F492759
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1301 | 578 | 1168 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100258553|Ga0307408_1002585532 |
| Length | 264 |
| Sequence | MTDLIAIVRDNWLLLLVGQYPNGPLGGLACTLILSILGIVLAFPLSVLVALARLSRWRLLNWPATALVYGARGIPLLLIILWVYFLVPVLIGRNVTGFTTMVCTLVIYESAFLAEVVRAGILALPSGQMEAARALGHGYLGAMWYVILPQALYNMLPSMLSQFVSTIKETTLGYVINVPELTFAASQINNQLLTKPFHVFFLLAVMYFILCWSLTQLAGWLERRIAAKRSGAGAARQVADAENAVISPIATDRPLATASTRQLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 4 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 5 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 6 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 7 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 8 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 11 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 12 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 13 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 14 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 15 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 16 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 17 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 18 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 19 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 20 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 21 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 22 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 23 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 24 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 25 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 26 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 27 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 28 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 29 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 30 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 31 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 32 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 33 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 34 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 35 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 36 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 37 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 38 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 39 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 40 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 41 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 42 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 43 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 44 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 45 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 46 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 47 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 48 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 49 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 50 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 51 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 52 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 53 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 54 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 55 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 56 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 57 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 58 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 59 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 60 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 61 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 62 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 63 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 64 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 65 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 66 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 67 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 68 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 69 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 70 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 71 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 72 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 73 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 74 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 75 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 76 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 77 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 78 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 79 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 80 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 81 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 82 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 83 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 84 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 85 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 86 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 87 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 88 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 89 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 90 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 91 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 92 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 93 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 94 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 95 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 96 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 97 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 98 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 99 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 100 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 101 | 2941479691 | |||
| 102 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 103 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 104 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 105 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 106 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 107 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 108 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 109 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 110 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 111 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 112 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 113 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 114 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 115 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 116 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 117 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 118 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 119 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 120 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 121 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 122 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 123 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 124 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 125 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 126 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 127 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 128 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 129 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 130 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 131 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 132 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 133 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 134 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 135 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 136 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 137 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 138 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 139 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 140 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 141 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 142 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 143 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 144 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 148 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 150 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 151 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 153 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 169 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 175 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 178 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 180 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 181 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 182 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 183 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 184 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 185 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 186 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 187 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 188 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 189 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 190 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 191 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 192 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 193 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 194 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 197 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 198 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 199 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 200 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 202 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 203 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 204 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 206 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 207 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 208 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 224 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 225 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 229 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 233 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 236 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 237 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 238 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 239 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 241 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 242 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 243 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 244 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 245 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 246 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 253 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 254 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 255 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 257 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 258 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 259 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 260 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 262 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 265 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 268 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 319 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 320 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 321 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 323 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 325 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 329 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 330 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 331 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 332 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 333 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 334 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 335 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 336 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 337 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 338 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 339 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 340 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 341 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 342 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 343 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 344 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 345 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 346 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 347 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 348 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 349 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 350 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 351 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 352 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 353 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 354 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 355 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 356 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 357 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 358 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 359 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 360 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 361 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 362 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 363 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 364 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 365 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 366 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 367 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 368 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 369 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 370 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 375 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 376 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 377 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 378 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 379 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 380 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 381 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 382 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 383 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 384 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 385 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 386 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 387 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 388 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 389 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 390 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 391 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 392 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 393 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 394 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 395 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 396 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 397 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 398 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 399 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 400 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 401 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 402 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 403 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 404 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 405 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 406 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 407 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 408 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 409 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 410 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 411 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 412 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 413 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 414 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 415 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 497 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 498 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 499 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 500 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 501 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 502 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 503 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 504 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 505 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 506 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 507 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 508 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 509 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 510 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 511 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 512 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 513 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 514 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 515 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 516 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 517 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 523 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 524 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 525 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 526 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 527 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 528 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 529 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 530 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 531 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 532 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 533 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 534 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 536 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 537 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 539 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 540 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 541 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 542 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 543 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 544 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 545 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 547 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 548 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 549 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 550 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 551 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 552 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 553 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 554 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 555 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 556 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 557 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 558 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 559 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 560 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 561 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 562 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 563 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 564 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 565 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 566 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 567 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 568 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 569 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 570 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 571 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 572 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 573 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 574 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 575 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 576 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 577 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 578 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.85 |
| Metatranscriptomes | 0.08 |
| Isolates | 10.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.98 |
| Nodule | 2.84 |
| Rhizoplane | 2.54 |
| Rhizosphere | 52.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3866527 | 2162886007 | Bacteria | 1768 |
| 2 | JGI24739J22299_10000884 | 3300001989 | Bacteria | 11069 |
| 3 | JGI24739J22299_10008256 | 3300001989 | Bacteria | 3886 |
| 4 | JGI24739J22299_10050406 | 3300001989 | Bacteria | 1346 |
| 5 | JGI24737J22298_10022393 | 3300001990 | Bacteria | 2008 |
| 6 | JGI24735J21928_10001089 | 3300002067 | Bacteria | 9706 |
| 7 | JGI25155J39150_1000334 | 3300002704 | Bacteria | 15216 |
| 8 | JGI25156J39149_1001160 | 3300002705 | Bacteria | 11788 |
| 9 | JGI25156J39149_1008436 | 3300002705 | Bacteria | 2596 |
| 10 | JGI25154J39366_1000262 | 3300002738 | Bacteria | 33718 |
| 11 | JGI25158J39367_1004694 | 3300002739 | Bacteria | 2041 |
| 12 | JGI25152J39213_1000073 | 3300002773 | Bacteria | 66515 |
| 13 | JGI25152J39213_1001016 | 3300002773 | Bacteria | 13497 |
| 14 | JGI25152J39213_1003342 | 3300002773 | Bacteria | 5514 |
| 15 | JGI25152J39213_1017840 | 3300002773 | Bacteria | 1327 |
| 16 | JGI25150J39212_1000062 | 3300002774 | Bacteria | 64560 |
| 17 | JGI25150J39212_1005437 | 3300002774 | Bacteria | 2719 |
| 18 | JGI25150J39212_1005624 | 3300002774 | Bacteria | 2658 |
| 19 | JGI25159J45721_1000058 | 3300002987 | Bacteria | 53410 |
| 20 | JGI25159J45721_1001730 | 3300002987 | Bacteria | 8804 |
| 21 | JGI25159J45721_1003524 | 3300002987 | Bacteria | 5514 |
| 22 | JGI25159J45721_1007582 | 3300002987 | Bacteria | 3090 |
| 23 | JGI25151J46595_10000255 | 3300003187 | Bacteria | 62389 |
| 24 | JGI25151J46595_10000262 | 3300003187 | Bacteria | 61170 |
| 25 | JGI25151J46595_10001460 | 3300003187 | Bacteria | 16029 |
| 26 | JGI25151J46595_10004189 | 3300003187 | Bacteria | 7686 |
| 27 | JGI25151J46595_10007131 | 3300003187 | Bacteria | 5514 |
| 28 | JGI25151J46595_10033571 | 3300003187 | Bacteria | 1975 |
| 29 | JGI25153J46596_10000151 | 3300003215 | Bacteria | 70139 |
| 30 | JGI25153J46596_10000165 | 3300003215 | Bacteria | 66515 |
| 31 | JGI25153J46596_10007202 | 3300003215 | Bacteria | 5514 |
| 32 | JGI25153J46596_10044762 | 3300003215 | Bacteria | 1327 |
| 33 | rootH2_10050129 | 3300003320 | Bacteria | 1665 |
| 34 | rootH2_10059852 | 3300003320 | Bacteria | 1131 |
| 35 | rootL2_10034467 | 3300003322 | Bacteria | 2223 |
| 36 | rootL2_10050359 | 3300003322 | Bacteria | 1231 |
| 37 | rootL2_10143669 | 3300003322 | Bacteria | 3096 |
| 38 | rootH1_10107676 | 3300003323 | Bacteria | 1966 |
| 39 | rootH1_10401376 | 3300003323 | Bacteria | 1736 |
| 40 | JGI25160J50197_1000181 | 3300003354 | Bacteria | 53411 |
| 41 | JGI25160J50197_1005126 | 3300003354 | Bacteria | 5514 |
| 42 | JGI25160J50197_1011694 | 3300003354 | Bacteria | 3090 |
| 43 | JGI25161J50226_1000145 | 3300003374 | Bacteria | 49306 |
| 44 | JGI25161J50226_1002037 | 3300003374 | Bacteria | 5502 |
| 45 | JGI25161J50226_1006710 | 3300003374 | Bacteria | 2042 |
| 46 | Ga0006562J51391_1082376 | 3300003578 | Bacteria | 1700 |
| 47 | Ga0055538_1000051 | 3300003751 | Bacteria | 129958 |
| 48 | Ga0055539_1000076 | 3300003752 | Bacteria | 129958 |
| 49 | Ga0055533_1000082 | 3300003756 | Bacteria | 129958 |
| 50 | Ga0055533_1008674 | 3300003756 | Bacteria | 1262 |
| 51 | Ga0055525_1000109 | 3300003759 | Bacteria | 129958 |
| 52 | Ga0055526_1000146 | 3300003771 | Bacteria | 62389 |
| 53 | Ga0055526_1001310 | 3300003771 | Bacteria | 17842 |
| 54 | Ga0055526_1004888 | 3300003771 | Bacteria | 7896 |
| 55 | Ga0055526_1007739 | 3300003771 | Bacteria | 5514 |
| 56 | Ga0055537_1000024 | 3300003773 | Bacteria | 111410 |
| 57 | Ga0055537_1000090 | 3300003773 | Bacteria | 66515 |
| 58 | Ga0055537_1002874 | 3300003773 | Bacteria | 5514 |
| 59 | Ga0055537_1008855 | 3300003773 | Bacteria | 2276 |
| 60 | Ga0055537_1012606 | 3300003773 | Bacteria | 1638 |
| 61 | Ga0055524_1000195 | 3300003775 | Bacteria | 66515 |
| 62 | Ga0055524_1003526 | 3300003775 | Bacteria | 7565 |
| 63 | Ga0055524_1005712 | 3300003775 | Bacteria | 5514 |
| 64 | Ga0055536_1000113 | 3300003781 | Bacteria | 70340 |
| 65 | Ga0055536_1014327 | 3300003781 | Bacteria | 2796 |
| 66 | Ga0055536_1029422 | 3300003781 | Bacteria | 1476 |
| 67 | Ga0055536_1049137 | 3300003781 | Bacteria | 939 |
| 68 | Ga0055534_1000032 | 3300003784 | Bacteria | 118890 |
| 69 | Ga0055534_1000101 | 3300003784 | Bacteria | 66515 |
| 70 | Ga0055534_1001127 | 3300003784 | Bacteria | 11333 |
| 71 | Ga0055534_1001134 | 3300003784 | Bacteria | 11292 |
| 72 | Ga0055534_1003029 | 3300003784 | Bacteria | 5514 |
| 73 | Ga0055528_1000111 | 3300003790 | Bacteria | 66515 |
| 74 | Ga0055528_1000328 | 3300003790 | Bacteria | 39935 |
| 75 | Ga0055528_1039347 | 3300003790 | Bacteria | 1081 |
| 76 | Ga0055530_10003037 | 3300003791 | Bacteria | 10026 |
| 77 | Ga0055530_10005422 | 3300003791 | Bacteria | 6073 |
| 78 | Ga0055530_10005744 | 3300003791 | Bacteria | 5766 |
| 79 | Ga0055530_10013538 | 3300003791 | Bacteria | 2777 |
| 80 | Ga0055530_10037452 | 3300003791 | Bacteria | 1213 |
| 81 | Ga0055540_1000045 | 3300003792 | Bacteria | 152083 |
| 82 | Ga0055540_1006668 | 3300003792 | Bacteria | 4531 |
| 83 | Ga0055540_1011758 | 3300003792 | Bacteria | 2796 |
| 84 | Ga0055540_1012321 | 3300003792 | Bacteria | 2691 |
| 85 | Ga0055531_10000149 | 3300003794 | Bacteria | 80949 |
| 86 | Ga0055531_10001310 | 3300003794 | Bacteria | 18750 |
| 87 | Ga0055531_10002248 | 3300003794 | Bacteria | 13074 |
| 88 | Ga0055531_10004992 | 3300003794 | Bacteria | 7871 |
| 89 | Ga0055531_10019085 | 3300003794 | Bacteria | 2796 |
| 90 | Ga0055541_1000053 | 3300003841 | Bacteria | 129958 |
| 91 | Ga0055543_1000232 | 3300004625 | Bacteria | 44221 |
| 92 | Ga0055543_1002768 | 3300004625 | Bacteria | 5560 |
| 93 | Ga0055543_1006414 | 3300004625 | Bacteria | 2845 |
| 94 | Ga0065165_1000229 | 3300005262 | Bacteria | 98699 |
| 95 | Ga0065165_1000683 | 3300005262 | Bacteria | 48599 |
| 96 | Ga0065165_1000707 | 3300005262 | Bacteria | 47352 |
| 97 | Ga0065165_1007205 | 3300005262 | Bacteria | 5552 |
| 98 | Ga0065165_1086121 | 3300005262 | Bacteria | 808 |
| 99 | Ga0065714_10002413 | 3300005288 | Bacteria | 21651 |
| 100 | Ga0065714_10006056 | 3300005288 | Bacteria | 9266 |
| 101 | Ga0065714_10064788 | 3300005288 | Bacteria | 18794 |
| 102 | Ga0065714_10091146 | 3300005288 | Bacteria | 1919 |
| 103 | Ga0065714_10100060 | 3300005288 | Bacteria | 1672 |
| 104 | Ga0065704_10007833 | 3300005289 | Bacteria | 2842 |
| 105 | Ga0065704_10155909 | 3300005289 | Bacteria | 1391 |
| 106 | Ga0070658_10100066 | 3300005327 | Bacteria | 2396 |
| 107 | Ga0070676_10027658 | 3300005328 | Bacteria | 3218 |
| 108 | Ga0070683_100634969 | 3300005329 | Bacteria | 1022 |
| 109 | Ga0070677_10037564 | 3300005333 | Bacteria | 1890 |
| 110 | Ga0068869_100044913 | 3300005334 | Bacteria | 3179 |
| 111 | Ga0068869_100068719 | 3300005334 | Bacteria | 2618 |
| 112 | Ga0068869_100161450 | 3300005334 | Bacteria | 1745 |
| 113 | Ga0068869_100183386 | 3300005334 | Bacteria | 1642 |
| 114 | Ga0068869_100414763 | 3300005334 | Bacteria | 1110 |
| 115 | Ga0068869_100424591 | 3300005334 | Bacteria | 1097 |
| 116 | Ga0068868_100035446 | 3300005338 | Bacteria | 3857 |
| 117 | Ga0070660_100042053 | 3300005339 | Bacteria | 3486 |
| 118 | Ga0070660_100194430 | 3300005339 | Bacteria | 1644 |
| 119 | Ga0070689_100226629 | 3300005340 | Bacteria | 1535 |
| 120 | Ga0070661_100104326 | 3300005344 | Bacteria | 2112 |
| 121 | Ga0070669_100447370 | 3300005353 | Bacteria | 1064 |
| 122 | Ga0070675_100002236 | 3300005354 | Bacteria | 14369 |
| 123 | Ga0070675_100065901 | 3300005354 | Bacteria | 2995 |
| 124 | Ga0070675_100202229 | 3300005354 | Bacteria | 1724 |
| 125 | Ga0070675_100623740 | 3300005354 | Bacteria | 979 |
| 126 | Ga0070671_100061377 | 3300005355 | Bacteria | 3131 |
| 127 | Ga0070671_100304832 | 3300005355 | Bacteria | 1356 |
| 128 | Ga0070674_100233356 | 3300005356 | Bacteria | 1437 |
| 129 | Ga0070673_100014369 | 3300005364 | Bacteria | 5511 |
| 130 | Ga0070659_100170590 | 3300005366 | Bacteria | 1782 |
| 131 | Ga0070659_100252257 | 3300005366 | Bacteria | 1463 |
| 132 | Ga0070667_100100410 | 3300005367 | Bacteria | 2499 |
| 133 | Ga0070667_100604933 | 3300005367 | Bacteria | 1010 |
| 134 | Ga0070709_10000273 | 3300005434 | Bacteria | 33081 |
| 135 | Ga0070714_100005827 | 3300005435 | Bacteria | 9449 |
| 136 | Ga0070710_10000212 | 3300005437 | Bacteria | 27146 |
| 137 | Ga0070711_100005770 | 3300005439 | Bacteria | 7431 |
| 138 | Ga0070663_100087966 | 3300005455 | Bacteria | 2297 |
| 139 | Ga0070663_100149105 | 3300005455 | Bacteria | 1792 |
| 140 | Ga0070663_100162118 | 3300005455 | Bacteria | 1722 |
| 141 | Ga0070678_100499699 | 3300005456 | Bacteria | 1073 |
| 142 | Ga0070678_100547491 | 3300005456 | Bacteria | 1027 |
| 143 | Ga0070662_100128024 | 3300005457 | Bacteria | 1954 |
| 144 | Ga0070662_100174454 | 3300005457 | Bacteria | 1690 |
| 145 | Ga0070662_100420942 | 3300005457 | Bacteria | 1105 |
| 146 | Ga0068867_100008131 | 3300005459 | Bacteria | 7412 |
| 147 | Ga0068867_100220837 | 3300005459 | Bacteria | 1527 |
| 148 | Ga0070706_100002001 | 3300005467 | Bacteria | 20981 |
| 149 | Ga0070707_100050329 | 3300005468 | Bacteria | 3994 |
| 150 | Ga0070698_100058198 | 3300005471 | Bacteria | 3908 |
| 151 | Ga0070698_100671354 | 3300005471 | Bacteria | 978 |
| 152 | Ga0070699_100096827 | 3300005518 | Bacteria | 2585 |
| 153 | Ga0070679_100054296 | 3300005530 | Bacteria | 3988 |
| 154 | Ga0068853_100075902 | 3300005539 | Bacteria | 2934 |
| 155 | Ga0068853_100150267 | 3300005539 | Bacteria | 2096 |
| 156 | Ga0070672_100007481 | 3300005543 | Bacteria | 7416 |
| 157 | Ga0070672_100109110 | 3300005543 | Bacteria | 2254 |
| 158 | Ga0070672_100642816 | 3300005543 | Bacteria | 926 |
| 159 | Ga0070665_100009677 | 3300005548 | Bacteria | 9741 |
| 160 | Ga0070665_100047941 | 3300005548 | Bacteria | 4289 |
| 161 | Ga0070665_100313470 | 3300005548 | Bacteria | 1573 |
| 162 | Ga0070665_100432335 | 3300005548 | Bacteria | 1325 |
| 163 | Ga0068855_100014961 | 3300005563 | Bacteria | 9345 |
| 164 | Ga0068855_100024941 | 3300005563 | Bacteria | 7156 |
| 165 | Ga0068855_100046805 | 3300005563 | Bacteria | 5112 |
| 166 | Ga0068855_100212698 | 3300005563 | Bacteria | 2172 |
| 167 | Ga0068855_100461994 | 3300005563 | Bacteria | 1384 |
| 168 | Ga0070664_100014177 | 3300005564 | Bacteria | 6500 |
| 169 | Ga0070664_100047658 | 3300005564 | Bacteria | 3621 |
| 170 | Ga0068857_100010180 | 3300005577 | Bacteria | 8174 |
| 171 | Ga0068857_100246547 | 3300005577 | Bacteria | 1637 |
| 172 | Ga0068857_100593434 | 3300005577 | Bacteria | 1047 |
| 173 | Ga0068854_100059290 | 3300005578 | Bacteria | 2766 |
| 174 | Ga0068854_100063721 | 3300005578 | Bacteria | 2677 |
| 175 | Ga0068854_100373796 | 3300005578 | Bacteria | 1173 |
| 176 | Ga0068856_100476594 | 3300005614 | Bacteria | 1269 |
| 177 | Ga0068856_100505105 | 3300005614 | Bacteria | 1230 |
| 178 | Ga0068852_100000685 | 3300005616 | Bacteria | 22196 |
| 179 | Ga0068852_100328895 | 3300005616 | Bacteria | 1486 |
| 180 | Ga0068852_100418916 | 3300005616 | Bacteria | 1321 |
| 181 | Ga0068859_100212786 | 3300005617 | Bacteria | 2020 |
| 182 | Ga0068864_100482027 | 3300005618 | Bacteria | 1191 |
| 183 | Ga0068863_100116157 | 3300005841 | Bacteria | 2550 |
| 184 | Ga0068858_100832898 | 3300005842 | Bacteria | 901 |
| 185 | Ga0068860_100003437 | 3300005843 | Bacteria | 16288 |
| 186 | Ga0068862_100091402 | 3300005844 | Bacteria | 2651 |
| 187 | Ga0075365_10060275 | 3300006038 | Bacteria | 2531 |
| 188 | Ga0075363_100033189 | 3300006048 | Bacteria | 2686 |
| 189 | Ga0075363_100051911 | 3300006048 | Bacteria | 2188 |
| 190 | Ga0075364_10004709 | 3300006051 | Bacteria | 7877 |
| 191 | Ga0075364_10028552 | 3300006051 | Bacteria | 3571 |
| 192 | Ga0075364_10057494 | 3300006051 | Bacteria | 2548 |
| 193 | Ga0075364_10165480 | 3300006051 | Bacteria | 1494 |
| 194 | Ga0075432_10011587 | 3300006058 | Bacteria | 2996 |
| 195 | Ga0075432_10043274 | 3300006058 | Bacteria | 1577 |
| 196 | Ga0075432_10070482 | 3300006058 | Bacteria | 1255 |
| 197 | Ga0075432_10111901 | 3300006058 | Bacteria | 1018 |
| 198 | Ga0070715_10032928 | 3300006163 | Bacteria | 2115 |
| 199 | Ga0070716_100002266 | 3300006173 | Bacteria | 8867 |
| 200 | Ga0070712_100025966 | 3300006175 | Bacteria | 3898 |
| 201 | Ga0075362_10000208 | 3300006177 | Bacteria | 16362 |
| 202 | Ga0075362_10006362 | 3300006177 | Bacteria | 4401 |
| 203 | Ga0075362_10009615 | 3300006177 | Bacteria | 3746 |
| 204 | Ga0075362_10013681 | 3300006177 | Bacteria | 3255 |
| 205 | Ga0075362_10033080 | 3300006177 | Bacteria | 2247 |
| 206 | Ga0075362_10053163 | 3300006177 | Bacteria | 1817 |
| 207 | Ga0075362_10186859 | 3300006177 | Bacteria | 1005 |
| 208 | Ga0075367_10029978 | 3300006178 | Bacteria | 3115 |
| 209 | Ga0075367_10043998 | 3300006178 | Bacteria | 2615 |
| 210 | Ga0075367_10080453 | 3300006178 | Bacteria | 1971 |
| 211 | Ga0075367_10108540 | 3300006178 | Bacteria | 1702 |
| 212 | Ga0075369_10000489 | 3300006186 | Bacteria | 12265 |
| 213 | Ga0075369_10013822 | 3300006186 | Bacteria | 3213 |
| 214 | Ga0075366_10000903 | 3300006195 | Bacteria | 14366 |
| 215 | Ga0075366_10002875 | 3300006195 | Bacteria | 8929 |
| 216 | Ga0075366_10006394 | 3300006195 | Bacteria | 6455 |
| 217 | Ga0075366_10011740 | 3300006195 | Bacteria | 4952 |
| 218 | Ga0075366_10021430 | 3300006195 | Bacteria | 3755 |
| 219 | Ga0075366_10039721 | 3300006195 | Bacteria | 2781 |
| 220 | Ga0075366_10056113 | 3300006195 | Bacteria | 2339 |
| 221 | Ga0075366_10068257 | 3300006195 | Bacteria | 2115 |
| 222 | Ga0075366_10068393 | 3300006195 | Bacteria | 2113 |
| 223 | Ga0075366_10094136 | 3300006195 | Bacteria | 1796 |
| 224 | Ga0075366_10129714 | 3300006195 | Bacteria | 1521 |
| 225 | Ga0075366_10197337 | 3300006195 | Bacteria | 1223 |
| 226 | Ga0097621_100236848 | 3300006237 | Bacteria | 1595 |
| 227 | Ga0097621_100288772 | 3300006237 | Bacteria | 1445 |
| 228 | Ga0097621_100297213 | 3300006237 | Bacteria | 1425 |
| 229 | Ga0075370_10000837 | 3300006353 | Bacteria | 12436 |
| 230 | Ga0075370_10019416 | 3300006353 | Bacteria | 3702 |
| 231 | Ga0075370_10025648 | 3300006353 | Bacteria | 3262 |
| 232 | Ga0075370_10033785 | 3300006353 | Bacteria | 2865 |
| 233 | Ga0075370_10046452 | 3300006353 | Bacteria | 2457 |
| 234 | Ga0075370_10071807 | 3300006353 | Bacteria | 1981 |
| 235 | Ga0075370_10088581 | 3300006353 | Bacteria | 1784 |
| 236 | Ga0068871_100141221 | 3300006358 | Bacteria | 2048 |
| 237 | Ga0068871_100185673 | 3300006358 | Bacteria | 1789 |
| 238 | Ga0068871_100201548 | 3300006358 | Bacteria | 1718 |
| 239 | Ga0068871_100364000 | 3300006358 | Bacteria | 1281 |
| 240 | Ga0068865_100274460 | 3300006881 | Bacteria | 1340 |
| 241 | Ga0097620_100212794 | 3300006931 | Bacteria | 2020 |
| 242 | Ga0099823_1069269 | 3300006944 | Bacteria | 1606 |
| 243 | Ga0079104_1000014 | 3300006946 | Bacteria | 337362 |
| 244 | Ga0099826_10000060 | 3300006948 | Bacteria | 63334 |
| 245 | Ga0099826_10190731 | 3300006948 | Bacteria | 1131 |
| 246 | Ga0105251_10000496 | 3300009011 | Bacteria | 37267 |
| 247 | Ga0105244_10010597 | 3300009036 | Bacteria | 5576 |
| 248 | Ga0105244_10018258 | 3300009036 | Bacteria | 3939 |
| 249 | Ga0105244_10139950 | 3300009036 | Bacteria | 1164 |
| 250 | Ga0105240_10001617 | 3300009093 | Bacteria | 38199 |
| 251 | Ga0105240_10029724 | 3300009093 | Bacteria | 7111 |
| 252 | Ga0105240_10125834 | 3300009093 | Bacteria | 3080 |
| 253 | Ga0111539_10933917 | 3300009094 | Bacteria | 1009 |
| 254 | Ga0105245_10019045 | 3300009098 | Bacteria | 6007 |
| 255 | Ga0105245_10049156 | 3300009098 | Bacteria | 3775 |
| 256 | Ga0105245_10116403 | 3300009098 | Bacteria | 2492 |
| 257 | Ga0105245_10130847 | 3300009098 | Bacteria | 2353 |
| 258 | Ga0105245_10244713 | 3300009098 | Bacteria | 1740 |
| 259 | Ga0105247_10009542 | 3300009101 | Bacteria | 5889 |
| 260 | Ga0105247_10240481 | 3300009101 | Bacteria | 1233 |
| 261 | Ga0105243_10010819 | 3300009148 | Bacteria | 6904 |
| 262 | Ga0105243_10016506 | 3300009148 | Bacteria | 5582 |
| 263 | Ga0105243_10021385 | 3300009148 | Bacteria | 4910 |
| 264 | Ga0105243_10096992 | 3300009148 | Bacteria | 2440 |
| 265 | Ga0105241_10002869 | 3300009174 | Bacteria | 12876 |
| 266 | Ga0105241_10444866 | 3300009174 | Bacteria | 1145 |
| 267 | Ga0105241_10718906 | 3300009174 | Bacteria | 913 |
| 268 | Ga0105242_10099359 | 3300009176 | Bacteria | 2463 |
| 269 | Ga0105248_10506674 | 3300009177 | Bacteria | 1361 |
| 270 | Ga0105237_10001263 | 3300009545 | Bacteria | 33774 |
| 271 | Ga0105237_10046055 | 3300009545 | Bacteria | 4388 |
| 272 | Ga0105237_10085232 | 3300009545 | Bacteria | 3149 |
| 273 | Ga0105237_10266053 | 3300009545 | Bacteria | 1717 |
| 274 | Ga0105238_10246666 | 3300009551 | Bacteria | 1764 |
| 275 | Ga0105238_10336574 | 3300009551 | Bacteria | 1497 |
| 276 | Ga0105238_10378973 | 3300009551 | Bacteria | 1406 |
| 277 | Ga0105249_10596983 | 3300009553 | Bacteria | 1158 |
| 278 | Ga0105249_10815586 | 3300009553 | Bacteria | 997 |
| 279 | Ga0105239_10007556 | 3300010375 | Bacteria | 12467 |
| 280 | Ga0105239_10015359 | 3300010375 | Bacteria | 8484 |
| 281 | Ga0105239_10178708 | 3300010375 | Bacteria | 2374 |
| 282 | Ga0105239_10358473 | 3300010375 | Bacteria | 1647 |
| 283 | Ga0105239_10728656 | 3300010375 | Bacteria | 1134 |
| 284 | Ga0105246_10259428 | 3300011119 | Bacteria | 1384 |
| 285 | Ga0105246_10471430 | 3300011119 | Bacteria | 1060 |
| 286 | Ga0105246_10820727 | 3300011119 | Bacteria | 827 |
| 287 | Ga0157347_1001548 | 3300012502 | Bacteria | 1828 |
| 288 | Ga0157347_1009801 | 3300012502 | Bacteria | 997 |
| 289 | Ga0157339_1003962 | 3300012505 | Bacteria | 1097 |
| 290 | Ga0157373_10021915 | 3300013100 | Bacteria | 4636 |
| 291 | Ga0157373_10083632 | 3300013100 | Bacteria | 2250 |
| 292 | Ga0157370_10194426 | 3300013104 | Bacteria | 1883 |
| 293 | Ga0157369_10015236 | 3300013105 | Bacteria | 8675 |
| 294 | Ga0171462_1015 | 3300013250 | Bacteria | 169578 |
| 295 | Ga0171462_1043 | 3300013250 | Bacteria | 56604 |
| 296 | Ga0157378_10089005 | 3300013297 | Bacteria | 2803 |
| 297 | Ga0163162_10046903 | 3300013306 | Bacteria | 4331 |
| 298 | Ga0163162_10135136 | 3300013306 | Bacteria | 2577 |
| 299 | Ga0163162_10192024 | 3300013306 | Bacteria | 2170 |
| 300 | Ga0163162_10480458 | 3300013306 | Bacteria | 1374 |
| 301 | Ga0163162_10550796 | 3300013306 | Bacteria | 1282 |
| 302 | Ga0157375_10043012 | 3300013308 | Bacteria | 4377 |
| 303 | Ga0157375_10108427 | 3300013308 | Bacteria | 2871 |
| 304 | Ga0157375_10231827 | 3300013308 | Bacteria | 2005 |
| 305 | Ga0157375_10397693 | 3300013308 | Bacteria | 1545 |
| 306 | Ga0182008_10000412 | 3300014497 | Bacteria | 33105 |
| 307 | Ga0182008_10005923 | 3300014497 | Bacteria | 6899 |
| 308 | Ga0182008_10006022 | 3300014497 | Bacteria | 6826 |
| 309 | Ga0182008_10026429 | 3300014497 | Bacteria | 2944 |
| 310 | Ga0157379_10294327 | 3300014968 | Bacteria | 1479 |
| 311 | Ga0157376_10000620 | 3300014969 | Bacteria | 22978 |
| 312 | Ga0157376_10391564 | 3300014969 | Bacteria | 1341 |
| 313 | Ga0157376_11031760 | 3300014969 | Bacteria | 846 |
| 314 | Ga0182006_1000053 | 3300015261 | Bacteria | 180648 |
| 315 | Ga0182006_1002039 | 3300015261 | Bacteria | 11337 |
| 316 | Ga0182006_1013692 | 3300015261 | Bacteria | 3510 |
| 317 | Ga0182007_10000075 | 3300015262 | Bacteria | 77567 |
| 318 | Ga0182007_10001181 | 3300015262 | Bacteria | 14184 |
| 319 | Ga0182007_10002674 | 3300015262 | Bacteria | 8750 |
| 320 | Ga0182007_10006376 | 3300015262 | Bacteria | 5066 |
| 321 | Ga0182007_10006880 | 3300015262 | Bacteria | 4833 |
| 322 | Ga0182005_1000031 | 3300015265 | Bacteria | 202902 |
| 323 | Ga0182005_1020136 | 3300015265 | Bacteria | 1837 |
| 324 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 325 | Ga0183362_10011 | 3300015683 | Bacteria | 85355 |
| 326 | Ga0163161_10157636 | 3300017792 | Bacteria | 1729 |
| 327 | Ga0163161_10433207 | 3300017792 | Bacteria | 1060 |
| 328 | Ga0214544_1007467 | 3300021320 | Bacteria | 19156 |
| 329 | Ga0214542_1020416 | 3300021321 | Bacteria | 4865 |
| 330 | Ga0214545_1010456 | 3300021324 | Bacteria | 13467 |
| 331 | Ga0214543_1008348 | 3300021327 | Bacteria | 17026 |
| 332 | Ga0213872_10000681 | 3300021361 | Bacteria | 25737 |
| 333 | Ga0213872_10003867 | 3300021361 | Bacteria | 8133 |
| 334 | Ga0213872_10015097 | 3300021361 | Bacteria | 3593 |
| 335 | Ga0209435_100104 | 3300025206 | Bacteria | 33801 |
| 336 | Ga0209435_101167 | 3300025206 | Bacteria | 3592 |
| 337 | Ga0209436_105070 | 3300025208 | Bacteria | 3108 |
| 338 | Ga0209436_108800 | 3300025208 | Bacteria | 1975 |
| 339 | Ga0209784_100083 | 3300025224 | Bacteria | 131194 |
| 340 | Ga0209566_100102 | 3300025225 | Bacteria | 131194 |
| 341 | Ga0209674_100078 | 3300025226 | Bacteria | 206136 |
| 342 | Ga0209674_100125 | 3300025226 | Bacteria | 131194 |
| 343 | Ga0209672_103796 | 3300025228 | Bacteria | 2997 |
| 344 | Ga0209563_100120 | 3300025230 | Bacteria | 131194 |
| 345 | Ga0207425_1000042 | 3300025245 | Bacteria | 210165 |
| 346 | Ga0207425_1000116 | 3300025245 | Bacteria | 75410 |
| 347 | Ga0207425_1000328 | 3300025245 | Bacteria | 33571 |
| 348 | Ga0207425_1001669 | 3300025245 | Bacteria | 8876 |
| 349 | Ga0209646_1000108 | 3300025246 | Bacteria | 158853 |
| 350 | Ga0209026_1002531 | 3300025250 | Bacteria | 6765 |
| 351 | Ga0209677_100076 | 3300025253 | Bacteria | 131194 |
| 352 | Ga0209759_1000087 | 3300025256 | Bacteria | 166470 |
| 353 | Ga0209759_1000173 | 3300025256 | Bacteria | 107724 |
| 354 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 355 | Ga0209129_1000058 | 3300025258 | Bacteria | 252258 |
| 356 | Ga0209129_1000247 | 3300025258 | Bacteria | 56623 |
| 357 | Ga0209129_1003795 | 3300025258 | Bacteria | 6330 |
| 358 | Ga0209565_1000027 | 3300025263 | Bacteria | 360545 |
| 359 | Ga0209565_1000039 | 3300025263 | Bacteria | 278026 |
| 360 | Ga0209565_1000256 | 3300025263 | Bacteria | 56528 |
| 361 | Ga0209673_1000031 | 3300025273 | Bacteria | 347560 |
| 362 | Ga0209673_1000284 | 3300025273 | Bacteria | 94932 |
| 363 | Ga0209673_1000592 | 3300025273 | Bacteria | 56577 |
| 364 | Ga0209673_1000731 | 3300025273 | Bacteria | 45565 |
| 365 | Ga0209673_1003402 | 3300025273 | Bacteria | 9431 |
| 366 | Ga0209673_1012164 | 3300025273 | Bacteria | 3489 |
| 367 | Ga0209130_1000025 | 3300025284 | Bacteria | 336491 |
| 368 | Ga0209130_1000045 | 3300025284 | Bacteria | 240278 |
| 369 | Ga0209130_1000366 | 3300025284 | Bacteria | 51201 |
| 370 | Ga0209130_1001347 | 3300025284 | Bacteria | 16627 |
| 371 | Ga0209130_1019026 | 3300025284 | Bacteria | 1601 |
| 372 | Ga0209675_1000030 | 3300025291 | Bacteria | 278026 |
| 373 | Ga0209675_1000064 | 3300025291 | Bacteria | 177063 |
| 374 | Ga0209675_1000397 | 3300025291 | Bacteria | 36156 |
| 375 | Ga0209675_1000683 | 3300025291 | Bacteria | 23657 |
| 376 | Ga0209675_1003937 | 3300025291 | Bacteria | 6808 |
| 377 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 378 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 379 | Ga0209676_1000135 | 3300025292 | Bacteria | 182756 |
| 380 | Ga0209676_1000633 | 3300025292 | Bacteria | 50662 |
| 381 | Ga0209676_1001946 | 3300025292 | Bacteria | 16637 |
| 382 | Ga0209676_1006693 | 3300025292 | Bacteria | 5612 |
| 383 | Ga0209025_1000057 | 3300025294 | Bacteria | 314601 |
| 384 | Ga0209025_1000075 | 3300025294 | Bacteria | 275717 |
| 385 | Ga0209025_1000432 | 3300025294 | Bacteria | 82875 |
| 386 | Ga0209025_1000710 | 3300025294 | Bacteria | 56623 |
| 387 | Ga0209025_1000893 | 3300025294 | Bacteria | 46429 |
| 388 | Ga0209025_1020385 | 3300025294 | Bacteria | 3630 |
| 389 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 390 | Ga0209564_1000040 | 3300025295 | Bacteria | 411388 |
| 391 | Ga0209564_1000596 | 3300025295 | Bacteria | 56623 |
| 392 | Ga0209564_1001056 | 3300025295 | Bacteria | 33579 |
| 393 | Ga0209758_1000050 | 3300025297 | Bacteria | 345008 |
| 394 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 395 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 396 | Ga0209758_1000213 | 3300025297 | Bacteria | 126745 |
| 397 | Ga0209758_1002886 | 3300025297 | Bacteria | 16627 |
| 398 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 399 | Ga0209050_1000100 | 3300025298 | Bacteria | 231385 |
| 400 | Ga0209050_1000178 | 3300025298 | Bacteria | 145314 |
| 401 | Ga0209050_1000460 | 3300025298 | Bacteria | 72933 |
| 402 | Ga0209050_1000617 | 3300025298 | Bacteria | 55750 |
| 403 | Ga0209050_1004472 | 3300025298 | Bacteria | 9413 |
| 404 | Ga0209256_1000023 | 3300025299 | Bacteria | 461150 |
| 405 | Ga0209256_1000516 | 3300025299 | Bacteria | 56623 |
| 406 | Ga0209256_1000679 | 3300025299 | Bacteria | 45927 |
| 407 | Ga0209256_1011869 | 3300025299 | Bacteria | 3420 |
| 408 | Ga0209256_1014142 | 3300025299 | Bacteria | 2898 |
| 409 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 410 | Ga0207426_1000118 | 3300025302 | Bacteria | 223341 |
| 411 | Ga0207426_1000710 | 3300025302 | Bacteria | 39012 |
| 412 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 413 | Ga0209051_1000067 | 3300025303 | Bacteria | 227181 |
| 414 | Ga0209051_1000221 | 3300025303 | Bacteria | 96174 |
| 415 | Ga0209051_1000777 | 3300025303 | Bacteria | 33839 |
| 416 | Ga0209051_1001382 | 3300025303 | Bacteria | 20949 |
| 417 | Ga0209051_1001862 | 3300025303 | Bacteria | 16570 |
| 418 | Ga0209051_1008202 | 3300025303 | Bacteria | 5565 |
| 419 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 420 | Ga0209257_1000057 | 3300025304 | Bacteria | 396985 |
| 421 | Ga0209257_1000095 | 3300025304 | Bacteria | 259437 |
| 422 | Ga0209257_1000188 | 3300025304 | Bacteria | 154074 |
| 423 | Ga0209257_1000451 | 3300025304 | Bacteria | 77246 |
| 424 | Ga0209257_1004070 | 3300025304 | Bacteria | 11730 |
| 425 | Ga0209257_1018547 | 3300025304 | Bacteria | 2670 |
| 426 | Ga0209257_1048255 | 3300025304 | Bacteria | 1219 |
| 427 | Ga0207655_1003178 | 3300025728 | Bacteria | 12400 |
| 428 | Ga0207655_1010745 | 3300025728 | Bacteria | 5524 |
| 429 | Ga0207713_1001113 | 3300025735 | Bacteria | 22951 |
| 430 | Ga0207692_10000086 | 3300025898 | Bacteria | 27120 |
| 431 | Ga0207710_10015253 | 3300025900 | Bacteria | 3244 |
| 432 | Ga0207647_10004634 | 3300025904 | Bacteria | 10188 |
| 433 | Ga0207647_10031606 | 3300025904 | Bacteria | 3406 |
| 434 | Ga0207647_10109369 | 3300025904 | Bacteria | 1635 |
| 435 | Ga0207647_10125275 | 3300025904 | Bacteria | 1512 |
| 436 | Ga0207685_10017087 | 3300025905 | Bacteria | 2336 |
| 437 | Ga0207699_10000515 | 3300025906 | Bacteria | 19183 |
| 438 | Ga0207645_10006283 | 3300025907 | Bacteria | 8540 |
| 439 | Ga0207645_10100894 | 3300025907 | Bacteria | 1862 |
| 440 | Ga0207705_10015142 | 3300025909 | Bacteria | 5544 |
| 441 | Ga0207705_10138089 | 3300025909 | Bacteria | 1818 |
| 442 | Ga0207705_10317095 | 3300025909 | Bacteria | 1198 |
| 443 | Ga0207684_10019493 | 3300025910 | Bacteria | 5801 |
| 444 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 445 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 446 | Ga0207695_10026593 | 3300025913 | Bacteria | 6457 |
| 447 | Ga0207695_10161880 | 3300025913 | Bacteria | 2169 |
| 448 | Ga0207671_10009661 | 3300025914 | Bacteria | 8037 |
| 449 | Ga0207671_10100189 | 3300025914 | Bacteria | 2193 |
| 450 | Ga0207671_10256385 | 3300025914 | Bacteria | 1376 |
| 451 | Ga0207693_10018998 | 3300025915 | Bacteria | 5470 |
| 452 | Ga0207663_10001767 | 3300025916 | Bacteria | 10187 |
| 453 | Ga0207662_10226742 | 3300025918 | Bacteria | 1219 |
| 454 | Ga0207657_10018853 | 3300025919 | Bacteria | 6571 |
| 455 | Ga0207657_10431067 | 3300025919 | Bacteria | 1036 |
| 456 | Ga0207657_10434891 | 3300025919 | Bacteria | 1030 |
| 457 | Ga0207652_10110945 | 3300025921 | Bacteria | 2432 |
| 458 | Ga0207694_10184045 | 3300025924 | Bacteria | 1695 |
| 459 | Ga0207694_10230685 | 3300025924 | Bacteria | 1512 |
| 460 | Ga0207694_10513345 | 3300025924 | Bacteria | 1004 |
| 461 | Ga0207650_10017844 | 3300025925 | Bacteria | 4972 |
| 462 | Ga0207659_10017903 | 3300025926 | Bacteria | 4635 |
| 463 | Ga0207687_10039339 | 3300025927 | Bacteria | 3237 |
| 464 | Ga0207687_10088279 | 3300025927 | Bacteria | 2255 |
| 465 | Ga0207687_10097146 | 3300025927 | Bacteria | 2160 |
| 466 | Ga0207687_10396547 | 3300025927 | Bacteria | 1134 |
| 467 | Ga0207700_10005674 | 3300025928 | Bacteria | 7492 |
| 468 | Ga0207664_10299720 | 3300025929 | Bacteria | 1414 |
| 469 | Ga0207644_10072269 | 3300025931 | Bacteria | 2526 |
| 470 | Ga0207644_10163672 | 3300025931 | Bacteria | 1731 |
| 471 | Ga0207644_10173699 | 3300025931 | Bacteria | 1684 |
| 472 | Ga0207690_10081721 | 3300025932 | Bacteria | 2259 |
| 473 | Ga0207690_10277869 | 3300025932 | Bacteria | 1303 |
| 474 | Ga0207706_10016401 | 3300025933 | Bacteria | 6689 |
| 475 | Ga0207706_10113494 | 3300025933 | Bacteria | 2383 |
| 476 | Ga0207706_10313136 | 3300025933 | Bacteria | 1366 |
| 477 | Ga0207709_10000491 | 3300025935 | Bacteria | 35713 |
| 478 | Ga0207709_10003200 | 3300025935 | Bacteria | 9841 |
| 479 | Ga0207709_10018580 | 3300025935 | Bacteria | 3895 |
| 480 | Ga0207709_10021645 | 3300025935 | Bacteria | 3640 |
| 481 | Ga0207709_10272932 | 3300025935 | Bacteria | 1245 |
| 482 | Ga0207670_10247690 | 3300025936 | Bacteria | 1376 |
| 483 | Ga0207669_10050596 | 3300025937 | Bacteria | 2485 |
| 484 | Ga0207665_10002776 | 3300025939 | Bacteria | 11733 |
| 485 | Ga0207691_10003629 | 3300025940 | Bacteria | 14981 |
| 486 | Ga0207691_10065263 | 3300025940 | Bacteria | 3296 |
| 487 | Ga0207691_10420480 | 3300025940 | Bacteria | 1139 |
| 488 | Ga0207689_10027056 | 3300025942 | Bacteria | 4801 |
| 489 | Ga0207689_10198759 | 3300025942 | Bacteria | 1655 |
| 490 | Ga0207689_10278214 | 3300025942 | Bacteria | 1386 |
| 491 | Ga0207689_10336481 | 3300025942 | Bacteria | 1254 |
| 492 | Ga0207679_10018847 | 3300025945 | Bacteria | 4630 |
| 493 | Ga0207679_10041723 | 3300025945 | Bacteria | 3293 |
| 494 | Ga0207667_10002561 | 3300025949 | Bacteria | 22613 |
| 495 | Ga0207667_10028495 | 3300025949 | Bacteria | 6066 |
| 496 | Ga0207667_10099751 | 3300025949 | Bacteria | 2996 |
| 497 | Ga0207667_10152304 | 3300025949 | Bacteria | 2380 |
| 498 | Ga0207667_10256617 | 3300025949 | Bacteria | 1788 |
| 499 | Ga0207651_10019311 | 3300025960 | Bacteria | 4080 |
| 500 | Ga0207651_10426802 | 3300025960 | Bacteria | 1133 |
| 501 | Ga0207712_10326174 | 3300025961 | Bacteria | 1268 |
| 502 | Ga0207640_10058242 | 3300025981 | Bacteria | 2544 |
| 503 | Ga0207640_10113777 | 3300025981 | Bacteria | 1924 |
| 504 | Ga0207640_10169229 | 3300025981 | Bacteria | 1626 |
| 505 | Ga0207658_10015535 | 3300025986 | Bacteria | 5223 |
| 506 | Ga0207658_10042781 | 3300025986 | Bacteria | 3288 |
| 507 | Ga0207658_10129530 | 3300025986 | Bacteria | 2025 |
| 508 | Ga0207677_10016985 | 3300026023 | Bacteria | 4325 |
| 509 | Ga0207639_10196053 | 3300026041 | Bacteria | 1729 |
| 510 | Ga0207678_10019795 | 3300026067 | Bacteria | 5919 |
| 511 | Ga0207678_10248208 | 3300026067 | Bacteria | 1524 |
| 512 | Ga0207678_10356855 | 3300026067 | Bacteria | 1261 |
| 513 | Ga0207648_10003368 | 3300026089 | Bacteria | 16788 |
| 514 | Ga0207676_10142739 | 3300026095 | Bacteria | 2052 |
| 515 | Ga0207676_10554062 | 3300026095 | Bacteria | 1099 |
| 516 | Ga0207674_10008463 | 3300026116 | Bacteria | 11884 |
| 517 | Ga0207674_10101659 | 3300026116 | Bacteria | 2855 |
| 518 | Ga0207674_10132788 | 3300026116 | Bacteria | 2452 |
| 519 | Ga0207674_10237780 | 3300026116 | Bacteria | 1768 |
| 520 | Ga0207675_100323106 | 3300026118 | Bacteria | 1507 |
| 521 | Ga0207683_10394660 | 3300026121 | Bacteria | 1272 |
| 522 | Ga0207683_10501281 | 3300026121 | Bacteria | 1121 |
| 523 | Ga0207683_10712067 | 3300026121 | Bacteria | 931 |
| 524 | Ga0207698_10107910 | 3300026142 | Bacteria | 2325 |
| 525 | Ga0207698_10128225 | 3300026142 | Bacteria | 2162 |
| 526 | Ga0207698_10327107 | 3300026142 | Bacteria | 1438 |
| 527 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 528 | Ga0209389_1026550 | 3300027296 | Bacteria | 5015 |
| 529 | Ga0209489_115028 | 3300027361 | Bacteria | 5015 |
| 530 | Ga0209700_100026 | 3300027363 | Bacteria | 224498 |
| 531 | Ga0209282_1000934 | 3300027666 | Bacteria | 15275 |
| 532 | Ga0209813_10058807 | 3300027866 | Bacteria | 1222 |
| 533 | Ga0207428_10150283 | 3300027907 | Bacteria | 1773 |
| 534 | Ga0207428_10257875 | 3300027907 | Bacteria | 1299 |
| 535 | Ga0268266_10033588 | 3300028379 | Bacteria | 4361 |
| 536 | Ga0268266_10063810 | 3300028379 | Bacteria | 3180 |
| 537 | Ga0268266_10215669 | 3300028379 | Bacteria | 1762 |
| 538 | Ga0268266_10401158 | 3300028379 | Bacteria | 1296 |
| 539 | Ga0268265_10054227 | 3300028380 | Bacteria | 3041 |
| 540 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 541 | Ga0265334_10060317 | 3300028573 | Bacteria | 1432 |
| 542 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 543 | Ga0307517_10001174 | 3300028786 | Bacteria | 44101 |
| 544 | Ga0307517_10003316 | 3300028786 | Bacteria | 25116 |
| 545 | Ga0307517_10056423 | 3300028786 | Bacteria | 3833 |
| 546 | Ga0307517_10105455 | 3300028786 | Bacteria | 2187 |
| 547 | Ga0307517_10107801 | 3300028786 | Bacteria | 2143 |
| 548 | Ga0307517_10130465 | 3300028786 | Bacteria | 1812 |
| 549 | Ga0307515_10000030 | 3300028794 | Bacteria | 364482 |
| 550 | Ga0307515_10000067 | 3300028794 | Bacteria | 242978 |
| 551 | Ga0307515_10000195 | 3300028794 | Bacteria | 148138 |
| 552 | Ga0307515_10000842 | 3300028794 | Bacteria | 70481 |
| 553 | Ga0307515_10001836 | 3300028794 | Bacteria | 47333 |
| 554 | Ga0307515_10002244 | 3300028794 | Bacteria | 42358 |
| 555 | Ga0307515_10002513 | 3300028794 | Bacteria | 39723 |
| 556 | Ga0307515_10011464 | 3300028794 | Bacteria | 16826 |
| 557 | Ga0307515_10012396 | 3300028794 | Bacteria | 16037 |
| 558 | Ga0307515_10020574 | 3300028794 | Bacteria | 11761 |
| 559 | Ga0307515_10037126 | 3300028794 | Bacteria | 7848 |
| 560 | Ga0307515_10056827 | 3300028794 | Bacteria | 5677 |
| 561 | Ga0307515_10096844 | 3300028794 | Bacteria | 3613 |
| 562 | Ga0307515_10182403 | 3300028794 | Bacteria | 2043 |
| 563 | Ga0307515_10364524 | 3300028794 | Bacteria | 1084 |
| 564 | Ga0268256_1011353 | 3300030500 | Bacteria | 2822 |
| 565 | Ga0307511_10044832 | 3300030521 | Bacteria | 3666 |
| 566 | Ga0307511_10168026 | 3300030521 | Bacteria | 1213 |
| 567 | Ga0307512_10010124 | 3300030522 | Bacteria | 9019 |
| 568 | Ga0307512_10072907 | 3300030522 | Bacteria | 2535 |
| 569 | Ga0307512_10118509 | 3300030522 | Bacteria | 1711 |
| 570 | Ga0316176_1214160 | 3300030732 | Bacteria | 1810 |
| 571 | Ga0265332_10001568 | 3300031238 | Bacteria | 12527 |
| 572 | Ga0265327_10003656 | 3300031251 | Bacteria | 14447 |
| 573 | Ga0307513_10006822 | 3300031456 | Bacteria | 14880 |
| 574 | Ga0307513_10011950 | 3300031456 | Bacteria | 10751 |
| 575 | Ga0307513_10022166 | 3300031456 | Bacteria | 7473 |
| 576 | Ga0307513_10026537 | 3300031456 | Bacteria | 6677 |
| 577 | Ga0307513_10049682 | 3300031456 | Bacteria | 4541 |
| 578 | Ga0307513_10053784 | 3300031456 | Bacteria | 4324 |
| 579 | Ga0307513_10108752 | 3300031456 | Bacteria | 2772 |
| 580 | Ga0307513_10116986 | 3300031456 | Bacteria | 2644 |
| 581 | Ga0307513_10360566 | 3300031456 | Bacteria | 1199 |
| 582 | Ga0307513_10388942 | 3300031456 | Bacteria | 1132 |
| 583 | Ga0307513_10389383 | 3300031456 | Bacteria | 1131 |
| 584 | Ga0307509_10000654 | 3300031507 | Bacteria | 58837 |
| 585 | Ga0307509_10004345 | 3300031507 | Bacteria | 20558 |
| 586 | Ga0307509_10004938 | 3300031507 | Bacteria | 18878 |
| 587 | Ga0307509_10065073 | 3300031507 | Bacteria | 3831 |
| 588 | Ga0307509_10077568 | 3300031507 | Bacteria | 3445 |
| 589 | Ga0307509_10098125 | 3300031507 | Bacteria | 2976 |
| 590 | Ga0307509_10119904 | 3300031507 | Bacteria | 2611 |
| 591 | Ga0307408_100001218 | 3300031548 | Bacteria | 19365 |
| 592 | Ga0307408_100060611 | 3300031548 | Bacteria | 2758 |
| 593 | Ga0307408_100227105 | 3300031548 | Bacteria | 1526 |
| 594 | Ga0307408_100258553 | 3300031548 | Bacteria | 1440 |
| 595 | Ga0307408_100308081 | 3300031548 | Bacteria | 1329 |
| 596 | Ga0307408_100479725 | 3300031548 | Bacteria | 1084 |
| 597 | Ga0307508_10000204 | 3300031616 | Bacteria | 71518 |
| 598 | Ga0307508_10000333 | 3300031616 | Bacteria | 57002 |
| 599 | Ga0307508_10025899 | 3300031616 | Bacteria | 5318 |
| 600 | Ga0307508_10175501 | 3300031616 | Bacteria | 1746 |
| 601 | Ga0307508_10436645 | 3300031616 | Bacteria | 901 |
| 602 | Ga0307514_10012268 | 3300031649 | Bacteria | 7132 |
| 603 | Ga0307514_10027913 | 3300031649 | Bacteria | 4556 |
| 604 | Ga0307514_10242734 | 3300031649 | Bacteria | 1077 |
| 605 | Ga0307516_10000136 | 3300031730 | Bacteria | 87938 |
| 606 | Ga0307516_10001738 | 3300031730 | Bacteria | 29930 |
| 607 | Ga0307516_10006407 | 3300031730 | Bacteria | 13802 |
| 608 | Ga0307516_10009389 | 3300031730 | Bacteria | 10913 |
| 609 | Ga0307516_10016230 | 3300031730 | Bacteria | 7796 |
| 610 | Ga0307516_10123686 | 3300031730 | Bacteria | 2374 |
| 611 | Ga0307405_10023955 | 3300031731 | Bacteria | 3479 |
| 612 | Ga0307405_10042528 | 3300031731 | Bacteria | 2766 |
| 613 | Ga0307405_10101759 | 3300031731 | Bacteria | 1928 |
| 614 | Ga0307406_10001377 | 3300031901 | Bacteria | 13548 |
| 615 | Ga0307412_10000024 | 3300031911 | Bacteria | 235467 |
| 616 | Ga0307412_10070878 | 3300031911 | Bacteria | 2377 |
| 617 | Ga0307412_10091879 | 3300031911 | Bacteria | 2125 |
| 618 | Ga0307416_100524000 | 3300032002 | Bacteria | 1254 |
| 619 | Ga0307414_10085437 | 3300032004 | Bacteria | 2325 |
| 620 | Ga0307414_10189735 | 3300032004 | Bacteria | 1662 |
| 621 | Ga0307411_10051181 | 3300032005 | Bacteria | 2693 |
| 622 | Ga0307411_10136556 | 3300032005 | Bacteria | 1801 |
| 623 | Ga0307411_10823714 | 3300032005 | Bacteria | 819 |
| 624 | Ga0307507_10064150 | 3300033179 | Bacteria | 3393 |
| 625 | Ga0307507_10098070 | 3300033179 | Bacteria | 2469 |
| 626 | Ga0307507_10314934 | 3300033179 | Bacteria | 947 |
| 627 | Ga0307510_10001775 | 3300033180 | Bacteria | 24067 |
| 628 | Ga0307510_10159955 | 3300033180 | Bacteria | 1851 |
| 629 | Ga0307510_10168688 | 3300033180 | Bacteria | 1772 |
| 630 | Ga0307510_10200140 | 3300033180 | Bacteria | 1533 |
| 631 | Ga0307510_10216151 | 3300033180 | Bacteria | 1433 |
| 632 | Ga0373932_0036826 | 3300035112 | Bacteria | 1391 |
| 633 | Ga0373935_0038345 | 3300035692 | Bacteria | 3000 |
| 634 | Ga0373947_0080970 | 3300035725 | Bacteria | 2010 |
| 635 | Ga0373925_0076610 | 3300037068 | Bacteria | 2537 |
| 636 | Ga0373925_0084469 | 3300037068 | Bacteria | 2419 |
| 637 | Ga0373925_0387142 | 3300037068 | Bacteria | 1139 |
| 638 | Ga0395899_0002715 | 3300037312 | Bacteria | 14263 |
| 639 | Ga0395899_0003953 | 3300037312 | Bacteria | 11678 |
| 640 | Ga0395900_0013023 | 3300037418 | Bacteria | 8498 |
| 641 | Ga0395900_0061151 | 3300037418 | Bacteria | 3873 |
| 642 | Ga0395900_0082740 | 3300037418 | Bacteria | 3298 |
| 643 | Ga0395898_0210532 | 3300037466 | Bacteria | 1854 |
| 644 | Ga0395898_0268045 | 3300037466 | Bacteria | 1628 |
| 645 | Ga0395905_0078758 | 3300037471 | Bacteria | 3089 |
| 646 | Ga0395905_0446154 | 3300037471 | Bacteria | 1191 |
| 647 | Ga0395901_0037138 | 3300038443 | Bacteria | 5038 |
| 648 | Ga0395901_0044783 | 3300038443 | Bacteria | 4589 |
| 649 | Ga0436361_0044104 | 3300039447 | Bacteria | 25711 |
| 650 | Ga0436361_0455580 | 3300039447 | Bacteria | 1664 |
| 651 | Ga0436361_0694654 | 3300039447 | Bacteria | 4208 |
| 652 | Ga0436361_0716290 | 3300039447 | Bacteria | 39995 |
| 653 | Ga0436361_1111077 | 3300039447 | Bacteria | 19555 |
| 654 | Ga0436363_1512662 | 3300039450 | Bacteria | 1589 |
| 655 | Ga0439436_0000486 | 3300041404 | Bacteria | 10325 |
| 656 | Ga0439436_0004722 | 3300041404 | Bacteria | 4179 |
| 657 | Ga0439436_0007083 | 3300041404 | Bacteria | 3451 |
| 658 | Ga0439436_0007676 | 3300041404 | Bacteria | 3319 |
| 659 | Ga0439439_0009488 | 3300041406 | Bacteria | 2315 |
| 660 | Ga0439466_0018576 | 3300041411 | Bacteria | 2493 |
| 661 | Ga0439466_0026452 | 3300041411 | Bacteria | 2017 |
| 662 | Ga0439466_0048484 | 3300041411 | Bacteria | 1397 |
| 663 | Ga0439466_0066266 | 3300041411 | Bacteria | 1156 |
| 664 | Ga0439465_0011301 | 3300041413 | Bacteria | 2802 |
| 665 | Ga0439465_0018713 | 3300041413 | Bacteria | 2164 |
| 666 | Ga0439465_0141694 | 3300041413 | Bacteria | 854 |
| 667 | Ga0451793_0179075 | 3300041452 | Bacteria | 1456 |
| 668 | Ga0451793_0300542 | 3300041452 | Bacteria | 3323 |
| 669 | Ga0451795_0268819 | 3300041456 | Bacteria | 3345 |
| 670 | Ga0451795_0556773 | 3300041456 | Bacteria | 1367 |
| 671 | Ga0451798_0006020 | 3300041458 | Bacteria | 2171 |
| 672 | Ga0451800_0725212 | 3300041459 | Bacteria | 1423 |
| 673 | Ga0451802_0869575 | 3300041460 | Bacteria | 1824 |
| 674 | Ga0451802_1174236 | 3300041460 | Bacteria | 1091 |
| 675 | Ga0451804_0208994 | 3300041463 | Bacteria | 2207 |
| 676 | Ga0451807_0874863 | 3300041486 | Bacteria | 1116 |
| 677 | Ga0451807_1859406 | 3300041486 | Bacteria | 2255 |
| 678 | Ga0451839_1210773 | 3300041496 | Bacteria | 1593 |
| 679 | Ga0451853_3319420 | 3300041512 | Bacteria | 2257 |
| 680 | Ga0439431_0001562 | 3300041997 | Bacteria | 5076 |
| 681 | Ga0439431_0004108 | 3300041997 | Bacteria | 3203 |
| 682 | Ga0439431_0046420 | 3300041997 | Bacteria | 1118 |
| 683 | Ga0439433_0003311 | 3300041999 | Bacteria | 3453 |
| 684 | Ga0439433_0012982 | 3300041999 | Bacteria | 1829 |
| 685 | Ga0439437_008148 | 3300042000 | Bacteria | 1176 |
| 686 | Ga0439442_006072 | 3300042002 | Bacteria | 2420 |
| 687 | Ga0439445_0003396 | 3300042004 | Bacteria | 3571 |
| 688 | Ga0439445_0009673 | 3300042004 | Bacteria | 2273 |
| 689 | Ga0439445_0050310 | 3300042004 | Bacteria | 1124 |
| 690 | Ga0439432_005828 | 3300042006 | Bacteria | 4422 |
| 691 | Ga0439432_016992 | 3300042006 | Bacteria | 2444 |
| 692 | Ga0439449_0000970 | 3300042007 | Bacteria | 11274 |
| 693 | Ga0439449_0001676 | 3300042007 | Bacteria | 8714 |
| 694 | Ga0439449_0002065 | 3300042007 | Bacteria | 7907 |
| 695 | Ga0439449_0005212 | 3300042007 | Bacteria | 4987 |
| 696 | Ga0439449_0006540 | 3300042007 | Bacteria | 4453 |
| 697 | Ga0439449_0007725 | 3300042007 | Bacteria | 4084 |
| 698 | Ga0439449_0020580 | 3300042007 | Bacteria | 2472 |
| 699 | Ga0439452_001192 | 3300042010 | Bacteria | 11185 |
| 700 | Ga0439457_022857 | 3300042014 | Bacteria | 1384 |
| 701 | Ga0439462_0010395 | 3300042015 | Bacteria | 2356 |
| 702 | Ga0439462_0014056 | 3300042015 | Bacteria | 2054 |
| 703 | Ga0450911_000104 | 3300042115 | Bacteria | 34662 |
| 704 | Ga0450921_001811 | 3300042123 | Bacteria | 1351 |
| 705 | Ga0450923_005039 | 3300042125 | Bacteria | 2112 |
| 706 | Ga0450888_020924 | 3300042126 | Bacteria | 833 |
| 707 | Ga0450890_008032 | 3300042127 | Bacteria | 1350 |
| 708 | Ga0450896_010426 | 3300042133 | Bacteria | 1304 |
| 709 | Ga0450898_008877 | 3300042134 | Bacteria | 1598 |
| 710 | Ga0450898_012684 | 3300042134 | Bacteria | 1396 |
| 711 | Ga0450906_005442 | 3300042145 | Bacteria | 2618 |
| 712 | Ga0439446_0013356 | 3300042156 | Bacteria | 2253 |
| 713 | Ga0450908_002904 | 3300042184 | Bacteria | 3334 |
| 714 | Ga0450909_023806 | 3300042185 | Bacteria | 919 |
| 715 | Ga0439434_0006287 | 3300042435 | Bacteria | 3465 |
| 716 | Ga0439434_0010043 | 3300042435 | Bacteria | 2787 |
| 717 | Ga0439434_0015320 | 3300042435 | Bacteria | 2286 |
| 718 | Ga0439434_0047894 | 3300042435 | Bacteria | 1321 |
| 719 | Ga0439434_0062989 | 3300042435 | Bacteria | 1161 |
| 720 | Ga0439464_0007442 | 3300042439 | Bacteria | 2864 |
| 721 | Ga0450918_001241 | 3300042531 | Bacteria | 5182 |
| 722 | Ga0450918_001794 | 3300042531 | Bacteria | 4181 |
| 723 | Ga0466969_0003126 | 3300044656 | Bacteria | 8823 |
| 724 | Ga0466969_0004989 | 3300044656 | Bacteria | 7069 |
| 725 | Ga0466969_0007670 | 3300044656 | Bacteria | 5735 |
| 726 | Ga0466969_0080316 | 3300044656 | Bacteria | 1558 |
| 727 | Ga0466972_0000708 | 3300044658 | Bacteria | 15929 |
| 728 | Ga0466972_0002810 | 3300044658 | Bacteria | 8629 |
| 729 | Ga0466965_0000290 | 3300044683 | Bacteria | 16664 |
| 730 | Ga0466965_0013432 | 3300044683 | Bacteria | 3864 |
| 731 | Ga0466965_0025004 | 3300044683 | Bacteria | 2889 |
| 732 | Ga0466965_0354874 | 3300044683 | Bacteria | 804 |
| 733 | Ga0466966_0010599 | 3300044684 | Bacteria | 6127 |
| 734 | Ga0466966_0025298 | 3300044684 | Bacteria | 3878 |
| 735 | Ga0466966_0028973 | 3300044684 | Bacteria | 3604 |
| 736 | Ga0466961_0025923 | 3300044693 | Bacteria | 3768 |
| 737 | Ga0466961_0058919 | 3300044693 | Bacteria | 2442 |
| 738 | Ga0466961_0076414 | 3300044693 | Bacteria | 2122 |
| 739 | Ga0466961_0077753 | 3300044693 | Bacteria | 2101 |
| 740 | Ga0466963_0148113 | 3300044694 | Bacteria | 1629 |
| 741 | Ga0466964_0010149 | 3300044706 | Bacteria | 3550 |
| 742 | Ga0466971_0009952 | 3300044719 | Bacteria | 4153 |
| 743 | Ga0466968_0008282 | 3300044735 | Bacteria | 3977 |
| 744 | Ga0466970_0008244 | 3300044765 | Bacteria | 5235 |
| 745 | Ga0466970_0020888 | 3300044765 | Bacteria | 3407 |
| 746 | Ga0466957_0001020 | 3300044842 | Bacteria | 14442 |
| 747 | Ga0466957_0147842 | 3300044842 | Bacteria | 1518 |
| 748 | Ga0466957_0169246 | 3300044842 | Bacteria | 1423 |
| 749 | Ga0466960_0004844 | 3300044901 | Bacteria | 5291 |
| 750 | Ga0466960_0007734 | 3300044901 | Bacteria | 4377 |
| 751 | Ga0466959_0002228 | 3300045049 | Bacteria | 12350 |
| 752 | Ga0466959_0006848 | 3300045049 | Bacteria | 7944 |
| 753 | Ga0466959_0087184 | 3300045049 | Bacteria | 2245 |
| 754 | Ga0466958_0015767 | 3300045836 | Bacteria | 4339 |
| 755 | Ga0466967_0000802 | 3300045976 | Bacteria | 16428 |
| 756 | Ga0466967_0051642 | 3300045976 | Bacteria | 3604 |
| 757 | Ga0495617_000044 | 3300046452 | Bacteria | 119709 |
| 758 | Ga0495617_030769 | 3300046452 | Bacteria | 1804 |
| 759 | Ga0495627_000062 | 3300046453 | Bacteria | 138772 |
| 760 | Ga0495627_000380 | 3300046453 | Bacteria | 40821 |
| 761 | Ga0495627_004816 | 3300046453 | Bacteria | 5572 |
| 762 | Ga0495627_017729 | 3300046453 | Bacteria | 2413 |
| 763 | Ga0495592_0000131 | 3300046454 | Bacteria | 66382 |
| 764 | Ga0495592_0000967 | 3300046454 | Bacteria | 19913 |
| 765 | Ga0495592_0259680 | 3300046454 | Bacteria | 1145 |
| 766 | Ga0495590_0023666 | 3300046457 | Bacteria | 2167 |
| 767 | Ga0495590_0036138 | 3300046457 | Bacteria | 1723 |
| 768 | Ga0495591_000023 | 3300046458 | Bacteria | 191598 |
| 769 | Ga0495591_011049 | 3300046458 | Bacteria | 3444 |
| 770 | Ga0495629_0072486 | 3300046459 | Bacteria | 2404 |
| 771 | Ga0495629_0074081 | 3300046459 | Bacteria | 2377 |
| 772 | Ga0495638_0016815 | 3300046460 | Bacteria | 4891 |
| 773 | Ga0495638_0092437 | 3300046460 | Bacteria | 1821 |
| 774 | Ga0495638_0099373 | 3300046460 | Bacteria | 1742 |
| 775 | Ga0495651_0186321 | 3300046462 | Bacteria | 1464 |
| 776 | Ga0495653_0000761 | 3300046463 | Bacteria | 24711 |
| 777 | Ga0495653_0002408 | 3300046463 | Bacteria | 14891 |
| 778 | Ga0495653_0073660 | 3300046463 | Bacteria | 2547 |
| 779 | Ga0495650_0004823 | 3300046471 | Bacteria | 9034 |
| 780 | Ga0495650_0008643 | 3300046471 | Bacteria | 5903 |
| 781 | Ga0495650_0018553 | 3300046471 | Bacteria | 3452 |
| 782 | Ga0495650_0030600 | 3300046471 | Bacteria | 2435 |
| 783 | Ga0495580_0000252 | 3300046472 | Bacteria | 42451 |
| 784 | Ga0495580_0000279 | 3300046472 | Bacteria | 41404 |
| 785 | Ga0495580_0001423 | 3300046472 | Bacteria | 21034 |
| 786 | Ga0495580_0005484 | 3300046472 | Bacteria | 10485 |
| 787 | Ga0495580_0009254 | 3300046472 | Bacteria | 7757 |
| 788 | Ga0495582_0027193 | 3300046473 | Bacteria | 3134 |
| 789 | Ga0495605_0001112 | 3300046474 | Bacteria | 17910 |
| 790 | Ga0495605_0040748 | 3300046474 | Bacteria | 2317 |
| 791 | Ga0495639_0001601 | 3300046475 | Bacteria | 10073 |
| 792 | Ga0495639_0009042 | 3300046475 | Bacteria | 4272 |
| 793 | Ga0495664_0006494 | 3300046477 | Bacteria | 6463 |
| 794 | Ga0495664_0085697 | 3300046477 | Bacteria | 1891 |
| 795 | Ga0495594_0067088 | 3300046499 | Bacteria | 1991 |
| 796 | Ga0495596_0011373 | 3300046500 | Bacteria | 3843 |
| 797 | Ga0495607_0001124 | 3300046501 | Bacteria | 24272 |
| 798 | Ga0495607_0001321 | 3300046501 | Bacteria | 22100 |
| 799 | Ga0495607_0001514 | 3300046501 | Bacteria | 20453 |
| 800 | Ga0495583_0000306 | 3300046506 | Bacteria | 77699 |
| 801 | Ga0495606_0000644 | 3300046507 | Bacteria | 54819 |
| 802 | Ga0495606_0001437 | 3300046507 | Bacteria | 31965 |
| 803 | Ga0495606_0089093 | 3300046507 | Bacteria | 1901 |
| 804 | Ga0495606_0156666 | 3300046507 | Bacteria | 1332 |
| 805 | Ga0495610_0002534 | 3300046512 | Bacteria | 15238 |
| 806 | Ga0495610_0013222 | 3300046512 | Bacteria | 4915 |
| 807 | Ga0495610_0036516 | 3300046512 | Bacteria | 2510 |
| 808 | Ga0495610_0059906 | 3300046512 | Bacteria | 1815 |
| 809 | Ga0495616_0002465 | 3300046513 | Bacteria | 12267 |
| 810 | Ga0495616_0054140 | 3300046513 | Bacteria | 1991 |
| 811 | Ga0495618_0008335 | 3300046514 | Bacteria | 6277 |
| 812 | Ga0495620_0011399 | 3300046515 | Bacteria | 4636 |
| 813 | Ga0495620_0086174 | 3300046515 | Bacteria | 1265 |
| 814 | Ga0495620_0102600 | 3300046515 | Bacteria | 1139 |
| 815 | Ga0495620_0129101 | 3300046515 | Bacteria | 993 |
| 816 | Ga0495628_0003496 | 3300046516 | Bacteria | 14061 |
| 817 | Ga0495628_0003725 | 3300046516 | Bacteria | 13566 |
| 818 | Ga0495628_0016052 | 3300046516 | Bacteria | 6249 |
| 819 | Ga0495628_0267383 | 3300046516 | Bacteria | 1273 |
| 820 | Ga0495628_0422647 | 3300046516 | Bacteria | 971 |
| 821 | Ga0495630_0011618 | 3300046517 | Bacteria | 6379 |
| 822 | Ga0495630_0021337 | 3300046517 | Bacteria | 4782 |
| 823 | Ga0495630_0081240 | 3300046517 | Bacteria | 2446 |
| 824 | Ga0495630_0155931 | 3300046517 | Bacteria | 1738 |
| 825 | Ga0495631_0000773 | 3300046518 | Bacteria | 20563 |
| 826 | Ga0495631_0000883 | 3300046518 | Bacteria | 18773 |
| 827 | Ga0495631_0131823 | 3300046518 | Bacteria | 1074 |
| 828 | Ga0495632_0003689 | 3300046519 | Bacteria | 10743 |
| 829 | Ga0495632_0028604 | 3300046519 | Bacteria | 2908 |
| 830 | Ga0495632_0085614 | 3300046519 | Bacteria | 1499 |
| 831 | Ga0495632_0135921 | 3300046519 | Bacteria | 1142 |
| 832 | Ga0495637_0004267 | 3300046520 | Bacteria | 7424 |
| 833 | Ga0495637_0004928 | 3300046520 | Bacteria | 6876 |
| 834 | Ga0495637_0014892 | 3300046520 | Bacteria | 3662 |
| 835 | Ga0495643_0127991 | 3300046522 | Bacteria | 1277 |
| 836 | Ga0495643_0209742 | 3300046522 | Bacteria | 930 |
| 837 | Ga0495648_0001162 | 3300046524 | Bacteria | 26627 |
| 838 | Ga0495648_0006300 | 3300046524 | Bacteria | 9704 |
| 839 | Ga0495648_0189720 | 3300046524 | Bacteria | 1038 |
| 840 | Ga0495666_0000626 | 3300046526 | Bacteria | 15922 |
| 841 | Ga0495642_0150825 | 3300046528 | Bacteria | 1005 |
| 842 | Ga0495652_0012733 | 3300046529 | Bacteria | 7577 |
| 843 | Ga0495652_0017183 | 3300046529 | Bacteria | 6458 |
| 844 | Ga0495652_0312054 | 3300046529 | Bacteria | 1139 |
| 845 | Ga0495654_0000192 | 3300046530 | Bacteria | 59720 |
| 846 | Ga0495654_0000313 | 3300046530 | Bacteria | 42607 |
| 847 | Ga0495654_0007188 | 3300046530 | Bacteria | 6250 |
| 848 | Ga0495654_0009986 | 3300046530 | Bacteria | 5184 |
| 849 | Ga0495654_0034731 | 3300046530 | Bacteria | 2543 |
| 850 | Ga0495665_0003521 | 3300046531 | Bacteria | 8501 |
| 851 | Ga0495665_0137363 | 3300046531 | Bacteria | 1278 |
| 852 | Ga0495640_0014104 | 3300046533 | Bacteria | 6058 |
| 853 | Ga0495587_0001168 | 3300046536 | Bacteria | 17295 |
| 854 | Ga0495587_0140819 | 3300046536 | Bacteria | 1377 |
| 855 | Ga0495609_0000014 | 3300046538 | Bacteria | 326023 |
| 856 | Ga0495609_0036123 | 3300046538 | Bacteria | 2233 |
| 857 | Ga0495609_0057422 | 3300046538 | Bacteria | 1723 |
| 858 | Ga0495621_0004801 | 3300046539 | Bacteria | 3834 |
| 859 | Ga0495597_0001107 | 3300046542 | Bacteria | 20418 |
| 860 | Ga0495597_0068127 | 3300046542 | Bacteria | 1538 |
| 861 | Ga0495645_0014660 | 3300046543 | Bacteria | 5565 |
| 862 | Ga0495645_0015453 | 3300046543 | Bacteria | 5428 |
| 863 | Ga0495645_0022656 | 3300046543 | Bacteria | 4544 |
| 864 | Ga0495645_0325545 | 3300046543 | Bacteria | 997 |
| 865 | Ga0495622_0211359 | 3300046557 | Bacteria | 862 |
| 866 | Ga0495633_0000625 | 3300046558 | Bacteria | 33168 |
| 867 | Ga0495656_0002510 | 3300046615 | Bacteria | 6103 |
| 868 | Ga0495668_0011278 | 3300046616 | Bacteria | 5362 |
| 869 | Ga0495634_0017659 | 3300046642 | Bacteria | 5088 |
| 870 | Ga0495634_0086531 | 3300046642 | Bacteria | 2041 |
| 871 | Ga0495625_0000146 | 3300046660 | Bacteria | 108123 |
| 872 | Ga0495625_0000661 | 3300046660 | Bacteria | 49248 |
| 873 | Ga0495625_0001586 | 3300046660 | Bacteria | 26961 |
| 874 | Ga0495625_0009203 | 3300046660 | Bacteria | 8297 |
| 875 | Ga0495625_0097378 | 3300046660 | Bacteria | 2025 |
| 876 | Ga0495625_0153394 | 3300046660 | Bacteria | 1547 |
| 877 | Ga0495625_0171897 | 3300046660 | Bacteria | 1446 |
| 878 | Ga0495625_0273150 | 3300046660 | Bacteria | 1090 |
| 879 | Ga0495635_0217440 | 3300046663 | Bacteria | 1293 |
| 880 | Ga0495661_0000009 | 3300046665 | Bacteria | 291327 |
| 881 | Ga0495661_0062290 | 3300046665 | Bacteria | 2210 |
| 882 | Ga0495661_0265287 | 3300046665 | Bacteria | 871 |
| 883 | Ga0495588_0011830 | 3300046674 | Bacteria | 4107 |
| 884 | Ga0495588_0016167 | 3300046674 | Bacteria | 3603 |
| 885 | Ga0495588_0024531 | 3300046674 | Bacteria | 2996 |
| 886 | Ga0495657_0177716 | 3300046675 | Bacteria | 1308 |
| 887 | Ga0495599_0004856 | 3300046678 | Bacteria | 7996 |
| 888 | Ga0495623_0006265 | 3300046679 | Bacteria | 7733 |
| 889 | Ga0495623_0012599 | 3300046679 | Bacteria | 5473 |
| 890 | Ga0495646_0000413 | 3300046680 | Bacteria | 22567 |
| 891 | Ga0495646_0011065 | 3300046680 | Bacteria | 5729 |
| 892 | Ga0495646_0020409 | 3300046680 | Bacteria | 4192 |
| 893 | Ga0495646_0095715 | 3300046680 | Bacteria | 1708 |
| 894 | Ga0495658_0141246 | 3300046683 | Bacteria | 1473 |
| 895 | Ga0495613_0111115 | 3300046689 | Bacteria | 1974 |
| 896 | Ga0495624_0005226 | 3300046690 | Bacteria | 9381 |
| 897 | Ga0495624_0059569 | 3300046690 | Bacteria | 2395 |
| 898 | Ga0495670_0174833 | 3300046691 | Bacteria | 1132 |
| 899 | Ga0495671_0001267 | 3300046692 | Bacteria | 17228 |
| 900 | Ga0495671_0042585 | 3300046692 | Bacteria | 2281 |
| 901 | Ga0495671_0105007 | 3300046692 | Bacteria | 1380 |
| 902 | Ga0495671_0112566 | 3300046692 | Bacteria | 1329 |
| 903 | Ga0495649_0000167 | 3300046694 | Bacteria | 57151 |
| 904 | Ga0495649_0001466 | 3300046694 | Bacteria | 17735 |
| 905 | Ga0495649_0011109 | 3300046694 | Bacteria | 5300 |
| 906 | Ga0495649_0020431 | 3300046694 | Bacteria | 3715 |
| 907 | Ga0495649_0248669 | 3300046694 | Bacteria | 914 |
| 908 | Ga0495660_0000992 | 3300046810 | Bacteria | 20689 |
| 909 | Ga0495660_0001495 | 3300046810 | Bacteria | 15816 |
| 910 | Ga0495660_0004737 | 3300046810 | Bacteria | 8214 |
| 911 | Ga0495581_0003594 | 3300047315 | Bacteria | 8917 |
| 912 | Ga0495581_0273821 | 3300047315 | Bacteria | 987 |
| 913 | Ga0495604_0002262 | 3300047317 | Bacteria | 15421 |
| 914 | Ga0495604_0031408 | 3300047317 | Bacteria | 4211 |
| 915 | Ga0495604_0186335 | 3300047317 | Bacteria | 1449 |
| 916 | Ga0495636_0148694 | 3300047318 | Bacteria | 1050 |
| 917 | Ga0495674_0005201 | 3300047319 | Bacteria | 12497 |
| 918 | Ga0495674_0005454 | 3300047319 | Bacteria | 12219 |
| 919 | Ga0495674_0013440 | 3300047319 | Bacteria | 7697 |
| 920 | Ga0495674_0021724 | 3300047319 | Bacteria | 5932 |
| 921 | Ga0495674_0087164 | 3300047319 | Bacteria | 2672 |
| 922 | Ga0495672_0005003 | 3300047320 | Bacteria | 10608 |
| 923 | Ga0495672_0008368 | 3300047320 | Bacteria | 7649 |
| 924 | Ga0495672_0022359 | 3300047320 | Bacteria | 4112 |
| 925 | Ga0495672_0022684 | 3300047320 | Bacteria | 4076 |
| 926 | Ga0495672_0029944 | 3300047320 | Bacteria | 3422 |
| 927 | Ga0495676_0002666 | 3300047321 | Bacteria | 15977 |
| 928 | Ga0495676_0006001 | 3300047321 | Bacteria | 11160 |
| 929 | Ga0495676_0059007 | 3300047321 | Bacteria | 3016 |
| 930 | Ga0495676_0066877 | 3300047321 | Bacteria | 2782 |
| 931 | Ga0495680_0002100 | 3300047322 | Bacteria | 20691 |
| 932 | Ga0495680_0021405 | 3300047322 | Bacteria | 5414 |
| 933 | Ga0495683_0000004 | 3300047323 | Bacteria | 321136 |
| 934 | Ga0495683_0024946 | 3300047323 | Bacteria | 3066 |
| 935 | Ga0495683_0038427 | 3300047323 | Bacteria | 2424 |
| 936 | Ga0495687_000451 | 3300047443 | Bacteria | 50656 |
| 937 | Ga0495687_048175 | 3300047443 | Bacteria | 1829 |
| 938 | Ga0495687_048178 | 3300047443 | Bacteria | 1829 |
| 939 | Ga0495675_0005240 | 3300047444 | Bacteria | 7893 |
| 940 | Ga0495675_0103796 | 3300047444 | Bacteria | 1777 |
| 941 | Ga0495675_0278561 | 3300047444 | Bacteria | 998 |
| 942 | Ga0495679_000472 | 3300047446 | Bacteria | 29136 |
| 943 | Ga0495673_0002876 | 3300047469 | Bacteria | 11710 |
| 944 | Ga0495681_0006549 | 3300047470 | Bacteria | 7631 |
| 945 | Ga0495684_0037247 | 3300047471 | Bacteria | 3730 |
| 946 | Ga0495686_0005491 | 3300047472 | Bacteria | 9980 |
| 947 | Ga0495686_0012210 | 3300047472 | Bacteria | 6018 |
| 948 | Ga0495593_0001905 | 3300047673 | Bacteria | 12435 |
| 949 | Ga0495593_0019945 | 3300047673 | Bacteria | 3755 |
| 950 | Ga0495593_0038193 | 3300047673 | Bacteria | 2593 |
| 951 | Ga0495602_0006074 | 3300048088 | Bacteria | 12665 |
| 952 | Ga0495602_0033131 | 3300048088 | Bacteria | 4852 |
| 953 | Ga0495602_0066872 | 3300048088 | Bacteria | 3094 |
| 954 | Ga0495602_0163284 | 3300048088 | Bacteria | 1737 |
| 955 | Ga0495602_0226379 | 3300048088 | Bacteria | 1408 |
| 956 | Ga0495614_0005110 | 3300048089 | Bacteria | 5919 |
| 957 | Ga0495626_0124677 | 3300048091 | Bacteria | 1104 |
| 958 | Ga0496100_0002213 | 3300048903 | Bacteria | 9823 |
| 959 | Ga0496101_0001976 | 3300048904 | Bacteria | 12432 |
| 960 | Ga0496101_0424783 | 3300048904 | Bacteria | 1048 |
| 961 | Ga0496102_0011642 | 3300048905 | Bacteria | 7592 |
| 962 | Ga0496102_0015674 | 3300048905 | Bacteria | 6603 |
| 963 | Ga0496102_0241533 | 3300048905 | Bacteria | 1703 |
| 964 | Ga0496103_0157530 | 3300048906 | Bacteria | 1456 |
| 965 | Ga0496104_0015072 | 3300048907 | Bacteria | 6996 |
| 966 | Ga0496104_0446086 | 3300048907 | Bacteria | 1206 |
| 967 | Ga0496104_0588534 | 3300048907 | Bacteria | 1023 |
| 968 | Ga0496105_0000980 | 3300048908 | Bacteria | 19637 |
| 969 | Ga0496106_0003842 | 3300048909 | Bacteria | 11195 |
| 970 | Ga0496106_0212778 | 3300048909 | Bacteria | 1540 |
| 971 | Ga0496109_0629337 | 3300048912 | Bacteria | 1010 |
| 972 | Ga0496110_0234732 | 3300048913 | Bacteria | 1668 |
| 973 | Ga0496111_0014555 | 3300048914 | Bacteria | 5378 |
| 974 | Ga0496111_0056450 | 3300048914 | Bacteria | 2841 |
| 975 | Ga0496116_0010201 | 3300048919 | Bacteria | 7902 |
| 976 | Ga0496116_0011992 | 3300048919 | Bacteria | 7116 |
| 977 | Ga0496116_0024989 | 3300048919 | Bacteria | 4402 |
| 978 | Ga0496116_0070269 | 3300048919 | Bacteria | 2222 |
| 979 | Ga0496116_0103806 | 3300048919 | Bacteria | 1690 |
| 980 | Ga0496117_0000032 | 3300048920 | Bacteria | 375533 |
| 981 | Ga0496117_0000428 | 3300048920 | Bacteria | 70517 |
| 982 | Ga0496117_0016574 | 3300048920 | Bacteria | 6209 |
| 983 | Ga0496117_0019294 | 3300048920 | Bacteria | 5607 |
| 984 | Ga0496117_0022148 | 3300048920 | Bacteria | 5103 |
| 985 | Ga0496117_0109369 | 3300048920 | Bacteria | 1726 |
| 986 | Ga0496117_0225350 | 3300048920 | Bacteria | 1040 |
| 987 | Ga0496118_0000027 | 3300048921 | Bacteria | 375533 |
| 988 | Ga0496118_0001373 | 3300048921 | Bacteria | 36687 |
| 989 | Ga0496118_0016483 | 3300048921 | Bacteria | 6776 |
| 990 | Ga0496118_0056110 | 3300048921 | Bacteria | 2964 |
| 991 | Ga0496118_0062498 | 3300048921 | Bacteria | 2748 |
| 992 | Ga0496118_0068269 | 3300048921 | Bacteria | 2583 |
| 993 | Ga0496119_0000011 | 3300048922 | Bacteria | 438315 |
| 994 | Ga0496119_0066278 | 3300048922 | Bacteria | 2134 |
| 995 | Ga0496119_0073429 | 3300048922 | Bacteria | 1995 |
| 996 | Ga0496120_0001187 | 3300048923 | Bacteria | 33127 |
| 997 | Ga0496121_0000233 | 3300048924 | Bacteria | 119434 |
| 998 | Ga0496121_0002222 | 3300048924 | Bacteria | 30310 |
| 999 | Ga0496121_0009084 | 3300048924 | Bacteria | 11506 |
| 1000 | Ga0496121_0010777 | 3300048924 | Bacteria | 10247 |
| 1001 | Ga0496121_0031856 | 3300048924 | Bacteria | 4808 |
| 1002 | Ga0496121_0037742 | 3300048924 | Bacteria | 4286 |
| 1003 | Ga0496121_0068712 | 3300048924 | Bacteria | 2864 |
| 1004 | Ga0496121_0100594 | 3300048924 | Bacteria | 2231 |
| 1005 | Ga0496121_0181769 | 3300048924 | Bacteria | 1517 |
| 1006 | Ga0496121_0195470 | 3300048924 | Bacteria | 1446 |
| 1007 | Ga0496122_0003391 | 3300048925 | Bacteria | 20976 |
| 1008 | Ga0496122_0011489 | 3300048925 | Bacteria | 8957 |
| 1009 | Ga0496122_0016952 | 3300048925 | Bacteria | 6844 |
| 1010 | Ga0496122_0025766 | 3300048925 | Bacteria | 5094 |
| 1011 | Ga0496122_0060756 | 3300048925 | Bacteria | 2780 |
| 1012 | Ga0496122_0102469 | 3300048925 | Bacteria | 1908 |
| 1013 | Ga0496122_0146023 | 3300048925 | Bacteria | 1470 |
| 1014 | Ga0496123_0007507 | 3300048926 | Bacteria | 10239 |
| 1015 | Ga0496123_0013499 | 3300048926 | Bacteria | 6847 |
| 1016 | Ga0496123_0024574 | 3300048926 | Bacteria | 4575 |
| 1017 | Ga0496123_0029756 | 3300048926 | Bacteria | 4011 |
| 1018 | Ga0496123_0035073 | 3300048926 | Bacteria | 3581 |
| 1019 | Ga0496123_0094591 | 3300048926 | Bacteria | 1760 |
| 1020 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 1021 | Ga0496124_0000085 | 3300048927 | Bacteria | 203358 |
| 1022 | Ga0496124_0005442 | 3300048927 | Bacteria | 14316 |
| 1023 | Ga0496124_0069827 | 3300048927 | Bacteria | 2915 |
| 1024 | Ga0496124_0084981 | 3300048927 | Bacteria | 2594 |
| 1025 | Ga0496124_0147287 | 3300048927 | Bacteria | 1851 |
| 1026 | Ga0496124_0254812 | 3300048927 | Bacteria | 1295 |
| 1027 | Ga0496124_0351883 | 3300048927 | Bacteria | 1042 |
| 1028 | Ga0496125_0000096 | 3300048928 | Bacteria | 205618 |
| 1029 | Ga0496125_0000101 | 3300048928 | Bacteria | 202248 |
| 1030 | Ga0496125_0008704 | 3300048928 | Bacteria | 10562 |
| 1031 | Ga0496125_0057514 | 3300048928 | Bacteria | 3149 |
| 1032 | Ga0496125_0082680 | 3300048928 | Bacteria | 2446 |
| 1033 | Ga0496125_0221307 | 3300048928 | Bacteria | 1219 |
| 1034 | Ga0496126_0001857 | 3300048929 | Bacteria | 30790 |
| 1035 | Ga0496126_0069745 | 3300048929 | Bacteria | 3134 |
| 1036 | Ga0496126_0093716 | 3300048929 | Bacteria | 2636 |
| 1037 | Ga0496126_0493835 | 3300048929 | Bacteria | 979 |
| 1038 | Ga0496126_0499397 | 3300048929 | Bacteria | 972 |
| 1039 | Ga0496126_0643539 | 3300048929 | Bacteria | 830 |
| 1040 | Ga0495678_000014 | 3300049459 | Bacteria | 313755 |
| 1041 | Ga0495678_027017 | 3300049459 | Bacteria | 2440 |
| 1042 | Ga0495682_0003529 | 3300049460 | Bacteria | 6930 |
| 1043 | Ga0495682_0010500 | 3300049460 | Bacteria | 3585 |
| 1044 | Ga0501046_0114541 | 3300049580 | Bacteria | 2057 |
| 1045 | Ga0501047_0030621 | 3300049581 | Bacteria | 5187 |
| 1046 | Ga0501047_0059974 | 3300049581 | Bacteria | 3673 |
| 1047 | Ga0501070_0750569 | 3300049586 | Bacteria | 769 |
| 1048 | Ga0501249_012357 | 3300049679 | Bacteria | 1803 |
| 1049 | Ga0501225_0019511 | 3300049705 | Bacteria | 1876 |
| 1050 | Ga0501262_000152 | 3300049759 | Bacteria | 8580 |
| 1051 | nmdc:mga03683_105921_c1 | 3300050489 | Bacteria | 1239 |
| 1052 | nmdc:mga03683_11036_c1 | 3300050489 | Bacteria | 3256 |
| 1053 | nmdc:mga03683_18307_c1 | 3300050489 | Bacteria | 2662 |
| 1054 | nmdc:mga03683_2013_c1 | 3300050489 | Bacteria | 6220 |
| 1055 | nmdc:mga03683_21009_c1 | 3300050489 | Bacteria | 2511 |
| 1056 | nmdc:mga03683_73173_c1 | 3300050489 | Bacteria | 1469 |
| 1057 | nmdc:mga03n38_23409_c1 | 3300050490 | Bacteria | 2512 |
| 1058 | nmdc:mga03n38_3064_c1 | 3300050490 | Bacteria | 5299 |
| 1059 | nmdc:mga03n38_63247_c1 | 3300050490 | Bacteria | 1691 |
| 1060 | nmdc:mga00v17_203009_c1 | 3300050491 | Bacteria | 1282 |
| 1061 | nmdc:mga00v17_45731_c1 | 3300050491 | Bacteria | 2645 |
| 1062 | nmdc:mga00v17_53860_c1 | 3300050491 | Bacteria | 2453 |
| 1063 | nmdc:mga00v17_54408_c1 | 3300050491 | Bacteria | 2441 |
| 1064 | nmdc:mga00v17_7678_c1 | 3300050491 | Bacteria | 5770 |
| 1065 | nmdc:mga00v17_8760_c1 | 3300050491 | Bacteria | 5450 |
| 1066 | nmdc:mga0yw44_36724_c1 | 3300050492 | Bacteria | 2889 |
| 1067 | nmdc:mga0yw44_3952_c1 | 3300050492 | Bacteria | 6686 |
| 1068 | nmdc:mga0k408_102039_c1 | 3300050493 | Bacteria | 1692 |
| 1069 | nmdc:mga0k408_10609_c1 | 3300050493 | Bacteria | 4988 |
| 1070 | nmdc:mga0k408_10736_c1 | 3300050493 | Bacteria | 4962 |
| 1071 | nmdc:mga0k408_123429_c1 | 3300050493 | Bacteria | 1535 |
| 1072 | nmdc:mga0k408_128812_c1 | 3300050493 | Bacteria | 1502 |
| 1073 | nmdc:mga0k408_1452_c1 | 3300050493 | Bacteria | 12811 |
| 1074 | nmdc:mga0k408_152409_c1 | 3300050493 | Bacteria | 1377 |
| 1075 | nmdc:mga0k408_1592_c1 | 3300050493 | Bacteria | 12280 |
| 1076 | nmdc:mga0k408_174746_c1 | 3300050493 | Bacteria | 1281 |
| 1077 | nmdc:mga0k408_20723_c1 | 3300050493 | Bacteria | 3688 |
| 1078 | nmdc:mga0k408_38_c1 | 3300050493 | Bacteria | 69925 |
| 1079 | nmdc:mga0k408_47816_c1 | 3300050493 | Bacteria | 2473 |
| 1080 | nmdc:mga0k408_4859_c1 | 3300050493 | Bacteria | 7130 |
| 1081 | nmdc:mga0k408_4937_c1 | 3300050493 | Bacteria | 7065 |
| 1082 | nmdc:mga0k408_5814_c1 | 3300050493 | Bacteria | 6569 |
| 1083 | nmdc:mga0k408_5920_c1 | 3300050493 | Bacteria | 6523 |
| 1084 | nmdc:mga0k408_8640_c1 | 3300050493 | Bacteria | 5475 |
| 1085 | nmdc:mga06z11_35089_c1 | 3300050494 | Bacteria | 2466 |
| 1086 | nmdc:mga07m45_10646_c1 | 3300050496 | Bacteria | 4810 |
| 1087 | nmdc:mga07m45_12677_c1 | 3300050496 | Bacteria | 4458 |
| 1088 | nmdc:mga07m45_31684_c1 | 3300050496 | Bacteria | 2931 |
| 1089 | nmdc:mga07m45_33368_c1 | 3300050496 | Bacteria | 2859 |
| 1090 | nmdc:mga07m45_6733_c1 | 3300050496 | Bacteria | 5830 |
| 1091 | nmdc:mga07m45_89296_c1 | 3300050496 | Bacteria | 1765 |
| 1092 | nmdc:mga07m45_9001_c1 | 3300050496 | Bacteria | 5158 |
| 1093 | nmdc:mga0sz30_37259_c1 | 3300050516 | Bacteria | 2035 |
| 1094 | nmdc:mga0sz30_43645_c1 | 3300050516 | Bacteria | 1887 |
| 1095 | nmdc:mga0sz30_91293_c1 | 3300050516 | Bacteria | 1325 |
| 1096 | Ga0500610_0023764 | 3300053079 | Bacteria | 3038 |
| 1097 | Ga0500610_0025324 | 3300053079 | Bacteria | 2957 |
| 1098 | Ga0500610_0026635 | 3300053079 | Bacteria | 2895 |
| 1099 | Ga0500610_0119794 | 3300053079 | Bacteria | 1346 |
| 1100 | Ga0500610_0163268 | 3300053079 | Bacteria | 1106 |
| 1101 | Ga0500635_0000030 | 3300053080 | Bacteria | 99936 |
| 1102 | Ga0500635_0040027 | 3300053080 | Bacteria | 1562 |
| 1103 | Ga0500578_0000393 | 3300053086 | Bacteria | 53719 |
| 1104 | Ga0500578_0209435 | 3300053086 | Bacteria | 1190 |
| 1105 | Ga0500643_000694 | 3300053087 | Bacteria | 22492 |
| 1106 | Ga0500643_012300 | 3300053087 | Bacteria | 3069 |
| 1107 | Ga0500644_0006782 | 3300053088 | Bacteria | 2951 |
| 1108 | Ga0500583_0117002 | 3300053092 | Bacteria | 1316 |
| 1109 | Ga0500651_0000468 | 3300053093 | Bacteria | 21321 |
| 1110 | Ga0500651_0038676 | 3300053093 | Bacteria | 3005 |
| 1111 | Ga0500651_0072617 | 3300053093 | Bacteria | 2139 |
| 1112 | Ga0500566_0106792 | 3300053094 | Bacteria | 1527 |
| 1113 | Ga0500641_0059945 | 3300053096 | Bacteria | 1583 |
| 1114 | Ga0500650_0018663 | 3300053098 | Bacteria | 3013 |
| 1115 | Ga0500562_004783 | 3300053108 | Bacteria | 3411 |
| 1116 | Ga0500569_059105 | 3300053109 | Bacteria | 1179 |
| 1117 | Ga0500571_000217 | 3300053110 | Bacteria | 21202 |
| 1118 | Ga0500593_000365 | 3300053117 | Bacteria | 18184 |
| 1119 | Ga0500593_000448 | 3300053117 | Bacteria | 16302 |
| 1120 | Ga0500593_106802 | 3300053117 | Bacteria | 1158 |
| 1121 | Ga0500594_0000278 | 3300053118 | Bacteria | 11929 |
| 1122 | Ga0500594_0004732 | 3300053118 | Bacteria | 3003 |
| 1123 | Ga0500607_000889 | 3300053121 | Bacteria | 28747 |
| 1124 | Ga0500607_056728 | 3300053121 | Bacteria | 2066 |
| 1125 | Ga0500607_159665 | 3300053121 | Bacteria | 1032 |
| 1126 | Ga0500608_004592 | 3300053122 | Bacteria | 5374 |
| 1127 | Ga0500608_060948 | 3300053122 | Bacteria | 1804 |
| 1128 | Ga0500618_001137 | 3300053125 | Bacteria | 12903 |
| 1129 | Ga0500618_002201 | 3300053125 | Bacteria | 7637 |
| 1130 | Ga0500618_005766 | 3300053125 | Bacteria | 3724 |
| 1131 | Ga0500618_058862 | 3300053125 | Bacteria | 865 |
| 1132 | Ga0500626_004723 | 3300053128 | Bacteria | 5222 |
| 1133 | Ga0500642_0037532 | 3300053130 | Bacteria | 2071 |
| 1134 | Ga0500652_000629 | 3300053131 | Bacteria | 12098 |
| 1135 | Ga0500652_192202 | 3300053131 | Bacteria | 832 |
| 1136 | Ga0500655_000301 | 3300053133 | Bacteria | 11205 |
| 1137 | Ga0500655_000418 | 3300053133 | Bacteria | 8938 |
| 1138 | Ga0500658_0000470 | 3300053134 | Bacteria | 17245 |
| 1139 | Ga0500658_0004473 | 3300053134 | Bacteria | 5217 |
| 1140 | Ga0500658_0053858 | 3300053134 | Bacteria | 1651 |
| 1141 | Ga0500559_0000249 | 3300053136 | Bacteria | 42713 |
| 1142 | Ga0500559_0027912 | 3300053136 | Bacteria | 2410 |
| 1143 | Ga0500561_0026293 | 3300053137 | Bacteria | 1425 |
| 1144 | Ga0500564_044553 | 3300053138 | Bacteria | 2037 |
| 1145 | Ga0500564_146821 | 3300053138 | Bacteria | 1008 |
| 1146 | Ga0500573_0005967 | 3300053140 | Bacteria | 6557 |
| 1147 | Ga0500573_0011632 | 3300053140 | Bacteria | 4930 |
| 1148 | Ga0500574_000052 | 3300053141 | Bacteria | 13757 |
| 1149 | Ga0500577_0227899 | 3300053142 | Bacteria | 807 |
| 1150 | Ga0500586_012418 | 3300053145 | Bacteria | 2478 |
| 1151 | Ga0500589_100166 | 3300053147 | Bacteria | 1260 |
| 1152 | Ga0500616_0016583 | 3300053153 | Bacteria | 4190 |
| 1153 | Ga0500616_0049392 | 3300053153 | Bacteria | 2226 |
| 1154 | Ga0500619_000018 | 3300053154 | Bacteria | 52926 |
| 1155 | Ga0500622_0000232 | 3300053156 | Bacteria | 57941 |
| 1156 | Ga0500622_0005316 | 3300053156 | Bacteria | 7763 |
| 1157 | Ga0500622_0014640 | 3300053156 | Bacteria | 4206 |
| 1158 | Ga0500627_0002314 | 3300053158 | Bacteria | 5613 |
| 1159 | Ga0500634_0007218 | 3300053161 | Bacteria | 5456 |
| 1160 | Ga0500638_007998 | 3300053162 | Bacteria | 4474 |
| 1161 | Ga0500636_0003095 | 3300053177 | Bacteria | 9325 |
| 1162 | Ga0500636_0005975 | 3300053177 | Bacteria | 6975 |
| 1163 | Ga0500636_0011020 | 3300053177 | Bacteria | 5288 |
| 1164 | Ga0500636_0128468 | 3300053177 | Bacteria | 1414 |
| 1165 | Ga0500645_016986 | 3300053730 | Bacteria | 2286 |
| 1166 | Ga0500596_007476 | 3300053735 | Bacteria | 1790 |
| 1167 | Ga0466962_0019388 | 3300061719 | Bacteria | 3268 |
| 1168 | Ga0466962_0067365 | 3300061719 | Bacteria | 1709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10039721 | Ga0075366_100397213 | 197 |
| 2 | 3300050493 | nmdc:mga0k408_4937_c1 | nmdc:mga0k408_4937_c1_5018_5710 | 197 |
| 3 | 3300044656 | Ga0466969_0003126 | Ga0466969_0003126_3094_3804 | 199 |
| 4 | 3300044684 | Ga0466966_0010599 | Ga0466966_0010599_2727_3437 | 199 |
| 5 | 3300044693 | Ga0466961_0076414 | Ga0466961_0076414_850_1560 | 199 |
| 6 | 3300045049 | Ga0466959_0006848 | Ga0466959_0006848_6395_7105 | 199 |
| 7 | 3300044683 | Ga0466965_0025004 | Ga0466965_0025004_990_1664 | 201 |
| 8 | 3300044901 | Ga0466960_0004844 | Ga0466960_0004844_2604_3278 | 201 |
| 9 | 3300017792 | Ga0163161_10433207 | Ga0163161_104332072 | 205 |
| 10 | 3300046515 | Ga0495620_0129101 | Ga0495620_0129101_132_806 | 205 |
| 11 | 3300046694 | Ga0495649_0248669 | Ga0495649_0248669_171_845 | 205 |
| 12 | 3300025304 | Ga0209257_1018547 | Ga0209257_10185472 | 208 |
| 13 | 3300003773 | Ga0055537_1008855 | Ga0055537_10088552 | 209 |
| 14 | 3300028786 | Ga0307517_10001174 | Ga0307517_1000117424 | 209 |
| 15 | 3300005289 | Ga0065704_10155909 | Ga0065704_101559092 | 210 |
| 16 | 3300028786 | Ga0307517_10056423 | Ga0307517_100564234 | 210 |
| 17 | 3300053154 | Ga0500619_000018 | Ga0500619_000018_19497_20183 | 210 |
| 18 | 3300003323 | rootH1_10401376 | rootH1_104013762 | 211 |
| 19 | 3300006051 | Ga0075364_10165480 | Ga0075364_101654802 | 211 |
| 20 | 3300009553 | Ga0105249_10596983 | Ga0105249_105969832 | 211 |
| 21 | 3300009553 | Ga0105249_10815586 | Ga0105249_108155862 | 211 |
| 22 | 3300017792 | Ga0163161_10157636 | Ga0163161_101576362 | 211 |
| 23 | 3300025961 | Ga0207712_10326174 | Ga0207712_103261742 | 211 |
| 24 | 3300028794 | Ga0307515_10364524 | Ga0307515_103645242 | 212 |
| 25 | 3300046665 | Ga0495661_0265287 | Ga0495661_0265287_23_733 | 212 |
| 26 | 3300053131 | Ga0500652_192202 | Ga0500652_192202_101_811 | 212 |
| 27 | 3300053137 | Ga0500561_0026293 | Ga0500561_0026293_405_1115 | 212 |
| 28 | 3300053142 | Ga0500577_0227899 | Ga0500577_0227899_26_736 | 212 |
| 29 | 3300053156 | Ga0500622_0005316 | Ga0500622_0005316_6533_7243 | 212 |
| 30 | 3300053177 | Ga0500636_0011020 | Ga0500636_0011020_3766_4476 | 212 |
| 31 | 3300046474 | Ga0495605_0040748 | Ga0495605_0040748_38_694 | 213 |
| 32 | 3300046557 | Ga0495622_0211359 | Ga0495622_0211359_19_723 | 213 |
| 33 | 3300046692 | Ga0495671_0105007 | Ga0495671_0105007_113_817 | 213 |
| 34 | 3300048925 | Ga0496122_0146023 | Ga0496122_0146023_523_1218 | 213 |
| 35 | 3300003751 | Ga0055538_1000051 | Ga0055538_100005115 | 214 |
| 36 | 3300003752 | Ga0055539_1000076 | Ga0055539_100007615 | 214 |
| 37 | 3300003756 | Ga0055533_1000082 | Ga0055533_100008215 | 214 |
| 38 | 3300003759 | Ga0055525_1000109 | Ga0055525_100010915 | 214 |
| 39 | 3300003791 | Ga0055530_10037452 | Ga0055530_100374521 | 214 |
| 40 | 3300003841 | Ga0055541_1000053 | Ga0055541_100005315 | 214 |
| 41 | 3300025224 | Ga0209784_100083 | Ga0209784_10008316 | 214 |
| 42 | 3300025225 | Ga0209566_100102 | Ga0209566_10010216 | 214 |
| 43 | 3300025226 | Ga0209674_100125 | Ga0209674_10012516 | 214 |
| 44 | 3300025230 | Ga0209563_100120 | Ga0209563_10012016 | 214 |
| 45 | 3300025253 | Ga0209677_100076 | Ga0209677_10007616 | 214 |
| 46 | 3300031456 | Ga0307513_10360566 | Ga0307513_103605662 | 214 |
| 47 | 3300033180 | Ga0307510_10159955 | Ga0307510_101599553 | 214 |
| 48 | 3300046515 | Ga0495620_0086174 | Ga0495620_0086174_266_970 | 214 |
| 49 | 3300046542 | Ga0495597_0068127 | Ga0495597_0068127_609_1316 | 214 |
| 50 | 3300046694 | Ga0495649_0020431 | Ga0495649_0020431_544_1248 | 214 |
| 51 | 3300047323 | Ga0495683_0024946 | Ga0495683_0024946_1273_1977 | 214 |
| 52 | 3300047443 | Ga0495687_000451 | Ga0495687_000451_7333_8040 | 214 |
| 53 | 3300048927 | Ga0496124_0000024 | Ga0496124_0000024_270452_271159 | 214 |
| 54 | 3300048929 | Ga0496126_0643539 | Ga0496126_0643539_17_721 | 214 |
| 55 | 3300049460 | Ga0495682_0010500 | Ga0495682_0010500_1552_2256 | 214 |
| 56 | 3300050491 | nmdc:mga00v17_45731_c1 | nmdc:mga00v17_45731_c1_277_984 | 214 |
| 57 | 3300050493 | nmdc:mga0k408_10736_c1 | nmdc:mga0k408_10736_c1_453_1163 | 214 |
| 58 | 3300025292 | Ga0209676_1006693 | Ga0209676_10066934 | 215 |
| 59 | 3300025298 | Ga0209050_1004472 | Ga0209050_10044729 | 215 |
| 60 | 3300046538 | Ga0495609_0000014 | Ga0495609_0000014_138202_138948 | 215 |
| 61 | 3300053117 | Ga0500593_000448 | Ga0500593_000448_7800_8468 | 215 |
| 62 | 3300025919 | Ga0207657_10431067 | Ga0207657_104310672 | 216 |
| 63 | 3300048091 | Ga0495626_0124677 | Ga0495626_0124677_77_790 | 216 |
| 64 | 3300003187 | JGI25151J46595_10001460 | JGI25151J46595_100014607 | 217 |
| 65 | 3300025294 | Ga0209025_1000057 | Ga0209025_1000057200 | 217 |
| 66 | 3300046810 | Ga0495660_0000992 | Ga0495660_0000992_11818_12564 | 217 |
| 67 | 3300053145 | Ga0500586_012418 | Ga0500586_012418_108_797 | 217 |
| 68 | 3300046519 | Ga0495632_0085614 | Ga0495632_0085614_320_1039 | 218 |
| 69 | 3300048905 | Ga0496102_0011642 | Ga0496102_0011642_871_1581 | 218 |
| 70 | 3300053134 | Ga0500658_0053858 | Ga0500658_0053858_288_1007 | 218 |
| 71 | 3300003320 | rootH2_10050129 | rootH2_100501291 | 219 |
| 72 | 3300009545 | Ga0105237_10085232 | Ga0105237_100852322 | 219 |
| 73 | 3300046530 | Ga0495654_0009986 | Ga0495654_0009986_455_1216 | 219 |
| 74 | 3300046616 | Ga0495668_0011278 | Ga0495668_0011278_2574_3320 | 219 |
| 75 | 3300013250 | Ga0171462_1043 | Ga0171462_104349 | 220 |
| 76 | 3300042004 | Ga0439445_0050310 | Ga0439445_0050310_179_937 | 220 |
| 77 | 3300046660 | Ga0495625_0097378 | Ga0495625_0097378_822_1568 | 220 |
| 78 | 3300048920 | Ga0496117_0000428 | Ga0496117_0000428_17570_18304 | 220 |
| 79 | 3300048921 | Ga0496118_0001373 | Ga0496118_0001373_9940_10674 | 220 |
| 80 | 3300049586 | Ga0501070_0750569 | Ga0501070_0750569_36_749 | 220 |
| 81 | 3300044658 | Ga0466972_0002810 | Ga0466972_0002810_701_1366 | 221 |
| 82 | 3300046453 | Ga0495627_000380 | Ga0495627_000380_28319_29065 | 221 |
| 83 | 3300046474 | Ga0495605_0001112 | Ga0495605_0001112_9725_10471 | 221 |
| 84 | 3300053080 | Ga0500635_0000030 | Ga0500635_0000030_46188_46925 | 221 |
| 85 | 3300053140 | Ga0500573_0005967 | Ga0500573_0005967_3355_4101 | 221 |
| 86 | iso_pu_bacteria | 2585428058 | 2587733651 | 221 |
| 87 | 3300003322 | rootL2_10034467 | rootL2_100344673 | 222 |
| 88 | 3300006195 | Ga0075366_10006394 | Ga0075366_100063945 | 222 |
| 89 | 3300006353 | Ga0075370_10071807 | Ga0075370_100718073 | 222 |
| 90 | 3300046457 | Ga0495590_0023666 | Ga0495590_0023666_847_1566 | 222 |
| 91 | 3300046460 | Ga0495638_0092437 | Ga0495638_0092437_74_808 | 222 |
| 92 | 3300046513 | Ga0495616_0054140 | Ga0495616_0054140_1030_1749 | 222 |
| 93 | 3300046694 | Ga0495649_0011109 | Ga0495649_0011109_897_1616 | 222 |
| 94 | 3300050493 | nmdc:mga0k408_1452_c1 | nmdc:mga0k408_1452_c1_7900_8607 | 222 |
| 95 | 3300053136 | Ga0500559_0000249 | Ga0500559_0000249_6801_7535 | 222 |
| 96 | 3300028794 | Ga0307515_10000842 | Ga0307515_1000084227 | 223 |
| 97 | 3300028794 | Ga0307515_10037126 | Ga0307515_100371265 | 223 |
| 98 | 3300031456 | Ga0307513_10006822 | Ga0307513_100068223 | 223 |
| 99 | 3300031456 | Ga0307513_10116986 | Ga0307513_101169862 | 223 |
| 100 | 3300031507 | Ga0307509_10000654 | Ga0307509_1000065435 | 223 |
| 101 | 3300031616 | Ga0307508_10000333 | Ga0307508_1000033323 | 223 |
| 102 | 3300031730 | Ga0307516_10009389 | Ga0307516_100093899 | 223 |
| 103 | 3300033180 | Ga0307510_10001775 | Ga0307510_1000177511 | 223 |
| 104 | 3300041456 | Ga0451795_0556773 | Ga0451795_0556773_480_1199 | 223 |
| 105 | 3300041496 | Ga0451839_1210773 | Ga0451839_1210773_457_1176 | 223 |
| 106 | 3300041512 | Ga0451853_3319420 | Ga0451853_3319420_1295_2014 | 223 |
| 107 | 3300041997 | Ga0439431_0004108 | Ga0439431_0004108_133_891 | 223 |
| 108 | 3300046454 | Ga0495592_0000967 | Ga0495592_0000967_16164_16898 | 223 |
| 109 | 3300046471 | Ga0495650_0018553 | Ga0495650_0018553_606_1349 | 223 |
| 110 | 3300046512 | Ga0495610_0013222 | Ga0495610_0013222_2641_3360 | 223 |
| 111 | 3300046512 | Ga0495610_0059906 | Ga0495610_0059906_928_1662 | 223 |
| 112 | 3300046519 | Ga0495632_0135921 | Ga0495632_0135921_207_926 | 223 |
| 113 | 3300046522 | Ga0495643_0209742 | Ga0495643_0209742_131_850 | 223 |
| 114 | 3300046680 | Ga0495646_0020409 | Ga0495646_0020409_1049_1783 | 223 |
| 115 | 3300053088 | Ga0500644_0006782 | Ga0500644_0006782_147_881 | 223 |
| 116 | 3300053093 | Ga0500651_0038676 | Ga0500651_0038676_41_775 | 223 |
| 117 | 3300053118 | Ga0500594_0004732 | Ga0500594_0004732_1039_1773 | 223 |
| 118 | 3300031507 | Ga0307509_10098125 | Ga0307509_100981253 | 224 |
| 119 | 3300033179 | Ga0307507_10064150 | Ga0307507_100641503 | 224 |
| 120 | 3300042004 | Ga0439445_0003396 | Ga0439445_0003396_1841_2572 | 224 |
| 121 | 3300042115 | Ga0450911_000104 | Ga0450911_000104_33418_34149 | 224 |
| 122 | 3300046660 | Ga0495625_0001586 | Ga0495625_0001586_9306_10028 | 224 |
| 123 | 3300048927 | Ga0496124_0254812 | Ga0496124_0254812_462_1193 | 224 |
| 124 | 3300048928 | Ga0496125_0008704 | Ga0496125_0008704_5057_5788 | 224 |
| 125 | iso_pu_bacteria | 2643221569 | 2643859506 | 224 |
| 126 | iso_pu_bacteria | 2643221594 | 2643978806 | 224 |
| 127 | iso_pu_bacteria | 2643221609 | 2644060764 | 224 |
| 128 | iso_pu_bacteria | 2643221611 | 2644071634 | 224 |
| 129 | iso_pu_bacteria | 2687453129 | 2687578254 | 224 |
| 130 | iso_pu_bacteria | 2808606395 | 2809036437 | 224 |
| 131 | iso_pu_bacteria | 2857542790 | 2857545068 | 224 |
| 132 | iso_pu_bacteria | 2857576091 | 2857578410 | 224 |
| 133 | iso_pu_bacteria | 2881412998 | 2881414867 | 224 |
| 134 | iso_pu_bacteria | 2941479691 | 2941483339 | 224 |
| 135 | 3300006195 | Ga0075366_10056113 | Ga0075366_100561132 | 225 |
| 136 | 3300006353 | Ga0075370_10019416 | Ga0075370_100194165 | 225 |
| 137 | 3300048919 | Ga0496116_0024989 | Ga0496116_0024989_2963_3703 | 225 |
| 138 | 3300048924 | Ga0496121_0068712 | Ga0496121_0068712_1368_2108 | 225 |
| 139 | 3300048925 | Ga0496122_0060756 | Ga0496122_0060756_725_1441 | 225 |
| 140 | 3300048928 | Ga0496125_0000101 | Ga0496125_0000101_35916_36632 | 225 |
| 141 | 3300050489 | nmdc:mga03683_105921_c1 | nmdc:mga03683_105921_c1_539_1222 | 225 |
| 142 | iso_pu_bacteria | 2932410948 | 2932413823 | 225 |
| 143 | iso_pu_bacteria | 2932416698 | 2932417883 | 225 |
| 144 | 3300003791 | Ga0055530_10005744 | Ga0055530_100057445 | 226 |
| 145 | 3300005329 | Ga0070683_100634969 | Ga0070683_1006349691 | 226 |
| 146 | 3300005354 | Ga0070675_100202229 | Ga0070675_1002022292 | 226 |
| 147 | 3300025298 | Ga0209050_1000178 | Ga0209050_100017841 | 226 |
| 148 | 3300031616 | Ga0307508_10436645 | Ga0307508_104366452 | 226 |
| 149 | 3300041460 | Ga0451802_0869575 | Ga0451802_0869575_222_941 | 226 |
| 150 | 3300046458 | Ga0495591_000023 | Ga0495591_000023_182479_183225 | 226 |
| 151 | 3300046501 | Ga0495607_0001514 | Ga0495607_0001514_8372_9118 | 226 |
| 152 | 3300046520 | Ga0495637_0014892 | Ga0495637_0014892_586_1332 | 226 |
| 153 | 3300046542 | Ga0495597_0001107 | Ga0495597_0001107_8372_9118 | 226 |
| 154 | 3300046810 | Ga0495660_0001495 | Ga0495660_0001495_8358_9104 | 226 |
| 155 | 3300047320 | Ga0495672_0022684 | Ga0495672_0022684_2865_3611 | 226 |
| 156 | 3300048907 | Ga0496104_0588534 | Ga0496104_0588534_120_857 | 226 |
| 157 | 3300053092 | Ga0500583_0117002 | Ga0500583_0117002_459_1139 | 226 |
| 158 | 3300053096 | Ga0500641_0059945 | Ga0500641_0059945_241_921 | 226 |
| 159 | 3300053138 | Ga0500564_146821 | Ga0500564_146821_216_953 | 226 |
| 160 | 3300053156 | Ga0500622_0014640 | Ga0500622_0014640_549_1229 | 226 |
| 161 | 3300053177 | Ga0500636_0005975 | Ga0500636_0005975_4841_5578 | 226 |
| 162 | 3300003322 | rootL2_10143669 | rootL2_101436693 | 227 |
| 163 | 3300028794 | Ga0307515_10002513 | Ga0307515_1000251313 | 227 |
| 164 | 3300028794 | Ga0307515_10020574 | Ga0307515_100205745 | 227 |
| 165 | 3300028794 | Ga0307515_10182403 | Ga0307515_101824033 | 227 |
| 166 | 3300030522 | Ga0307512_10010124 | Ga0307512_100101249 | 227 |
| 167 | 3300031456 | Ga0307513_10389383 | Ga0307513_103893831 | 227 |
| 168 | 3300046506 | Ga0495583_0000306 | Ga0495583_0000306_3085_3822 | 227 |
| 169 | 3300046507 | Ga0495606_0000644 | Ga0495606_0000644_31714_32451 | 227 |
| 170 | 3300046660 | Ga0495625_0009203 | Ga0495625_0009203_763_1485 | 227 |
| 171 | 3300046694 | Ga0495649_0000167 | Ga0495649_0000167_55170_55907 | 227 |
| 172 | 3300053086 | Ga0500578_0209435 | Ga0500578_0209435_284_1021 | 227 |
| 173 | 3300053093 | Ga0500651_0072617 | Ga0500651_0072617_284_1021 | 227 |
| 174 | 3300053125 | Ga0500618_001137 | Ga0500618_001137_3167_3910 | 227 |
| 175 | 3300053730 | Ga0500645_016986 | Ga0500645_016986_454_1203 | 227 |
| 176 | iso_pu_bacteria | 2643221592 | 2643967139 | 227 |
| 177 | iso_pu_bacteria | 2643221625 | 2644139969 | 227 |
| 178 | iso_pu_bacteria | 2643221648 | 2644271209 | 227 |
| 179 | 3300006946 | Ga0079104_1000014 | Ga0079104_1000014189 | 228 |
| 180 | 3300013100 | Ga0157373_10083632 | Ga0157373_100836322 | 228 |
| 181 | 3300027111 | Ga0209281_1000032 | Ga0209281_1000032189 | 228 |
| 182 | 3300028794 | Ga0307515_10000030 | Ga0307515_10000030201 | 228 |
| 183 | 3300041997 | Ga0439431_0046420 | Ga0439431_0046420_401_1087 | 228 |
| 184 | 3300042007 | Ga0439449_0020580 | Ga0439449_0020580_738_1490 | 228 |
| 185 | 3300047472 | Ga0495686_0005491 | Ga0495686_0005491_8154_8846 | 228 |
| 186 | 3300050491 | nmdc:mga00v17_53860_c1 | nmdc:mga00v17_53860_c1_880_1569 | 228 |
| 187 | 3300050491 | nmdc:mga00v17_7678_c1 | nmdc:mga00v17_7678_c1_2964_3653 | 228 |
| 188 | iso_pu_bacteria | 643348564 | 643598654 | 228 |
| 189 | 3300005288 | Ga0065714_10064788 | Ga0065714_1006478810 | 229 |
| 190 | 3300009036 | Ga0105244_10139950 | Ga0105244_101399502 | 229 |
| 191 | 3300013306 | Ga0163162_10135136 | Ga0163162_101351363 | 229 |
| 192 | 3300014497 | Ga0182008_10005923 | Ga0182008_100059232 | 229 |
| 193 | 3300015261 | Ga0182006_1000053 | Ga0182006_1000053121 | 229 |
| 194 | 3300015262 | Ga0182007_10000075 | Ga0182007_1000007521 | 229 |
| 195 | 3300015265 | Ga0182005_1000031 | Ga0182005_100003191 | 229 |
| 196 | 3300044656 | Ga0466969_0080316 | Ga0466969_0080316_776_1465 | 229 |
| 197 | 3300044693 | Ga0466961_0025923 | Ga0466961_0025923_3047_3736 | 229 |
| 198 | 3300046452 | Ga0495617_000044 | Ga0495617_000044_69072_69761 | 229 |
| 199 | 3300046530 | Ga0495654_0007188 | Ga0495654_0007188_4209_4901 | 229 |
| 200 | 3300046558 | Ga0495633_0000625 | Ga0495633_0000625_24531_25223 | 229 |
| 201 | 3300048919 | Ga0496116_0070269 | Ga0496116_0070269_859_1551 | 229 |
| 202 | 3300048920 | Ga0496117_0000032 | Ga0496117_0000032_252362_253054 | 229 |
| 203 | 3300048921 | Ga0496118_0000027 | Ga0496118_0000027_122480_123172 | 229 |
| 204 | 3300048924 | Ga0496121_0009084 | Ga0496121_0009084_2580_3272 | 229 |
| 205 | 3300048924 | Ga0496121_0010777 | Ga0496121_0010777_233_925 | 229 |
| 206 | 3300048925 | Ga0496122_0003391 | Ga0496122_0003391_11674_12366 | 229 |
| 207 | 3300048926 | Ga0496123_0007507 | Ga0496123_0007507_9243_9935 | 229 |
| 208 | 3300048928 | Ga0496125_0082680 | Ga0496125_0082680_30_722 | 229 |
| 209 | 3300048928 | Ga0496125_0221307 | Ga0496125_0221307_30_722 | 229 |
| 210 | 3300049460 | Ga0495682_0003529 | Ga0495682_0003529_1630_2322 | 229 |
| 211 | 3300061719 | Ga0466962_0067365 | Ga0466962_0067365_584_1273 | 229 |
| 212 | iso_pu_bacteria | 2585428057 | 2587729077 | 229 |
| 213 | iso_pu_bacteria | 2606217733 | 2608384181 | 229 |
| 214 | iso_pu_bacteria | 2857542790 | 2857542907 | 229 |
| 215 | iso_pu_bacteria | 2932801729 | 2932802888 | 229 |
| 216 | iso_pu_bacteria | 2935883170 | 2935885228 | 229 |
| 217 | iso_pu_bacteria | 2599185292 | 2599904659 | 230 |
| 218 | iso_pu_bacteria | 2643221569 | 2643860966 | 230 |
| 219 | iso_pu_bacteria | 2643221594 | 2643981106 | 230 |
| 220 | iso_pu_bacteria | 2643221621 | 2644124568 | 230 |
| 221 | iso_pu_bacteria | 2808606395 | 2809034974 | 230 |
| 222 | iso_pu_bacteria | 2818991467 | 2819721881 | 230 |
| 223 | iso_pu_bacteria | 2831265667 | 2831271813 | 230 |
| 224 | iso_pu_bacteria | 2838054893 | 2838059604 | 230 |
| 225 | iso_pu_bacteria | 2841760612 | 2841764224 | 230 |
| 226 | iso_pu_bacteria | 2844104063 | 2844108321 | 230 |
| 227 | iso_pu_bacteria | 2851182111 | 2851185544 | 230 |
| 228 | iso_pu_bacteria | 2851246043 | 2851250659 | 230 |
| 229 | iso_pu_bacteria | 2885192300 | 2885196850 | 230 |
| 230 | iso_pu_bacteria | 2885198086 | 2885198700 | 230 |
| 231 | iso_pu_bacteria | 2885211737 | 2885211920 | 230 |
| 232 | iso_pu_bacteria | 2885366525 | 2885370240 | 230 |
| 233 | iso_pu_bacteria | 2928037797 | 2928041357 | 230 |
| 234 | iso_pu_bacteria | 2928044640 | 2928048199 | 230 |
| 235 | iso_pu_bacteria | 2928064002 | 2928066477 | 230 |
| 236 | iso_pu_bacteria | 2928084124 | 2928087673 | 230 |
| 237 | iso_pu_bacteria | 2941479691 | 2941485930 | 230 |
| 238 | 3300005262 | Ga0065165_1000707 | Ga0065165_10007076 | 231 |
| 239 | 3300005334 | Ga0068869_100183386 | Ga0068869_1001833862 | 231 |
| 240 | 3300005353 | Ga0070669_100447370 | Ga0070669_1004473702 | 231 |
| 241 | 3300005354 | Ga0070675_100065901 | Ga0070675_1000659014 | 231 |
| 242 | 3300005355 | Ga0070671_100304832 | Ga0070671_1003048322 | 231 |
| 243 | 3300005356 | Ga0070674_100233356 | Ga0070674_1002333562 | 231 |
| 244 | 3300005367 | Ga0070667_100604933 | Ga0070667_1006049331 | 231 |
| 245 | 3300005543 | Ga0070672_100109110 | Ga0070672_1001091103 | 231 |
| 246 | 3300013306 | Ga0163162_10550796 | Ga0163162_105507962 | 231 |
| 247 | 3300013308 | Ga0157375_10231827 | Ga0157375_102318272 | 231 |
| 248 | 3300021361 | Ga0213872_10000681 | Ga0213872_1000068115 | 231 |
| 249 | 3300025273 | Ga0209673_1003402 | Ga0209673_10034022 | 231 |
| 250 | 3300025931 | Ga0207644_10173699 | Ga0207644_101736992 | 231 |
| 251 | 3300025940 | Ga0207691_10065263 | Ga0207691_100652633 | 231 |
| 252 | 3300025942 | Ga0207689_10198759 | Ga0207689_101987591 | 231 |
| 253 | 3300028786 | Ga0307517_10107801 | Ga0307517_101078013 | 231 |
| 254 | 3300039447 | Ga0436361_1111077 | Ga0436361_1111077_4612_5310 | 231 |
| 255 | 3300042126 | Ga0450888_020924 | Ga0450888_020924_38_796 | 231 |
| 256 | 3300053086 | Ga0500578_0000393 | Ga0500578_0000393_2400_3098 | 231 |
| 257 | 3300053117 | Ga0500593_106802 | Ga0500593_106802_22_720 | 231 |
| 258 | iso_pu_bacteria | 2894023352 | 2894027605 | 231 |
| 259 | iso_pu_bacteria | 2932422444 | 2932424782 | 231 |
| 260 | 3300021361 | Ga0213872_10003867 | Ga0213872_100038676 | 232 |
| 261 | 3300025297 | Ga0209758_1000213 | Ga0209758_100021354 | 232 |
| 262 | 3300026121 | Ga0207683_10501281 | Ga0207683_105012811 | 232 |
| 263 | 3300033180 | Ga0307510_10168688 | Ga0307510_101686882 | 232 |
| 264 | 3300039447 | Ga0436361_0044104 | Ga0436361_0044104_20114_20863 | 232 |
| 265 | 3300046460 | Ga0495638_0016815 | Ga0495638_0016815_1695_2399 | 232 |
| 266 | 3300047315 | Ga0495581_0273821 | Ga0495581_0273821_23_730 | 232 |
| 267 | iso_pu_bacteria | 2547132374 | 2548499715 | 232 |
| 268 | iso_pu_bacteria | 2585428062 | 2587756455 | 232 |
| 269 | iso_pu_bacteria | 2643221717 | 2644644968 | 232 |
| 270 | iso_pu_bacteria | 2824704595 | 2824705453 | 232 |
| 271 | 3300002773 | JGI25152J39213_1001016 | JGI25152J39213_100101613 | 233 |
| 272 | 3300002774 | JGI25150J39212_1005624 | JGI25150J39212_10056243 | 233 |
| 273 | 3300003771 | Ga0055526_1001310 | Ga0055526_100131012 | 233 |
| 274 | 3300006051 | Ga0075364_10028552 | Ga0075364_100285523 | 233 |
| 275 | 3300025245 | Ga0207425_1000328 | Ga0207425_100032830 | 233 |
| 276 | 3300025258 | Ga0209129_1000035 | Ga0209129_1000035310 | 233 |
| 277 | 3300025273 | Ga0209673_1012164 | Ga0209673_10121642 | 233 |
| 278 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024504 | 233 |
| 279 | 3300025297 | Ga0209758_1000066 | Ga0209758_10000668 | 233 |
| 280 | 3300025299 | Ga0209256_1011869 | Ga0209256_10118693 | 233 |
| 281 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006541 | 233 |
| 282 | 3300031456 | Ga0307513_10388942 | Ga0307513_103889421 | 233 |
| 283 | 3300041452 | Ga0451793_0300542 | Ga0451793_0300542_2120_2824 | 233 |
| 284 | 3300041456 | Ga0451795_0268819 | Ga0451795_0268819_163_867 | 233 |
| 285 | 3300041458 | Ga0451798_0006020 | Ga0451798_0006020_125_829 | 233 |
| 286 | 3300041459 | Ga0451800_0725212 | Ga0451800_0725212_475_1179 | 233 |
| 287 | 3300041460 | Ga0451802_1174236 | Ga0451802_1174236_192_896 | 233 |
| 288 | 3300041463 | Ga0451804_0208994 | Ga0451804_0208994_1493_2197 | 233 |
| 289 | 3300041486 | Ga0451807_1859406 | Ga0451807_1859406_1508_2212 | 233 |
| 290 | 3300046519 | Ga0495632_0003689 | Ga0495632_0003689_4220_4924 | 233 |
| 291 | 3300048924 | Ga0496121_0031856 | Ga0496121_0031856_3463_4173 | 233 |
| 292 | 3300048927 | Ga0496124_0000085 | Ga0496124_0000085_119528_120238 | 233 |
| 293 | 3300050491 | nmdc:mga00v17_8760_c1 | nmdc:mga00v17_8760_c1_233_943 | 233 |
| 294 | 3300053098 | Ga0500650_0018663 | Ga0500650_0018663_1522_2226 | 233 |
| 295 | 3300053109 | Ga0500569_059105 | Ga0500569_059105_367_1071 | 233 |
| 296 | 3300053130 | Ga0500642_0037532 | Ga0500642_0037532_136_840 | 233 |
| 297 | 3300053131 | Ga0500652_000629 | Ga0500652_000629_6208_6912 | 233 |
| 298 | 3300053156 | Ga0500622_0000232 | Ga0500622_0000232_34027_34731 | 233 |
| 299 | iso_pu_bacteria | 2588253510 | 2588294036 | 233 |
| 300 | iso_pu_bacteria | 2738543013 | 2739248661 | 233 |
| 301 | iso_pu_bacteria | 2842677519 | 2842677637 | 233 |
| 302 | iso_pu_bacteria | 2945945610 | 2945946223 | 233 |
| 303 | iso_pu_bacteria | 2945972063 | 2945975825 | 233 |
| 304 | 3300001989 | JGI24739J22299_10050406 | JGI24739J22299_100504062 | 234 |
| 305 | 3300002987 | JGI25159J45721_1001730 | JGI25159J45721_10017306 | 234 |
| 306 | 3300003187 | JGI25151J46595_10033571 | JGI25151J46595_100335713 | 234 |
| 307 | 3300003215 | JGI25153J46596_10000151 | JGI25153J46596_1000015153 | 234 |
| 308 | 3300003781 | Ga0055536_1029422 | Ga0055536_10294221 | 234 |
| 309 | 3300003791 | Ga0055530_10005422 | Ga0055530_100054222 | 234 |
| 310 | 3300003794 | Ga0055531_10002248 | Ga0055531_1000224815 | 234 |
| 311 | 3300004625 | Ga0055543_1006414 | Ga0055543_10064142 | 234 |
| 312 | 3300005262 | Ga0065165_1000229 | Ga0065165_100022940 | 234 |
| 313 | 3300005262 | Ga0065165_1086121 | Ga0065165_10861211 | 234 |
| 314 | 3300005334 | Ga0068869_100414763 | Ga0068869_1004147632 | 234 |
| 315 | 3300005344 | Ga0070661_100104326 | Ga0070661_1001043262 | 234 |
| 316 | 3300005456 | Ga0070678_100547491 | Ga0070678_1005474912 | 234 |
| 317 | 3300005564 | Ga0070664_100047658 | Ga0070664_1000476584 | 234 |
| 318 | 3300005616 | Ga0068852_100418916 | Ga0068852_1004189162 | 234 |
| 319 | 3300006177 | Ga0075362_10006362 | Ga0075362_100063622 | 234 |
| 320 | 3300006177 | Ga0075362_10013681 | Ga0075362_100136812 | 234 |
| 321 | 3300006195 | Ga0075366_10002875 | Ga0075366_100028758 | 234 |
| 322 | 3300006195 | Ga0075366_10129714 | Ga0075366_101297142 | 234 |
| 323 | 3300006353 | Ga0075370_10046452 | Ga0075370_100464523 | 234 |
| 324 | 3300009036 | Ga0105244_10010597 | Ga0105244_100105973 | 234 |
| 325 | 3300009148 | Ga0105243_10010819 | Ga0105243_100108196 | 234 |
| 326 | 3300011119 | Ga0105246_10820727 | Ga0105246_108207271 | 234 |
| 327 | 3300012502 | Ga0157347_1009801 | Ga0157347_10098012 | 234 |
| 328 | 3300015262 | Ga0182007_10006880 | Ga0182007_100068805 | 234 |
| 329 | 3300025284 | Ga0209130_1000045 | Ga0209130_100004521 | 234 |
| 330 | 3300025292 | Ga0209676_1001946 | Ga0209676_10019468 | 234 |
| 331 | 3300025294 | Ga0209025_1000893 | Ga0209025_10008938 | 234 |
| 332 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012096 | 234 |
| 333 | 3300025298 | Ga0209050_1000460 | Ga0209050_10004608 | 234 |
| 334 | 3300025299 | Ga0209256_1014142 | Ga0209256_10141423 | 234 |
| 335 | 3300025303 | Ga0209051_1001862 | Ga0209051_100186214 | 234 |
| 336 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057334 | 234 |
| 337 | 3300025728 | Ga0207655_1003178 | Ga0207655_10031785 | 234 |
| 338 | 3300025904 | Ga0207647_10125275 | Ga0207647_101252752 | 234 |
| 339 | 3300025933 | Ga0207706_10016401 | Ga0207706_100164015 | 234 |
| 340 | 3300025935 | Ga0207709_10000491 | Ga0207709_1000049111 | 234 |
| 341 | 3300025942 | Ga0207689_10278214 | Ga0207689_102782142 | 234 |
| 342 | 3300025945 | Ga0207679_10041723 | Ga0207679_100417232 | 234 |
| 343 | 3300026067 | Ga0207678_10248208 | Ga0207678_102482081 | 234 |
| 344 | 3300026116 | Ga0207674_10101659 | Ga0207674_101016593 | 234 |
| 345 | 3300026142 | Ga0207698_10107910 | Ga0207698_101079103 | 234 |
| 346 | 3300028794 | Ga0307515_10002244 | Ga0307515_1000224415 | 234 |
| 347 | 3300030500 | Ga0268256_1011353 | Ga0268256_10113532 | 234 |
| 348 | 3300031238 | Ga0265332_10001568 | Ga0265332_1000156811 | 234 |
| 349 | 3300031548 | Ga0307408_100227105 | Ga0307408_1002271052 | 234 |
| 350 | 3300031731 | Ga0307405_10023955 | Ga0307405_100239552 | 234 |
| 351 | 3300031911 | Ga0307412_10070878 | Ga0307412_100708783 | 234 |
| 352 | 3300041404 | Ga0439436_0000486 | Ga0439436_0000486_4401_5111 | 234 |
| 353 | 3300041406 | Ga0439439_0009488 | Ga0439439_0009488_666_1376 | 234 |
| 354 | 3300041413 | Ga0439465_0141694 | Ga0439465_0141694_49_759 | 234 |
| 355 | 3300042007 | Ga0439449_0007725 | Ga0439449_0007725_1785_2495 | 234 |
| 356 | 3300042127 | Ga0450890_008032 | Ga0450890_008032_186_896 | 234 |
| 357 | 3300042134 | Ga0450898_012684 | Ga0450898_012684_485_1195 | 234 |
| 358 | 3300042435 | Ga0439434_0047894 | Ga0439434_0047894_86_796 | 234 |
| 359 | 3300044683 | Ga0466965_0013432 | Ga0466965_0013432_1228_1938 | 234 |
| 360 | 3300048905 | Ga0496102_0241533 | Ga0496102_0241533_689_1399 | 234 |
| 361 | 3300048906 | Ga0496103_0157530 | Ga0496103_0157530_570_1280 | 234 |
| 362 | 3300048912 | Ga0496109_0629337 | Ga0496109_0629337_202_912 | 234 |
| 363 | 3300048919 | Ga0496116_0103806 | Ga0496116_0103806_791_1507 | 234 |
| 364 | 3300048920 | Ga0496117_0019294 | Ga0496117_0019294_3141_3851 | 234 |
| 365 | 3300048920 | Ga0496117_0225350 | Ga0496117_0225350_157_867 | 234 |
| 366 | 3300048921 | Ga0496118_0056110 | Ga0496118_0056110_1703_2419 | 234 |
| 367 | 3300048922 | Ga0496119_0066278 | Ga0496119_0066278_1257_1973 | 234 |
| 368 | 3300048922 | Ga0496119_0073429 | Ga0496119_0073429_640_1350 | 234 |
| 369 | 3300048924 | Ga0496121_0002222 | Ga0496121_0002222_24028_24744 | 234 |
| 370 | 3300048925 | Ga0496122_0011489 | Ga0496122_0011489_668_1378 | 234 |
| 371 | 3300048925 | Ga0496122_0016952 | Ga0496122_0016952_1155_1871 | 234 |
| 372 | 3300048925 | Ga0496122_0102469 | Ga0496122_0102469_430_1146 | 234 |
| 373 | 3300048926 | Ga0496123_0013499 | Ga0496123_0013499_4977_5693 | 234 |
| 374 | 3300048927 | Ga0496124_0084981 | Ga0496124_0084981_1180_1896 | 234 |
| 375 | 3300048927 | Ga0496124_0147287 | Ga0496124_0147287_513_1229 | 234 |
| 376 | 3300048928 | Ga0496125_0000096 | Ga0496125_0000096_4722_5438 | 234 |
| 377 | 3300049580 | Ga0501046_0114541 | Ga0501046_0114541_836_1543 | 234 |
| 378 | 3300049581 | Ga0501047_0059974 | Ga0501047_0059974_1892_2599 | 234 |
| 379 | 3300050489 | nmdc:mga03683_11036_c1 | nmdc:mga03683_11036_c1_2004_2714 | 234 |
| 380 | 3300050489 | nmdc:mga03683_2013_c1 | nmdc:mga03683_2013_c1_38_775 | 234 |
| 381 | 3300050493 | nmdc:mga0k408_20723_c1 | nmdc:mga0k408_20723_c1_559_1269 | 234 |
| 382 | 3300050496 | nmdc:mga07m45_12677_c1 | nmdc:mga07m45_12677_c1_905_1612 | 234 |
| 383 | 3300050496 | nmdc:mga07m45_9001_c1 | nmdc:mga07m45_9001_c1_399_1109 | 234 |
| 384 | 3300050516 | nmdc:mga0sz30_91293_c1 | nmdc:mga0sz30_91293_c1_235_945 | 234 |
| 385 | iso_pu_bacteria | 2904434214 | 2904434230 | 234 |
| 386 | iso_pu_bacteria | 2945909444 | 2945910210 | 234 |
| 387 | iso_pu_bacteria | 2945984333 | 2945987764 | 234 |
| 388 | 3300005455 | Ga0070663_100149105 | Ga0070663_1001491052 | 235 |
| 389 | 3300015683 | Ga0183362_10001 | Ga0183362_10001980 | 235 |
| 390 | 3300046501 | Ga0495607_0001321 | Ga0495607_0001321_6717_7463 | 235 |
| 391 | 3300047320 | Ga0495672_0029944 | Ga0495672_0029944_60_806 | 235 |
| 392 | iso_pu_bacteria | 2808606386 | 2808984121 | 235 |
| 393 | iso_pu_bacteria | 2808606415 | 2809132145 | 235 |
| 394 | iso_pu_bacteria | 2808606419 | 2809151718 | 235 |
| 395 | iso_pu_bacteria | 2852618963 | 2852623071 | 235 |
| 396 | 3300014497 | Ga0182008_10000412 | Ga0182008_1000041224 | 236 |
| 397 | 3300041404 | Ga0439436_0004722 | Ga0439436_0004722_1107_1832 | 236 |
| 398 | 3300041411 | Ga0439466_0048484 | Ga0439466_0048484_215_940 | 236 |
| 399 | 3300041997 | Ga0439431_0001562 | Ga0439431_0001562_885_1610 | 236 |
| 400 | 3300041999 | Ga0439433_0003311 | Ga0439433_0003311_375_1100 | 236 |
| 401 | 3300042004 | Ga0439445_0009673 | Ga0439445_0009673_216_941 | 236 |
| 402 | 3300042006 | Ga0439432_005828 | Ga0439432_005828_1108_1833 | 236 |
| 403 | 3300042007 | Ga0439449_0005212 | Ga0439449_0005212_3933_4658 | 236 |
| 404 | 3300042010 | Ga0439452_001192 | Ga0439452_001192_4809_5534 | 236 |
| 405 | 3300042015 | Ga0439462_0014056 | Ga0439462_0014056_1001_1726 | 236 |
| 406 | 3300042156 | Ga0439446_0013356 | Ga0439446_0013356_1155_1880 | 236 |
| 407 | 3300042435 | Ga0439434_0062989 | Ga0439434_0062989_96_821 | 236 |
| 408 | 3300048929 | Ga0496126_0493835 | Ga0496126_0493835_109_825 | 236 |
| 409 | iso_pu_bacteria | 2687453129 | 2687579196 | 236 |
| 410 | iso_pu_bacteria | 2738543012 | 2739241044 | 236 |
| 411 | iso_pu_bacteria | 2791355137 | 2792834528 | 236 |
| 412 | 3300003322 | rootL2_10050359 | rootL2_100503592 | 237 |
| 413 | 3300003784 | Ga0055534_1001134 | Ga0055534_100113410 | 237 |
| 414 | 3300005548 | Ga0070665_100009677 | Ga0070665_1000096776 | 237 |
| 415 | 3300006048 | Ga0075363_100033189 | Ga0075363_1000331892 | 237 |
| 416 | 3300006058 | Ga0075432_10011587 | Ga0075432_100115873 | 237 |
| 417 | 3300006177 | Ga0075362_10033080 | Ga0075362_100330803 | 237 |
| 418 | 3300006178 | Ga0075367_10043998 | Ga0075367_100439983 | 237 |
| 419 | 3300006948 | Ga0099826_10190731 | Ga0099826_101907312 | 237 |
| 420 | 3300009098 | Ga0105245_10244713 | Ga0105245_102447132 | 237 |
| 421 | 3300021361 | Ga0213872_10015097 | Ga0213872_100150973 | 237 |
| 422 | 3300025284 | Ga0209130_1019026 | Ga0209130_10190262 | 237 |
| 423 | 3300025291 | Ga0209675_1000683 | Ga0209675_100068316 | 237 |
| 424 | 3300025304 | Ga0209257_1048255 | Ga0209257_10482552 | 237 |
| 425 | 3300027907 | Ga0207428_10257875 | Ga0207428_102578752 | 237 |
| 426 | 3300028379 | Ga0268266_10033588 | Ga0268266_100335884 | 237 |
| 427 | 3300030732 | Ga0316176_1214160 | Ga0316176_12141602 | 237 |
| 428 | 3300031548 | Ga0307408_100479725 | Ga0307408_1004797252 | 237 |
| 429 | 3300031731 | Ga0307405_10101759 | Ga0307405_101017592 | 237 |
| 430 | 3300032005 | Ga0307411_10051181 | Ga0307411_100511813 | 237 |
| 431 | 3300032005 | Ga0307411_10823714 | Ga0307411_108237141 | 237 |
| 432 | 3300039447 | Ga0436361_0716290 | Ga0436361_0716290_38032_38751 | 237 |
| 433 | 3300041404 | Ga0439436_0007676 | Ga0439436_0007676_1350_2072 | 237 |
| 434 | 3300041411 | Ga0439466_0018576 | Ga0439466_0018576_394_1116 | 237 |
| 435 | 3300041413 | Ga0439465_0011301 | Ga0439465_0011301_1368_2090 | 237 |
| 436 | 3300042123 | Ga0450921_001811 | Ga0450921_001811_168_890 | 237 |
| 437 | 3300042134 | Ga0450898_008877 | Ga0450898_008877_602_1324 | 237 |
| 438 | 3300042184 | Ga0450908_002904 | Ga0450908_002904_994_1716 | 237 |
| 439 | 3300042435 | Ga0439434_0010043 | Ga0439434_0010043_541_1263 | 237 |
| 440 | 3300042531 | Ga0450918_001241 | Ga0450918_001241_4199_4921 | 237 |
| 441 | 3300046517 | Ga0495630_0081240 | Ga0495630_0081240_406_1140 | 237 |
| 442 | 3300046660 | Ga0495625_0000661 | Ga0495625_0000661_47711_48433 | 237 |
| 443 | 3300047319 | Ga0495674_0005201 | Ga0495674_0005201_3521_4255 | 237 |
| 444 | 3300048924 | Ga0496121_0037742 | Ga0496121_0037742_2755_3519 | 237 |
| 445 | 3300049679 | Ga0501249_012357 | Ga0501249_012357_804_1526 | 237 |
| 446 | 3300049705 | Ga0501225_0019511 | Ga0501225_0019511_528_1250 | 237 |
| 447 | 3300049759 | Ga0501262_000152 | Ga0501262_000152_7139_7861 | 237 |
| 448 | 3300050490 | nmdc:mga03n38_63247_c1 | nmdc:mga03n38_63247_c1_139_861 | 237 |
| 449 | 3300050491 | nmdc:mga00v17_203009_c1 | nmdc:mga00v17_203009_c1_70_792 | 237 |
| 450 | 3300050492 | nmdc:mga0yw44_36724_c1 | nmdc:mga0yw44_36724_c1_1291_2013 | 237 |
| 451 | 3300050493 | nmdc:mga0k408_128812_c1 | nmdc:mga0k408_128812_c1_90_812 | 237 |
| 452 | 3300050496 | nmdc:mga07m45_10646_c1 | nmdc:mga07m45_10646_c1_1571_2293 | 237 |
| 453 | iso_pu_bacteria | 2765235838 | 2765567209 | 237 |
| 454 | iso_pu_bacteria | 2816332133 | 2816471878 | 237 |
| 455 | iso_pu_bacteria | 2839094727 | 2839095149 | 237 |
| 456 | iso_pu_bacteria | 2904541872 | 2904545007 | 237 |
| 457 | iso_pu_bacteria | 2929160207 | 2929165180 | 237 |
| 458 | 3300005842 | Ga0068858_100832898 | Ga0068858_1008328981 | 238 |
| 459 | 3300053125 | Ga0500618_005766 | Ga0500618_005766_1487_2221 | 238 |
| 460 | iso_pu_bacteria | 2842348783 | 2842349902 | 238 |
| 461 | iso_pu_bacteria | 2842454564 | 2842454868 | 238 |
| 462 | iso_pu_bacteria | 2842843487 | 2842843640 | 238 |
| 463 | 3300003187 | JGI25151J46595_10004189 | JGI25151J46595_100041897 | 239 |
| 464 | 3300005614 | Ga0068856_100476594 | Ga0068856_1004765942 | 239 |
| 465 | 3300037068 | Ga0373925_0387142 | Ga0373925_0387142_82_837 | 239 |
| 466 | 3300044658 | Ga0466972_0000708 | Ga0466972_0000708_3523_4287 | 239 |
| 467 | 3300044683 | Ga0466965_0354874 | Ga0466965_0354874_11_775 | 239 |
| 468 | 3300044735 | Ga0466968_0008282 | Ga0466968_0008282_1644_2408 | 239 |
| 469 | 3300044901 | Ga0466960_0007734 | Ga0466960_0007734_2228_2992 | 239 |
| 470 | 3300053079 | Ga0500610_0163268 | Ga0500610_0163268_356_1084 | 239 |
| 471 | 3300005339 | Ga0070660_100042053 | Ga0070660_1000420532 | 240 |
| 472 | 3300005455 | Ga0070663_100087966 | Ga0070663_1000879663 | 240 |
| 473 | 3300005530 | Ga0070679_100054296 | Ga0070679_1000542963 | 240 |
| 474 | 3300005543 | Ga0070672_100642816 | Ga0070672_1006428162 | 240 |
| 475 | 3300005563 | Ga0068855_100046805 | Ga0068855_1000468053 | 240 |
| 476 | 3300009174 | Ga0105241_10718906 | Ga0105241_107189062 | 240 |
| 477 | 3300009551 | Ga0105238_10246666 | Ga0105238_102466662 | 240 |
| 478 | 3300015262 | Ga0182007_10006376 | Ga0182007_100063763 | 240 |
| 479 | 3300025909 | Ga0207705_10015142 | Ga0207705_100151426 | 240 |
| 480 | 3300025919 | Ga0207657_10018853 | Ga0207657_100188534 | 240 |
| 481 | 3300025921 | Ga0207652_10110945 | Ga0207652_101109453 | 240 |
| 482 | 3300025924 | Ga0207694_10230685 | Ga0207694_102306852 | 240 |
| 483 | 3300025949 | Ga0207667_10099751 | Ga0207667_100997512 | 240 |
| 484 | 3300031456 | Ga0307513_10108752 | Ga0307513_101087523 | 240 |
| 485 | 3300042007 | Ga0439449_0002065 | Ga0439449_0002065_1025_1774 | 240 |
| 486 | 3300042015 | Ga0439462_0010395 | Ga0439462_0010395_1025_1774 | 240 |
| 487 | 3300047472 | Ga0495686_0012210 | Ga0495686_0012210_2440_3177 | 240 |
| 488 | 3300053079 | Ga0500610_0119794 | Ga0500610_0119794_160_918 | 240 |
| 489 | 3300053121 | Ga0500607_159665 | Ga0500607_159665_209_940 | 240 |
| 490 | 3300053147 | Ga0500589_100166 | Ga0500589_100166_252_989 | 240 |
| 491 | 3300006178 | Ga0075367_10080453 | Ga0075367_100804532 | 241 |
| 492 | 3300006237 | Ga0097621_100297213 | Ga0097621_1002972132 | 241 |
| 493 | 3300006358 | Ga0068871_100201548 | Ga0068871_1002015483 | 241 |
| 494 | 3300025940 | Ga0207691_10420480 | Ga0207691_104204802 | 241 |
| 495 | 3300028573 | Ga0265334_10060317 | Ga0265334_100603171 | 241 |
| 496 | 3300028666 | Ga0265336_10000013 | Ga0265336_1000001321 | 241 |
| 497 | 3300031730 | Ga0307516_10000136 | Ga0307516_1000013643 | 241 |
| 498 | 3300046453 | Ga0495627_017729 | Ga0495627_017729_501_1289 | 241 |
| 499 | 3300046459 | Ga0495629_0072486 | Ga0495629_0072486_1136_1870 | 241 |
| 500 | 3300046462 | Ga0495651_0186321 | Ga0495651_0186321_686_1420 | 241 |
| 501 | 3300046463 | Ga0495653_0002408 | Ga0495653_0002408_10904_11638 | 241 |
| 502 | 3300046471 | Ga0495650_0008643 | Ga0495650_0008643_3950_4708 | 241 |
| 503 | 3300046471 | Ga0495650_0030600 | Ga0495650_0030600_1416_2150 | 241 |
| 504 | 3300046475 | Ga0495639_0009042 | Ga0495639_0009042_775_1509 | 241 |
| 505 | 3300046516 | Ga0495628_0016052 | Ga0495628_0016052_3254_3988 | 241 |
| 506 | 3300046516 | Ga0495628_0422647 | Ga0495628_0422647_86_820 | 241 |
| 507 | 3300046517 | Ga0495630_0011618 | Ga0495630_0011618_4743_5477 | 241 |
| 508 | 3300046526 | Ga0495666_0000626 | Ga0495666_0000626_2397_3131 | 241 |
| 509 | 3300046529 | Ga0495652_0017183 | Ga0495652_0017183_4468_5202 | 241 |
| 510 | 3300046529 | Ga0495652_0312054 | Ga0495652_0312054_224_958 | 241 |
| 511 | 3300046531 | Ga0495665_0003521 | Ga0495665_0003521_3456_4190 | 241 |
| 512 | 3300046538 | Ga0495609_0057422 | Ga0495609_0057422_691_1425 | 241 |
| 513 | 3300046642 | Ga0495634_0086531 | Ga0495634_0086531_162_896 | 241 |
| 514 | 3300046679 | Ga0495623_0006265 | Ga0495623_0006265_144_878 | 241 |
| 515 | 3300046690 | Ga0495624_0005226 | Ga0495624_0005226_3711_4445 | 241 |
| 516 | 3300047317 | Ga0495604_0002262 | Ga0495604_0002262_8637_9371 | 241 |
| 517 | 3300047319 | Ga0495674_0005454 | Ga0495674_0005454_10090_10824 | 241 |
| 518 | 3300047319 | Ga0495674_0013440 | Ga0495674_0013440_3677_4411 | 241 |
| 519 | 3300047321 | Ga0495676_0002666 | Ga0495676_0002666_3414_4148 | 241 |
| 520 | 3300047322 | Ga0495680_0002100 | Ga0495680_0002100_13747_14481 | 241 |
| 521 | 3300047444 | Ga0495675_0005240 | Ga0495675_0005240_6839_7573 | 241 |
| 522 | 3300047673 | Ga0495593_0001905 | Ga0495593_0001905_3303_4037 | 241 |
| 523 | 3300048088 | Ga0495602_0006074 | Ga0495602_0006074_6719_7453 | 241 |
| 524 | 3300048924 | Ga0496121_0000233 | Ga0496121_0000233_97545_98279 | 241 |
| 525 | 3300048926 | Ga0496123_0024574 | Ga0496123_0024574_2809_3597 | 241 |
| 526 | 3300048929 | Ga0496126_0001857 | Ga0496126_0001857_9080_9814 | 241 |
| 527 | 3300003187 | JGI25151J46595_10000262 | JGI25151J46595_1000026226 | 242 |
| 528 | 3300005355 | Ga0070671_100061377 | Ga0070671_1000613773 | 242 |
| 529 | 3300005617 | Ga0068859_100212786 | Ga0068859_1002127862 | 242 |
| 530 | 3300005841 | Ga0068863_100116157 | Ga0068863_1001161573 | 242 |
| 531 | 3300006931 | Ga0097620_100212794 | Ga0097620_1002127942 | 242 |
| 532 | 3300009098 | Ga0105245_10130847 | Ga0105245_101308472 | 242 |
| 533 | 3300013306 | Ga0163162_10480458 | Ga0163162_104804582 | 242 |
| 534 | 3300013308 | Ga0157375_10108427 | Ga0157375_101084273 | 242 |
| 535 | 3300025294 | Ga0209025_1000057 | Ga0209025_1000057232 | 242 |
| 536 | 3300046459 | Ga0495629_0074081 | Ga0495629_0074081_70_807 | 242 |
| 537 | 3300046463 | Ga0495653_0073660 | Ga0495653_0073660_652_1389 | 242 |
| 538 | 3300046472 | Ga0495580_0001423 | Ga0495580_0001423_3690_4427 | 242 |
| 539 | 3300046472 | Ga0495580_0005484 | Ga0495580_0005484_5655_6392 | 242 |
| 540 | 3300046473 | Ga0495582_0027193 | Ga0495582_0027193_725_1462 | 242 |
| 541 | 3300046477 | Ga0495664_0085697 | Ga0495664_0085697_430_1167 | 242 |
| 542 | 3300046499 | Ga0495594_0067088 | Ga0495594_0067088_730_1467 | 242 |
| 543 | 3300046507 | Ga0495606_0156666 | Ga0495606_0156666_552_1289 | 242 |
| 544 | 3300046514 | Ga0495618_0008335 | Ga0495618_0008335_1437_2174 | 242 |
| 545 | 3300046516 | Ga0495628_0003496 | Ga0495628_0003496_4094_4831 | 242 |
| 546 | 3300046516 | Ga0495628_0003725 | Ga0495628_0003725_3196_3933 | 242 |
| 547 | 3300046517 | Ga0495630_0021337 | Ga0495630_0021337_83_820 | 242 |
| 548 | 3300046524 | Ga0495648_0001162 | Ga0495648_0001162_11025_11762 | 242 |
| 549 | 3300046524 | Ga0495648_0006300 | Ga0495648_0006300_3844_4581 | 242 |
| 550 | 3300046531 | Ga0495665_0137363 | Ga0495665_0137363_159_896 | 242 |
| 551 | 3300046533 | Ga0495640_0014104 | Ga0495640_0014104_507_1244 | 242 |
| 552 | 3300046536 | Ga0495587_0001168 | Ga0495587_0001168_16010_16747 | 242 |
| 553 | 3300046543 | Ga0495645_0022656 | Ga0495645_0022656_3627_4364 | 242 |
| 554 | 3300046642 | Ga0495634_0017659 | Ga0495634_0017659_455_1192 | 242 |
| 555 | 3300046665 | Ga0495661_0062290 | Ga0495661_0062290_31_768 | 242 |
| 556 | 3300046674 | Ga0495588_0011830 | Ga0495588_0011830_2420_3157 | 242 |
| 557 | 3300046678 | Ga0495599_0004856 | Ga0495599_0004856_5689_6426 | 242 |
| 558 | 3300046679 | Ga0495623_0012599 | Ga0495623_0012599_1179_1916 | 242 |
| 559 | 3300046680 | Ga0495646_0000413 | Ga0495646_0000413_1472_2209 | 242 |
| 560 | 3300046689 | Ga0495613_0111115 | Ga0495613_0111115_159_896 | 242 |
| 561 | 3300046690 | Ga0495624_0059569 | Ga0495624_0059569_1571_2308 | 242 |
| 562 | 3300047315 | Ga0495581_0003594 | Ga0495581_0003594_5938_6675 | 242 |
| 563 | 3300047317 | Ga0495604_0031408 | Ga0495604_0031408_1421_2158 | 242 |
| 564 | 3300047319 | Ga0495674_0021724 | Ga0495674_0021724_159_896 | 242 |
| 565 | 3300047319 | Ga0495674_0087164 | Ga0495674_0087164_19_756 | 242 |
| 566 | 3300047321 | Ga0495676_0006001 | Ga0495676_0006001_6130_6867 | 242 |
| 567 | 3300047322 | Ga0495680_0021405 | Ga0495680_0021405_4647_5384 | 242 |
| 568 | 3300047444 | Ga0495675_0103796 | Ga0495675_0103796_10_747 | 242 |
| 569 | 3300047446 | Ga0495679_000472 | Ga0495679_000472_14684_15421 | 242 |
| 570 | 3300047471 | Ga0495684_0037247 | Ga0495684_0037247_135_872 | 242 |
| 571 | 3300047673 | Ga0495593_0019945 | Ga0495593_0019945_1443_2180 | 242 |
| 572 | 3300048088 | Ga0495602_0066872 | Ga0495602_0066872_1443_2180 | 242 |
| 573 | 3300048089 | Ga0495614_0005110 | Ga0495614_0005110_159_896 | 242 |
| 574 | 3300048922 | Ga0496119_0000011 | Ga0496119_0000011_208708_209445 | 242 |
| 575 | 3300048923 | Ga0496120_0001187 | Ga0496120_0001187_22188_22925 | 242 |
| 576 | iso_pu_bacteria | 2904541872 | 2904546135 | 242 |
| 577 | iso_pu_bacteria | 2904584206 | 2904586077 | 242 |
| 578 | iso_pu_bacteria | 2904589729 | 2904592110 | 242 |
| 579 | iso_pu_bacteria | 2904601388 | 2904601733 | 242 |
| 580 | iso_pu_bacteria | 2919079590 | 2919084812 | 242 |
| 581 | iso_pu_bacteria | 2929160207 | 2929163953 | 242 |
| 582 | 3300025931 | Ga0207644_10163672 | Ga0207644_101636722 | 243 |
| 583 | 3300026095 | Ga0207676_10142739 | Ga0207676_101427393 | 243 |
| 584 | 3300046452 | Ga0495617_030769 | Ga0495617_030769_212_958 | 243 |
| 585 | 3300046453 | Ga0495627_000062 | Ga0495627_000062_39269_40015 | 243 |
| 586 | 3300046458 | Ga0495591_011049 | Ga0495591_011049_915_1661 | 243 |
| 587 | 3300046463 | Ga0495653_0000761 | Ga0495653_0000761_14306_15052 | 243 |
| 588 | 3300046471 | Ga0495650_0004823 | Ga0495650_0004823_385_1131 | 243 |
| 589 | 3300046501 | Ga0495607_0001124 | Ga0495607_0001124_20865_21611 | 243 |
| 590 | 3300046507 | Ga0495606_0001437 | Ga0495606_0001437_7882_8628 | 243 |
| 591 | 3300046518 | Ga0495631_0000773 | Ga0495631_0000773_7960_8706 | 243 |
| 592 | 3300046519 | Ga0495632_0028604 | Ga0495632_0028604_622_1368 | 243 |
| 593 | 3300046530 | Ga0495654_0000192 | Ga0495654_0000192_25654_26400 | 243 |
| 594 | 3300046692 | Ga0495671_0042585 | Ga0495671_0042585_1135_1881 | 243 |
| 595 | 3300046810 | Ga0495660_0004737 | Ga0495660_0004737_6027_6773 | 243 |
| 596 | 3300047320 | Ga0495672_0008368 | Ga0495672_0008368_595_1341 | 243 |
| 597 | 3300047320 | Ga0495672_0022359 | Ga0495672_0022359_1364_2119 | 243 |
| 598 | 3300049459 | Ga0495678_027017 | Ga0495678_027017_289_1035 | 243 |
| 599 | iso_pu_bacteria | 2511231003 | 2511250493 | 243 |
| 600 | iso_pu_bacteria | 2515154123 | 2515691153 | 243 |
| 601 | iso_pu_bacteria | 2738541296 | 2738824353 | 243 |
| 602 | iso_pu_bacteria | 2738541298 | 2738836716 | 243 |
| 603 | iso_pu_bacteria | 2738541306 | 2738878247 | 243 |
| 604 | iso_pu_bacteria | 2738543002 | 2739189939 | 243 |
| 605 | iso_pu_bacteria | 2738543008 | 2739224840 | 243 |
| 606 | iso_pu_bacteria | 2818991450 | 2819622512 | 243 |
| 607 | iso_pu_bacteria | 2856287931 | 2856288044 | 243 |
| 608 | iso_pu_bacteria | 2857357740 | 2857358334 | 243 |
| 609 | iso_pu_bacteria | 2900634093 | 2900639981 | 243 |
| 610 | iso_pu_bacteria | 2921643360 | 2921645939 | 243 |
| 611 | iso_pu_bacteria | 2928108538 | 2928111925 | 243 |
| 612 | iso_pu_bacteria | 2928135762 | 2928139164 | 243 |
| 613 | iso_pu_bacteria | 2928503688 | 2928508868 | 243 |
| 614 | iso_pu_bacteria | 8055266321 | 8055273397 | 243 |
| 615 | 3300002773 | JGI25152J39213_1000073 | JGI25152J39213_100007344 | 244 |
| 616 | 3300002774 | JGI25150J39212_1000062 | JGI25150J39212_100006244 | 244 |
| 617 | 3300002987 | JGI25159J45721_1000058 | JGI25159J45721_100005828 | 244 |
| 618 | 3300003187 | JGI25151J46595_10000255 | JGI25151J46595_1000025526 | 244 |
| 619 | 3300003215 | JGI25153J46596_10000165 | JGI25153J46596_1000016544 | 244 |
| 620 | 3300003354 | JGI25160J50197_1000181 | JGI25160J50197_100018128 | 244 |
| 621 | 3300003374 | JGI25161J50226_1000145 | JGI25161J50226_100014526 | 244 |
| 622 | 3300003771 | Ga0055526_1000146 | Ga0055526_100014626 | 244 |
| 623 | 3300003773 | Ga0055537_1000090 | Ga0055537_100009044 | 244 |
| 624 | 3300003775 | Ga0055524_1000195 | Ga0055524_100019544 | 244 |
| 625 | 3300003784 | Ga0055534_1000101 | Ga0055534_100010144 | 244 |
| 626 | 3300003790 | Ga0055528_1000111 | Ga0055528_100011144 | 244 |
| 627 | 3300003794 | Ga0055531_10001310 | Ga0055531_1000131018 | 244 |
| 628 | 3300004625 | Ga0055543_1000232 | Ga0055543_100023215 | 244 |
| 629 | 3300005262 | Ga0065165_1000683 | Ga0065165_100068325 | 244 |
| 630 | 3300025245 | Ga0207425_1000042 | Ga0207425_100004252 | 244 |
| 631 | 3300025258 | Ga0209129_1000058 | Ga0209129_100005858 | 244 |
| 632 | 3300025263 | Ga0209565_1000027 | Ga0209565_100002773 | 244 |
| 633 | 3300025273 | Ga0209673_1000031 | Ga0209673_100003163 | 244 |
| 634 | 3300025284 | Ga0209130_1000025 | Ga0209130_100002558 | 244 |
| 635 | 3300025291 | Ga0209675_1000064 | Ga0209675_100006447 | 244 |
| 636 | 3300025292 | Ga0209676_1000633 | Ga0209676_100063319 | 244 |
| 637 | 3300025294 | Ga0209025_1000075 | Ga0209025_1000075233 | 244 |
| 638 | 3300025295 | Ga0209564_1000040 | Ga0209564_1000040156 | 244 |
| 639 | 3300025297 | Ga0209758_1000050 | Ga0209758_1000050281 | 244 |
| 640 | 3300025299 | Ga0209256_1000023 | Ga0209256_1000023281 | 244 |
| 641 | 3300025302 | Ga0207426_1000118 | Ga0207426_100011847 | 244 |
| 642 | 3300025303 | Ga0209051_1001382 | Ga0209051_100138218 | 244 |
| 643 | 3300025304 | Ga0209257_1000188 | Ga0209257_1000188126 | 244 |
| 644 | 3300031456 | Ga0307513_10053784 | Ga0307513_100537844 | 244 |
| 645 | 3300044656 | Ga0466969_0007670 | Ga0466969_0007670_1602_2345 | 244 |
| 646 | 3300044683 | Ga0466965_0000290 | Ga0466965_0000290_2610_3353 | 244 |
| 647 | 3300044684 | Ga0466966_0028973 | Ga0466966_0028973_2001_2744 | 244 |
| 648 | 3300044693 | Ga0466961_0077753 | Ga0466961_0077753_958_1701 | 244 |
| 649 | 3300044694 | Ga0466963_0148113 | Ga0466963_0148113_480_1223 | 244 |
| 650 | 3300044706 | Ga0466964_0010149 | Ga0466964_0010149_1175_1918 | 244 |
| 651 | 3300044719 | Ga0466971_0009952 | Ga0466971_0009952_1883_2626 | 244 |
| 652 | 3300044765 | Ga0466970_0008244 | Ga0466970_0008244_3536_4279 | 244 |
| 653 | 3300044842 | Ga0466957_0001020 | Ga0466957_0001020_736_1479 | 244 |
| 654 | 3300045049 | Ga0466959_0002228 | Ga0466959_0002228_9962_10705 | 244 |
| 655 | 3300045836 | Ga0466958_0015767 | Ga0466958_0015767_1609_2352 | 244 |
| 656 | 3300045976 | Ga0466967_0051642 | Ga0466967_0051642_2218_2961 | 244 |
| 657 | 3300046512 | Ga0495610_0002534 | Ga0495610_0002534_1829_2569 | 244 |
| 658 | 3300046665 | Ga0495661_0000009 | Ga0495661_0000009_271136_271876 | 244 |
| 659 | 3300047323 | Ga0495683_0000004 | Ga0495683_0000004_88553_89293 | 244 |
| 660 | 3300047469 | Ga0495673_0002876 | Ga0495673_0002876_9142_9882 | 244 |
| 661 | 3300047470 | Ga0495681_0006549 | Ga0495681_0006549_5638_6378 | 244 |
| 662 | 3300048925 | Ga0496122_0025766 | Ga0496122_0025766_4273_5013 | 244 |
| 663 | 3300048926 | Ga0496123_0035073 | Ga0496123_0035073_1018_1758 | 244 |
| 664 | 3300049459 | Ga0495678_000014 | Ga0495678_000014_225104_225844 | 244 |
| 665 | 3300061719 | Ga0466962_0019388 | Ga0466962_0019388_830_1573 | 244 |
| 666 | iso_pu_bacteria | 2508501050 | 2508730175 | 244 |
| 667 | iso_pu_bacteria | 2738541277 | 2738722602 | 244 |
| 668 | iso_pu_bacteria | 2738543019 | 2739283173 | 244 |
| 669 | iso_pu_bacteria | 2775506901 | 2776266414 | 244 |
| 670 | iso_pu_bacteria | 2844315083 | 2844322769 | 244 |
| 671 | iso_pu_bacteria | 2903727486 | 2903734715 | 244 |
| 672 | iso_pu_bacteria | 2906602504 | 2906604974 | 244 |
| 673 | iso_pu_bacteria | 3005594810 | 3005602636 | 244 |
| 674 | iso_pu_bacteria | 3005710791 | 3005716980 | 244 |
| 675 | iso_pu_bacteria | 3005718088 | 3005726106 | 244 |
| 676 | iso_pu_bacteria | 8056967851 | 8056976571 | 244 |
| 677 | 3300002704 | JGI25155J39150_1000334 | JGI25155J39150_10003347 | 245 |
| 678 | 3300002705 | JGI25156J39149_1008436 | JGI25156J39149_10084362 | 245 |
| 679 | 3300002738 | JGI25154J39366_1000262 | JGI25154J39366_100026219 | 245 |
| 680 | 3300003781 | Ga0055536_1000113 | Ga0055536_100011372 | 245 |
| 681 | 3300003792 | Ga0055540_1000045 | Ga0055540_100004554 | 245 |
| 682 | 3300003794 | Ga0055531_10000149 | Ga0055531_1000014955 | 245 |
| 683 | 3300005288 | Ga0065714_10002413 | Ga0065714_100024138 | 245 |
| 684 | 3300005288 | Ga0065714_10091146 | Ga0065714_100911463 | 245 |
| 685 | 3300005456 | Ga0070678_100499699 | Ga0070678_1004996992 | 245 |
| 686 | 3300005563 | Ga0068855_100024941 | Ga0068855_1000249416 | 245 |
| 687 | 3300005563 | Ga0068855_100461994 | Ga0068855_1004619942 | 245 |
| 688 | 3300006058 | Ga0075432_10070482 | Ga0075432_100704822 | 245 |
| 689 | 3300025206 | Ga0209435_100104 | Ga0209435_1001049 | 245 |
| 690 | 3300025228 | Ga0209672_103796 | Ga0209672_1037962 | 245 |
| 691 | 3300025246 | Ga0209646_1000108 | Ga0209646_1000108105 | 245 |
| 692 | 3300025250 | Ga0209026_1002531 | Ga0209026_10025316 | 245 |
| 693 | 3300025256 | Ga0209759_1000173 | Ga0209759_10001734 | 245 |
| 694 | 3300025292 | Ga0209676_1000135 | Ga0209676_1000135105 | 245 |
| 695 | 3300025298 | Ga0209050_1000100 | Ga0209050_100010079 | 245 |
| 696 | 3300025303 | Ga0209051_1000067 | Ga0209051_1000067148 | 245 |
| 697 | 3300025304 | Ga0209257_1000095 | Ga0209257_100009593 | 245 |
| 698 | 3300025909 | Ga0207705_10317095 | Ga0207705_103170952 | 245 |
| 699 | 3300025913 | Ga0207695_10026593 | Ga0207695_100265934 | 245 |
| 700 | 3300025949 | Ga0207667_10002561 | Ga0207667_100025616 | 245 |
| 701 | 3300025949 | Ga0207667_10256617 | Ga0207667_102566171 | 245 |
| 702 | 3300028794 | Ga0307515_10096844 | Ga0307515_100968443 | 245 |
| 703 | 3300031548 | Ga0307408_100308081 | Ga0307408_1003080812 | 245 |
| 704 | 3300032002 | Ga0307416_100524000 | Ga0307416_1005240002 | 245 |
| 705 | 3300032004 | Ga0307414_10085437 | Ga0307414_100854373 | 245 |
| 706 | 3300032004 | Ga0307414_10189735 | Ga0307414_101897352 | 245 |
| 707 | 3300037312 | Ga0395899_0003953 | Ga0395899_0003953_2070_2822 | 245 |
| 708 | 3300037418 | Ga0395900_0013023 | Ga0395900_0013023_7044_7796 | 245 |
| 709 | 3300037418 | Ga0395900_0082740 | Ga0395900_0082740_317_1069 | 245 |
| 710 | 3300037466 | Ga0395898_0210532 | Ga0395898_0210532_655_1407 | 245 |
| 711 | 3300037471 | Ga0395905_0446154 | Ga0395905_0446154_127_879 | 245 |
| 712 | 3300038443 | Ga0395901_0044783 | Ga0395901_0044783_316_1068 | 245 |
| 713 | 3300041486 | Ga0451807_0874863 | Ga0451807_0874863_141_917 | 245 |
| 714 | 3300046516 | Ga0495628_0267383 | Ga0495628_0267383_191_946 | 245 |
| 715 | 3300046529 | Ga0495652_0012733 | Ga0495652_0012733_5467_6222 | 245 |
| 716 | 3300046543 | Ga0495645_0014660 | Ga0495645_0014660_2421_3176 | 245 |
| 717 | 3300046680 | Ga0495646_0011065 | Ga0495646_0011065_2716_3471 | 245 |
| 718 | 3300048088 | Ga0495602_0226379 | Ga0495602_0226379_130_885 | 245 |
| 719 | 3300050493 | nmdc:mga0k408_38_c1 | nmdc:mga0k408_38_c1_250_1005 | 245 |
| 720 | 3300050516 | nmdc:mga0sz30_43645_c1 | nmdc:mga0sz30_43645_c1_512_1279 | 245 |
| 721 | 3300053087 | Ga0500643_000694 | Ga0500643_000694_15582_16343 | 245 |
| 722 | 3300053133 | Ga0500655_000418 | Ga0500655_000418_3654_4415 | 245 |
| 723 | 3300053141 | Ga0500574_000052 | Ga0500574_000052_3003_3764 | 245 |
| 724 | iso_pu_bacteria | 2738541307 | 2738881079 | 245 |
| 725 | iso_pu_bacteria | 8016583857 | 8016590204 | 245 |
| 726 | 3300003320 | rootH2_10059852 | rootH2_100598522 | 246 |
| 727 | 3300005563 | Ga0068855_100014961 | Ga0068855_10001496111 | 246 |
| 728 | 3300009101 | Ga0105247_10240481 | Ga0105247_102404812 | 246 |
| 729 | 3300009545 | Ga0105237_10046055 | Ga0105237_100460556 | 246 |
| 730 | 3300013250 | Ga0171462_1015 | Ga0171462_1015142 | 246 |
| 731 | 3300015261 | Ga0182006_1002039 | Ga0182006_10020394 | 246 |
| 732 | 3300025914 | Ga0207671_10100189 | Ga0207671_101001892 | 246 |
| 733 | 3300025914 | Ga0207671_10256385 | Ga0207671_102563852 | 246 |
| 734 | 3300025949 | Ga0207667_10028495 | Ga0207667_100284952 | 246 |
| 735 | 3300030521 | Ga0307511_10044832 | Ga0307511_100448324 | 246 |
| 736 | 3300030521 | Ga0307511_10168026 | Ga0307511_101680262 | 246 |
| 737 | 3300031507 | Ga0307509_10065073 | Ga0307509_100650732 | 246 |
| 738 | 3300031730 | Ga0307516_10016230 | Ga0307516_100162304 | 246 |
| 739 | 3300035692 | Ga0373935_0038345 | Ga0373935_0038345_1548_2300 | 246 |
| 740 | 3300035725 | Ga0373947_0080970 | Ga0373947_0080970_631_1383 | 246 |
| 741 | 3300037068 | Ga0373925_0076610 | Ga0373925_0076610_1554_2306 | 246 |
| 742 | 3300039447 | Ga0436361_0455580 | Ga0436361_0455580_343_1113 | 246 |
| 743 | 3300046454 | Ga0495592_0259680 | Ga0495592_0259680_290_1042 | 246 |
| 744 | 3300046518 | Ga0495631_0131823 | Ga0495631_0131823_201_959 | 246 |
| 745 | 3300046683 | Ga0495658_0141246 | Ga0495658_0141246_29_781 | 246 |
| 746 | 3300047320 | Ga0495672_0005003 | Ga0495672_0005003_8803_9549 | 246 |
| 747 | 3300047444 | Ga0495675_0278561 | Ga0495675_0278561_228_980 | 246 |
| 748 | 3300048909 | Ga0496106_0003842 | Ga0496106_0003842_1275_2027 | 246 |
| 749 | 3300048921 | Ga0496118_0068269 | Ga0496118_0068269_687_1439 | 246 |
| 750 | 3300048927 | Ga0496124_0005442 | Ga0496124_0005442_10555_11307 | 246 |
| 751 | 3300048927 | Ga0496124_0351883 | Ga0496124_0351883_144_953 | 246 |
| 752 | 3300048929 | Ga0496126_0069745 | Ga0496126_0069745_1044_1796 | 246 |
| 753 | 3300053080 | Ga0500635_0040027 | Ga0500635_0040027_334_1086 | 246 |
| 754 | 3300053094 | Ga0500566_0106792 | Ga0500566_0106792_612_1364 | 246 |
| 755 | 3300053140 | Ga0500573_0011632 | Ga0500573_0011632_1813_2565 | 246 |
| 756 | 3300053177 | Ga0500636_0128468 | Ga0500636_0128468_215_967 | 246 |
| 757 | 3300053735 | Ga0500596_007476 | Ga0500596_007476_409_1161 | 246 |
| 758 | iso_pu_bacteria | 2904666416 | 2904672415 | 246 |
| 759 | iso_pu_bacteria | 3005718088 | 3005721092 | 246 |
| 760 | iso_pu_bacteria | 8019648815 | 8019656835 | 246 |
| 761 | iso_pu_bacteria | 8056967851 | 8056968496 | 246 |
| 762 | 3300001989 | JGI24739J22299_10000884 | JGI24739J22299_100008846 | 247 |
| 763 | 3300002067 | JGI24735J21928_10001089 | JGI24735J21928_100010898 | 247 |
| 764 | 3300002705 | JGI25156J39149_1001160 | JGI25156J39149_10011604 | 247 |
| 765 | 3300003756 | Ga0055533_1008674 | Ga0055533_10086742 | 247 |
| 766 | 3300005354 | Ga0070675_100623740 | Ga0070675_1006237402 | 247 |
| 767 | 3300005367 | Ga0070667_100100410 | Ga0070667_1001004103 | 247 |
| 768 | 3300006058 | Ga0075432_10111901 | Ga0075432_101119012 | 247 |
| 769 | 3300006944 | Ga0099823_1069269 | Ga0099823_10692692 | 247 |
| 770 | 3300009011 | Ga0105251_10000496 | Ga0105251_1000049618 | 247 |
| 771 | 3300009094 | Ga0111539_10933917 | Ga0111539_109339171 | 247 |
| 772 | 3300010375 | Ga0105239_10007556 | Ga0105239_100075565 | 247 |
| 773 | 3300011119 | Ga0105246_10259428 | Ga0105246_102594282 | 247 |
| 774 | 3300011119 | Ga0105246_10471430 | Ga0105246_104714302 | 247 |
| 775 | 3300015262 | Ga0182007_10002674 | Ga0182007_100026743 | 247 |
| 776 | 3300021320 | Ga0214544_1007467 | Ga0214544_100746719 | 247 |
| 777 | 3300021321 | Ga0214542_1020416 | Ga0214542_10204163 | 247 |
| 778 | 3300021324 | Ga0214545_1010456 | Ga0214545_10104562 | 247 |
| 779 | 3300021327 | Ga0214543_1008348 | Ga0214543_10083485 | 247 |
| 780 | 3300025206 | Ga0209435_101167 | Ga0209435_1011672 | 247 |
| 781 | 3300025226 | Ga0209674_100078 | Ga0209674_100078133 | 247 |
| 782 | 3300025256 | Ga0209759_1000087 | Ga0209759_1000087110 | 247 |
| 783 | 3300025735 | Ga0207713_1001113 | Ga0207713_100111320 | 247 |
| 784 | 3300025904 | Ga0207647_10004634 | Ga0207647_1000463412 | 247 |
| 785 | 3300025904 | Ga0207647_10031606 | Ga0207647_100316063 | 247 |
| 786 | 3300025924 | Ga0207694_10513345 | Ga0207694_105133452 | 247 |
| 787 | 3300025986 | Ga0207658_10129530 | Ga0207658_101295302 | 247 |
| 788 | 3300027296 | Ga0209389_1026550 | Ga0209389_10265504 | 247 |
| 789 | 3300027361 | Ga0209489_115028 | Ga0209489_1150284 | 247 |
| 790 | 3300027363 | Ga0209700_100026 | Ga0209700_100026152 | 247 |
| 791 | 3300031730 | Ga0307516_10001738 | Ga0307516_1000173824 | 247 |
| 792 | 3300031911 | Ga0307412_10000024 | Ga0307412_10000024253 | 247 |
| 793 | 3300044656 | Ga0466969_0004989 | Ga0466969_0004989_320_1069 | 247 |
| 794 | 3300044684 | Ga0466966_0025298 | Ga0466966_0025298_1426_2175 | 247 |
| 795 | 3300044693 | Ga0466961_0058919 | Ga0466961_0058919_1491_2240 | 247 |
| 796 | 3300044765 | Ga0466970_0020888 | Ga0466970_0020888_1977_2726 | 247 |
| 797 | 3300044842 | Ga0466957_0147842 | Ga0466957_0147842_623_1381 | 247 |
| 798 | 3300045049 | Ga0466959_0087184 | Ga0466959_0087184_1261_2010 | 247 |
| 799 | 3300045976 | Ga0466967_0000802 | Ga0466967_0000802_6493_7251 | 247 |
| 800 | 3300046472 | Ga0495580_0000252 | Ga0495580_0000252_11863_12612 | 247 |
| 801 | 3300046472 | Ga0495580_0000279 | Ga0495580_0000279_22082_22831 | 247 |
| 802 | 3300046500 | Ga0495596_0011373 | Ga0495596_0011373_2619_3368 | 247 |
| 803 | 3300046507 | Ga0495606_0089093 | Ga0495606_0089093_769_1518 | 247 |
| 804 | 3300046517 | Ga0495630_0155931 | Ga0495630_0155931_960_1709 | 247 |
| 805 | 3300046520 | Ga0495637_0004928 | Ga0495637_0004928_2119_2880 | 247 |
| 806 | 3300046674 | Ga0495588_0016167 | Ga0495588_0016167_2582_3343 | 247 |
| 807 | 3300047323 | Ga0495683_0038427 | Ga0495683_0038427_440_1189 | 247 |
| 808 | 3300048088 | Ga0495602_0033131 | Ga0495602_0033131_3031_3780 | 247 |
| 809 | 3300048907 | Ga0496104_0446086 | Ga0496104_0446086_180_929 | 247 |
| 810 | 3300048919 | Ga0496116_0010201 | Ga0496116_0010201_4210_4959 | 247 |
| 811 | 3300048920 | Ga0496117_0016574 | Ga0496117_0016574_1208_1957 | 247 |
| 812 | 3300048920 | Ga0496117_0109369 | Ga0496117_0109369_783_1532 | 247 |
| 813 | 3300048921 | Ga0496118_0016483 | Ga0496118_0016483_2363_3112 | 247 |
| 814 | 3300053079 | Ga0500610_0026635 | Ga0500610_0026635_109_870 | 247 |
| 815 | 3300053125 | Ga0500618_002201 | Ga0500618_002201_3071_3841 | 247 |
| 816 | 3300053153 | Ga0500616_0049392 | Ga0500616_0049392_692_1447 | 247 |
| 817 | 3300001990 | JGI24737J22298_10022393 | JGI24737J22298_100223932 | 248 |
| 818 | 3300005366 | Ga0070659_100170590 | Ga0070659_1001705902 | 248 |
| 819 | 3300005457 | Ga0070662_100420942 | Ga0070662_1004209422 | 248 |
| 820 | 3300005471 | Ga0070698_100671354 | Ga0070698_1006713542 | 248 |
| 821 | 3300005578 | Ga0068854_100373796 | Ga0068854_1003737962 | 248 |
| 822 | 3300005614 | Ga0068856_100505105 | Ga0068856_1005051052 | 248 |
| 823 | 3300005616 | Ga0068852_100000685 | Ga0068852_10000068511 | 248 |
| 824 | 3300005843 | Ga0068860_100003437 | Ga0068860_10000343716 | 248 |
| 825 | 3300006237 | Ga0097621_100236848 | Ga0097621_1002368482 | 248 |
| 826 | 3300006358 | Ga0068871_100141221 | Ga0068871_1001412213 | 248 |
| 827 | 3300009093 | Ga0105240_10001617 | Ga0105240_1000161732 | 248 |
| 828 | 3300009098 | Ga0105245_10019045 | Ga0105245_100190454 | 248 |
| 829 | 3300009101 | Ga0105247_10009542 | Ga0105247_100095425 | 248 |
| 830 | 3300009174 | Ga0105241_10002869 | Ga0105241_100028696 | 248 |
| 831 | 3300009545 | Ga0105237_10001263 | Ga0105237_1000126322 | 248 |
| 832 | 3300010375 | Ga0105239_10178708 | Ga0105239_101787082 | 248 |
| 833 | 3300010375 | Ga0105239_10728656 | Ga0105239_107286562 | 248 |
| 834 | 3300013297 | Ga0157378_10089005 | Ga0157378_100890053 | 248 |
| 835 | 3300025900 | Ga0207710_10015253 | Ga0207710_100152533 | 248 |
| 836 | 3300025904 | Ga0207647_10109369 | Ga0207647_101093692 | 248 |
| 837 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008371 | 248 |
| 838 | 3300025914 | Ga0207671_10009661 | Ga0207671_100096612 | 248 |
| 839 | 3300025927 | Ga0207687_10088279 | Ga0207687_100882793 | 248 |
| 840 | 3300025927 | Ga0207687_10396547 | Ga0207687_103965472 | 248 |
| 841 | 3300025932 | Ga0207690_10081721 | Ga0207690_100817212 | 248 |
| 842 | 3300026142 | Ga0207698_10128225 | Ga0207698_101282252 | 248 |
| 843 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020347 | 248 |
| 844 | 3300028786 | Ga0307517_10105455 | Ga0307517_101054552 | 248 |
| 845 | 3300028794 | Ga0307515_10000067 | Ga0307515_10000067213 | 248 |
| 846 | 3300028794 | Ga0307515_10011464 | Ga0307515_100114645 | 248 |
| 847 | 3300028794 | Ga0307515_10056827 | Ga0307515_100568273 | 248 |
| 848 | 3300031456 | Ga0307513_10011950 | Ga0307513_100119502 | 248 |
| 849 | 3300031456 | Ga0307513_10022166 | Ga0307513_100221668 | 248 |
| 850 | 3300031507 | Ga0307509_10077568 | Ga0307509_100775684 | 248 |
| 851 | 3300031507 | Ga0307509_10119904 | Ga0307509_101199043 | 248 |
| 852 | 3300031616 | Ga0307508_10175501 | Ga0307508_101755012 | 248 |
| 853 | 3300031649 | Ga0307514_10027913 | Ga0307514_100279133 | 248 |
| 854 | 3300031730 | Ga0307516_10006407 | Ga0307516_100064078 | 248 |
| 855 | 3300033179 | Ga0307507_10098070 | Ga0307507_100980701 | 248 |
| 856 | 3300046530 | Ga0495654_0000313 | Ga0495654_0000313_18199_18948 | 248 |
| 857 | 3300046660 | Ga0495625_0273150 | Ga0495625_0273150_119_883 | 248 |
| 858 | 3300048924 | Ga0496121_0100594 | Ga0496121_0100594_1146_1907 | 248 |
| 859 | 3300048929 | Ga0496126_0093716 | Ga0496126_0093716_1139_1900 | 248 |
| 860 | 3300053108 | Ga0500562_004783 | Ga0500562_004783_561_1310 | 248 |
| 861 | iso_pu_bacteria | 2513020051 | 2513227018 | 248 |
| 862 | iso_pu_bacteria | 2599185214 | 2599627595 | 248 |
| 863 | iso_pu_bacteria | 2599185226 | 2599677806 | 248 |
| 864 | iso_pu_bacteria | 2599185227 | 2599685321 | 248 |
| 865 | iso_pu_bacteria | 2599185229 | 2599697030 | 248 |
| 866 | iso_pu_bacteria | 2643221628 | 2644161127 | 248 |
| 867 | iso_pu_bacteria | 2643221658 | 2644325923 | 248 |
| 868 | iso_pu_bacteria | 2643221672 | 2644397208 | 248 |
| 869 | iso_pu_bacteria | 2738541277 | 2738723847 | 248 |
| 870 | iso_pu_bacteria | 2738541307 | 2738880536 | 248 |
| 871 | iso_pu_bacteria | 2738543019 | 2739284578 | 248 |
| 872 | iso_pu_bacteria | 2838054893 | 2838061182 | 248 |
| 873 | iso_pu_bacteria | 2885198086 | 2885203231 | 248 |
| 874 | iso_pu_bacteria | 2885211737 | 2885216372 | 248 |
| 875 | iso_pu_bacteria | 2904449895 | 2904453355 | 248 |
| 876 | iso_pu_bacteria | 2904456579 | 2904459326 | 248 |
| 877 | iso_pu_bacteria | 2928070936 | 2928075154 | 248 |
| 878 | iso_pu_bacteria | 2928084124 | 2928090750 | 248 |
| 879 | iso_pu_bacteria | 2945945610 | 2945948361 | 248 |
| 880 | iso_pu_bacteria | 2945972063 | 2945972140 | 248 |
| 881 | 3300005434 | Ga0070709_10000273 | Ga0070709_1000027324 | 249 |
| 882 | 3300005435 | Ga0070714_100005827 | Ga0070714_1000058278 | 249 |
| 883 | 3300005437 | Ga0070710_10000212 | Ga0070710_100002127 | 249 |
| 884 | 3300005439 | Ga0070711_100005770 | Ga0070711_1000057703 | 249 |
| 885 | 3300006163 | Ga0070715_10032928 | Ga0070715_100329282 | 249 |
| 886 | 3300006173 | Ga0070716_100002266 | Ga0070716_1000022665 | 249 |
| 887 | 3300006175 | Ga0070712_100025966 | Ga0070712_1000259662 | 249 |
| 888 | 3300009551 | Ga0105238_10336574 | Ga0105238_103365742 | 249 |
| 889 | 3300014968 | Ga0157379_10294327 | Ga0157379_102943272 | 249 |
| 890 | 3300025898 | Ga0207692_10000086 | Ga0207692_1000008625 | 249 |
| 891 | 3300025905 | Ga0207685_10017087 | Ga0207685_100170872 | 249 |
| 892 | 3300025906 | Ga0207699_10000515 | Ga0207699_1000051513 | 249 |
| 893 | 3300025915 | Ga0207693_10018998 | Ga0207693_100189984 | 249 |
| 894 | 3300025916 | Ga0207663_10001767 | Ga0207663_100017673 | 249 |
| 895 | 3300025928 | Ga0207700_10005674 | Ga0207700_100056743 | 249 |
| 896 | 3300025929 | Ga0207664_10299720 | Ga0207664_102997202 | 249 |
| 897 | 3300025939 | Ga0207665_10002776 | Ga0207665_100027768 | 249 |
| 898 | 3300028794 | Ga0307515_10001836 | Ga0307515_1000183617 | 249 |
| 899 | 3300028794 | Ga0307515_10012396 | Ga0307515_100123963 | 249 |
| 900 | 3300030522 | Ga0307512_10072907 | Ga0307512_100729073 | 249 |
| 901 | 3300031507 | Ga0307509_10004345 | Ga0307509_1000434515 | 249 |
| 902 | 3300031507 | Ga0307509_10004938 | Ga0307509_100049388 | 249 |
| 903 | 3300031616 | Ga0307508_10000204 | Ga0307508_1000020463 | 249 |
| 904 | 3300033179 | Ga0307507_10314934 | Ga0307507_103149342 | 249 |
| 905 | 3300033180 | Ga0307510_10200140 | Ga0307510_102001402 | 249 |
| 906 | 3300033180 | Ga0307510_10216151 | Ga0307510_102161511 | 249 |
| 907 | 3300035112 | Ga0373932_0036826 | Ga0373932_0036826_11_778 | 249 |
| 908 | 3300037068 | Ga0373925_0084469 | Ga0373925_0084469_751_1518 | 249 |
| 909 | 3300046454 | Ga0495592_0000131 | Ga0495592_0000131_25133_25900 | 249 |
| 910 | 3300046477 | Ga0495664_0006494 | Ga0495664_0006494_2770_3525 | 249 |
| 911 | 3300046524 | Ga0495648_0189720 | Ga0495648_0189720_146_913 | 249 |
| 912 | 3300046543 | Ga0495645_0015453 | Ga0495645_0015453_3554_4309 | 249 |
| 913 | 3300046680 | Ga0495646_0095715 | Ga0495646_0095715_574_1341 | 249 |
| 914 | 3300047317 | Ga0495604_0186335 | Ga0495604_0186335_533_1300 | 249 |
| 915 | 3300047321 | Ga0495676_0059007 | Ga0495676_0059007_317_1084 | 249 |
| 916 | 3300048924 | Ga0496121_0181769 | Ga0496121_0181769_233_1000 | 249 |
| 917 | 3300048926 | Ga0496123_0029756 | Ga0496123_0029756_484_1260 | 249 |
| 918 | 3300048929 | Ga0496126_0499397 | Ga0496126_0499397_161_928 | 249 |
| 919 | 3300053121 | Ga0500607_056728 | Ga0500607_056728_267_1061 | 249 |
| 920 | 3300005288 | Ga0065714_10100060 | Ga0065714_101000602 | 250 |
| 921 | 3300005328 | Ga0070676_10027658 | Ga0070676_100276584 | 250 |
| 922 | 3300005333 | Ga0070677_10037564 | Ga0070677_100375643 | 250 |
| 923 | 3300005334 | Ga0068869_100044913 | Ga0068869_1000449134 | 250 |
| 924 | 3300005334 | Ga0068869_100068719 | Ga0068869_1000687191 | 250 |
| 925 | 3300005334 | Ga0068869_100161450 | Ga0068869_1001614503 | 250 |
| 926 | 3300005338 | Ga0068868_100035446 | Ga0068868_1000354465 | 250 |
| 927 | 3300005340 | Ga0070689_100226629 | Ga0070689_1002266292 | 250 |
| 928 | 3300005354 | Ga0070675_100002236 | Ga0070675_1000022369 | 250 |
| 929 | 3300005364 | Ga0070673_100014369 | Ga0070673_1000143695 | 250 |
| 930 | 3300005455 | Ga0070663_100162118 | Ga0070663_1001621182 | 250 |
| 931 | 3300005457 | Ga0070662_100128024 | Ga0070662_1001280243 | 250 |
| 932 | 3300005459 | Ga0068867_100008131 | Ga0068867_1000081313 | 250 |
| 933 | 3300005459 | Ga0068867_100220837 | Ga0068867_1002208373 | 250 |
| 934 | 3300005467 | Ga0070706_100002001 | Ga0070706_10000200112 | 250 |
| 935 | 3300005468 | Ga0070707_100050329 | Ga0070707_1000503294 | 250 |
| 936 | 3300005471 | Ga0070698_100058198 | Ga0070698_1000581985 | 250 |
| 937 | 3300005518 | Ga0070699_100096827 | Ga0070699_1000968272 | 250 |
| 938 | 3300005539 | Ga0068853_100075902 | Ga0068853_1000759022 | 250 |
| 939 | 3300005539 | Ga0068853_100150267 | Ga0068853_1001502673 | 250 |
| 940 | 3300005543 | Ga0070672_100007481 | Ga0070672_1000074813 | 250 |
| 941 | 3300005548 | Ga0070665_100313470 | Ga0070665_1003134702 | 250 |
| 942 | 3300005548 | Ga0070665_100432335 | Ga0070665_1004323351 | 250 |
| 943 | 3300005577 | Ga0068857_100010180 | Ga0068857_1000101804 | 250 |
| 944 | 3300005577 | Ga0068857_100246547 | Ga0068857_1002465472 | 250 |
| 945 | 3300005578 | Ga0068854_100063721 | Ga0068854_1000637212 | 250 |
| 946 | 3300005618 | Ga0068864_100482027 | Ga0068864_1004820272 | 250 |
| 947 | 3300006051 | Ga0075364_10057494 | Ga0075364_100574942 | 250 |
| 948 | 3300006177 | Ga0075362_10000208 | Ga0075362_100002082 | 250 |
| 949 | 3300006178 | Ga0075367_10029978 | Ga0075367_100299784 | 250 |
| 950 | 3300006178 | Ga0075367_10108540 | Ga0075367_101085402 | 250 |
| 951 | 3300006186 | Ga0075369_10000489 | Ga0075369_100004898 | 250 |
| 952 | 3300006186 | Ga0075369_10013822 | Ga0075369_100138224 | 250 |
| 953 | 3300006195 | Ga0075366_10000903 | Ga0075366_100009038 | 250 |
| 954 | 3300006195 | Ga0075366_10011740 | Ga0075366_100117403 | 250 |
| 955 | 3300006195 | Ga0075366_10094136 | Ga0075366_100941362 | 250 |
| 956 | 3300006237 | Ga0097621_100288772 | Ga0097621_1002887722 | 250 |
| 957 | 3300006353 | Ga0075370_10033785 | Ga0075370_100337852 | 250 |
| 958 | 3300006353 | Ga0075370_10088581 | Ga0075370_100885812 | 250 |
| 959 | 3300006358 | Ga0068871_100185673 | Ga0068871_1001856732 | 250 |
| 960 | 3300006881 | Ga0068865_100274460 | Ga0068865_1002744601 | 250 |
| 961 | 3300009093 | Ga0105240_10029724 | Ga0105240_100297248 | 250 |
| 962 | 3300009098 | Ga0105245_10049156 | Ga0105245_100491564 | 250 |
| 963 | 3300009098 | Ga0105245_10116403 | Ga0105245_101164032 | 250 |
| 964 | 3300009148 | Ga0105243_10016506 | Ga0105243_100165062 | 250 |
| 965 | 3300009148 | Ga0105243_10096992 | Ga0105243_100969923 | 250 |
| 966 | 3300009174 | Ga0105241_10444866 | Ga0105241_104448662 | 250 |
| 967 | 3300009177 | Ga0105248_10506674 | Ga0105248_105066742 | 250 |
| 968 | 3300010375 | Ga0105239_10015359 | Ga0105239_100153592 | 250 |
| 969 | 3300013306 | Ga0163162_10046903 | Ga0163162_100469032 | 250 |
| 970 | 3300013308 | Ga0157375_10043012 | Ga0157375_100430124 | 250 |
| 971 | 3300014969 | Ga0157376_10000620 | Ga0157376_100006208 | 250 |
| 972 | 3300014969 | Ga0157376_10391564 | Ga0157376_103915642 | 250 |
| 973 | 3300015262 | Ga0182007_10001181 | Ga0182007_100011814 | 250 |
| 974 | 3300025907 | Ga0207645_10006283 | Ga0207645_100062839 | 250 |
| 975 | 3300025907 | Ga0207645_10100894 | Ga0207645_101008942 | 250 |
| 976 | 3300025910 | Ga0207684_10019493 | Ga0207684_100194936 | 250 |
| 977 | 3300025913 | Ga0207695_10161880 | Ga0207695_101618802 | 250 |
| 978 | 3300025918 | Ga0207662_10226742 | Ga0207662_102267422 | 250 |
| 979 | 3300025925 | Ga0207650_10017844 | Ga0207650_100178444 | 250 |
| 980 | 3300025926 | Ga0207659_10017903 | Ga0207659_100179034 | 250 |
| 981 | 3300025927 | Ga0207687_10039339 | Ga0207687_100393394 | 250 |
| 982 | 3300025927 | Ga0207687_10097146 | Ga0207687_100971462 | 250 |
| 983 | 3300025931 | Ga0207644_10072269 | Ga0207644_100722693 | 250 |
| 984 | 3300025932 | Ga0207690_10277869 | Ga0207690_102778692 | 250 |
| 985 | 3300025933 | Ga0207706_10313136 | Ga0207706_103131362 | 250 |
| 986 | 3300025935 | Ga0207709_10018580 | Ga0207709_100185804 | 250 |
| 987 | 3300025935 | Ga0207709_10021645 | Ga0207709_100216453 | 250 |
| 988 | 3300025935 | Ga0207709_10272932 | Ga0207709_102729322 | 250 |
| 989 | 3300025936 | Ga0207670_10247690 | Ga0207670_102476902 | 250 |
| 990 | 3300025940 | Ga0207691_10003629 | Ga0207691_100036293 | 250 |
| 991 | 3300025942 | Ga0207689_10027056 | Ga0207689_100270562 | 250 |
| 992 | 3300025960 | Ga0207651_10019311 | Ga0207651_100193112 | 250 |
| 993 | 3300025981 | Ga0207640_10113777 | Ga0207640_101137772 | 250 |
| 994 | 3300025981 | Ga0207640_10169229 | Ga0207640_101692292 | 250 |
| 995 | 3300025986 | Ga0207658_10015535 | Ga0207658_100155354 | 250 |
| 996 | 3300025986 | Ga0207658_10042781 | Ga0207658_100427813 | 250 |
| 997 | 3300026023 | Ga0207677_10016985 | Ga0207677_100169852 | 250 |
| 998 | 3300026041 | Ga0207639_10196053 | Ga0207639_101960532 | 250 |
| 999 | 3300026067 | Ga0207678_10019795 | Ga0207678_100197956 | 250 |
| 1000 | 3300026089 | Ga0207648_10003368 | Ga0207648_100033688 | 250 |
| 1001 | 3300026095 | Ga0207676_10554062 | Ga0207676_105540622 | 250 |
| 1002 | 3300026116 | Ga0207674_10008463 | Ga0207674_1000846314 | 250 |
| 1003 | 3300026116 | Ga0207674_10132788 | Ga0207674_101327883 | 250 |
| 1004 | 3300026116 | Ga0207674_10237780 | Ga0207674_102377802 | 250 |
| 1005 | 3300026118 | Ga0207675_100323106 | Ga0207675_1003231062 | 250 |
| 1006 | 3300026121 | Ga0207683_10712067 | Ga0207683_107120671 | 250 |
| 1007 | 3300026142 | Ga0207698_10327107 | Ga0207698_103271072 | 250 |
| 1008 | 3300027866 | Ga0209813_10058807 | Ga0209813_100588072 | 250 |
| 1009 | 3300028379 | Ga0268266_10401158 | Ga0268266_104011582 | 250 |
| 1010 | 3300028380 | Ga0268265_10054227 | Ga0268265_100542273 | 250 |
| 1011 | 3300028786 | Ga0307517_10003316 | Ga0307517_1000331611 | 250 |
| 1012 | 3300028786 | Ga0307517_10130465 | Ga0307517_101304653 | 250 |
| 1013 | 3300030522 | Ga0307512_10118509 | Ga0307512_101185092 | 250 |
| 1014 | 3300031456 | Ga0307513_10026537 | Ga0307513_100265373 | 250 |
| 1015 | 3300031456 | Ga0307513_10049682 | Ga0307513_100496824 | 250 |
| 1016 | 3300031616 | Ga0307508_10025899 | Ga0307508_100258992 | 250 |
| 1017 | 3300031649 | Ga0307514_10242734 | Ga0307514_102427342 | 250 |
| 1018 | 3300031730 | Ga0307516_10123686 | Ga0307516_101236862 | 250 |
| 1019 | 3300037312 | Ga0395899_0002715 | Ga0395899_0002715_10867_11652 | 250 |
| 1020 | 3300037418 | Ga0395900_0061151 | Ga0395900_0061151_2764_3549 | 250 |
| 1021 | 3300037466 | Ga0395898_0268045 | Ga0395898_0268045_331_1116 | 250 |
| 1022 | 3300037471 | Ga0395905_0078758 | Ga0395905_0078758_811_1596 | 250 |
| 1023 | 3300038443 | Ga0395901_0037138 | Ga0395901_0037138_1490_2275 | 250 |
| 1024 | 3300039447 | Ga0436361_0694654 | Ga0436361_0694654_2782_3552 | 250 |
| 1025 | 3300039450 | Ga0436363_1512662 | Ga0436363_1512662_547_1320 | 250 |
| 1026 | 3300042007 | Ga0439449_0000970 | Ga0439449_0000970_2001_2783 | 250 |
| 1027 | 3300046457 | Ga0495590_0036138 | Ga0495590_0036138_247_1005 | 250 |
| 1028 | 3300046472 | Ga0495580_0009254 | Ga0495580_0009254_1883_2644 | 250 |
| 1029 | 3300046475 | Ga0495639_0001601 | Ga0495639_0001601_3916_4671 | 250 |
| 1030 | 3300046515 | Ga0495620_0102600 | Ga0495620_0102600_197_955 | 250 |
| 1031 | 3300046660 | Ga0495625_0153394 | Ga0495625_0153394_152_910 | 250 |
| 1032 | 3300046692 | Ga0495671_0112566 | Ga0495671_0112566_300_1058 | 250 |
| 1033 | 3300046694 | Ga0495649_0001466 | Ga0495649_0001466_849_1607 | 250 |
| 1034 | 3300047443 | Ga0495687_048175 | Ga0495687_048175_225_983 | 250 |
| 1035 | 3300047443 | Ga0495687_048178 | Ga0495687_048178_847_1605 | 250 |
| 1036 | 3300048903 | Ga0496100_0002213 | Ga0496100_0002213_739_1494 | 250 |
| 1037 | 3300048904 | Ga0496101_0001976 | Ga0496101_0001976_3997_4752 | 250 |
| 1038 | 3300048905 | Ga0496102_0015674 | Ga0496102_0015674_5448_6203 | 250 |
| 1039 | 3300048907 | Ga0496104_0015072 | Ga0496104_0015072_5350_6105 | 250 |
| 1040 | 3300048908 | Ga0496105_0000980 | Ga0496105_0000980_18325_19080 | 250 |
| 1041 | 3300048909 | Ga0496106_0212778 | Ga0496106_0212778_324_1079 | 250 |
| 1042 | 3300048913 | Ga0496110_0234732 | Ga0496110_0234732_498_1253 | 250 |
| 1043 | 3300048914 | Ga0496111_0056450 | Ga0496111_0056450_729_1484 | 250 |
| 1044 | 3300050489 | nmdc:mga03683_21009_c1 | nmdc:mga03683_21009_c1_640_1398 | 250 |
| 1045 | 3300050491 | nmdc:mga00v17_54408_c1 | nmdc:mga00v17_54408_c1_1135_1893 | 250 |
| 1046 | 3300050493 | nmdc:mga0k408_123429_c1 | nmdc:mga0k408_123429_c1_689_1447 | 250 |
| 1047 | 3300050493 | nmdc:mga0k408_152409_c1 | nmdc:mga0k408_152409_c1_181_939 | 250 |
| 1048 | 3300050493 | nmdc:mga0k408_1592_c1 | nmdc:mga0k408_1592_c1_4284_5042 | 250 |
| 1049 | 3300050493 | nmdc:mga0k408_174746_c1 | nmdc:mga0k408_174746_c1_343_1101 | 250 |
| 1050 | 3300050493 | nmdc:mga0k408_47816_c1 | nmdc:mga0k408_47816_c1_854_1612 | 250 |
| 1051 | 3300050493 | nmdc:mga0k408_5814_c1 | nmdc:mga0k408_5814_c1_1150_1911 | 250 |
| 1052 | 3300050493 | nmdc:mga0k408_5920_c1 | nmdc:mga0k408_5920_c1_3432_4190 | 250 |
| 1053 | 3300050493 | nmdc:mga0k408_8640_c1 | nmdc:mga0k408_8640_c1_3988_4746 | 250 |
| 1054 | 3300050494 | nmdc:mga06z11_35089_c1 | nmdc:mga06z11_35089_c1_964_1722 | 250 |
| 1055 | 3300050496 | nmdc:mga07m45_33368_c1 | nmdc:mga07m45_33368_c1_1198_1956 | 250 |
| 1056 | 3300002773 | JGI25152J39213_1003342 | JGI25152J39213_10033422 | 251 |
| 1057 | 3300002774 | JGI25150J39212_1005437 | JGI25150J39212_10054372 | 251 |
| 1058 | 3300002987 | JGI25159J45721_1003524 | JGI25159J45721_10035242 | 251 |
| 1059 | 3300003187 | JGI25151J46595_10007131 | JGI25151J46595_100071312 | 251 |
| 1060 | 3300003215 | JGI25153J46596_10007202 | JGI25153J46596_100072022 | 251 |
| 1061 | 3300003354 | JGI25160J50197_1005126 | JGI25160J50197_10051262 | 251 |
| 1062 | 3300003374 | JGI25161J50226_1002037 | JGI25161J50226_10020372 | 251 |
| 1063 | 3300003771 | Ga0055526_1007739 | Ga0055526_10077392 | 251 |
| 1064 | 3300003773 | Ga0055537_1002874 | Ga0055537_10028742 | 251 |
| 1065 | 3300003775 | Ga0055524_1005712 | Ga0055524_10057122 | 251 |
| 1066 | 3300003784 | Ga0055534_1003029 | Ga0055534_10030292 | 251 |
| 1067 | 3300003792 | Ga0055540_1012321 | Ga0055540_10123213 | 251 |
| 1068 | 3300004625 | Ga0055543_1002768 | Ga0055543_10027688 | 251 |
| 1069 | 3300005262 | Ga0065165_1007205 | Ga0065165_10072058 | 251 |
| 1070 | 3300005548 | Ga0070665_100047941 | Ga0070665_1000479414 | 251 |
| 1071 | 3300015265 | Ga0182005_1020136 | Ga0182005_10201363 | 251 |
| 1072 | 3300025208 | Ga0209436_105070 | Ga0209436_1050702 | 251 |
| 1073 | 3300025245 | Ga0207425_1000116 | Ga0207425_100011642 | 251 |
| 1074 | 3300025258 | Ga0209129_1000247 | Ga0209129_10002477 | 251 |
| 1075 | 3300025263 | Ga0209565_1000256 | Ga0209565_100025650 | 251 |
| 1076 | 3300025273 | Ga0209673_1000592 | Ga0209673_100059250 | 251 |
| 1077 | 3300025284 | Ga0209130_1001347 | Ga0209130_100134714 | 251 |
| 1078 | 3300025291 | Ga0209675_1000397 | Ga0209675_10003977 | 251 |
| 1079 | 3300025294 | Ga0209025_1000710 | Ga0209025_10007107 | 251 |
| 1080 | 3300025295 | Ga0209564_1000596 | Ga0209564_100059650 | 251 |
| 1081 | 3300025297 | Ga0209758_1002886 | Ga0209758_100288614 | 251 |
| 1082 | 3300025299 | Ga0209256_1000516 | Ga0209256_100051650 | 251 |
| 1083 | 3300025302 | Ga0207426_1000710 | Ga0207426_10007107 | 251 |
| 1084 | 3300025303 | Ga0209051_1008202 | Ga0209051_10082028 | 251 |
| 1085 | 3300025304 | Ga0209257_1004070 | Ga0209257_10040709 | 251 |
| 1086 | 3300025937 | Ga0207669_10050596 | Ga0207669_100505962 | 251 |
| 1087 | 3300025960 | Ga0207651_10426802 | Ga0207651_104268021 | 251 |
| 1088 | 3300026121 | Ga0207683_10394660 | Ga0207683_103946602 | 251 |
| 1089 | 3300028379 | Ga0268266_10063810 | Ga0268266_100638104 | 251 |
| 1090 | 3300028379 | Ga0268266_10215669 | Ga0268266_102156692 | 251 |
| 1091 | 3300041452 | Ga0451793_0179075 | Ga0451793_0179075_398_1156 | 251 |
| 1092 | 3300046522 | Ga0495643_0127991 | Ga0495643_0127991_59_817 | 251 |
| 1093 | 3300046528 | Ga0495642_0150825 | Ga0495642_0150825_88_843 | 251 |
| 1094 | 3300046539 | Ga0495621_0004801 | Ga0495621_0004801_1694_2449 | 251 |
| 1095 | 3300046615 | Ga0495656_0002510 | Ga0495656_0002510_998_1753 | 251 |
| 1096 | 3300046675 | Ga0495657_0177716 | Ga0495657_0177716_484_1239 | 251 |
| 1097 | 3300047318 | Ga0495636_0148694 | Ga0495636_0148694_196_951 | 251 |
| 1098 | 3300048914 | Ga0496111_0014555 | Ga0496111_0014555_2651_3406 | 251 |
| 1099 | 3300049581 | Ga0501047_0030621 | Ga0501047_0030621_3550_4338 | 251 |
| 1100 | 2162886007 | SwRhRL2b_contig_3866527 | SwRhRL2b_0741.00001530 | 252 |
| 1101 | 3300001989 | JGI24739J22299_10008256 | JGI24739J22299_100082566 | 252 |
| 1102 | 3300002739 | JGI25158J39367_1004694 | JGI25158J39367_10046944 | 252 |
| 1103 | 3300002773 | JGI25152J39213_1017840 | JGI25152J39213_10178402 | 252 |
| 1104 | 3300002987 | JGI25159J45721_1007582 | JGI25159J45721_10075822 | 252 |
| 1105 | 3300003215 | JGI25153J46596_10044762 | JGI25153J46596_100447622 | 252 |
| 1106 | 3300003323 | rootH1_10107676 | rootH1_101076762 | 252 |
| 1107 | 3300003354 | JGI25160J50197_1011694 | JGI25160J50197_10116942 | 252 |
| 1108 | 3300003374 | JGI25161J50226_1006710 | JGI25161J50226_10067102 | 252 |
| 1109 | 3300003578 | Ga0006562J51391_1082376 | Ga0006562J51391_10823762 | 252 |
| 1110 | 3300003771 | Ga0055526_1004888 | Ga0055526_10048882 | 252 |
| 1111 | 3300003773 | Ga0055537_1000024 | Ga0055537_100002454 | 252 |
| 1112 | 3300003773 | Ga0055537_1012606 | Ga0055537_10126062 | 252 |
| 1113 | 3300003775 | Ga0055524_1003526 | Ga0055524_10035267 | 252 |
| 1114 | 3300003781 | Ga0055536_1014327 | Ga0055536_10143272 | 252 |
| 1115 | 3300003781 | Ga0055536_1049137 | Ga0055536_10491371 | 252 |
| 1116 | 3300003784 | Ga0055534_1000032 | Ga0055534_100003260 | 252 |
| 1117 | 3300003784 | Ga0055534_1001127 | Ga0055534_10011279 | 252 |
| 1118 | 3300003790 | Ga0055528_1000328 | Ga0055528_100032818 | 252 |
| 1119 | 3300003790 | Ga0055528_1039347 | Ga0055528_10393472 | 252 |
| 1120 | 3300003791 | Ga0055530_10003037 | Ga0055530_100030379 | 252 |
| 1121 | 3300003791 | Ga0055530_10013538 | Ga0055530_100135382 | 252 |
| 1122 | 3300003792 | Ga0055540_1006668 | Ga0055540_10066685 | 252 |
| 1123 | 3300003792 | Ga0055540_1011758 | Ga0055540_10117582 | 252 |
| 1124 | 3300003794 | Ga0055531_10004992 | Ga0055531_100049928 | 252 |
| 1125 | 3300003794 | Ga0055531_10019085 | Ga0055531_100190852 | 252 |
| 1126 | 3300005288 | Ga0065714_10006056 | Ga0065714_100060564 | 252 |
| 1127 | 3300005289 | Ga0065704_10007833 | Ga0065704_100078333 | 252 |
| 1128 | 3300005327 | Ga0070658_10100066 | Ga0070658_101000662 | 252 |
| 1129 | 3300005334 | Ga0068869_100424591 | Ga0068869_1004245912 | 252 |
| 1130 | 3300005339 | Ga0070660_100194430 | Ga0070660_1001944302 | 252 |
| 1131 | 3300005366 | Ga0070659_100252257 | Ga0070659_1002522572 | 252 |
| 1132 | 3300005457 | Ga0070662_100174454 | Ga0070662_1001744542 | 252 |
| 1133 | 3300005563 | Ga0068855_100212698 | Ga0068855_1002126982 | 252 |
| 1134 | 3300005564 | Ga0070664_100014177 | Ga0070664_1000141775 | 252 |
| 1135 | 3300005577 | Ga0068857_100593434 | Ga0068857_1005934342 | 252 |
| 1136 | 3300005578 | Ga0068854_100059290 | Ga0068854_1000592903 | 252 |
| 1137 | 3300005616 | Ga0068852_100328895 | Ga0068852_1003288952 | 252 |
| 1138 | 3300005844 | Ga0068862_100091402 | Ga0068862_1000914023 | 252 |
| 1139 | 3300006038 | Ga0075365_10060275 | Ga0075365_100602753 | 252 |
| 1140 | 3300006048 | Ga0075363_100051911 | Ga0075363_1000519113 | 252 |
| 1141 | 3300006051 | Ga0075364_10004709 | Ga0075364_100047092 | 252 |
| 1142 | 3300006058 | Ga0075432_10043274 | Ga0075432_100432742 | 252 |
| 1143 | 3300006177 | Ga0075362_10009615 | Ga0075362_100096151 | 252 |
| 1144 | 3300006177 | Ga0075362_10053163 | Ga0075362_100531632 | 252 |
| 1145 | 3300006177 | Ga0075362_10186859 | Ga0075362_101868591 | 252 |
| 1146 | 3300006195 | Ga0075366_10021430 | Ga0075366_100214303 | 252 |
| 1147 | 3300006195 | Ga0075366_10068257 | Ga0075366_100682573 | 252 |
| 1148 | 3300006195 | Ga0075366_10068393 | Ga0075366_100683932 | 252 |
| 1149 | 3300006195 | Ga0075366_10197337 | Ga0075366_101973372 | 252 |
| 1150 | 3300006353 | Ga0075370_10000837 | Ga0075370_1000083712 | 252 |
| 1151 | 3300006353 | Ga0075370_10025648 | Ga0075370_100256482 | 252 |
| 1152 | 3300006358 | Ga0068871_100364000 | Ga0068871_1003640002 | 252 |
| 1153 | 3300006948 | Ga0099826_10000060 | Ga0099826_1000006061 | 252 |
| 1154 | 3300009036 | Ga0105244_10018258 | Ga0105244_100182583 | 252 |
| 1155 | 3300009093 | Ga0105240_10125834 | Ga0105240_101258342 | 252 |
| 1156 | 3300009148 | Ga0105243_10021385 | Ga0105243_100213853 | 252 |
| 1157 | 3300009176 | Ga0105242_10099359 | Ga0105242_100993593 | 252 |
| 1158 | 3300009545 | Ga0105237_10266053 | Ga0105237_102660532 | 252 |
| 1159 | 3300009551 | Ga0105238_10378973 | Ga0105238_103789732 | 252 |
| 1160 | 3300010375 | Ga0105239_10358473 | Ga0105239_103584732 | 252 |
| 1161 | 3300012502 | Ga0157347_1001548 | Ga0157347_10015482 | 252 |
| 1162 | 3300012505 | Ga0157339_1003962 | Ga0157339_10039622 | 252 |
| 1163 | 3300013100 | Ga0157373_10021915 | Ga0157373_100219156 | 252 |
| 1164 | 3300013104 | Ga0157370_10194426 | Ga0157370_101944262 | 252 |
| 1165 | 3300013105 | Ga0157369_10015236 | Ga0157369_100152364 | 252 |
| 1166 | 3300013306 | Ga0163162_10192024 | Ga0163162_101920242 | 252 |
| 1167 | 3300013308 | Ga0157375_10397693 | Ga0157375_103976932 | 252 |
| 1168 | 3300014497 | Ga0182008_10006022 | Ga0182008_100060222 | 252 |
| 1169 | 3300014497 | Ga0182008_10026429 | Ga0182008_100264293 | 252 |
| 1170 | 3300014969 | Ga0157376_11031760 | Ga0157376_110317601 | 252 |
| 1171 | 3300015261 | Ga0182006_1013692 | Ga0182006_10136922 | 252 |
| 1172 | 3300015683 | Ga0183362_10011 | Ga0183362_1001172 | 252 |
| 1173 | 3300025208 | Ga0209436_108800 | Ga0209436_1088003 | 252 |
| 1174 | 3300025245 | Ga0207425_1001669 | Ga0207425_10016693 | 252 |
| 1175 | 3300025258 | Ga0209129_1003795 | Ga0209129_10037957 | 252 |
| 1176 | 3300025263 | Ga0209565_1000039 | Ga0209565_100003960 | 252 |
| 1177 | 3300025273 | Ga0209673_1000284 | Ga0209673_100028470 | 252 |
| 1178 | 3300025273 | Ga0209673_1000731 | Ga0209673_100073139 | 252 |
| 1179 | 3300025284 | Ga0209130_1000366 | Ga0209130_10003664 | 252 |
| 1180 | 3300025291 | Ga0209675_1000030 | Ga0209675_100003060 | 252 |
| 1181 | 3300025291 | Ga0209675_1003937 | Ga0209675_10039374 | 252 |
| 1182 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048269 | 252 |
| 1183 | 3300025292 | Ga0209676_1000123 | Ga0209676_1000123187 | 252 |
| 1184 | 3300025294 | Ga0209025_1000432 | Ga0209025_10004327 | 252 |
| 1185 | 3300025294 | Ga0209025_1020385 | Ga0209025_10203854 | 252 |
| 1186 | 3300025295 | Ga0209564_1001056 | Ga0209564_100105628 | 252 |
| 1187 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012269 | 252 |
| 1188 | 3300025298 | Ga0209050_1000617 | Ga0209050_100061715 | 252 |
| 1189 | 3300025299 | Ga0209256_1000679 | Ga0209256_100067940 | 252 |
| 1190 | 3300025302 | Ga0207426_1000058 | Ga0207426_100005876 | 252 |
| 1191 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019188 | 252 |
| 1192 | 3300025303 | Ga0209051_1000221 | Ga0209051_100022179 | 252 |
| 1193 | 3300025303 | Ga0209051_1000777 | Ga0209051_10007778 | 252 |
| 1194 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024215 | 252 |
| 1195 | 3300025304 | Ga0209257_1000057 | Ga0209257_1000057145 | 252 |
| 1196 | 3300025304 | Ga0209257_1000451 | Ga0209257_10004519 | 252 |
| 1197 | 3300025728 | Ga0207655_1010745 | Ga0207655_10107453 | 252 |
| 1198 | 3300025909 | Ga0207705_10138089 | Ga0207705_101380891 | 252 |
| 1199 | 3300025919 | Ga0207657_10434891 | Ga0207657_104348911 | 252 |
| 1200 | 3300025924 | Ga0207694_10184045 | Ga0207694_101840451 | 252 |
| 1201 | 3300025933 | Ga0207706_10113494 | Ga0207706_101134942 | 252 |
| 1202 | 3300025935 | Ga0207709_10003200 | Ga0207709_100032005 | 252 |
| 1203 | 3300025942 | Ga0207689_10336481 | Ga0207689_103364812 | 252 |
| 1204 | 3300025945 | Ga0207679_10018847 | Ga0207679_100188475 | 252 |
| 1205 | 3300025949 | Ga0207667_10152304 | Ga0207667_101523043 | 252 |
| 1206 | 3300025981 | Ga0207640_10058242 | Ga0207640_100582422 | 252 |
| 1207 | 3300026067 | Ga0207678_10356855 | Ga0207678_103568552 | 252 |
| 1208 | 3300027666 | Ga0209282_1000934 | Ga0209282_10009348 | 252 |
| 1209 | 3300027907 | Ga0207428_10150283 | Ga0207428_101502832 | 252 |
| 1210 | 3300028794 | Ga0307515_10000195 | Ga0307515_10000195138 | 252 |
| 1211 | 3300031251 | Ga0265327_10003656 | Ga0265327_1000365610 | 252 |
| 1212 | 3300031548 | Ga0307408_100001218 | Ga0307408_1000012183 | 252 |
| 1213 | 3300031548 | Ga0307408_100060611 | Ga0307408_1000606113 | 252 |
| 1214 | 3300031548 | Ga0307408_100258553 | Ga0307408_1002585532 | 252 |
| 1215 | 3300031649 | Ga0307514_10012268 | Ga0307514_100122686 | 252 |
| 1216 | 3300031731 | Ga0307405_10042528 | Ga0307405_100425282 | 252 |
| 1217 | 3300031901 | Ga0307406_10001377 | Ga0307406_100013774 | 252 |
| 1218 | 3300031911 | Ga0307412_10091879 | Ga0307412_100918793 | 252 |
| 1219 | 3300032005 | Ga0307411_10136556 | Ga0307411_101365563 | 252 |
| 1220 | 3300041404 | Ga0439436_0007083 | Ga0439436_0007083_1741_2499 | 252 |
| 1221 | 3300041411 | Ga0439466_0026452 | Ga0439466_0026452_349_1107 | 252 |
| 1222 | 3300041411 | Ga0439466_0066266 | Ga0439466_0066266_379_1137 | 252 |
| 1223 | 3300041413 | Ga0439465_0018713 | Ga0439465_0018713_795_1553 | 252 |
| 1224 | 3300041999 | Ga0439433_0012982 | Ga0439433_0012982_532_1290 | 252 |
| 1225 | 3300042000 | Ga0439437_008148 | Ga0439437_008148_359_1150 | 252 |
| 1226 | 3300042002 | Ga0439442_006072 | Ga0439442_006072_346_1104 | 252 |
| 1227 | 3300042006 | Ga0439432_016992 | Ga0439432_016992_358_1116 | 252 |
| 1228 | 3300042007 | Ga0439449_0001676 | Ga0439449_0001676_3092_3850 | 252 |
| 1229 | 3300042007 | Ga0439449_0006540 | Ga0439449_0006540_1970_2728 | 252 |
| 1230 | 3300042014 | Ga0439457_022857 | Ga0439457_022857_189_947 | 252 |
| 1231 | 3300042125 | Ga0450923_005039 | Ga0450923_005039_566_1324 | 252 |
| 1232 | 3300042133 | Ga0450896_010426 | Ga0450896_010426_80_838 | 252 |
| 1233 | 3300042145 | Ga0450906_005442 | Ga0450906_005442_434_1192 | 252 |
| 1234 | 3300042185 | Ga0450909_023806 | Ga0450909_023806_132_890 | 252 |
| 1235 | 3300042435 | Ga0439434_0006287 | Ga0439434_0006287_339_1097 | 252 |
| 1236 | 3300042435 | Ga0439434_0015320 | Ga0439434_0015320_1408_2199 | 252 |
| 1237 | 3300042439 | Ga0439464_0007442 | Ga0439464_0007442_1177_1968 | 252 |
| 1238 | 3300042531 | Ga0450918_001794 | Ga0450918_001794_1054_1812 | 252 |
| 1239 | 3300044842 | Ga0466957_0169246 | Ga0466957_0169246_22_813 | 252 |
| 1240 | 3300046453 | Ga0495627_004816 | Ga0495627_004816_904_1662 | 252 |
| 1241 | 3300046460 | Ga0495638_0099373 | Ga0495638_0099373_282_1040 | 252 |
| 1242 | 3300046512 | Ga0495610_0036516 | Ga0495610_0036516_1229_1987 | 252 |
| 1243 | 3300046513 | Ga0495616_0002465 | Ga0495616_0002465_11036_11794 | 252 |
| 1244 | 3300046515 | Ga0495620_0011399 | Ga0495620_0011399_3845_4603 | 252 |
| 1245 | 3300046518 | Ga0495631_0000883 | Ga0495631_0000883_11011_11769 | 252 |
| 1246 | 3300046520 | Ga0495637_0004267 | Ga0495637_0004267_3320_4078 | 252 |
| 1247 | 3300046530 | Ga0495654_0034731 | Ga0495654_0034731_1682_2440 | 252 |
| 1248 | 3300046536 | Ga0495587_0140819 | Ga0495587_0140819_106_864 | 252 |
| 1249 | 3300046538 | Ga0495609_0036123 | Ga0495609_0036123_293_1051 | 252 |
| 1250 | 3300046543 | Ga0495645_0325545 | Ga0495645_0325545_205_963 | 252 |
| 1251 | 3300046660 | Ga0495625_0000146 | Ga0495625_0000146_64341_65099 | 252 |
| 1252 | 3300046660 | Ga0495625_0171897 | Ga0495625_0171897_26_784 | 252 |
| 1253 | 3300046663 | Ga0495635_0217440 | Ga0495635_0217440_245_1003 | 252 |
| 1254 | 3300046674 | Ga0495588_0024531 | Ga0495588_0024531_345_1103 | 252 |
| 1255 | 3300046691 | Ga0495670_0174833 | Ga0495670_0174833_151_909 | 252 |
| 1256 | 3300046692 | Ga0495671_0001267 | Ga0495671_0001267_2954_3712 | 252 |
| 1257 | 3300047321 | Ga0495676_0066877 | Ga0495676_0066877_1281_2039 | 252 |
| 1258 | 3300047673 | Ga0495593_0038193 | Ga0495593_0038193_982_1740 | 252 |
| 1259 | 3300048088 | Ga0495602_0163284 | Ga0495602_0163284_927_1685 | 252 |
| 1260 | 3300048904 | Ga0496101_0424783 | Ga0496101_0424783_95_853 | 252 |
| 1261 | 3300048919 | Ga0496116_0011992 | Ga0496116_0011992_6267_7025 | 252 |
| 1262 | 3300048920 | Ga0496117_0022148 | Ga0496117_0022148_1386_2144 | 252 |
| 1263 | 3300048921 | Ga0496118_0062498 | Ga0496118_0062498_511_1269 | 252 |
| 1264 | 3300048924 | Ga0496121_0195470 | Ga0496121_0195470_603_1361 | 252 |
| 1265 | 3300048926 | Ga0496123_0094591 | Ga0496123_0094591_385_1143 | 252 |
| 1266 | 3300048927 | Ga0496124_0069827 | Ga0496124_0069827_320_1078 | 252 |
| 1267 | 3300048928 | Ga0496125_0057514 | Ga0496125_0057514_379_1137 | 252 |
| 1268 | 3300050489 | nmdc:mga03683_18307_c1 | nmdc:mga03683_18307_c1_1010_1768 | 252 |
| 1269 | 3300050489 | nmdc:mga03683_73173_c1 | nmdc:mga03683_73173_c1_522_1280 | 252 |
| 1270 | 3300050490 | nmdc:mga03n38_23409_c1 | nmdc:mga03n38_23409_c1_1678_2436 | 252 |
| 1271 | 3300050490 | nmdc:mga03n38_3064_c1 | nmdc:mga03n38_3064_c1_651_1409 | 252 |
| 1272 | 3300050492 | nmdc:mga0yw44_3952_c1 | nmdc:mga0yw44_3952_c1_691_1449 | 252 |
| 1273 | 3300050493 | nmdc:mga0k408_102039_c1 | nmdc:mga0k408_102039_c1_527_1285 | 252 |
| 1274 | 3300050493 | nmdc:mga0k408_10609_c1 | nmdc:mga0k408_10609_c1_1226_1984 | 252 |
| 1275 | 3300050493 | nmdc:mga0k408_4859_c1 | nmdc:mga0k408_4859_c1_5986_6744 | 252 |
| 1276 | 3300050496 | nmdc:mga07m45_31684_c1 | nmdc:mga07m45_31684_c1_140_898 | 252 |
| 1277 | 3300050496 | nmdc:mga07m45_6733_c1 | nmdc:mga07m45_6733_c1_1374_2132 | 252 |
| 1278 | 3300050496 | nmdc:mga07m45_89296_c1 | nmdc:mga07m45_89296_c1_228_986 | 252 |
| 1279 | 3300050516 | nmdc:mga0sz30_37259_c1 | nmdc:mga0sz30_37259_c1_1059_1817 | 252 |
| 1280 | 3300053079 | Ga0500610_0023764 | Ga0500610_0023764_1547_2305 | 252 |
| 1281 | 3300053079 | Ga0500610_0025324 | Ga0500610_0025324_1466_2224 | 252 |
| 1282 | 3300053087 | Ga0500643_012300 | Ga0500643_012300_527_1285 | 252 |
| 1283 | 3300053093 | Ga0500651_0000468 | Ga0500651_0000468_6475_7233 | 252 |
| 1284 | 3300053110 | Ga0500571_000217 | Ga0500571_000217_13428_14186 | 252 |
| 1285 | 3300053117 | Ga0500593_000365 | Ga0500593_000365_14495_15253 | 252 |
| 1286 | 3300053118 | Ga0500594_0000278 | Ga0500594_0000278_11111_11869 | 252 |
| 1287 | 3300053121 | Ga0500607_000889 | Ga0500607_000889_2110_2868 | 252 |
| 1288 | 3300053122 | Ga0500608_004592 | Ga0500608_004592_798_1556 | 252 |
| 1289 | 3300053122 | Ga0500608_060948 | Ga0500608_060948_288_1046 | 252 |
| 1290 | 3300053125 | Ga0500618_058862 | Ga0500618_058862_89_847 | 252 |
| 1291 | 3300053128 | Ga0500626_004723 | Ga0500626_004723_34_792 | 252 |
| 1292 | 3300053133 | Ga0500655_000301 | Ga0500655_000301_3185_3943 | 252 |
| 1293 | 3300053134 | Ga0500658_0000470 | Ga0500658_0000470_15138_15896 | 252 |
| 1294 | 3300053134 | Ga0500658_0004473 | Ga0500658_0004473_1347_2105 | 252 |
| 1295 | 3300053136 | Ga0500559_0027912 | Ga0500559_0027912_555_1313 | 252 |
| 1296 | 3300053138 | Ga0500564_044553 | Ga0500564_044553_551_1309 | 252 |
| 1297 | 3300053153 | Ga0500616_0016583 | Ga0500616_0016583_453_1211 | 252 |
| 1298 | 3300053158 | Ga0500627_0002314 | Ga0500627_0002314_4497_5255 | 252 |
| 1299 | 3300053161 | Ga0500634_0007218 | Ga0500634_0007218_2595_3353 | 252 |
| 1300 | 3300053162 | Ga0500638_007998 | Ga0500638_007998_2722_3480 | 252 |
| 1301 | 3300053177 | Ga0500636_0003095 | Ga0500636_0003095_926_1684 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
37
227
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8147 | 5 | 224 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.7944 | 5 | 224 |
| 3fh6-assembly2.cif.gz_H | crystal structure of the resting state maltose transporter from e. coli | 0.745 | 29 | 173 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.706 | 2 | 218 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.6876 | 3 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8464 | 4 | 229 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.836 | 4 | 229 | 1.10.3720.10 |
| af_Q2FX86_270_484_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8327 | 8 | 227 | 1.10.3720.10 |
| af_P45768_144_364_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8249 | 26 | 225 | 1.10.3720.10 |
| af_P0AEU3_9_230_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8236 | 21 | 226 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J5PXE5-F1-model_v4 | Amino acid ABC transporter permease | 0.9418 | 1 | 163 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A336QLQ4-F1-model_v4 | deleted | 0.9364 | 5 | 165 |
|
| AF-A0A378A824-F1-model_v4 | Glutamate transport membrane-spanning protein | 0.9321 | 1 | 168 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A2J5PXE5-F1-model_v4 | Amino acid ABC transporter permease | 0.9308 | 1 | 163 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-X0SP61-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9167 | 1 | 174 |
GO:0006865
GO:0022857 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar