_10261254 Ga0307414_102612542 315
803 3300032005 Ga0307411_10115608 Ga0307411_101156083 315
804 3300032126 Ga0307415_100045786 Ga0307415_1000457863 315
805 3300032126 Ga0307415_100239930 Ga0307415_1002399302 315
806 3300035086 Ga0373934_0010153 Ga0373934_0010153_2220_3233 315
807 3300035111 Ga0373923_0076069 Ga0373923_0076069_399_1412 315
808 3300035119 Ga0373956_0017640 Ga0373956_0017640_562_1575 315
809 3300036401 Ga0373937_0017333 Ga0373937_0017333_750_1763 315
810 3300039450 Ga0436363_0081723 Ga0436363_0081723_56_1066 315
811 3300042136 Ga0450900_003192 Ga0450900_003192_13_1038 315
812 3300044658 Ga0466972_0004035 Ga0466972_0004035_1419_2441 315
813 3300044683 Ga0466965_0000871 Ga0466965_0000871_2213_3238 315
814 3300044683 Ga0466965_0007131 Ga0466965_0007131_706_1731 315
815 3300044694 Ga0466963_0013798 Ga0466963_0013798_433_1461 315
816 3300044901 Ga0466960_0149300 Ga0466960_0149300_198_1226 315
817 3300046471 Ga0495650_0065073 Ga0495650_0065073_128_1153 315
818 3300046511 Ga0495608_0044518 Ga0495608_0044518_516_1529 315
819 3300046529 Ga0495652_0032726 Ga0495652_0032726_2993_4006 315
820 3300046536 Ga0495587_0053737 Ga0495587_0053737_1321_2334 315
821 3300046559 Ga0495667_0004412 Ga0495667_0004412_5521_6534 315
822 3300047317 Ga0495604_0015370 Ga0495604_0015370_4620_5633 315
823 3300047444 Ga0495675_0057352 Ga0495675_0057352_1182_2195 315
824 3300047447 Ga0495685_059617 Ga0495685_059617_230_1258 315
825 3300048088 Ga0495602_0038750 Ga0495602_0038750_1146_2159 315
826 3300048904 Ga0496101_0020193 Ga0496101_0020193_1381_2406 315
827 3300048905 Ga0496102_0064776 Ga0496102_0064776_1869_2894 315
828 3300048907 Ga0496104_0011156 Ga0496104_0011156_4250_5275 315
829 3300048907 Ga0496104_0030331 Ga0496104_0030331_3593_4621 315
830 3300048907 Ga0496104_0224854 Ga0496104_0224854_131_1156 315
831 3300048908 Ga0496105_0004398 Ga0496105_0004398_3543_4571 315
832 3300048908 Ga0496105_0102644 Ga0496105_0102644_935_1960 315
833 3300048910 Ga0496107_0152770 Ga0496107_0152770_656_1681 315
834 3300048911 Ga0496108_0021705 Ga0496108_0021705_499_1524 315
835 3300048911 Ga0496108_0027927 Ga0496108_0027927_2303_3331 315
836 3300048912 Ga0496109_0021560 Ga0496109_0021560_1148_2176 315
837 3300048913 Ga0496110_0000297 Ga0496110_0000297_27080_28108 315
838 3300048914 Ga0496111_0005756 Ga0496111_0005756_3449_4477 315
839 3300048914 Ga0496111_0087583 Ga0496111_0087583_36_1061 315
840 3300048915 Ga0496112_0101250 Ga0496112_0101250_702_1730 315
841 3300048915 Ga0496112_0220395 Ga0496112_0220395_600_1625 315
842 3300048916 Ga0496113_0031268 Ga0496113_0031268_2650_3678 315
843 3300048916 Ga0496113_0245628 Ga0496113_0245628_305_1330 315
844 3300048917 Ga0496114_0043680 Ga0496114_0043680_1950_2978 315
845 3300048917 Ga0496114_0098187 Ga0496114_0098187_1458_2483 315
846 3300048918 Ga0496115_0095728 Ga0496115_0095728_1332_2357 315
847 3300048919 Ga0496116_0016328 Ga0496116_0016328_1686_2711 315
848 3300048920 Ga0496117_0000053 Ga0496117_0000053_50437_51462 315
849 3300048920 Ga0496117_0022343 Ga0496117_0022343_35_1060 315
850 3300048922 Ga0496119_0004593 Ga0496119_0004593_9687_10712 315
851 3300048922 Ga0496119_0006393 Ga0496119_0006393_8583_9608 315
852 3300048922 Ga0496119_0007748 Ga0496119_0007748_8358_9383 315
853 3300048922 Ga0496119_0011021 Ga0496119_0011021_4666_5691 315
854 3300048922 Ga0496119_0074968 Ga0496119_0074968_236_1261 315
855 3300048923 Ga0496120_0001595 Ga0496120_0001595_11802_12827 315
856 3300048923 Ga0496120_0002066 Ga0496120_0002066_10889_11914 315
857 3300048923 Ga0496120_0004880 Ga0496120_0004880_7490_8515 315
858 3300048925 Ga0496122_0000031 Ga0496122_0000031_211408_212433 315
859 3300048925 Ga0496122_0004958 Ga0496122_0004958_9928_10953 315
860 3300048925 Ga0496122_0048019 Ga0496122_0048019_2244_3269 315
861 3300048926 Ga0496123_0000013 Ga0496123_0000013_211418_212443 315
862 3300048926 Ga0496123_0003480 Ga0496123_0003480_4684_5709 315
863 3300048926 Ga0496123_0018843 Ga0496123_0018843_1887_2912 315
864 3300048926 Ga0496123_0052050 Ga0496123_0052050_165_1190 315
865 3300048927 Ga0496124_0019590 Ga0496124_0019590_3241_4266 315
866 3300048927 Ga0496124_0066258 Ga0496124_0066258_604_1629 315
867 3300048928 Ga0496125_0000077 Ga0496125_0000077_95148_96173 315
868 3300048928 Ga0496125_0010943 Ga0496125_0010943_5388_6413 315
869 3300048928 Ga0496125_0024822 Ga0496125_0024822_3344_4369 315
870 3300048929 Ga0496126_0002399 Ga0496126_0002399_6536_7561 315
871 3300048929 Ga0496126_0092532 Ga0496126_0092532_1040_2065 315
872 3300049572 Ga0501036_0159175 Ga0501036_0159175_224_1249 315
873 3300049575 Ga0501039_0109137 Ga0501039_0109137_640_1665 315
874 3300049581 Ga0501047_0204694 Ga0501047_0204694_379_1404 315
875 3300049586 Ga0501070_0133352 Ga0501070_0133352_612_1637 315
876 3300049589 Ga0501073_0000057 Ga0501073_0000057_23162_24187 315
877 3300049823 Ga0501044_0120336 Ga0501044_0120336_1247_2272 315
878 3300050491 nmdc:mga00v17_32273_c1 nmdc:mga00v17_32273_c1_387_1412 315
879 3300050491 nmdc:mga00v17_4765_c1 nmdc:mga00v17_4765_c1_5243_6268 315
880 3300050492 nmdc:mga0yw44_39792_c1 nmdc:mga0yw44_39792_c1_1268_2293 315
881 3300050492 nmdc:mga0yw44_52592_c1 nmdc:mga0yw44_52592_c1_316_1341 315
882 3300050492 nmdc:mga0yw44_6861_c1 nmdc:mga0yw44_6861_c1_3886_4911 315
883 3300050494 nmdc:mga06z11_4715_c1 nmdc:mga06z11_4715_c1_840_1865 315
884 3300050495 nmdc:mga04h51_6087_c1 nmdc:mga04h51_6087_c1_58_1083 315
885 3300050496 nmdc:mga07m45_28725_c1 nmdc:mga07m45_28725_c1_1376_2401 315
886 3300050516 nmdc:mga0sz30_4016_c1 nmdc:mga0sz30_4016_c1_3148_4173 315
887 3300050516 nmdc:mga0sz30_9709_c1 nmdc:mga0sz30_9709_c1_818_1843 315
888 3300053104 Ga0500556_0000168 Ga0500556_0000168_28327_29352 315
889 3300053108 Ga0500562_001203 Ga0500562_001203_2168_3193 315
890 3300053117 Ga0500593_000819 Ga0500593_000819_5326_6351 315
891 3300053133 Ga0500655_002809 Ga0500655_002809_1333_2358 315
892 3300053136 Ga0500559_0000104 Ga0500559_0000104_30145_31170 315
893 3300053136 Ga0500559_0000159 Ga0500559_0000159_33516_34541 315
894 3300053139 Ga0500568_0001269 Ga0500568_0001269_2225_3250 315
895 3300053139 Ga0500568_0022590 Ga0500568_0022590_580_1605 315
896 3300053140 Ga0500573_0037461 Ga0500573_0037461_241_1266 315
897 3300059424 Ga0590075_025006 Ga0590075_025006_437_1462 315
898 3300059507 Ga0587086_003661 Ga0587086_003661_509_1534 315
899 3300059510 Ga0587090_000017 Ga0587090_000017_5045_6070 315
900 3300059511 Ga0587091_018730 Ga0587091_018730_140_1165 315
901 3300059604 Ga0587098_000970 Ga0587098_000970_967_1992 315
902 3300059647 Ga0587079_002236 Ga0587079_002236_167_1192 315
903 3300001991 JGI24743J22301_10024236 JGI24743J22301_100242361 316
904 3300003203 JGI25406J46586_10001708 JGI25406J46586_100017084 316
905 3300005329 Ga0070683_100139069 Ga0070683_1001390692 316
906 3300005329 Ga0070683_100248569 Ga0070683_1002485692 316
907 3300005345 Ga0070692_10041235 Ga0070692_100412352 316
908 3300005367 Ga0070667_100082228 Ga0070667_1000822281 316
909 3300005435 Ga0070714_100017121 Ga0070714_1000171212 316
910 3300005438 Ga0070701_10002525 Ga0070701_100025256 316
911 3300005441 Ga0070700_100007467 Ga0070700_1000074673 316
912 3300005455 Ga0070663_100215202 Ga0070663_1002152021 316
913 3300005456 Ga0070678_100244261 Ga0070678_1002442612 316
914 3300005466 Ga0070685_10022702 Ga0070685_100227023 316
915 3300005539 Ga0068853_100121875 Ga0068853_1001218752 316
916 3300005543 Ga0070672_100013603 Ga0070672_1000136034 316
917 3300005719 Ga0068861_100089040 Ga0068861_1000890403 316
918 3300005840 Ga0068870_10002617 Ga0068870_100026176 316
919 3300005985 Ga0081539_10000100 Ga0081539_10000100125 316
920 3300005985 Ga0081539_10054195 Ga0081539_100541952 316
921 3300006051 Ga0075364_10017613 Ga0075364_100176132 316
922 3300025935 Ga0207709_10013649 Ga0207709_100136492 316
923 3300025938 Ga0207704_10007814 Ga0207704_100078144 316
924 3300025944 Ga0207661_10009201 Ga0207661_100092015 316
925 3300025944 Ga0207661_10223447 Ga0207661_102234472 316
926 3300025945 Ga0207679_10005100 Ga0207679_100051003 316
927 3300025981 Ga0207640_10097199 Ga0207640_100971993 316
928 3300025986 Ga0207658_10179438 Ga0207658_101794383 316
929 3300026075 Ga0207708_10004147 Ga0207708_100041476 316
930 3300026118 Ga0207675_100004892 Ga0207675_10000489214 316
931 3300026142 Ga0207698_10007141 Ga0207698_100071415 316
932 3300028379 Ga0268266_10001751 Ga0268266_1000175122 316
933 3300031852 Ga0307410_10018609 Ga0307410_100186092 316
934 3300031852 Ga0307410_10031345 Ga0307410_100313453 316
935 3300031901 Ga0307406_10006377 Ga0307406_100063772 316
936 3300031911 Ga0307412_10037420 Ga0307412_100374201 316
937 3300031995 Ga0307409_100018062 Ga0307409_1000180622 316
938 3300032002 Ga0307416_100022433 Ga0307416_1000224333 316
939 3300032002 Ga0307416_100186731 Ga0307416_1001867312 316
940 3300032004 Ga0307414_10013682 Ga0307414_100136822 316
941 3300032004 Ga0307414_10125226 Ga0307414_101252262 316
942 3300032005 Ga0307411_10047739 Ga0307411_100477392 316
943 3300032126 Ga0307415_100002035 Ga0307415_1000020355 316
944 3300032126 Ga0307415_100012020 Ga0307415_1000120204 316
945 3300044694 Ga0466963_0135378 Ga0466963_0135378_652_1686 316
946 3300044765 Ga0466970_0000150 Ga0466970_0000150_16428_17504 316
947 3300046453 Ga0495627_002964 Ga0495627_002964_497_1525 316
948 3300048917 Ga0496114_0056947 Ga0496114_0056947_1339_2367 316
949 3300048920 Ga0496117_0001799 Ga0496117_0001799_17951_18979 316
950 3300048921 Ga0496118_0020800 Ga0496118_0020800_1526_2554 316
951 3300048925 Ga0496122_0042957 Ga0496122_0042957_14_1042 316
952 3300048927 Ga0496124_0013716 Ga0496124_0013716_5308_6393 316
953 3300048928 Ga0496125_0022776 Ga0496125_0022776_65_1093 316
954 3300048929 Ga0496126_0019364 Ga0496126_0019364_2431_3459 316
955 3300048929 Ga0496126_0136302 Ga0496126_0136302_724_1788 316
956 3300048929 Ga0496126_0344362 Ga0496126_0344362_75_1103 316
957 3300050491 nmdc:mga00v17_9707_c1 nmdc:mga00v17_9707_c1_1500_2528 316
958 3300053087 Ga0500643_000285 Ga0500643_000285_8029_9057 316
959 3300059491 Ga0587070_010073 Ga0587070_010073_339_1370 316
960 3300060353 Ga0501082_0010928 Ga0501082_0010928_6210_7238 316
961 iso_pu_bacteria 2643221962 2645723160 316
962 3300001976 JGI24752J21851_1007622 JGI24752J21851_10076221 317
963 3300001991 JGI24743J22301_10013855 JGI24743J22301_100138552 317
964 3300002067 JGI24735J21928_10007685 JGI24735J21928_100076853 317
965 3300002459 JGI24751J29686_10003815 JGI24751J29686_100038153 317
966 3300003911 JGI25405J52794_10005273 JGI25405J52794_100052731 317
967 3300005330 Ga0070690_100047382 Ga0070690_1000473821 317
968 3300005330 Ga0070690_100196649 Ga0070690_1001966492 317
969 3300005331 Ga0070670_100030908 Ga0070670_1000309083 317
970 3300005334 Ga0068869_100030699 Ga0068869_1000306993 317
971 3300005334 Ga0068869_100074482 Ga0068869_1000744822 317
972 3300005334 Ga0068869_100119246 Ga0068869_1001192462 317
973 3300005335 Ga0070666_10073082 Ga0070666_100730822 317
974 3300005336 Ga0070680_100009182 Ga0070680_1000091823 317
975 3300005337 Ga0070682_100009892 Ga0070682_1000098923 317
976 3300005337 Ga0070682_100016882 Ga0070682_1000168823 317
977 3300005337 Ga0070682_100035642 Ga0070682_1000356422 317
978 3300005338 Ga0068868_100013718 Ga0068868_1000137184 317
979 3300005338 Ga0068868_100106370 Ga0068868_1001063702 317
980 3300005338 Ga0068868_100238572 Ga0068868_1002385722 317
981 3300005339 Ga0070660_100040808 Ga0070660_1000408082 317
982 3300005339 Ga0070660_100109366 Ga0070660_1001093661 317
983 3300005341 Ga0070691_10000722 Ga0070691_1000072212 317
984 3300005343 Ga0070687_100133163 Ga0070687_1001331632 317
985 3300005344 Ga0070661_100028126 Ga0070661_1000281262 317
986 3300005345 Ga0070692_10010386 Ga0070692_100103864 317
987 3300005354 Ga0070675_100002908 Ga0070675_1000029089 317
988 3300005355 Ga0070671_100003146 Ga0070671_1000031463 317
989 3300005355 Ga0070671_100065944 Ga0070671_1000659442 317
990 3300005355 Ga0070671_100179731 Ga0070671_1001797312 317
991 3300005364 Ga0070673_100056671 Ga0070673_1000566712 317
992 3300005364 Ga0070673_100170107 Ga0070673_1001701071 317
993 3300005366 Ga0070659_100020947 Ga0070659_1000209474 317
994 3300005366 Ga0070659_100025947 Ga0070659_1000259474 317
995 3300005367 Ga0070667_100004070 Ga0070667_1000040703 317
996 3300005434 Ga0070709_10025240 Ga0070709_100252403 317
997 3300005437 Ga0070710_10019318 Ga0070710_100193184 317
998 3300005438 Ga0070701_10147943 Ga0070701_101479432 317
999 3300005439 Ga0070711_100005401 Ga0070711_1000054013 317
1000 3300005440 Ga0070705_100016616 Ga0070705_1000166164 317
1001 3300005441 Ga0070700_100000088 Ga0070700_10000008830 317
1002 3300005441 Ga0070700_100095974 Ga0070700_1000959742 317
1003 3300005441 Ga0070700_100187527 Ga0070700_1001875271 317
1004 3300005444 Ga0070694_100021669 Ga0070694_1000216693 317
1005 3300005455 Ga0070663_100014373 Ga0070663_1000143733 317
1006 3300005455 Ga0070663_100033401 Ga0070663_1000334013 317
1007 3300005456 Ga0070678_100007800 Ga0070678_1000078005 317
1008 3300005457 Ga0070662_100038941 Ga0070662_1000389412 317
1009 3300005458 Ga0070681_10038502 Ga0070681_100385022 317
1010 3300005466 Ga0070685_10026552 Ga0070685_100265523 317
1011 3300005530 Ga0070679_100015824 Ga0070679_1000158245 317
1012 3300005539 Ga0068853_100088383 Ga0068853_1000883833 317
1013 3300005545 Ga0070695_100042770 Ga0070695_1000427701 317
1014 3300005547 Ga0070693_100000949 Ga0070693_10000094912 317
1015 3300005548 Ga0070665_100000754 Ga0070665_10000075432 317
1016 3300005548 Ga0070665_100059982 Ga0070665_1000599823 317
1017 3300005548 Ga0070665_100060493 Ga0070665_1000604932 317
1018 3300005549 Ga0070704_100015340 Ga0070704_1000153403 317
1019 3300005563 Ga0068855_100005880 Ga0068855_10000588016 317
1020 3300005564 Ga0070664_100295548 Ga0070664_1002955482 317
1021 3300005578 Ga0068854_100081701 Ga0068854_1000817013 317
1022 3300005578 Ga0068854_100265214 Ga0068854_1002652141 317
1023 3300005614 Ga0068856_100033582 Ga0068856_1000335823 317
1024 3300005614 Ga0068856_100218892 Ga0068856_1002188922 317
1025 3300005615 Ga0070702_100034700 Ga0070702_1000347003 317
1026 3300005618 Ga0068864_100256773 Ga0068864_1002567732 317
1027 3300005718 Ga0068866_10030200 Ga0068866_100302002 317
1028 3300005719 Ga0068861_100013361 Ga0068861_1000133613 317
1029 3300005719 Ga0068861_100298318 Ga0068861_1002983182 317
1030 3300005834 Ga0068851_10009913 Ga0068851_100099134 317
1031 3300005840 Ga0068870_10002118 Ga0068870_100021185 317
1032 3300005841 Ga0068863_100019674 Ga0068863_1000196742 317
1033 3300005842 Ga0068858_100056766 Ga0068858_1000567663 317
1034 3300005843 Ga0068860_100000134 Ga0068860_10000013426 317
1035 3300005843 Ga0068860_100059370 Ga0068860_1000593703 317
1036 3300005937 Ga0081455_10000873 Ga0081455_1000087313 317
1037 3300005937 Ga0081455_10004022 Ga0081455_1000402215 317
1038 3300005937 Ga0081455_10005694 Ga0081455_100056948 317
1039 3300005937 Ga0081455_10019705 Ga0081455_100197053 317
1040 3300005981 Ga0081538_10012412 Ga0081538_100124122 317
1041 3300005983 Ga0081540_1005619 Ga0081540_10056194 317
1042 3300006028 Ga0070717_10048671 Ga0070717_100486713 317
1043 3300006028 Ga0070717_10068708 Ga0070717_100687081 317
1044 3300006058 Ga0075432_10000164 Ga0075432_1000016415 317
1045 3300006058 Ga0075432_10000498 Ga0075432_100004987 317
1046 3300006163 Ga0070715_10039103 Ga0070715_100391031 317
1047 3300006173 Ga0070716_100008168 Ga0070716_1000081684 317
1048 3300006175 Ga0070712_100080245 Ga0070712_1000802453 317
1049 3300006358 Ga0068871_100019328 Ga0068871_1000193282 317
1050 3300006358 Ga0068871_100077986 Ga0068871_1000779862 317
1051 3300006844 Ga0075428_100006874 Ga0075428_10000687411 317
1052 3300006844 Ga0075428_100059055 Ga0075428_1000590555 317
1053 3300006844 Ga0075428_100370281 Ga0075428_1003702812 317
1054 3300006846 Ga0075430_100041963 Ga0075430_1000419632 317
1055 3300006847 Ga0075431_100034795 Ga0075431_1000347955 317
1056 3300006847 Ga0075431_100061483 Ga0075431_1000614833 317
1057 3300006847 Ga0075431_100066647 Ga0075431_1000666473 317
1058 3300006847 Ga0075431_100099008 Ga0075431_1000990083 317
1059 3300006852 Ga0075433_10000748 Ga0075433_1000074815 317
1060 3300006852 Ga0075433_10027215 Ga0075433_100272155 317
1061 3300006852 Ga0075433_10087726 Ga0075433_100877263 317
1062 3300006871 Ga0075434_100000896 Ga0075434_1000008964 317
1063 3300006871 Ga0075434_100004650 Ga0075434_1000046505 317
1064 3300006871 Ga0075434_100009071 Ga0075434_1000090713 317
1065 3300006871 Ga0075434_100018451 Ga0075434_1000184514 317
1066 3300006880 Ga0075429_100034994 Ga0075429_1000349943 317
1067 3300006914 Ga0075436_100005264 Ga0075436_1000052646 317
1068 3300007076 Ga0075435_100005715 Ga0075435_1000057153 317
1069 3300007076 Ga0075435_100020996 Ga0075435_1000209963 317
1070 3300007076 Ga0075435_100034802 Ga0075435_1000348021 317
1071 3300009094 Ga0111539_10012865 Ga0111539_100128653 317
1072 3300009098 Ga0105245_10014876 Ga0105245_100148762 317
1073 3300009098 Ga0105245_10194539 Ga0105245_101945391 317
1074 3300009101 Ga0105247_10002264 Ga0105247_100022645 317
1075 3300009101 Ga0105247_10048148 Ga0105247_100481483 317
1076 3300009147 Ga0114129_10026014 Ga0114129_100260142 317
1077 3300009148 Ga0105243_10095924 Ga0105243_100959242 317
1078 3300009174 Ga0105241_10064959 Ga0105241_100649592 317
1079 3300009176 Ga0105242_10083798 Ga0105242_100837983 317
1080 3300009176 Ga0105242_10099973 Ga0105242_100999732 317
1081 3300009545 Ga0105237_10113707 Ga0105237_101137071 317
1082 3300009551 Ga0105238_10040892 Ga0105238_100408921 317
1083 3300009551 Ga0105238_10411887 Ga0105238_104118871 317
1084 3300009553 Ga0105249_10007742 Ga0105249_100077423 317
1085 3300009553 Ga0105249_10022176 Ga0105249_100221763 317
1086 3300010375 Ga0105239_10055480 Ga0105239_100554804 317
1087 3300010375 Ga0105239_10067538 Ga0105239_100675382 317
1088 3300010375 Ga0105239_10207288 Ga0105239_102072881 317
1089 3300010375 Ga0105239_10226594 Ga0105239_102265943 317
1090 3300010375 Ga0105239_10735706 Ga0105239_107357061 317
1091 3300011119 Ga0105246_10002299 Ga0105246_100022993 317
1092 3300011119 Ga0105246_10108764 Ga0105246_101087642 317
1093 3300013102 Ga0157371_10016243 Ga0157371_100162433 317
1094 3300013104 Ga0157370_10131468 Ga0157370_101314682 317
1095 3300013297 Ga0157378_10115467 Ga0157378_101154672 317
1096 3300013306 Ga0163162_10113028 Ga0163162_101130283 317
1097 3300013307 Ga0157372_10056369 Ga0157372_100563694 317
1098 3300013308 Ga0157375_10012428 Ga0157375_100124284 317
1099 3300013308 Ga0157375_10143155 Ga0157375_101431553 317
1100 3300014745 Ga0157377_10007380 Ga0157377_100073804 317
1101 3300014745 Ga0157377_10025279 Ga0157377_100252793 317
1102 3300014968 Ga0157379_10092311 Ga0157379_100923113 317
1103 3300017792 Ga0163161_10021892 Ga0163161_100218921 317
1104 3300017792 Ga0163161_10028584 Ga0163161_100285842 317
1105 3300020069 Ga0197907_10657334 Ga0197907_106573344 317
1106 3300020081 Ga0206354_10740334 Ga0206354_107403342 317
1107 3300021384 Ga0213876_10009192 Ga0213876_100091922 317
1108 3300022467 Ga0224712_10024184 Ga0224712_100241841 317
1109 3300025321 Ga0207656_10029262 Ga0207656_100292622 317
1110 3300025885 Ga0207653_10012992 Ga0207653_100129923 317
1111 3300025898 Ga0207692_10046842 Ga0207692_100468422 317
1112 3300025899 Ga0207642_10159351 Ga0207642_101593511 317
1113 3300025900 Ga0207710_10025344 Ga0207710_100253442 317
1114 3300025901 Ga0207688_10031128 Ga0207688_100311282 317
1115 3300025903 Ga0207680_10003699 Ga0207680_100036996 317
1116 3300025903 Ga0207680_10037859 Ga0207680_100378592 317
1117 3300025904 Ga0207647_10043315 Ga0207647_100433152 317
1118 3300025905 Ga0207685_10026716 Ga0207685_100267161 317
1119 3300025907 Ga0207645_10063793 Ga0207645_100637933 317
1120 3300025908 Ga0207643_10001031 Ga0207643_1000103112 317
1121 3300025910 Ga0207684_10095023 Ga0207684_100950232 317
1122 3300025911 Ga0207654_10053213 Ga0207654_100532132 317
1123 3300025912 Ga0207707_10019141 Ga0207707_100191412 317
1124 3300025914 Ga0207671_10154310 Ga0207671_101543102 317
1125 3300025915 Ga0207693_10003490 Ga0207693_100034903 317
1126 3300025917 Ga0207660_10023557 Ga0207660_100235572 317
1127 3300025918 Ga0207662_10079527 Ga0207662_100795272 317
1128 3300025918 Ga0207662_10190397 Ga0207662_101903972 317
1129 3300025919 Ga0207657_10007056 Ga0207657_1000705612 317
1130 3300025919 Ga0207657_10019848 Ga0207657_100198485 317
1131 3300025920 Ga0207649_10001439 Ga0207649_1000143911 317
1132 3300025921 Ga0207652_10006279 Ga0207652_100062799 317
1133 3300025924 Ga0207694_10144753 Ga0207694_101447532 317
1134 3300025924 Ga0207694_10364629 Ga0207694_103646292 317
1135 3300025925 Ga0207650_10001708 Ga0207650_1000170811 317
1136 3300025926 Ga0207659_10004891 Ga0207659_100048917 317
1137 3300025927 Ga0207687_10014575 Ga0207687_100145751 317
1138 3300025927 Ga0207687_10023909 Ga0207687_100239094 317
1139 3300025929 Ga0207664_10490346 Ga0207664_104903461 317
1140 3300025931 Ga0207644_10008552 Ga0207644_100085525 317
1141 3300025931 Ga0207644_10027123 Ga0207644_100271233 317
1142 3300025933 Ga0207706_10007413 Ga0207706_100074135 317
1143 3300025933 Ga0207706_10014789 Ga0207706_100147894 317
1144 3300025933 Ga0207706_10040185 Ga0207706_100401853 317
1145 3300025934 Ga0207686_10037556 Ga0207686_100375563 317
1146 3300025935 Ga0207709_10058260 Ga0207709_100582601 317
1147 3300025939 Ga0207665_10003841 Ga0207665_100038417 317
1148 3300025940 Ga0207691_10024380 Ga0207691_100243803 317
1149 3300025941 Ga0207711_10093727 Ga0207711_100937271 317
1150 3300025942 Ga0207689_10001114 Ga0207689_100011147 317
1151 3300025942 Ga0207689_10200272 Ga0207689_102002721 317
1152 3300025944 Ga0207661_10002442 Ga0207661_100024428 317
1153 3300025945 Ga0207679_10002060 Ga0207679_100020602 317
1154 3300025961 Ga0207712_10021186 Ga0207712_100211862 317
1155 3300025961 Ga0207712_10251047 Ga0207712_102510472 317
1156 3300025972 Ga0207668_10008633 Ga0207668_100086334 317
1157 3300025972 Ga0207668_10054162 Ga0207668_100541622 317
1158 3300025981 Ga0207640_10072221 Ga0207640_100722213 317
1159 3300025981 Ga0207640_10215362 Ga0207640_102153622 317
1160 3300025986 Ga0207658_10035711 Ga0207658_100357112 317
1161 3300026023 Ga0207677_10006208 Ga0207677_100062084 317
1162 3300026023 Ga0207677_10033552 Ga0207677_100335523 317
1163 3300026023 Ga0207677_10082792 Ga0207677_100827922 317
1164 3300026035 Ga0207703_10050431 Ga0207703_100504313 317
1165 3300026041 Ga0207639_10027963 Ga0207639_100279634 317
1166 3300026041 Ga0207639_10090405 Ga0207639_100904053 317
1167 3300026041 Ga0207639_10394033 Ga0207639_103940332 317
1168 3300026067 Ga0207678_10005283 Ga0207678_100052835 317
1169 3300026067 Ga0207678_10022460 Ga0207678_100224604 317
1170 3300026067 Ga0207678_10097563 Ga0207678_100975632 317
1171 3300026075 Ga0207708_10000079 Ga0207708_1000007970 317
1172 3300026075 Ga0207708_10040962 Ga0207708_100409622 317
1173 3300026075 Ga0207708_10041659 Ga0207708_100416592 317
1174 3300026078 Ga0207702_10003467 Ga0207702_1000346711 317
1175 3300026078 Ga0207702_10007249 Ga0207702_100072495 317
1176 3300026078 Ga0207702_10065014 Ga0207702_100650142 317
1177 3300026078 Ga0207702_10079263 Ga0207702_100792633 317
1178 3300026078 Ga0207702_10244375 Ga0207702_102443752 317
1179 3300026088 Ga0207641_10007288 Ga0207641_100072885 317
1180 3300026095 Ga0207676_10001689 Ga0207676_1000168912 317
1181 3300026095 Ga0207676_10024112 Ga0207676_100241123 317
1182 3300026118 Ga0207675_100005587 Ga0207675_1000055874 317
1183 3300026118 Ga0207675_100071254 Ga0207675_1000712543 317
1184 3300026118 Ga0207675_100098146 Ga0207675_1000981463 317
1185 3300026118 Ga0207675_100246196 Ga0207675_1002461961 317
1186 3300026121 Ga0207683_10002016 Ga0207683_1000201614 317
1187 3300026121 Ga0207683_10064724 Ga0207683_100647243 317
1188 3300026142 Ga0207698_10005452 Ga0207698_100054524 317
1189 3300027907 Ga0207428_10001703 Ga0207428_1000170315 317
1190 3300027907 Ga0207428_10004857 Ga0207428_100048576 317
1191 3300027907 Ga0207428_10004938 Ga0207428_100049385 317
1192 3300027907 Ga0207428_10074534 Ga0207428_100745342 317
1193 3300028379 Ga0268266_10007568 Ga0268266_100075688 317
1194 3300028381 Ga0268264_10000206 Ga0268264_1000020693 317
1195 3300028381 Ga0268264_10129225 Ga0268264_101292252 317
1196 3300028381 Ga0268264_10434983 Ga0268264_104349831 317
1197 3300028381 Ga0268264_10452264 Ga0268264_104522642 317
1198 3300028794 Ga0307515_10016003 Ga0307515_100160033 317
1199 3300030521 Ga0307511_10000622 Ga0307511_1000062218 317
1200 3300030522 Ga0307512_10088690 Ga0307512_100886903 317
1201 3300031548 Ga0307408_100009663 Ga0307408_1000096635 317
1202 3300031731 Ga0307405_10001256 Ga0307405_100012564 317
1203 3300031824 Ga0307413_10011099 Ga0307413_100110992 317
1204 3300031852 Ga0307410_10001264 Ga0307410_1000126411 317
1205 3300031852 Ga0307410_10005638 Ga0307410_100056386 317
1206 3300031852 Ga0307410_10283180 Ga0307410_102831801 317
1207 3300031901 Ga0307406_10001047 Ga0307406_1000104712 317
1208 3300031901 Ga0307406_10018591 Ga0307406_100185913 317
1209 3300031901 Ga0307406_10040156 Ga0307406_100401563 317
1210 3300031901 Ga0307406_10058828 Ga0307406_100588283 317
1211 3300031903 Ga0307407_10000253 Ga0307407_1000025314 317
1212 3300031911 Ga0307412_10010395 Ga0307412_100103953 317
1213 3300031995 Ga0307409_100000147 Ga0307409_10000014715 317
1214 3300031995 Ga0307409_100194383 Ga0307409_1001943831 317
1215 3300032002 Ga0307416_100000096 Ga0307416_10000009612 317
1216 3300032002 Ga0307416_100026971 Ga0307416_1000269713 317
1217 3300032005 Ga0307411_10011885 Ga0307411_100118853 317
1218 3300032005 Ga0307411_10046650 Ga0307411_100466501 317
1219 3300032126 Ga0307415_100002748 Ga0307415_1000027488 317
1220 3300032126 Ga0307415_100185743 Ga0307415_1001857431 317
1221 3300033180 Ga0307510_10051130 Ga0307510_100511301 317
1222 3300034957 Ga0373938_0032708 Ga0373938_0032708_76_1107 317
1223 3300035091 Ga0373951_0011909 Ga0373951_0011909_478_1506 317
1224 3300035114 Ga0373939_0026490 Ga0373939_0026490_130_1158 317
1225 3300035171 Ga0373946_0037040 Ga0373946_0037040_869_1900 317
1226 3300035207 Ga0373942_0021099 Ga0373942_0021099_463_1491 317
1227 3300035241 Ga0373961_0018750 Ga0373961_0018750_235_1263 317
1228 3300035242 Ga0373962_0004504 Ga0373962_0004504_2139_3167 317
1229 3300037471 Ga0395905_0021363 Ga0395905_0021363_4462_5475 317
1230 3300037853 Ga0436364_0132104 Ga0436364_0132104_2242_3276 317
1231 3300037853 Ga0436364_1519328 Ga0436364_1519328_1456_2469 317
1232 3300038443 Ga0395901_0145868 Ga0395901_0145868_1419_2432 317
1233 3300044683 Ga0466965_0161680 Ga0466965_0161680_84_1130 317
1234 3300044684 Ga0466966_0014054 Ga0466966_0014054_1594_2622 317
1235 3300044693 Ga0466961_0012501 Ga0466961_0012501_1918_2931 317
1236 3300044693 Ga0466961_0059196 Ga0466961_0059196_1076_2107 317
1237 3300044693 Ga0466961_0062550 Ga0466961_0062550_312_1340 317
1238 3300044693 Ga0466961_0148278 Ga0466961_0148278_256_1293 317
1239 3300044693 Ga0466961_0195877 Ga0466961_0195877_132_1178 317
1240 3300044694 Ga0466963_0031995 Ga0466963_0031995_596_1624 317
1241 3300044694 Ga0466963_0184063 Ga0466963_0184063_351_1379 317
1242 3300044694 Ga0466963_0202789 Ga0466963_0202789_46_1074 317
1243 3300044694 Ga0466963_0249901 Ga0466963_0249901_195_1223 317
1244 3300044706 Ga0466964_0035553 Ga0466964_0035553_357_1385 317
1245 3300044765 Ga0466970_0007824 Ga0466970_0007824_42_1055 317
1246 3300044842 Ga0466957_0066658 Ga0466957_0066658_47_1075 317
1247 3300044901 Ga0466960_0024185 Ga0466960_0024185_304_1350 317
1248 3300045049 Ga0466959_0012810 Ga0466959_0012810_4330_5343 317
1249 3300045049 Ga0466959_0068943 Ga0466959_0068943_395_1423 317
1250 3300045049 Ga0466959_0150714 Ga0466959_0150714_397_1434 317
1251 3300045049 Ga0466959_0180620 Ga0466959_0180620_19_1047 317
1252 3300045836 Ga0466958_0007658 Ga0466958_0007658_3154_4182 317
1253 3300045836 Ga0466958_0045020 Ga0466958_0045020_62_1090 317
1254 3300045836 Ga0466958_0104555 Ga0466958_0104555_448_1485 317
1255 3300045836 Ga0466958_0130492 Ga0466958_0130492_497_1528 317
1256 3300045976 Ga0466967_0007515 Ga0466967_0007515_72_1100 317
1257 3300045976 Ga0466967_0010973 Ga0466967_0010973_254_1282 317
1258 3300045976 Ga0466967_0064319 Ga0466967_0064319_2201_3238 317
1259 3300045976 Ga0466967_0069869 Ga0466967_0069869_219_1247 317
1260 3300045976 Ga0466967_0468838 Ga0466967_0468838_51_1079 317
1261 3300046690 Ga0495624_0101773 Ga0495624_0101773_695_1723 317
1262 3300048903 Ga0496100_0094009 Ga0496100_0094009_714_1742 317
1263 3300048904 Ga0496101_0060077 Ga0496101_0060077_418_1446 317
1264 3300048905 Ga0496102_0004562 Ga0496102_0004562_8683_9696 317
1265 3300048906 Ga0496103_0077445 Ga0496103_0077445_581_1609 317
1266 3300048907 Ga0496104_0002039 Ga0496104_0002039_3538_4551 317
1267 3300048907 Ga0496104_0013081 Ga0496104_0013081_4950_5978 317
1268 3300048908 Ga0496105_0004304 Ga0496105_0004304_6036_7049 317
1269 3300048908 Ga0496105_0078654 Ga0496105_0078654_816_1844 317
1270 3300048909 Ga0496106_0010733 Ga0496106_0010733_2568_3581 317
1271 3300048910 Ga0496107_0046180 Ga0496107_0046180_1925_2938 317
1272 3300048911 Ga0496108_0003215 Ga0496108_0003215_2549_3577 317
1273 3300048911 Ga0496108_0005025 Ga0496108_0005025_6036_7049 317
1274 3300048911 Ga0496108_0043434 Ga0496108_0043434_1298_2326 317
1275 3300048912 Ga0496109_0017008 Ga0496109_0017008_2764_3792 317
1276 3300048912 Ga0496109_0026938 Ga0496109_0026938_3731_4759 317
1277 3300048913 Ga0496110_0005654 Ga0496110_0005654_8375_9388 317
1278 3300048913 Ga0496110_0009807 Ga0496110_0009807_3551_4579 317
1279 3300048914 Ga0496111_0001007 Ga0496111_0001007_10661_11674 317
1280 3300048914 Ga0496111_0014929 Ga0496111_0014929_2692_3720 317
1281 3300048914 Ga0496111_0190053 Ga0496111_0190053_286_1314 317
1282 3300048915 Ga0496112_0049018 Ga0496112_0049018_1964_2992 317
1283 3300048915 Ga0496112_0068652 Ga0496112_0068652_1225_2238 317
1284 3300048917 Ga0496114_0189083 Ga0496114_0189083_579_1592 317
1285 3300048918 Ga0496115_0106044 Ga0496115_0106044_1229_2257 317
1286 3300049568 Ga0501031_0023230 Ga0501031_0023230_2810_3841 317
1287 3300049569 Ga0501032_0013108 Ga0501032_0013108_1772_2803 317
1288 3300049574 Ga0501038_0026722 Ga0501038_0026722_14_1045 317
1289 3300049579 Ga0501043_0035628 Ga0501043_0035628_26_1057 317
1290 3300049580 Ga0501046_0192666 Ga0501046_0192666_91_1122 317
1291 3300049581 Ga0501047_0017379 Ga0501047_0017379_2689_3720 317
1292 3300049582 Ga0501048_0013474 Ga0501048_0013474_991_2022 317
1293 3300050507 nmdc:mga05p37_338571_c1 nmdc:mga05p37_338571_c1_398_1411 317
1294 3300050507 nmdc:mga05p37_7095_c1 nmdc:mga05p37_7095_c1_4830_5849 317
1295 3300050508 nmdc:mga09592_41710_c1 nmdc:mga09592_41710_c1_1687_2700 317
1296 3300050510 nmdc:mga06r32_56136_c1 nmdc:mga06r32_56136_c1_1742_2866 317
1297 3300050511 nmdc:mga08y16_8872_c1 nmdc:mga08y16_8872_c1_3724_4737 317
1298 3300050512 nmdc:mga0n895_108726_c1 nmdc:mga0n895_108726_c1_1155_2183 317
1299 3300050512 nmdc:mga0n895_116830_c1 nmdc:mga0n895_116830_c1_170_1183 317
1300 3300050513 nmdc:mga0rr50_7151_c1 nmdc:mga0rr50_7151_c1_1928_2941 317
1301 3300050514 nmdc:mga08x19_3108_c1 nmdc:mga08x19_3108_c1_6935_7948 317
1302 3300050515 nmdc:mga0a205_9144_c1 nmdc:mga0a205_9144_c1_3866_4879 317
1303 3300061719 Ga0466962_0005614 Ga0466962_0005614_2951_3979 317
1304 3300061719 Ga0466962_0024254 Ga0466962_0024254_278_1306 317
1305 3300061719 Ga0466962_0141248 Ga0466962_0141248_34_1062 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01450

IlvC

Acetohydroxy acid isomeroreductase, catalytic domain

171

314

0.99

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

11

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kpq-assembly1.cif.gz_A crystal structure of ctde in complex with fad 0.9648 19 46
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9574 19 46
1zx9-assembly1.cif.gz_A crystal structure of tn501 mera 0.9547 20 46
2ivd-assembly2.cif.gz_B structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen 0.9535 20 46
3i3l-assembly1.cif.gz_A crystal structure of cmls, a flavin-dependent halogenase 0.9405 19 46
ID Description Score Start End Superfamily
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9967 1 183 3.40.50.720
af_P9WKJ7_1_183_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9913 1 183 3.40.50.720
4xehA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9745 3 183 3.40.50.720
4xehA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9692 3 183 3.40.50.720
af_Q54BK7_6_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9649 21 46 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A837GNI2-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 1.003 6 78 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A0Q0BUF5-F1-model_v4 Ketol-acid reductoisomerase 0.9988 6 78 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A7X3PML5-F1-model_v4 Ketol-acid reductoisomerase (EC 1.1.1.86) 0.9969 4 181 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853
AF-A0A2E0NNX8-F1-model_v4 deleted 0.9968 6 87
AF-A0A7K3B7V4-F1-model_v4 Ketol-acid reductoisomerase 0.9963 3 93 GO:0004455
GO:0005829
GO:0009097
GO:0009099
GO:0016853

Feature Viewer

pLDDT pTM Quality
90.99 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map