F492759

General Info

Members Datasets Scaffolds Average Seq Length
1301 578 1168 243

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100258553|Ga0307408_1002585532
Length 264
Sequence MTDLIAIVRDNWLLLLVGQYPNGPLGGLACTLILSILGIVLAFPLSVLVALARLSRWRLLNWPATALVYGARGIPLLLIILWVYFLVPVLIGRNVTGFTTMVCTLVIYESAFLAEVVRAGILALPSGQMEAARALGHGYLGAMWYVILPQALYNMLPSMLSQFVSTIKETTLGYVINVPELTFAASQINNQLLTKPFHVFFLLAVMYFILCWSLTQLAGWLERRIAAKRSGAGAARQVADAENAVISPIATDRPLATASTRQLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
6 2547132374 Acidovorax radicis N35 Isolate Unclassified
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
16 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
17 2643221569 Achromobacter sp. Root565 Isolate Unclassified
18 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
19 2643221594 Achromobacter sp. Root170 Isolate Unclassified
20 2643221609 Acidovorax sp. Root217 Isolate Unclassified
21 2643221611 Acidovorax sp. Root219 Isolate Unclassified
22 2643221621 Achromobacter sp. Root83 Isolate Unclassified
23 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
24 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
25 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
26 2643221658 Variovorax sp. Root411 Isolate Unclassified
27 2643221672 Variovorax sp. Root434 Isolate Unclassified
28 2643221717 Acidovorax sp. Root267 Isolate Unclassified
29 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
30 2738541277 Variovorax sp. GV051 Isolate Unclassified
31 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
32 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
33 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
34 2738541307 Variovorax sp. GV008 Isolate Unclassified
35 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
36 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
37 2738543012 Acidovorax sp. CF301 Isolate Unclassified
38 2738543013 Variovorax sp. BT01 Isolate Unclassified
39 2738543019 Variovorax sp. GV040 Isolate Unclassified
40 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
41 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
42 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
43 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
44 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
45 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
46 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
47 2816332133 Acidovorax radicis 2721A Isolate Unclassified
48 2818991450 Burkholderia sp. 604 Isolate Unclassified
49 2818991467 Bosea vestrisii 3192 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
52 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
53 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
54 2841760612 Bosea sp. Tri-49 Isolate Nodule
55 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
56 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
57 2842677519 Variovorax sp. R-72495 Isolate Unclassified
58 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
59 2844104063 Bosea sp. Tri-39 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2851182111 Bosea sp. Tri-44 Isolate Nodule
62 2851246043 Bosea sp. Tri-54 Isolate Nodule
63 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
64 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
65 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
66 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
67 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
68 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
69 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
70 2885198086 Variovorax sp. 679 Isolate Unclassified
71 2885211737 Variovorax sp. 553 Isolate Unclassified
72 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
73 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
74 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
75 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
76 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
77 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
78 2904456579 Variovorax sp. 2002 Isolate Unclassified
79 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
80 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
81 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
82 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
83 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
84 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
85 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
86 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
87 2928037797 Variovorax sp. 1126 Isolate Unclassified
88 2928044640 Variovorax sp. 1128 Isolate Unclassified
89 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
90 2928070936 Variovorax gossypii 1167 Isolate Unclassified
91 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
92 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
93 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
94 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
95 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
96 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
97 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
98 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
99 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
100 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
101 2941479691
102 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
103 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
104 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
105 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
106 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
107 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
108 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
109 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
110 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
111 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
112 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
113 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
114 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
115 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
116 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
117 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
118 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
119 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
120 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
121 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
122 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
123 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
124 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
125 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
126 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
127 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
128 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
129 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
130 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
131 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
132 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
133 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
134 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
135 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
136 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
137 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
138 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
139 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
140 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
141 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
142 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
143 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
144 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
145 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
146 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
147 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
148 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
149 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
150 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
151 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
152 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
153 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
156 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
157 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
158 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
159 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
160 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
161 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
162 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
163 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
164 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
165 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
166 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
167 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
168 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
169 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
170 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
171 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
172 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
173 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
176 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
177 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
178 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
179 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
180 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
181 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
182 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
183 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
184 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
185 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
186 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
187 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
188 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
189 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
190 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
191 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
192 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
193 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
194 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
195 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
196 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
197 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
198 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
199 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
200 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
201 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
202 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
203 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
204 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
205 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
206 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
207 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
208 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
209 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
210 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
211 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
213 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
214 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
215 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
216 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
217 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
218 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
219 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
220 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
221 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
222 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
223 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
224 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
225 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
226 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
227 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
228 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
229 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
230 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
231 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
232 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
233 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
234 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
235 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
236 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
237 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
238 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
239 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
240 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
241 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
242 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
243 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
244 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
245 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
246 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
247 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
253 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
254 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
255 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
257 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
258 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
261 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
262 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
264 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
266 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
269 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
319 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
320 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
321 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
322 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
323 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
324 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
325 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
329 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
330 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
331 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
332 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
333 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
334 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
335 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
336 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
337 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
338 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
339 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
340 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
341 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
342 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
343 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
344 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
345 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
346 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
347 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
348 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
349 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
350 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
351 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
352 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
353 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
354 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
355 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
356 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
357 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
358 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
359 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
360 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
361 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
362 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
363 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
364 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
365 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
366 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
367 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
368 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
369 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
370 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
371 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
372 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
373 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
374 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
375 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
376 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
377 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
378 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
379 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
380 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
381 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
382 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
383 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
384 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
385 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
386 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
387 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
388 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
389 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
390 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
391 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
392 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
393 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
394 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
395 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
396 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
397 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
398 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
399 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
400 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
401 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
402 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
403 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
404 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
405 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
406 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
407 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
408 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
409 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
410 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
411 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
412 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
413 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
414 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
415 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
416 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
417 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
418 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
419 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
420 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
421 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
422 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
423 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
424 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
425 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
426 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
427 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
428 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
429 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
430 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
431 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
432 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
433 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
434 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
435 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
436 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
437 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
438 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
439 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
440 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
441 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
442 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
443 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
444 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
445 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
446 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
447 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
448 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
449 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
450 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
451 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
452 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
453 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
454 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
455 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
456 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
457 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
458 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
459 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
460 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
461 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
462 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
463 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
464 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
465 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
466 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
467 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
468 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
469 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
470 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
471 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
472 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
473 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
474 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
475 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
476 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
477 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
478 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
479 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
480 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
481 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
482 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
483 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
484 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
485 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
486 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
487 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
488 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
489 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
490 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
491 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
492 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
493 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
494 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
495 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
496 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
497 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
498 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
499 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
500 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
501 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
502 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
503 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
504 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
505 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
506 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
507 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
508 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
509 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
510 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
511 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
512 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
513 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
514 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
515 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
516 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
517 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
518 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
519 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
522 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
523 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
524 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
525 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
526 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
527 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
528 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
529 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
530 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
531 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
532 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
533 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
534 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
535 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
536 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
537 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
538 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
539 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
540 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
541 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
542 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
543 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
544 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
545 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
546 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
547 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
548 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
549 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
550 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
551 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
552 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
553 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
554 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
555 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
556 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
557 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
558 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
559 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
560 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
561 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
562 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
563 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
564 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
565 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
566 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
567 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
568 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
569 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
570 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
571 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
572 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
573 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
574 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
575 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
576 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
577 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
578 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.85
Metatranscriptomes 0.08
Isolates 10.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.98
Nodule 2.84
Rhizoplane 2.54
Rhizosphere 52.57
Stem 0
Stem Tuber 0
Unclassified 17.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3866527 2162886007 Bacteria 1768
2 JGI24739J22299_10000884 3300001989 Bacteria 11069
3 JGI24739J22299_10008256 3300001989 Bacteria 3886
4 JGI24739J22299_10050406 3300001989 Bacteria 1346
5 JGI24737J22298_10022393 3300001990 Bacteria 2008
6 JGI24735J21928_10001089 3300002067 Bacteria 9706
7 JGI25155J39150_1000334 3300002704 Bacteria 15216
8 JGI25156J39149_1001160 3300002705 Bacteria 11788
9 JGI25156J39149_1008436 3300002705 Bacteria 2596
10 JGI25154J39366_1000262 3300002738 Bacteria 33718
11 JGI25158J39367_1004694 3300002739 Bacteria 2041
12 JGI25152J39213_1000073 3300002773 Bacteria 66515
13 JGI25152J39213_1001016 3300002773 Bacteria 13497
14 JGI25152J39213_1003342 3300002773 Bacteria 5514
15 JGI25152J39213_1017840 3300002773 Bacteria 1327
16 JGI25150J39212_1000062 3300002774 Bacteria 64560
17 JGI25150J39212_1005437 3300002774 Bacteria 2719
18 JGI25150J39212_1005624 3300002774 Bacteria 2658
19 JGI25159J45721_1000058 3300002987 Bacteria 53410
20 JGI25159J45721_1001730 3300002987 Bacteria 8804
21 JGI25159J45721_1003524 3300002987 Bacteria 5514
22 JGI25159J45721_1007582 3300002987 Bacteria 3090
23 JGI25151J46595_10000255 3300003187 Bacteria 62389
24 JGI25151J46595_10000262 3300003187 Bacteria 61170
25 JGI25151J46595_10001460 3300003187 Bacteria 16029
26 JGI25151J46595_10004189 3300003187 Bacteria 7686
27 JGI25151J46595_10007131 3300003187 Bacteria 5514
28 JGI25151J46595_10033571 3300003187 Bacteria 1975
29 JGI25153J46596_10000151 3300003215 Bacteria 70139
30 JGI25153J46596_10000165 3300003215 Bacteria 66515
31 JGI25153J46596_10007202 3300003215 Bacteria 5514
32 JGI25153J46596_10044762 3300003215 Bacteria 1327
33 rootH2_10050129 3300003320 Bacteria 1665
34 rootH2_10059852 3300003320 Bacteria 1131
35 rootL2_10034467 3300003322 Bacteria 2223
36 rootL2_10050359 3300003322 Bacteria 1231
37 rootL2_10143669 3300003322 Bacteria 3096
38 rootH1_10107676 3300003323 Bacteria 1966
39 rootH1_10401376 3300003323 Bacteria 1736
40 JGI25160J50197_1000181 3300003354 Bacteria 53411
41 JGI25160J50197_1005126 3300003354 Bacteria 5514
42 JGI25160J50197_1011694 3300003354 Bacteria 3090
43 JGI25161J50226_1000145 3300003374 Bacteria 49306
44 JGI25161J50226_1002037 3300003374 Bacteria 5502
45 JGI25161J50226_1006710 3300003374 Bacteria 2042
46 Ga0006562J51391_1082376 3300003578 Bacteria 1700
47 Ga0055538_1000051 3300003751 Bacteria 129958
48 Ga0055539_1000076 3300003752 Bacteria 129958
49 Ga0055533_1000082 3300003756 Bacteria 129958
50 Ga0055533_1008674 3300003756 Bacteria 1262
51 Ga0055525_1000109 3300003759 Bacteria 129958
52 Ga0055526_1000146 3300003771 Bacteria 62389
53 Ga0055526_1001310 3300003771 Bacteria 17842
54 Ga0055526_1004888 3300003771 Bacteria 7896
55 Ga0055526_1007739 3300003771 Bacteria 5514
56 Ga0055537_1000024 3300003773 Bacteria 111410
57 Ga0055537_1000090 3300003773 Bacteria 66515
58 Ga0055537_1002874 3300003773 Bacteria 5514
59 Ga0055537_1008855 3300003773 Bacteria 2276
60 Ga0055537_1012606 3300003773 Bacteria 1638
61 Ga0055524_1000195 3300003775 Bacteria 66515
62 Ga0055524_1003526 3300003775 Bacteria 7565
63 Ga0055524_1005712 3300003775 Bacteria 5514
64 Ga0055536_1000113 3300003781 Bacteria 70340
65 Ga0055536_1014327 3300003781 Bacteria 2796
66 Ga0055536_1029422 3300003781 Bacteria 1476
67 Ga0055536_1049137 3300003781 Bacteria 939
68 Ga0055534_1000032 3300003784 Bacteria 118890
69 Ga0055534_1000101 3300003784 Bacteria 66515
70 Ga0055534_1001127 3300003784 Bacteria 11333
71 Ga0055534_1001134 3300003784 Bacteria 11292
72 Ga0055534_1003029 3300003784 Bacteria 5514
73 Ga0055528_1000111 3300003790 Bacteria 66515
74 Ga0055528_1000328 3300003790 Bacteria 39935
75 Ga0055528_1039347 3300003790 Bacteria 1081
76 Ga0055530_10003037 3300003791 Bacteria 10026
77 Ga0055530_10005422 3300003791 Bacteria 6073
78 Ga0055530_10005744 3300003791 Bacteria 5766
79 Ga0055530_10013538 3300003791 Bacteria 2777
80 Ga0055530_10037452 3300003791 Bacteria 1213
81 Ga0055540_1000045 3300003792 Bacteria 152083
82 Ga0055540_1006668 3300003792 Bacteria 4531
83 Ga0055540_1011758 3300003792 Bacteria 2796
84 Ga0055540_1012321 3300003792 Bacteria 2691
85 Ga0055531_10000149 3300003794 Bacteria 80949
86 Ga0055531_10001310 3300003794 Bacteria 18750
87 Ga0055531_10002248 3300003794 Bacteria 13074
88 Ga0055531_10004992 3300003794 Bacteria 7871
89 Ga0055531_10019085 3300003794 Bacteria 2796
90 Ga0055541_1000053 3300003841 Bacteria 129958
91 Ga0055543_1000232 3300004625 Bacteria 44221
92 Ga0055543_1002768 3300004625 Bacteria 5560
93 Ga0055543_1006414 3300004625 Bacteria 2845
94 Ga0065165_1000229 3300005262 Bacteria 98699
95 Ga0065165_1000683 3300005262 Bacteria 48599
96 Ga0065165_1000707 3300005262 Bacteria 47352
97 Ga0065165_1007205 3300005262 Bacteria 5552
98 Ga0065165_1086121 3300005262 Bacteria 808
99 Ga0065714_10002413 3300005288 Bacteria 21651
100 Ga0065714_10006056 3300005288 Bacteria 9266
101 Ga0065714_10064788 3300005288 Bacteria 18794
102 Ga0065714_10091146 3300005288 Bacteria 1919
103 Ga0065714_10100060 3300005288 Bacteria 1672
104 Ga0065704_10007833 3300005289 Bacteria 2842
105 Ga0065704_10155909 3300005289 Bacteria 1391
106 Ga0070658_10100066 3300005327 Bacteria 2396
107 Ga0070676_10027658 3300005328 Bacteria 3218
108 Ga0070683_100634969 3300005329 Bacteria 1022
109 Ga0070677_10037564 3300005333 Bacteria 1890
110 Ga0068869_100044913 3300005334 Bacteria 3179
111 Ga0068869_100068719 3300005334 Bacteria 2618
112 Ga0068869_100161450 3300005334 Bacteria 1745
113 Ga0068869_100183386 3300005334 Bacteria 1642
114 Ga0068869_100414763 3300005334 Bacteria 1110
115 Ga0068869_100424591 3300005334 Bacteria 1097
116 Ga0068868_100035446 3300005338 Bacteria 3857
117 Ga0070660_100042053 3300005339 Bacteria 3486
118 Ga0070660_100194430 3300005339 Bacteria 1644
119 Ga0070689_100226629 3300005340 Bacteria 1535
120 Ga0070661_100104326 3300005344 Bacteria 2112
121 Ga0070669_100447370 3300005353 Bacteria 1064
122 Ga0070675_100002236 3300005354 Bacteria 14369
123 Ga0070675_100065901 3300005354 Bacteria 2995
124 Ga0070675_100202229 3300005354 Bacteria 1724
125 Ga0070675_100623740 3300005354 Bacteria 979
126 Ga0070671_100061377 3300005355 Bacteria 3131
127 Ga0070671_100304832 3300005355 Bacteria 1356
128 Ga0070674_100233356 3300005356 Bacteria 1437
129 Ga0070673_100014369 3300005364 Bacteria 5511
130 Ga0070659_100170590 3300005366 Bacteria 1782
131 Ga0070659_100252257 3300005366 Bacteria 1463
132 Ga0070667_100100410 3300005367 Bacteria 2499
133 Ga0070667_100604933 3300005367 Bacteria 1010
134 Ga0070709_10000273 3300005434 Bacteria 33081
135 Ga0070714_100005827 3300005435 Bacteria 9449
136 Ga0070710_10000212 3300005437 Bacteria 27146
137 Ga0070711_100005770 3300005439 Bacteria 7431
138 Ga0070663_100087966 3300005455 Bacteria 2297
139 Ga0070663_100149105 3300005455 Bacteria 1792
140 Ga0070663_100162118 3300005455 Bacteria 1722
141 Ga0070678_100499699 3300005456 Bacteria 1073
142 Ga0070678_100547491 3300005456 Bacteria 1027
143 Ga0070662_100128024 3300005457 Bacteria 1954
144 Ga0070662_100174454 3300005457 Bacteria 1690
145 Ga0070662_100420942 3300005457 Bacteria 1105
146 Ga0068867_100008131 3300005459 Bacteria 7412
147 Ga0068867_100220837 3300005459 Bacteria 1527
148 Ga0070706_100002001 3300005467 Bacteria 20981
149 Ga0070707_100050329 3300005468 Bacteria 3994
150 Ga0070698_100058198 3300005471 Bacteria 3908
151 Ga0070698_100671354 3300005471 Bacteria 978
152 Ga0070699_100096827 3300005518 Bacteria 2585
153 Ga0070679_100054296 3300005530 Bacteria 3988
154 Ga0068853_100075902 3300005539 Bacteria 2934
155 Ga0068853_100150267 3300005539 Bacteria 2096
156 Ga0070672_100007481 3300005543 Bacteria 7416
157 Ga0070672_100109110 3300005543 Bacteria 2254
158 Ga0070672_100642816 3300005543 Bacteria 926
159 Ga0070665_100009677 3300005548 Bacteria 9741
160 Ga0070665_100047941 3300005548 Bacteria 4289
161 Ga0070665_100313470 3300005548 Bacteria 1573
162 Ga0070665_100432335 3300005548 Bacteria 1325
163 Ga0068855_100014961 3300005563 Bacteria 9345
164 Ga0068855_100024941 3300005563 Bacteria 7156
165 Ga0068855_100046805 3300005563 Bacteria 5112
166 Ga0068855_100212698 3300005563 Bacteria 2172
167 Ga0068855_100461994 3300005563 Bacteria 1384
168 Ga0070664_100014177 3300005564 Bacteria 6500
169 Ga0070664_100047658 3300005564 Bacteria 3621
170 Ga0068857_100010180 3300005577 Bacteria 8174
171 Ga0068857_100246547 3300005577 Bacteria 1637
172 Ga0068857_100593434 3300005577 Bacteria 1047
173 Ga0068854_100059290 3300005578 Bacteria 2766
174 Ga0068854_100063721 3300005578 Bacteria 2677
175 Ga0068854_100373796 3300005578 Bacteria 1173
176 Ga0068856_100476594 3300005614 Bacteria 1269
177 Ga0068856_100505105 3300005614 Bacteria 1230
178 Ga0068852_100000685 3300005616 Bacteria 22196
179 Ga0068852_100328895 3300005616 Bacteria 1486
180 Ga0068852_100418916 3300005616 Bacteria 1321
181 Ga0068859_100212786 3300005617 Bacteria 2020
182 Ga0068864_100482027 3300005618 Bacteria 1191
183 Ga0068863_100116157 3300005841 Bacteria 2550
184 Ga0068858_100832898 3300005842 Bacteria 901
185 Ga0068860_100003437 3300005843 Bacteria 16288
186 Ga0068862_100091402 3300005844 Bacteria 2651
187 Ga0075365_10060275 3300006038 Bacteria 2531
188 Ga0075363_100033189 3300006048 Bacteria 2686
189 Ga0075363_100051911 3300006048 Bacteria 2188
190 Ga0075364_10004709 3300006051 Bacteria 7877
191 Ga0075364_10028552 3300006051 Bacteria 3571
192 Ga0075364_10057494 3300006051 Bacteria 2548
193 Ga0075364_10165480 3300006051 Bacteria 1494
194 Ga0075432_10011587 3300006058 Bacteria 2996
195 Ga0075432_10043274 3300006058 Bacteria 1577
196 Ga0075432_10070482 3300006058 Bacteria 1255
197 Ga0075432_10111901 3300006058 Bacteria 1018
198 Ga0070715_10032928 3300006163 Bacteria 2115
199 Ga0070716_100002266 3300006173 Bacteria 8867
200 Ga0070712_100025966 3300006175 Bacteria 3898
201 Ga0075362_10000208 3300006177 Bacteria 16362
202 Ga0075362_10006362 3300006177 Bacteria 4401
203 Ga0075362_10009615 3300006177 Bacteria 3746
204 Ga0075362_10013681 3300006177 Bacteria 3255
205 Ga0075362_10033080 3300006177 Bacteria 2247
206 Ga0075362_10053163 3300006177 Bacteria 1817
207 Ga0075362_10186859 3300006177 Bacteria 1005
208 Ga0075367_10029978 3300006178 Bacteria 3115
209 Ga0075367_10043998 3300006178 Bacteria 2615
210 Ga0075367_10080453 3300006178 Bacteria 1971
211 Ga0075367_10108540 3300006178 Bacteria 1702
212 Ga0075369_10000489 3300006186 Bacteria 12265
213 Ga0075369_10013822 3300006186 Bacteria 3213
214 Ga0075366_10000903 3300006195 Bacteria 14366
215 Ga0075366_10002875 3300006195 Bacteria 8929
216 Ga0075366_10006394 3300006195 Bacteria 6455
217 Ga0075366_10011740 3300006195 Bacteria 4952
218 Ga0075366_10021430 3300006195 Bacteria 3755
219 Ga0075366_10039721 3300006195 Bacteria 2781
220 Ga0075366_10056113 3300006195 Bacteria 2339
221 Ga0075366_10068257 3300006195 Bacteria 2115
222 Ga0075366_10068393 3300006195 Bacteria 2113
223 Ga0075366_10094136 3300006195 Bacteria 1796
224 Ga0075366_10129714 3300006195 Bacteria 1521
225 Ga0075366_10197337 3300006195 Bacteria 1223
226 Ga0097621_100236848 3300006237 Bacteria 1595
227 Ga0097621_100288772 3300006237 Bacteria 1445
228 Ga0097621_100297213 3300006237 Bacteria 1425
229 Ga0075370_10000837 3300006353 Bacteria 12436
230 Ga0075370_10019416 3300006353 Bacteria 3702
231 Ga0075370_10025648 3300006353 Bacteria 3262
232 Ga0075370_10033785 3300006353 Bacteria 2865
233 Ga0075370_10046452 3300006353 Bacteria 2457
234 Ga0075370_10071807 3300006353 Bacteria 1981
235 Ga0075370_10088581 3300006353 Bacteria 1784
236 Ga0068871_100141221 3300006358 Bacteria 2048
237 Ga0068871_100185673 3300006358 Bacteria 1789
238 Ga0068871_100201548 3300006358 Bacteria 1718
239 Ga0068871_100364000 3300006358 Bacteria 1281
240 Ga0068865_100274460 3300006881 Bacteria 1340
241 Ga0097620_100212794 3300006931 Bacteria 2020
242 Ga0099823_1069269 3300006944 Bacteria 1606
243 Ga0079104_1000014 3300006946 Bacteria 337362
244 Ga0099826_10000060 3300006948 Bacteria 63334
245 Ga0099826_10190731 3300006948 Bacteria 1131
246 Ga0105251_10000496 3300009011 Bacteria 37267
247 Ga0105244_10010597 3300009036 Bacteria 5576
248 Ga0105244_10018258 3300009036 Bacteria 3939
249 Ga0105244_10139950 3300009036 Bacteria 1164
250 Ga0105240_10001617 3300009093 Bacteria 38199
251 Ga0105240_10029724 3300009093 Bacteria 7111
252 Ga0105240_10125834 3300009093 Bacteria 3080
253 Ga0111539_10933917 3300009094 Bacteria 1009
254 Ga0105245_10019045 3300009098 Bacteria 6007
255 Ga0105245_10049156 3300009098 Bacteria 3775
256 Ga0105245_10116403 3300009098 Bacteria 2492
257 Ga0105245_10130847 3300009098 Bacteria 2353
258 Ga0105245_10244713 3300009098 Bacteria 1740
259 Ga0105247_10009542 3300009101 Bacteria 5889
260 Ga0105247_10240481 3300009101 Bacteria 1233
261 Ga0105243_10010819 3300009148 Bacteria 6904
262 Ga0105243_10016506 3300009148 Bacteria 5582
263 Ga0105243_10021385 3300009148 Bacteria 4910
264 Ga0105243_10096992 3300009148 Bacteria 2440
265 Ga0105241_10002869 3300009174 Bacteria 12876
266 Ga0105241_10444866 3300009174 Bacteria 1145
267 Ga0105241_10718906 3300009174 Bacteria 913
268 Ga0105242_10099359 3300009176 Bacteria 2463
269 Ga0105248_10506674 3300009177 Bacteria 1361
270 Ga0105237_10001263 3300009545 Bacteria 33774
271 Ga0105237_10046055 3300009545 Bacteria 4388
272 Ga0105237_10085232 3300009545 Bacteria 3149
273 Ga0105237_10266053 3300009545 Bacteria 1717
274 Ga0105238_10246666 3300009551 Bacteria 1764
275 Ga0105238_10336574 3300009551 Bacteria 1497
276 Ga0105238_10378973 3300009551 Bacteria 1406
277 Ga0105249_10596983 3300009553 Bacteria 1158
278 Ga0105249_10815586 3300009553 Bacteria 997
279 Ga0105239_10007556 3300010375 Bacteria 12467
280 Ga0105239_10015359 3300010375 Bacteria 8484
281 Ga0105239_10178708 3300010375 Bacteria 2374
282 Ga0105239_10358473 3300010375 Bacteria 1647
283 Ga0105239_10728656 3300010375 Bacteria 1134
284 Ga0105246_10259428 3300011119 Bacteria 1384
285 Ga0105246_10471430 3300011119 Bacteria 1060
286 Ga0105246_10820727 3300011119 Bacteria 827
287 Ga0157347_1001548 3300012502 Bacteria 1828
288 Ga0157347_1009801 3300012502 Bacteria 997
289 Ga0157339_1003962 3300012505 Bacteria 1097
290 Ga0157373_10021915 3300013100 Bacteria 4636
291 Ga0157373_10083632 3300013100 Bacteria 2250
292 Ga0157370_10194426 3300013104 Bacteria 1883
293 Ga0157369_10015236 3300013105 Bacteria 8675
294 Ga0171462_1015 3300013250 Bacteria 169578
295 Ga0171462_1043 3300013250 Bacteria 56604
296 Ga0157378_10089005 3300013297 Bacteria 2803
297 Ga0163162_10046903 3300013306 Bacteria 4331
298 Ga0163162_10135136 3300013306 Bacteria 2577
299 Ga0163162_10192024 3300013306 Bacteria 2170
300 Ga0163162_10480458 3300013306 Bacteria 1374
301 Ga0163162_10550796 3300013306 Bacteria 1282
302 Ga0157375_10043012 3300013308 Bacteria 4377
303 Ga0157375_10108427 3300013308 Bacteria 2871
304 Ga0157375_10231827 3300013308 Bacteria 2005
305 Ga0157375_10397693 3300013308 Bacteria 1545
306 Ga0182008_10000412 3300014497 Bacteria 33105
307 Ga0182008_10005923 3300014497 Bacteria 6899
308 Ga0182008_10006022 3300014497 Bacteria 6826
309 Ga0182008_10026429 3300014497 Bacteria 2944
310 Ga0157379_10294327 3300014968 Bacteria 1479
311 Ga0157376_10000620 3300014969 Bacteria 22978
312 Ga0157376_10391564 3300014969 Bacteria 1341
313 Ga0157376_11031760 3300014969 Bacteria 846
314 Ga0182006_1000053 3300015261 Bacteria 180648
315 Ga0182006_1002039 3300015261 Bacteria 11337
316 Ga0182006_1013692 3300015261 Bacteria 3510
317 Ga0182007_10000075 3300015262 Bacteria 77567
318 Ga0182007_10001181 3300015262 Bacteria 14184
319 Ga0182007_10002674 3300015262 Bacteria 8750
320 Ga0182007_10006376 3300015262 Bacteria 5066
321 Ga0182007_10006880 3300015262 Bacteria 4833
322 Ga0182005_1000031 3300015265 Bacteria 202902
323 Ga0182005_1020136 3300015265 Bacteria 1837
324 Ga0183362_10001 3300015683 Bacteria 2046624
325 Ga0183362_10011 3300015683 Bacteria 85355
326 Ga0163161_10157636 3300017792 Bacteria 1729
327 Ga0163161_10433207 3300017792 Bacteria 1060
328 Ga0214544_1007467 3300021320 Bacteria 19156
329 Ga0214542_1020416 3300021321 Bacteria 4865
330 Ga0214545_1010456 3300021324 Bacteria 13467
331 Ga0214543_1008348 3300021327 Bacteria 17026
332 Ga0213872_10000681 3300021361 Bacteria 25737
333 Ga0213872_10003867 3300021361 Bacteria 8133
334 Ga0213872_10015097 3300021361 Bacteria 3593
335 Ga0209435_100104 3300025206 Bacteria 33801
336 Ga0209435_101167 3300025206 Bacteria 3592
337 Ga0209436_105070 3300025208 Bacteria 3108
338 Ga0209436_108800 3300025208 Bacteria 1975
339 Ga0209784_100083 3300025224 Bacteria 131194
340 Ga0209566_100102 3300025225 Bacteria 131194
341 Ga0209674_100078 3300025226 Bacteria 206136
342 Ga0209674_100125 3300025226 Bacteria 131194
343 Ga0209672_103796 3300025228 Bacteria 2997
344 Ga0209563_100120 3300025230 Bacteria 131194
345 Ga0207425_1000042 3300025245 Bacteria 210165
346 Ga0207425_1000116 3300025245 Bacteria 75410
347 Ga0207425_1000328 3300025245 Bacteria 33571
348 Ga0207425_1001669 3300025245 Bacteria 8876
349 Ga0209646_1000108 3300025246 Bacteria 158853
350 Ga0209026_1002531 3300025250 Bacteria 6765
351 Ga0209677_100076 3300025253 Bacteria 131194
352 Ga0209759_1000087 3300025256 Bacteria 166470
353 Ga0209759_1000173 3300025256 Bacteria 107724
354 Ga0209129_1000035 3300025258 Bacteria 329303
355 Ga0209129_1000058 3300025258 Bacteria 252258
356 Ga0209129_1000247 3300025258 Bacteria 56623
357 Ga0209129_1003795 3300025258 Bacteria 6330
358 Ga0209565_1000027 3300025263 Bacteria 360545
359 Ga0209565_1000039 3300025263 Bacteria 278026
360 Ga0209565_1000256 3300025263 Bacteria 56528
361 Ga0209673_1000031 3300025273 Bacteria 347560
362 Ga0209673_1000284 3300025273 Bacteria 94932
363 Ga0209673_1000592 3300025273 Bacteria 56577
364 Ga0209673_1000731 3300025273 Bacteria 45565
365 Ga0209673_1003402 3300025273 Bacteria 9431
366 Ga0209673_1012164 3300025273 Bacteria 3489
367 Ga0209130_1000025 3300025284 Bacteria 336491
368 Ga0209130_1000045 3300025284 Bacteria 240278
369 Ga0209130_1000366 3300025284 Bacteria 51201
370 Ga0209130_1001347 3300025284 Bacteria 16627
371 Ga0209130_1019026 3300025284 Bacteria 1601
372 Ga0209675_1000030 3300025291 Bacteria 278026
373 Ga0209675_1000064 3300025291 Bacteria 177063
374 Ga0209675_1000397 3300025291 Bacteria 36156
375 Ga0209675_1000683 3300025291 Bacteria 23657
376 Ga0209675_1003937 3300025291 Bacteria 6808
377 Ga0209676_1000048 3300025292 Bacteria 403716
378 Ga0209676_1000123 3300025292 Bacteria 195351
379 Ga0209676_1000135 3300025292 Bacteria 182756
380 Ga0209676_1000633 3300025292 Bacteria 50662
381 Ga0209676_1001946 3300025292 Bacteria 16637
382 Ga0209676_1006693 3300025292 Bacteria 5612
383 Ga0209025_1000057 3300025294 Bacteria 314601
384 Ga0209025_1000075 3300025294 Bacteria 275717
385 Ga0209025_1000432 3300025294 Bacteria 82875
386 Ga0209025_1000710 3300025294 Bacteria 56623
387 Ga0209025_1000893 3300025294 Bacteria 46429
388 Ga0209025_1020385 3300025294 Bacteria 3630
389 Ga0209564_1000024 3300025295 Bacteria 535041
390 Ga0209564_1000040 3300025295 Bacteria 411388
391 Ga0209564_1000596 3300025295 Bacteria 56623
392 Ga0209564_1001056 3300025295 Bacteria 33579
393 Ga0209758_1000050 3300025297 Bacteria 345008
394 Ga0209758_1000066 3300025297 Bacteria 298620
395 Ga0209758_1000120 3300025297 Bacteria 192212
396 Ga0209758_1000213 3300025297 Bacteria 126745
397 Ga0209758_1002886 3300025297 Bacteria 16627
398 Ga0209050_1000012 3300025298 Bacteria 813717
399 Ga0209050_1000100 3300025298 Bacteria 231385
400 Ga0209050_1000178 3300025298 Bacteria 145314
401 Ga0209050_1000460 3300025298 Bacteria 72933
402 Ga0209050_1000617 3300025298 Bacteria 55750
403 Ga0209050_1004472 3300025298 Bacteria 9413
404 Ga0209256_1000023 3300025299 Bacteria 461150
405 Ga0209256_1000516 3300025299 Bacteria 56623
406 Ga0209256_1000679 3300025299 Bacteria 45927
407 Ga0209256_1011869 3300025299 Bacteria 3420
408 Ga0209256_1014142 3300025299 Bacteria 2898
409 Ga0207426_1000058 3300025302 Bacteria 363857
410 Ga0207426_1000118 3300025302 Bacteria 223341
411 Ga0207426_1000710 3300025302 Bacteria 39012
412 Ga0209051_1000019 3300025303 Bacteria 511268
413 Ga0209051_1000067 3300025303 Bacteria 227181
414 Ga0209051_1000221 3300025303 Bacteria 96174
415 Ga0209051_1000777 3300025303 Bacteria 33839
416 Ga0209051_1001382 3300025303 Bacteria 20949
417 Ga0209051_1001862 3300025303 Bacteria 16570
418 Ga0209051_1008202 3300025303 Bacteria 5565
419 Ga0209257_1000024 3300025304 Bacteria 726068
420 Ga0209257_1000057 3300025304 Bacteria 396985
421 Ga0209257_1000095 3300025304 Bacteria 259437
422 Ga0209257_1000188 3300025304 Bacteria 154074
423 Ga0209257_1000451 3300025304 Bacteria 77246
424 Ga0209257_1004070 3300025304 Bacteria 11730
425 Ga0209257_1018547 3300025304 Bacteria 2670
426 Ga0209257_1048255 3300025304 Bacteria 1219
427 Ga0207655_1003178 3300025728 Bacteria 12400
428 Ga0207655_1010745 3300025728 Bacteria 5524
429 Ga0207713_1001113 3300025735 Bacteria 22951
430 Ga0207692_10000086 3300025898 Bacteria 27120
431 Ga0207710_10015253 3300025900 Bacteria 3244
432 Ga0207647_10004634 3300025904 Bacteria 10188
433 Ga0207647_10031606 3300025904 Bacteria 3406
434 Ga0207647_10109369 3300025904 Bacteria 1635
435 Ga0207647_10125275 3300025904 Bacteria 1512
436 Ga0207685_10017087 3300025905 Bacteria 2336
437 Ga0207699_10000515 3300025906 Bacteria 19183
438 Ga0207645_10006283 3300025907 Bacteria 8540
439 Ga0207645_10100894 3300025907 Bacteria 1862
440 Ga0207705_10015142 3300025909 Bacteria 5544
441 Ga0207705_10138089 3300025909 Bacteria 1818
442 Ga0207705_10317095 3300025909 Bacteria 1198
443 Ga0207684_10019493 3300025910 Bacteria 5801
444 Ga0207695_10000006 3300025913 Bacteria 1135309
445 Ga0207695_10000008 3300025913 Bacteria 1058268
446 Ga0207695_10026593 3300025913 Bacteria 6457
447 Ga0207695_10161880 3300025913 Bacteria 2169
448 Ga0207671_10009661 3300025914 Bacteria 8037
449 Ga0207671_10100189 3300025914 Bacteria 2193
450 Ga0207671_10256385 3300025914 Bacteria 1376
451 Ga0207693_10018998 3300025915 Bacteria 5470
452 Ga0207663_10001767 3300025916 Bacteria 10187
453 Ga0207662_10226742 3300025918 Bacteria 1219
454 Ga0207657_10018853 3300025919 Bacteria 6571
455 Ga0207657_10431067 3300025919 Bacteria 1036
456 Ga0207657_10434891 3300025919 Bacteria 1030
457 Ga0207652_10110945 3300025921 Bacteria 2432
458 Ga0207694_10184045 3300025924 Bacteria 1695
459 Ga0207694_10230685 3300025924 Bacteria 1512
460 Ga0207694_10513345 3300025924 Bacteria 1004
461 Ga0207650_10017844 3300025925 Bacteria 4972
462 Ga0207659_10017903 3300025926 Bacteria 4635
463 Ga0207687_10039339 3300025927 Bacteria 3237
464 Ga0207687_10088279 3300025927 Bacteria 2255
465 Ga0207687_10097146 3300025927 Bacteria 2160
466 Ga0207687_10396547 3300025927 Bacteria 1134
467 Ga0207700_10005674 3300025928 Bacteria 7492
468 Ga0207664_10299720 3300025929 Bacteria 1414
469 Ga0207644_10072269 3300025931 Bacteria 2526
470 Ga0207644_10163672 3300025931 Bacteria 1731
471 Ga0207644_10173699 3300025931 Bacteria 1684
472 Ga0207690_10081721 3300025932 Bacteria 2259
473 Ga0207690_10277869 3300025932 Bacteria 1303
474 Ga0207706_10016401 3300025933 Bacteria 6689
475 Ga0207706_10113494 3300025933 Bacteria 2383
476 Ga0207706_10313136 3300025933 Bacteria 1366
477 Ga0207709_10000491 3300025935 Bacteria 35713
478 Ga0207709_10003200 3300025935 Bacteria 9841
479 Ga0207709_10018580 3300025935 Bacteria 3895
480 Ga0207709_10021645 3300025935 Bacteria 3640
481 Ga0207709_10272932 3300025935 Bacteria 1245
482 Ga0207670_10247690 3300025936 Bacteria 1376
483 Ga0207669_10050596 3300025937 Bacteria 2485
484 Ga0207665_10002776 3300025939 Bacteria 11733
485 Ga0207691_10003629 3300025940 Bacteria 14981
486 Ga0207691_10065263 3300025940 Bacteria 3296
487 Ga0207691_10420480 3300025940 Bacteria 1139
488 Ga0207689_10027056 3300025942 Bacteria 4801
489 Ga0207689_10198759 3300025942 Bacteria 1655
490 Ga0207689_10278214 3300025942 Bacteria 1386
491 Ga0207689_10336481 3300025942 Bacteria 1254
492 Ga0207679_10018847 3300025945 Bacteria 4630
493 Ga0207679_10041723 3300025945 Bacteria 3293
494 Ga0207667_10002561 3300025949 Bacteria 22613
495 Ga0207667_10028495 3300025949 Bacteria 6066
496 Ga0207667_10099751 3300025949 Bacteria 2996
497 Ga0207667_10152304 3300025949 Bacteria 2380
498 Ga0207667_10256617 3300025949 Bacteria 1788
499 Ga0207651_10019311 3300025960 Bacteria 4080
500 Ga0207651_10426802 3300025960 Bacteria 1133
501 Ga0207712_10326174 3300025961 Bacteria 1268
502 Ga0207640_10058242 3300025981 Bacteria 2544
503 Ga0207640_10113777 3300025981 Bacteria 1924
504 Ga0207640_10169229 3300025981 Bacteria 1626
505 Ga0207658_10015535 3300025986 Bacteria 5223
506 Ga0207658_10042781 3300025986 Bacteria 3288
507 Ga0207658_10129530 3300025986 Bacteria 2025
508 Ga0207677_10016985 3300026023 Bacteria 4325
509 Ga0207639_10196053 3300026041 Bacteria 1729
510 Ga0207678_10019795 3300026067 Bacteria 5919
511 Ga0207678_10248208 3300026067 Bacteria 1524
512 Ga0207678_10356855 3300026067 Bacteria 1261
513 Ga0207648_10003368 3300026089 Bacteria 16788
514 Ga0207676_10142739 3300026095 Bacteria 2052
515 Ga0207676_10554062 3300026095 Bacteria 1099
516 Ga0207674_10008463 3300026116 Bacteria 11884
517 Ga0207674_10101659 3300026116 Bacteria 2855
518 Ga0207674_10132788 3300026116 Bacteria 2452
519 Ga0207674_10237780 3300026116 Bacteria 1768
520 Ga0207675_100323106 3300026118 Bacteria 1507
521 Ga0207683_10394660 3300026121 Bacteria 1272
522 Ga0207683_10501281 3300026121 Bacteria 1121
523 Ga0207683_10712067 3300026121 Bacteria 931
524 Ga0207698_10107910 3300026142 Bacteria 2325
525 Ga0207698_10128225 3300026142 Bacteria 2162
526 Ga0207698_10327107 3300026142 Bacteria 1438
527 Ga0209281_1000032 3300027111 Bacteria 401727
528 Ga0209389_1026550 3300027296 Bacteria 5015
529 Ga0209489_115028 3300027361 Bacteria 5015
530 Ga0209700_100026 3300027363 Bacteria 224498
531 Ga0209282_1000934 3300027666 Bacteria 15275
532 Ga0209813_10058807 3300027866 Bacteria 1222
533 Ga0207428_10150283 3300027907 Bacteria 1773
534 Ga0207428_10257875 3300027907 Bacteria 1299
535 Ga0268266_10033588 3300028379 Bacteria 4361
536 Ga0268266_10063810 3300028379 Bacteria 3180
537 Ga0268266_10215669 3300028379 Bacteria 1762
538 Ga0268266_10401158 3300028379 Bacteria 1296
539 Ga0268265_10054227 3300028380 Bacteria 3041
540 Ga0268264_10000020 3300028381 Bacteria 483593
541 Ga0265334_10060317 3300028573 Bacteria 1432
542 Ga0265336_10000013 3300028666 Bacteria 252156
543 Ga0307517_10001174 3300028786 Bacteria 44101
544 Ga0307517_10003316 3300028786 Bacteria 25116
545 Ga0307517_10056423 3300028786 Bacteria 3833
546 Ga0307517_10105455 3300028786 Bacteria 2187
547 Ga0307517_10107801 3300028786 Bacteria 2143
548 Ga0307517_10130465 3300028786 Bacteria 1812
549 Ga0307515_10000030 3300028794 Bacteria 364482
550 Ga0307515_10000067 3300028794 Bacteria 242978
551 Ga0307515_10000195 3300028794 Bacteria 148138
552 Ga0307515_10000842 3300028794 Bacteria 70481
553 Ga0307515_10001836 3300028794 Bacteria 47333
554 Ga0307515_10002244 3300028794 Bacteria 42358
555 Ga0307515_10002513 3300028794 Bacteria 39723
556 Ga0307515_10011464 3300028794 Bacteria 16826
557 Ga0307515_10012396 3300028794 Bacteria 16037
558 Ga0307515_10020574 3300028794 Bacteria 11761
559 Ga0307515_10037126 3300028794 Bacteria 7848
560 Ga0307515_10056827 3300028794 Bacteria 5677
561 Ga0307515_10096844 3300028794 Bacteria 3613
562 Ga0307515_10182403 3300028794 Bacteria 2043
563 Ga0307515_10364524 3300028794 Bacteria 1084
564 Ga0268256_1011353 3300030500 Bacteria 2822
565 Ga0307511_10044832 3300030521 Bacteria 3666
566 Ga0307511_10168026 3300030521 Bacteria 1213
567 Ga0307512_10010124 3300030522 Bacteria 9019
568 Ga0307512_10072907 3300030522 Bacteria 2535
569 Ga0307512_10118509 3300030522 Bacteria 1711
570 Ga0316176_1214160 3300030732 Bacteria 1810
571 Ga0265332_10001568 3300031238 Bacteria 12527
572 Ga0265327_10003656 3300031251 Bacteria 14447
573 Ga0307513_10006822 3300031456 Bacteria 14880
574 Ga0307513_10011950 3300031456 Bacteria 10751
575 Ga0307513_10022166 3300031456 Bacteria 7473
576 Ga0307513_10026537 3300031456 Bacteria 6677
577 Ga0307513_10049682 3300031456 Bacteria 4541
578 Ga0307513_10053784 3300031456 Bacteria 4324
579 Ga0307513_10108752 3300031456 Bacteria 2772
580 Ga0307513_10116986 3300031456 Bacteria 2644
581 Ga0307513_10360566 3300031456 Bacteria 1199
582 Ga0307513_10388942 3300031456 Bacteria 1132
583 Ga0307513_10389383 3300031456 Bacteria 1131
584 Ga0307509_10000654 3300031507 Bacteria 58837
585 Ga0307509_10004345 3300031507 Bacteria 20558
586 Ga0307509_10004938 3300031507 Bacteria 18878
587 Ga0307509_10065073 3300031507 Bacteria 3831
588 Ga0307509_10077568 3300031507 Bacteria 3445
589 Ga0307509_10098125 3300031507 Bacteria 2976
590 Ga0307509_10119904 3300031507 Bacteria 2611
591 Ga0307408_100001218 3300031548 Bacteria 19365
592 Ga0307408_100060611 3300031548 Bacteria 2758
593 Ga0307408_100227105 3300031548 Bacteria 1526
594 Ga0307408_100258553 3300031548 Bacteria 1440
595 Ga0307408_100308081 3300031548 Bacteria 1329
596 Ga0307408_100479725 3300031548 Bacteria 1084
597 Ga0307508_10000204 3300031616 Bacteria 71518
598 Ga0307508_10000333 3300031616 Bacteria 57002
599 Ga0307508_10025899 3300031616 Bacteria 5318
600 Ga0307508_10175501 3300031616 Bacteria 1746
601 Ga0307508_10436645 3300031616 Bacteria 901
602 Ga0307514_10012268 3300031649 Bacteria 7132
603 Ga0307514_10027913 3300031649 Bacteria 4556
604 Ga0307514_10242734 3300031649 Bacteria 1077
605 Ga0307516_10000136 3300031730 Bacteria 87938
606 Ga0307516_10001738 3300031730 Bacteria 29930
607 Ga0307516_10006407 3300031730 Bacteria 13802
608 Ga0307516_10009389 3300031730 Bacteria 10913
609 Ga0307516_10016230 3300031730 Bacteria 7796
610 Ga0307516_10123686 3300031730 Bacteria 2374
611 Ga0307405_10023955 3300031731 Bacteria 3479
612 Ga0307405_10042528 3300031731 Bacteria 2766
613 Ga0307405_10101759 3300031731 Bacteria 1928
614 Ga0307406_10001377 3300031901 Bacteria 13548
615 Ga0307412_10000024 3300031911 Bacteria 235467
616 Ga0307412_10070878 3300031911 Bacteria 2377
617 Ga0307412_10091879 3300031911 Bacteria 2125
618 Ga0307416_100524000 3300032002 Bacteria 1254
619 Ga0307414_10085437 3300032004 Bacteria 2325
620 Ga0307414_10189735 3300032004 Bacteria 1662
621 Ga0307411_10051181 3300032005 Bacteria 2693
622 Ga0307411_10136556 3300032005 Bacteria 1801
623 Ga0307411_10823714 3300032005 Bacteria 819
624 Ga0307507_10064150 3300033179 Bacteria 3393
625 Ga0307507_10098070 3300033179 Bacteria 2469
626 Ga0307507_10314934 3300033179 Bacteria 947
627 Ga0307510_10001775 3300033180 Bacteria 24067
628 Ga0307510_10159955 3300033180 Bacteria 1851
629 Ga0307510_10168688 3300033180 Bacteria 1772
630 Ga0307510_10200140 3300033180 Bacteria 1533
631 Ga0307510_10216151 3300033180 Bacteria 1433
632 Ga0373932_0036826 3300035112 Bacteria 1391
633 Ga0373935_0038345 3300035692 Bacteria 3000
634 Ga0373947_0080970 3300035725 Bacteria 2010
635 Ga0373925_0076610 3300037068 Bacteria 2537
636 Ga0373925_0084469 3300037068 Bacteria 2419
637 Ga0373925_0387142 3300037068 Bacteria 1139
638 Ga0395899_0002715 3300037312 Bacteria 14263
639 Ga0395899_0003953 3300037312 Bacteria 11678
640 Ga0395900_0013023 3300037418 Bacteria 8498
641 Ga0395900_0061151 3300037418 Bacteria 3873
642 Ga0395900_0082740 3300037418 Bacteria 3298
643 Ga0395898_0210532 3300037466 Bacteria 1854
644 Ga0395898_0268045 3300037466 Bacteria 1628
645 Ga0395905_0078758 3300037471 Bacteria 3089
646 Ga0395905_0446154 3300037471 Bacteria 1191
647 Ga0395901_0037138 3300038443 Bacteria 5038
648 Ga0395901_0044783 3300038443 Bacteria 4589
649 Ga0436361_0044104 3300039447 Bacteria 25711
650 Ga0436361_0455580 3300039447 Bacteria 1664
651 Ga0436361_0694654 3300039447 Bacteria 4208
652 Ga0436361_0716290 3300039447 Bacteria 39995
653 Ga0436361_1111077 3300039447 Bacteria 19555
654 Ga0436363_1512662 3300039450 Bacteria 1589
655 Ga0439436_0000486 3300041404 Bacteria 10325
656 Ga0439436_0004722 3300041404 Bacteria 4179
657 Ga0439436_0007083 3300041404 Bacteria 3451
658 Ga0439436_0007676 3300041404 Bacteria 3319
659 Ga0439439_0009488 3300041406 Bacteria 2315
660 Ga0439466_0018576 3300041411 Bacteria 2493
661 Ga0439466_0026452 3300041411 Bacteria 2017
662 Ga0439466_0048484 3300041411 Bacteria 1397
663 Ga0439466_0066266 3300041411 Bacteria 1156
664 Ga0439465_0011301 3300041413 Bacteria 2802
665 Ga0439465_0018713 3300041413 Bacteria 2164
666 Ga0439465_0141694 3300041413 Bacteria 854
667 Ga0451793_0179075 3300041452 Bacteria 1456
668 Ga0451793_0300542 3300041452 Bacteria 3323
669 Ga0451795_0268819 3300041456 Bacteria 3345
670 Ga0451795_0556773 3300041456 Bacteria 1367
671 Ga0451798_0006020 3300041458 Bacteria 2171
672 Ga0451800_0725212 3300041459 Bacteria 1423
673 Ga0451802_0869575 3300041460 Bacteria 1824
674 Ga0451802_1174236 3300041460 Bacteria 1091
675 Ga0451804_0208994 3300041463 Bacteria 2207
676 Ga0451807_0874863 3300041486 Bacteria 1116
677 Ga0451807_1859406 3300041486 Bacteria 2255
678 Ga0451839_1210773 3300041496 Bacteria 1593
679 Ga0451853_3319420 3300041512 Bacteria 2257
680 Ga0439431_0001562 3300041997 Bacteria 5076
681 Ga0439431_0004108 3300041997 Bacteria 3203
682 Ga0439431_0046420 3300041997 Bacteria 1118
683 Ga0439433_0003311 3300041999 Bacteria 3453
684 Ga0439433_0012982 3300041999 Bacteria 1829
685 Ga0439437_008148 3300042000 Bacteria 1176
686 Ga0439442_006072 3300042002 Bacteria 2420
687 Ga0439445_0003396 3300042004 Bacteria 3571
688 Ga0439445_0009673 3300042004 Bacteria 2273
689 Ga0439445_0050310 3300042004 Bacteria 1124
690 Ga0439432_005828 3300042006 Bacteria 4422
691 Ga0439432_016992 3300042006 Bacteria 2444
692 Ga0439449_0000970 3300042007 Bacteria 11274
693 Ga0439449_0001676 3300042007 Bacteria 8714
694 Ga0439449_0002065 3300042007 Bacteria 7907
695 Ga0439449_0005212 3300042007 Bacteria 4987
696 Ga0439449_0006540 3300042007 Bacteria 4453
697 Ga0439449_0007725 3300042007 Bacteria 4084
698 Ga0439449_0020580 3300042007 Bacteria 2472
699 Ga0439452_001192 3300042010 Bacteria 11185
700 Ga0439457_022857 3300042014 Bacteria 1384
701 Ga0439462_0010395 3300042015 Bacteria 2356
702 Ga0439462_0014056 3300042015 Bacteria 2054
703 Ga0450911_000104 3300042115 Bacteria 34662
704 Ga0450921_001811 3300042123 Bacteria 1351
705 Ga0450923_005039 3300042125 Bacteria 2112
706 Ga0450888_020924 3300042126 Bacteria 833
707 Ga0450890_008032 3300042127 Bacteria 1350
708 Ga0450896_010426 3300042133 Bacteria 1304
709 Ga0450898_008877 3300042134 Bacteria 1598
710 Ga0450898_012684 3300042134 Bacteria 1396
711 Ga0450906_005442 3300042145 Bacteria 2618
712 Ga0439446_0013356 3300042156 Bacteria 2253
713 Ga0450908_002904 3300042184 Bacteria 3334
714 Ga0450909_023806 3300042185 Bacteria 919
715 Ga0439434_0006287 3300042435 Bacteria 3465
716 Ga0439434_0010043 3300042435 Bacteria 2787
717 Ga0439434_0015320 3300042435 Bacteria 2286
718 Ga0439434_0047894 3300042435 Bacteria 1321
719 Ga0439434_0062989 3300042435 Bacteria 1161
720 Ga0439464_0007442 3300042439 Bacteria 2864
721 Ga0450918_001241 3300042531 Bacteria 5182
722 Ga0450918_001794 3300042531 Bacteria 4181
723 Ga0466969_0003126 3300044656 Bacteria 8823
724 Ga0466969_0004989 3300044656 Bacteria 7069
725 Ga0466969_0007670 3300044656 Bacteria 5735
726 Ga0466969_0080316 3300044656 Bacteria 1558
727 Ga0466972_0000708 3300044658 Bacteria 15929
728 Ga0466972_0002810 3300044658 Bacteria 8629
729 Ga0466965_0000290 3300044683 Bacteria 16664
730 Ga0466965_0013432 3300044683 Bacteria 3864
731 Ga0466965_0025004 3300044683 Bacteria 2889
732 Ga0466965_0354874 3300044683 Bacteria 804
733 Ga0466966_0010599 3300044684 Bacteria 6127
734 Ga0466966_0025298 3300044684 Bacteria 3878
735 Ga0466966_0028973 3300044684 Bacteria 3604
736 Ga0466961_0025923 3300044693 Bacteria 3768
737 Ga0466961_0058919 3300044693 Bacteria 2442
738 Ga0466961_0076414 3300044693 Bacteria 2122
739 Ga0466961_0077753 3300044693 Bacteria 2101
740 Ga0466963_0148113 3300044694 Bacteria 1629
741 Ga0466964_0010149 3300044706 Bacteria 3550
742 Ga0466971_0009952 3300044719 Bacteria 4153
743 Ga0466968_0008282 3300044735 Bacteria 3977
744 Ga0466970_0008244 3300044765 Bacteria 5235
745 Ga0466970_0020888 3300044765 Bacteria 3407
746 Ga0466957_0001020 3300044842 Bacteria 14442
747 Ga0466957_0147842 3300044842 Bacteria 1518
748 Ga0466957_0169246 3300044842 Bacteria 1423
749 Ga0466960_0004844 3300044901 Bacteria 5291
750 Ga0466960_0007734 3300044901 Bacteria 4377
751 Ga0466959_0002228 3300045049 Bacteria 12350
752 Ga0466959_0006848 3300045049 Bacteria 7944
753 Ga0466959_0087184 3300045049 Bacteria 2245
754 Ga0466958_0015767 3300045836 Bacteria 4339
755 Ga0466967_0000802 3300045976 Bacteria 16428
756 Ga0466967_0051642 3300045976 Bacteria 3604
757 Ga0495617_000044 3300046452 Bacteria 119709
758 Ga0495617_030769 3300046452 Bacteria 1804
759 Ga0495627_000062 3300046453 Bacteria 138772
760 Ga0495627_000380 3300046453 Bacteria 40821
761 Ga0495627_004816 3300046453 Bacteria 5572
762 Ga0495627_017729 3300046453 Bacteria 2413
763 Ga0495592_0000131 3300046454 Bacteria 66382
764 Ga0495592_0000967 3300046454 Bacteria 19913
765 Ga0495592_0259680 3300046454 Bacteria 1145
766 Ga0495590_0023666 3300046457 Bacteria 2167
767 Ga0495590_0036138 3300046457 Bacteria 1723
768 Ga0495591_000023 3300046458 Bacteria 191598
769 Ga0495591_011049 3300046458 Bacteria 3444
770 Ga0495629_0072486 3300046459 Bacteria 2404
771 Ga0495629_0074081 3300046459 Bacteria 2377
772 Ga0495638_0016815 3300046460 Bacteria 4891
773 Ga0495638_0092437 3300046460 Bacteria 1821
774 Ga0495638_0099373 3300046460 Bacteria 1742
775 Ga0495651_0186321 3300046462 Bacteria 1464
776 Ga0495653_0000761 3300046463 Bacteria 24711
777 Ga0495653_0002408 3300046463 Bacteria 14891
778 Ga0495653_0073660 3300046463 Bacteria 2547
779 Ga0495650_0004823 3300046471 Bacteria 9034
780 Ga0495650_0008643 3300046471 Bacteria 5903
781 Ga0495650_0018553 3300046471 Bacteria 3452
782 Ga0495650_0030600 3300046471 Bacteria 2435
783 Ga0495580_0000252 3300046472 Bacteria 42451
784 Ga0495580_0000279 3300046472 Bacteria 41404
785 Ga0495580_0001423 3300046472 Bacteria 21034
786 Ga0495580_0005484 3300046472 Bacteria 10485
787 Ga0495580_0009254 3300046472 Bacteria 7757
788 Ga0495582_0027193 3300046473 Bacteria 3134
789 Ga0495605_0001112 3300046474 Bacteria 17910
790 Ga0495605_0040748 3300046474 Bacteria 2317
791 Ga0495639_0001601 3300046475 Bacteria 10073
792 Ga0495639_0009042 3300046475 Bacteria 4272
793 Ga0495664_0006494 3300046477 Bacteria 6463
794 Ga0495664_0085697 3300046477 Bacteria 1891
795 Ga0495594_0067088 3300046499 Bacteria 1991
796 Ga0495596_0011373 3300046500 Bacteria 3843
797 Ga0495607_0001124 3300046501 Bacteria 24272
798 Ga0495607_0001321 3300046501 Bacteria 22100
799 Ga0495607_0001514 3300046501 Bacteria 20453
800 Ga0495583_0000306 3300046506 Bacteria 77699
801 Ga0495606_0000644 3300046507 Bacteria 54819
802 Ga0495606_0001437 3300046507 Bacteria 31965
803 Ga0495606_0089093 3300046507 Bacteria 1901
804 Ga0495606_0156666 3300046507 Bacteria 1332
805 Ga0495610_0002534 3300046512 Bacteria 15238
806 Ga0495610_0013222 3300046512 Bacteria 4915
807 Ga0495610_0036516 3300046512 Bacteria 2510
808 Ga0495610_0059906 3300046512 Bacteria 1815
809 Ga0495616_0002465 3300046513 Bacteria 12267
810 Ga0495616_0054140 3300046513 Bacteria 1991
811 Ga0495618_0008335 3300046514 Bacteria 6277
812 Ga0495620_0011399 3300046515 Bacteria 4636
813 Ga0495620_0086174 3300046515 Bacteria 1265
814 Ga0495620_0102600 3300046515 Bacteria 1139
815 Ga0495620_0129101 3300046515 Bacteria 993
816 Ga0495628_0003496 3300046516 Bacteria 14061
817 Ga0495628_0003725 3300046516 Bacteria 13566
818 Ga0495628_0016052 3300046516 Bacteria 6249
819 Ga0495628_0267383 3300046516 Bacteria 1273
820 Ga0495628_0422647 3300046516 Bacteria 971
821 Ga0495630_0011618 3300046517 Bacteria 6379
822 Ga0495630_0021337 3300046517 Bacteria 4782
823 Ga0495630_0081240 3300046517 Bacteria 2446
824 Ga0495630_0155931 3300046517 Bacteria 1738
825 Ga0495631_0000773 3300046518 Bacteria 20563
826 Ga0495631_0000883 3300046518 Bacteria 18773
827 Ga0495631_0131823 3300046518 Bacteria 1074
828 Ga0495632_0003689 3300046519 Bacteria 10743
829 Ga0495632_0028604 3300046519 Bacteria 2908
830 Ga0495632_0085614 3300046519 Bacteria 1499
831 Ga0495632_0135921 3300046519 Bacteria 1142
832 Ga0495637_0004267 3300046520 Bacteria 7424
833 Ga0495637_0004928 3300046520 Bacteria 6876
834 Ga0495637_0014892 3300046520 Bacteria 3662
835 Ga0495643_0127991 3300046522 Bacteria 1277
836 Ga0495643_0209742 3300046522 Bacteria 930
837 Ga0495648_0001162 3300046524 Bacteria 26627
838 Ga0495648_0006300 3300046524 Bacteria 9704
839 Ga0495648_0189720 3300046524 Bacteria 1038
840 Ga0495666_0000626 3300046526 Bacteria 15922
841 Ga0495642_0150825 3300046528 Bacteria 1005
842 Ga0495652_0012733 3300046529 Bacteria 7577
843 Ga0495652_0017183 3300046529 Bacteria 6458
844 Ga0495652_0312054 3300046529 Bacteria 1139
845 Ga0495654_0000192 3300046530 Bacteria 59720
846 Ga0495654_0000313 3300046530 Bacteria 42607
847 Ga0495654_0007188 3300046530 Bacteria 6250
848 Ga0495654_0009986 3300046530 Bacteria 5184
849 Ga0495654_0034731 3300046530 Bacteria 2543
850 Ga0495665_0003521 3300046531 Bacteria 8501
851 Ga0495665_0137363 3300046531 Bacteria 1278
852 Ga0495640_0014104 3300046533 Bacteria 6058
853 Ga0495587_0001168 3300046536 Bacteria 17295
854 Ga0495587_0140819 3300046536 Bacteria 1377
855 Ga0495609_0000014 3300046538 Bacteria 326023
856 Ga0495609_0036123 3300046538 Bacteria 2233
857 Ga0495609_0057422 3300046538 Bacteria 1723
858 Ga0495621_0004801 3300046539 Bacteria 3834
859 Ga0495597_0001107 3300046542 Bacteria 20418
860 Ga0495597_0068127 3300046542 Bacteria 1538
861 Ga0495645_0014660 3300046543 Bacteria 5565
862 Ga0495645_0015453 3300046543 Bacteria 5428
863 Ga0495645_0022656 3300046543 Bacteria 4544
864 Ga0495645_0325545 3300046543 Bacteria 997
865 Ga0495622_0211359 3300046557 Bacteria 862
866 Ga0495633_0000625 3300046558 Bacteria 33168
867 Ga0495656_0002510 3300046615 Bacteria 6103
868 Ga0495668_0011278 3300046616 Bacteria 5362
869 Ga0495634_0017659 3300046642 Bacteria 5088
870 Ga0495634_0086531 3300046642 Bacteria 2041
871 Ga0495625_0000146 3300046660 Bacteria 108123
872 Ga0495625_0000661 3300046660 Bacteria 49248
873 Ga0495625_0001586 3300046660 Bacteria 26961
874 Ga0495625_0009203 3300046660 Bacteria 8297
875 Ga0495625_0097378 3300046660 Bacteria 2025
876 Ga0495625_0153394 3300046660 Bacteria 1547
877 Ga0495625_0171897 3300046660 Bacteria 1446
878 Ga0495625_0273150 3300046660 Bacteria 1090
879 Ga0495635_0217440 3300046663 Bacteria 1293
880 Ga0495661_0000009 3300046665 Bacteria 291327
881 Ga0495661_0062290 3300046665 Bacteria 2210
882 Ga0495661_0265287 3300046665 Bacteria 871
883 Ga0495588_0011830 3300046674 Bacteria 4107
884 Ga0495588_0016167 3300046674 Bacteria 3603
885 Ga0495588_0024531 3300046674 Bacteria 2996
886 Ga0495657_0177716 3300046675 Bacteria 1308
887 Ga0495599_0004856 3300046678 Bacteria 7996
888 Ga0495623_0006265 3300046679 Bacteria 7733
889 Ga0495623_0012599 3300046679 Bacteria 5473
890 Ga0495646_0000413 3300046680 Bacteria 22567
891 Ga0495646_0011065 3300046680 Bacteria 5729
892 Ga0495646_0020409 3300046680 Bacteria 4192
893 Ga0495646_0095715 3300046680 Bacteria 1708
894 Ga0495658_0141246 3300046683 Bacteria 1473
895 Ga0495613_0111115 3300046689 Bacteria 1974
896 Ga0495624_0005226 3300046690 Bacteria 9381
897 Ga0495624_0059569 3300046690 Bacteria 2395
898 Ga0495670_0174833 3300046691 Bacteria 1132
899 Ga0495671_0001267 3300046692 Bacteria 17228
900 Ga0495671_0042585 3300046692 Bacteria 2281
901 Ga0495671_0105007 3300046692 Bacteria 1380
902 Ga0495671_0112566 3300046692 Bacteria 1329
903 Ga0495649_0000167 3300046694 Bacteria 57151
904 Ga0495649_0001466 3300046694 Bacteria 17735
905 Ga0495649_0011109 3300046694 Bacteria 5300
906 Ga0495649_0020431 3300046694 Bacteria 3715
907 Ga0495649_0248669 3300046694 Bacteria 914
908 Ga0495660_0000992 3300046810 Bacteria 20689
909 Ga0495660_0001495 3300046810 Bacteria 15816
910 Ga0495660_0004737 3300046810 Bacteria 8214
911 Ga0495581_0003594 3300047315 Bacteria 8917
912 Ga0495581_0273821 3300047315 Bacteria 987
913 Ga0495604_0002262 3300047317 Bacteria 15421
914 Ga0495604_0031408 3300047317 Bacteria 4211
915 Ga0495604_0186335 3300047317 Bacteria 1449
916 Ga0495636_0148694 3300047318 Bacteria 1050
917 Ga0495674_0005201 3300047319 Bacteria 12497
918 Ga0495674_0005454 3300047319 Bacteria 12219
919 Ga0495674_0013440 3300047319 Bacteria 7697
920 Ga0495674_0021724 3300047319 Bacteria 5932
921 Ga0495674_0087164 3300047319 Bacteria 2672
922 Ga0495672_0005003 3300047320 Bacteria 10608
923 Ga0495672_0008368 3300047320 Bacteria 7649
924 Ga0495672_0022359 3300047320 Bacteria 4112
925 Ga0495672_0022684 3300047320 Bacteria 4076
926 Ga0495672_0029944 3300047320 Bacteria 3422
927 Ga0495676_0002666 3300047321 Bacteria 15977
928 Ga0495676_0006001 3300047321 Bacteria 11160
929 Ga0495676_0059007 3300047321 Bacteria 3016
930 Ga0495676_0066877 3300047321 Bacteria 2782
931 Ga0495680_0002100 3300047322 Bacteria 20691
932 Ga0495680_0021405 3300047322 Bacteria 5414
933 Ga0495683_0000004 3300047323 Bacteria 321136
934 Ga0495683_0024946 3300047323 Bacteria 3066
935 Ga0495683_0038427 3300047323 Bacteria 2424
936 Ga0495687_000451 3300047443 Bacteria 50656
937 Ga0495687_048175 3300047443 Bacteria 1829
938 Ga0495687_048178 3300047443 Bacteria 1829
939 Ga0495675_0005240 3300047444 Bacteria 7893
940 Ga0495675_0103796 3300047444 Bacteria 1777
941 Ga0495675_0278561 3300047444 Bacteria 998
942 Ga0495679_000472 3300047446 Bacteria 29136
943 Ga0495673_0002876 3300047469 Bacteria 11710
944 Ga0495681_0006549 3300047470 Bacteria 7631
945 Ga0495684_0037247 3300047471 Bacteria 3730
946 Ga0495686_0005491 3300047472 Bacteria 9980
947 Ga0495686_0012210 3300047472 Bacteria 6018
948 Ga0495593_0001905 3300047673 Bacteria 12435
949 Ga0495593_0019945 3300047673 Bacteria 3755
950 Ga0495593_0038193 3300047673 Bacteria 2593
951 Ga0495602_0006074 3300048088 Bacteria 12665
952 Ga0495602_0033131 3300048088 Bacteria 4852
953 Ga0495602_0066872 3300048088 Bacteria 3094
954 Ga0495602_0163284 3300048088 Bacteria 1737
955 Ga0495602_0226379 3300048088 Bacteria 1408
956 Ga0495614_0005110 3300048089 Bacteria 5919
957 Ga0495626_0124677 3300048091 Bacteria 1104
958 Ga0496100_0002213 3300048903 Bacteria 9823
959 Ga0496101_0001976 3300048904 Bacteria 12432
960 Ga0496101_0424783 3300048904 Bacteria 1048
961 Ga0496102_0011642 3300048905 Bacteria 7592
962 Ga0496102_0015674 3300048905 Bacteria 6603
963 Ga0496102_0241533 3300048905 Bacteria 1703
964 Ga0496103_0157530 3300048906 Bacteria 1456
965 Ga0496104_0015072 3300048907 Bacteria 6996
966 Ga0496104_0446086 3300048907 Bacteria 1206
967 Ga0496104_0588534 3300048907 Bacteria 1023
968 Ga0496105_0000980 3300048908 Bacteria 19637
969 Ga0496106_0003842 3300048909 Bacteria 11195
970 Ga0496106_0212778 3300048909 Bacteria 1540
971 Ga0496109_0629337 3300048912 Bacteria 1010
972 Ga0496110_0234732 3300048913 Bacteria 1668
973 Ga0496111_0014555 3300048914 Bacteria 5378
974 Ga0496111_0056450 3300048914 Bacteria 2841
975 Ga0496116_0010201 3300048919 Bacteria 7902
976 Ga0496116_0011992 3300048919 Bacteria 7116
977 Ga0496116_0024989 3300048919 Bacteria 4402
978 Ga0496116_0070269 3300048919 Bacteria 2222
979 Ga0496116_0103806 3300048919 Bacteria 1690
980 Ga0496117_0000032 3300048920 Bacteria 375533
981 Ga0496117_0000428 3300048920 Bacteria 70517
982 Ga0496117_0016574 3300048920 Bacteria 6209
983 Ga0496117_0019294 3300048920 Bacteria 5607
984 Ga0496117_0022148 3300048920 Bacteria 5103
985 Ga0496117_0109369 3300048920 Bacteria 1726
986 Ga0496117_0225350 3300048920 Bacteria 1040
987 Ga0496118_0000027 3300048921 Bacteria 375533
988 Ga0496118_0001373 3300048921 Bacteria 36687
989 Ga0496118_0016483 3300048921 Bacteria 6776
990 Ga0496118_0056110 3300048921 Bacteria 2964
991 Ga0496118_0062498 3300048921 Bacteria 2748
992 Ga0496118_0068269 3300048921 Bacteria 2583
993 Ga0496119_0000011 3300048922 Bacteria 438315
994 Ga0496119_0066278 3300048922 Bacteria 2134
995 Ga0496119_0073429 3300048922 Bacteria 1995
996 Ga0496120_0001187 3300048923 Bacteria 33127
997 Ga0496121_0000233 3300048924 Bacteria 119434
998 Ga0496121_0002222 3300048924 Bacteria 30310
999 Ga0496121_0009084 3300048924 Bacteria 11506
1000 Ga0496121_0010777 3300048924 Bacteria 10247
1001 Ga0496121_0031856 3300048924 Bacteria 4808
1002 Ga0496121_0037742 3300048924 Bacteria 4286
1003 Ga0496121_0068712 3300048924 Bacteria 2864
1004 Ga0496121_0100594 3300048924 Bacteria 2231
1005 Ga0496121_0181769 3300048924 Bacteria 1517
1006 Ga0496121_0195470 3300048924 Bacteria 1446
1007 Ga0496122_0003391 3300048925 Bacteria 20976
1008 Ga0496122_0011489 3300048925 Bacteria 8957
1009 Ga0496122_0016952 3300048925 Bacteria 6844
1010 Ga0496122_0025766 3300048925 Bacteria 5094
1011 Ga0496122_0060756 3300048925 Bacteria 2780
1012 Ga0496122_0102469 3300048925 Bacteria 1908
1013 Ga0496122_0146023 3300048925 Bacteria 1470
1014 Ga0496123_0007507 3300048926 Bacteria 10239
1015 Ga0496123_0013499 3300048926 Bacteria 6847
1016 Ga0496123_0024574 3300048926 Bacteria 4575
1017 Ga0496123_0029756 3300048926 Bacteria 4011
1018 Ga0496123_0035073 3300048926 Bacteria 3581
1019 Ga0496123_0094591 3300048926 Bacteria 1760
1020 Ga0496124_0000024 3300048927 Bacteria 414291
1021 Ga0496124_0000085 3300048927 Bacteria 203358
1022 Ga0496124_0005442 3300048927 Bacteria 14316
1023 Ga0496124_0069827 3300048927 Bacteria 2915
1024 Ga0496124_0084981 3300048927 Bacteria 2594
1025 Ga0496124_0147287 3300048927 Bacteria 1851
1026 Ga0496124_0254812 3300048927 Bacteria 1295
1027 Ga0496124_0351883 3300048927 Bacteria 1042
1028 Ga0496125_0000096 3300048928 Bacteria 205618
1029 Ga0496125_0000101 3300048928 Bacteria 202248
1030 Ga0496125_0008704 3300048928 Bacteria 10562
1031 Ga0496125_0057514 3300048928 Bacteria 3149
1032 Ga0496125_0082680 3300048928 Bacteria 2446
1033 Ga0496125_0221307 3300048928 Bacteria 1219
1034 Ga0496126_0001857 3300048929 Bacteria 30790
1035 Ga0496126_0069745 3300048929 Bacteria 3134
1036 Ga0496126_0093716 3300048929 Bacteria 2636
1037 Ga0496126_0493835 3300048929 Bacteria 979
1038 Ga0496126_0499397 3300048929 Bacteria 972
1039 Ga0496126_0643539 3300048929 Bacteria 830
1040 Ga0495678_000014 3300049459 Bacteria 313755
1041 Ga0495678_027017 3300049459 Bacteria 2440
1042 Ga0495682_0003529 3300049460 Bacteria 6930
1043 Ga0495682_0010500 3300049460 Bacteria 3585
1044 Ga0501046_0114541 3300049580 Bacteria 2057
1045 Ga0501047_0030621 3300049581 Bacteria 5187
1046 Ga0501047_0059974 3300049581 Bacteria 3673
1047 Ga0501070_0750569 3300049586 Bacteria 769
1048 Ga0501249_012357 3300049679 Bacteria 1803
1049 Ga0501225_0019511 3300049705 Bacteria 1876
1050 Ga0501262_000152 3300049759 Bacteria 8580
1051 nmdc:mga03683_105921_c1 3300050489 Bacteria 1239
1052 nmdc:mga03683_11036_c1 3300050489 Bacteria 3256
1053 nmdc:mga03683_18307_c1 3300050489 Bacteria 2662
1054 nmdc:mga03683_2013_c1 3300050489 Bacteria 6220
1055 nmdc:mga03683_21009_c1 3300050489 Bacteria 2511
1056 nmdc:mga03683_73173_c1 3300050489 Bacteria 1469
1057 nmdc:mga03n38_23409_c1 3300050490 Bacteria 2512
1058 nmdc:mga03n38_3064_c1 3300050490 Bacteria 5299
1059 nmdc:mga03n38_63247_c1 3300050490 Bacteria 1691
1060 nmdc:mga00v17_203009_c1 3300050491 Bacteria 1282
1061 nmdc:mga00v17_45731_c1 3300050491 Bacteria 2645
1062 nmdc:mga00v17_53860_c1 3300050491 Bacteria 2453
1063 nmdc:mga00v17_54408_c1 3300050491 Bacteria 2441
1064 nmdc:mga00v17_7678_c1 3300050491 Bacteria 5770
1065 nmdc:mga00v17_8760_c1 3300050491 Bacteria 5450
1066 nmdc:mga0yw44_36724_c1 3300050492 Bacteria 2889
1067 nmdc:mga0yw44_3952_c1 3300050492 Bacteria 6686
1068 nmdc:mga0k408_102039_c1 3300050493 Bacteria 1692
1069 nmdc:mga0k408_10609_c1 3300050493 Bacteria 4988
1070 nmdc:mga0k408_10736_c1 3300050493 Bacteria 4962
1071 nmdc:mga0k408_123429_c1 3300050493 Bacteria 1535
1072 nmdc:mga0k408_128812_c1 3300050493 Bacteria 1502
1073 nmdc:mga0k408_1452_c1 3300050493 Bacteria 12811
1074 nmdc:mga0k408_152409_c1 3300050493 Bacteria 1377
1075 nmdc:mga0k408_1592_c1 3300050493 Bacteria 12280
1076 nmdc:mga0k408_174746_c1 3300050493 Bacteria 1281
1077 nmdc:mga0k408_20723_c1 3300050493 Bacteria 3688
1078 nmdc:mga0k408_38_c1 3300050493 Bacteria 69925
1079 nmdc:mga0k408_47816_c1 3300050493 Bacteria 2473
1080 nmdc:mga0k408_4859_c1 3300050493 Bacteria 7130
1081 nmdc:mga0k408_4937_c1 3300050493 Bacteria 7065
1082 nmdc:mga0k408_5814_c1 3300050493 Bacteria 6569
1083 nmdc:mga0k408_5920_c1 3300050493 Bacteria 6523
1084 nmdc:mga0k408_8640_c1 3300050493 Bacteria 5475
1085 nmdc:mga06z11_35089_c1 3300050494 Bacteria 2466
1086 nmdc:mga07m45_10646_c1 3300050496 Bacteria 4810
1087 nmdc:mga07m45_12677_c1 3300050496 Bacteria 4458
1088 nmdc:mga07m45_31684_c1 3300050496 Bacteria 2931
1089 nmdc:mga07m45_33368_c1 3300050496 Bacteria 2859
1090 nmdc:mga07m45_6733_c1 3300050496 Bacteria 5830
1091 nmdc:mga07m45_89296_c1 3300050496 Bacteria 1765
1092 nmdc:mga07m45_9001_c1 3300050496 Bacteria 5158
1093 nmdc:mga0sz30_37259_c1 3300050516 Bacteria 2035
1094 nmdc:mga0sz30_43645_c1 3300050516 Bacteria 1887
1095 nmdc:mga0sz30_91293_c1 3300050516 Bacteria 1325
1096 Ga0500610_0023764 3300053079 Bacteria 3038
1097 Ga0500610_0025324 3300053079 Bacteria 2957
1098 Ga0500610_0026635 3300053079 Bacteria 2895
1099 Ga0500610_0119794 3300053079 Bacteria 1346
1100 Ga0500610_0163268 3300053079 Bacteria 1106
1101 Ga0500635_0000030 3300053080 Bacteria 99936
1102 Ga0500635_0040027 3300053080 Bacteria 1562
1103 Ga0500578_0000393 3300053086 Bacteria 53719
1104 Ga0500578_0209435 3300053086 Bacteria 1190
1105 Ga0500643_000694 3300053087 Bacteria 22492
1106 Ga0500643_012300 3300053087 Bacteria 3069
1107 Ga0500644_0006782 3300053088 Bacteria 2951
1108 Ga0500583_0117002 3300053092 Bacteria 1316
1109 Ga0500651_0000468 3300053093 Bacteria 21321
1110 Ga0500651_0038676 3300053093 Bacteria 3005
1111 Ga0500651_0072617 3300053093 Bacteria 2139
1112 Ga0500566_0106792 3300053094 Bacteria 1527
1113 Ga0500641_0059945 3300053096 Bacteria 1583
1114 Ga0500650_0018663 3300053098 Bacteria 3013
1115 Ga0500562_004783 3300053108 Bacteria 3411
1116 Ga0500569_059105 3300053109 Bacteria 1179
1117 Ga0500571_000217 3300053110 Bacteria 21202
1118 Ga0500593_000365 3300053117 Bacteria 18184
1119 Ga0500593_000448 3300053117 Bacteria 16302
1120 Ga0500593_106802 3300053117 Bacteria 1158
1121 Ga0500594_0000278 3300053118 Bacteria 11929
1122 Ga0500594_0004732 3300053118 Bacteria 3003
1123 Ga0500607_000889 3300053121 Bacteria 28747
1124 Ga0500607_056728 3300053121 Bacteria 2066
1125 Ga0500607_159665 3300053121 Bacteria 1032
1126 Ga0500608_004592 3300053122 Bacteria 5374
1127 Ga0500608_060948 3300053122 Bacteria 1804
1128 Ga0500618_001137 3300053125 Bacteria 12903
1129 Ga0500618_002201 3300053125 Bacteria 7637
1130 Ga0500618_005766 3300053125 Bacteria 3724
1131 Ga0500618_058862 3300053125 Bacteria 865
1132 Ga0500626_004723 3300053128 Bacteria 5222
1133 Ga0500642_0037532 3300053130 Bacteria 2071
1134 Ga0500652_000629 3300053131 Bacteria 12098
1135 Ga0500652_192202 3300053131 Bacteria 832
1136 Ga0500655_000301 3300053133 Bacteria 11205
1137 Ga0500655_000418 3300053133 Bacteria 8938
1138 Ga0500658_0000470 3300053134 Bacteria 17245
1139 Ga0500658_0004473 3300053134 Bacteria 5217
1140 Ga0500658_0053858 3300053134 Bacteria 1651
1141 Ga0500559_0000249 3300053136 Bacteria 42713
1142 Ga0500559_0027912 3300053136 Bacteria 2410
1143 Ga0500561_0026293 3300053137 Bacteria 1425
1144 Ga0500564_044553 3300053138 Bacteria 2037
1145 Ga0500564_146821 3300053138 Bacteria 1008
1146 Ga0500573_0005967 3300053140 Bacteria 6557
1147 Ga0500573_0011632 3300053140 Bacteria 4930
1148 Ga0500574_000052 3300053141 Bacteria 13757
1149 Ga0500577_0227899 3300053142 Bacteria 807
1150 Ga0500586_012418 3300053145 Bacteria 2478
1151 Ga0500589_100166 3300053147 Bacteria 1260
1152 Ga0500616_0016583 3300053153 Bacteria 4190
1153 Ga0500616_0049392 3300053153 Bacteria 2226
1154 Ga0500619_000018 3300053154 Bacteria 52926
1155 Ga0500622_0000232 3300053156 Bacteria 57941
1156 Ga0500622_0005316 3300053156 Bacteria 7763
1157 Ga0500622_0014640 3300053156 Bacteria 4206
1158 Ga0500627_0002314 3300053158 Bacteria 5613
1159 Ga0500634_0007218 3300053161 Bacteria 5456
1160 Ga0500638_007998 3300053162 Bacteria 4474
1161 Ga0500636_0003095 3300053177 Bacteria 9325
1162 Ga0500636_0005975 3300053177 Bacteria 6975
1163 Ga0500636_0011020 3300053177 Bacteria 5288
1164 Ga0500636_0128468 3300053177 Bacteria 1414
1165 Ga0500645_016986 3300053730 Bacteria 2286
1166 Ga0500596_007476 3300053735 Bacteria 1790
1167 Ga0466962_0019388 3300061719 Bacteria 3268
1168 Ga0466962_0067365 3300061719 Bacteria 1709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10039721 Ga0075366_100397213 197
2 3300050493 nmdc:mga0k408_4937_c1 nmdc:mga0k408_4937_c1_5018_5710 197
3 3300044656 Ga0466969_0003126 Ga0466969_0003126_3094_3804 199
4 3300044684 Ga0466966_0010599 Ga0466966_0010599_2727_3437 199
5 3300044693 Ga0466961_0076414 Ga0466961_0076414_850_1560 199
6 3300045049 Ga0466959_0006848 Ga0466959_0006848_6395_7105 199
7 3300044683 Ga0466965_0025004 Ga0466965_0025004_990_1664 201
8 3300044901 Ga0466960_0004844 Ga0466960_0004844_2604_3278 201
9 3300017792 Ga0163161_10433207 Ga0163161_104332072 205
10 3300046515 Ga0495620_0129101 Ga0495620_0129101_132_806 205
11 3300046694 Ga0495649_0248669 Ga0495649_0248669_171_845 205
12 3300025304 Ga0209257_1018547 Ga0209257_10185472 208
13 3300003773 Ga0055537_1008855 Ga0055537_10088552 209
14 3300028786 Ga0307517_10001174 Ga0307517_1000117424 209
15 3300005289 Ga0065704_10155909 Ga0065704_101559092 210
16 3300028786 Ga0307517_10056423 Ga0307517_100564234 210
17 3300053154 Ga0500619_000018 Ga0500619_000018_19497_20183 210
18 3300003323 rootH1_10401376 rootH1_104013762 211
19 3300006051 Ga0075364_10165480 Ga0075364_101654802 211
20 3300009553 Ga0105249_10596983 Ga0105249_105969832 211
21 3300009553 Ga0105249_10815586 Ga0105249_108155862 211
22 3300017792 Ga0163161_10157636 Ga0163161_101576362 211
23 3300025961 Ga0207712_10326174 Ga0207712_103261742 211
24 3300028794 Ga0307515_10364524 Ga0307515_103645242 212
25 3300046665 Ga0495661_0265287 Ga0495661_0265287_23_733 212
26 3300053131 Ga0500652_192202 Ga0500652_192202_101_811 212
27 3300053137 Ga0500561_0026293 Ga0500561_0026293_405_1115 212
28 3300053142 Ga0500577_0227899 Ga0500577_0227899_26_736 212
29 3300053156 Ga0500622_0005316 Ga0500622_0005316_6533_7243 212
30 3300053177 Ga0500636_0011020 Ga0500636_0011020_3766_4476 212
31 3300046474 Ga0495605_0040748 Ga0495605_0040748_38_694 213
32 3300046557 Ga0495622_0211359 Ga0495622_0211359_19_723 213
33 3300046692 Ga0495671_0105007 Ga0495671_0105007_113_817 213
34 3300048925 Ga0496122_0146023 Ga0496122_0146023_523_1218 213
35 3300003751 Ga0055538_1000051 Ga0055538_100005115 214
36 3300003752 Ga0055539_1000076 Ga0055539_100007615 214
37 3300003756 Ga0055533_1000082 Ga0055533_100008215 214
38 3300003759 Ga0055525_1000109 Ga0055525_100010915 214
39 3300003791 Ga0055530_10037452 Ga0055530_100374521 214
40 3300003841 Ga0055541_1000053 Ga0055541_100005315 214
41 3300025224 Ga0209784_100083 Ga0209784_10008316 214
42 3300025225 Ga0209566_100102 Ga0209566_10010216 214
43 3300025226 Ga0209674_100125 Ga0209674_10012516 214
44 3300025230 Ga0209563_100120 Ga0209563_10012016 214
45 3300025253 Ga0209677_100076 Ga0209677_10007616 214
46 3300031456 Ga0307513_10360566 Ga0307513_103605662 214
47 3300033180 Ga0307510_10159955 Ga0307510_101599553 214
48 3300046515 Ga0495620_0086174 Ga0495620_0086174_266_970 214
49 3300046542 Ga0495597_0068127 Ga0495597_0068127_609_1316 214
50 3300046694 Ga0495649_0020431 Ga0495649_0020431_544_1248 214
51 3300047323 Ga0495683_0024946 Ga0495683_0024946_1273_1977 214
52 3300047443 Ga0495687_000451 Ga0495687_000451_7333_8040 214
53 3300048927 Ga0496124_0000024 Ga0496124_0000024_270452_271159 214
54 3300048929 Ga0496126_0643539 Ga0496126_0643539_17_721 214
55 3300049460 Ga0495682_0010500 Ga0495682_0010500_1552_2256 214
56 3300050491 nmdc:mga00v17_45731_c1 nmdc:mga00v17_45731_c1_277_984 214
57 3300050493 nmdc:mga0k408_10736_c1 nmdc:mga0k408_10736_c1_453_1163 214
58 3300025292 Ga0209676_1006693 Ga0209676_10066934 215
59 3300025298 Ga0209050_1004472 Ga0209050_10044729 215
60 3300046538 Ga0495609_0000014 Ga0495609_0000014_138202_138948 215
61 3300053117 Ga0500593_000448 Ga0500593_000448_7800_8468 215
62 3300025919 Ga0207657_10431067 Ga0207657_104310672 216
63 3300048091 Ga0495626_0124677 Ga0495626_0124677_77_790 216
64 3300003187 JGI25151J46595_10001460 JGI25151J46595_100014607 217
65 3300025294 Ga0209025_1000057 Ga0209025_1000057200 217
66 3300046810 Ga0495660_0000992 Ga0495660_0000992_11818_12564 217
67 3300053145 Ga0500586_012418 Ga0500586_012418_108_797 217
68 3300046519 Ga0495632_0085614 Ga0495632_0085614_320_1039 218
69 3300048905 Ga0496102_0011642 Ga0496102_0011642_871_1581 218
70 3300053134 Ga0500658_0053858 Ga0500658_0053858_288_1007 218
71 3300003320 rootH2_10050129 rootH2_100501291 219
72 3300009545 Ga0105237_10085232 Ga0105237_100852322 219
73 3300046530 Ga0495654_0009986 Ga0495654_0009986_455_1216 219
74 3300046616 Ga0495668_0011278 Ga0495668_0011278_2574_3320 219
75 3300013250 Ga0171462_1043 Ga0171462_104349 220
76 3300042004 Ga0439445_0050310 Ga0439445_0050310_179_937 220
77 3300046660 Ga0495625_0097378 Ga0495625_0097378_822_1568 220
78 3300048920 Ga0496117_0000428 Ga0496117_0000428_17570_18304 220
79 3300048921 Ga0496118_0001373 Ga0496118_0001373_9940_10674 220
80 3300049586 Ga0501070_0750569 Ga0501070_0750569_36_749 220
81 3300044658 Ga0466972_0002810 Ga0466972_0002810_701_1366 221
82 3300046453 Ga0495627_000380 Ga0495627_000380_28319_29065 221
83 3300046474 Ga0495605_0001112 Ga0495605_0001112_9725_10471 221
84 3300053080 Ga0500635_0000030 Ga0500635_0000030_46188_46925 221
85 3300053140 Ga0500573_0005967 Ga0500573_0005967_3355_4101 221
86 iso_pu_bacteria 2585428058 2587733651 221
87 3300003322 rootL2_10034467 rootL2_100344673 222
88 3300006195 Ga0075366_10006394 Ga0075366_100063945 222
89 3300006353 Ga0075370_10071807 Ga0075370_100718073 222
90 3300046457 Ga0495590_0023666 Ga0495590_0023666_847_1566 222
91 3300046460 Ga0495638_0092437 Ga0495638_0092437_74_808 222
92 3300046513 Ga0495616_0054140 Ga0495616_0054140_1030_1749 222
93 3300046694 Ga0495649_0011109 Ga0495649_0011109_897_1616 222
94 3300050493 nmdc:mga0k408_1452_c1 nmdc:mga0k408_1452_c1_7900_8607 222
95 3300053136 Ga0500559_0000249 Ga0500559_0000249_6801_7535 222
96 3300028794 Ga0307515_10000842 Ga0307515_1000084227 223
97 3300028794 Ga0307515_10037126 Ga0307515_100371265 223
98 3300031456 Ga0307513_10006822 Ga0307513_100068223 223
99 3300031456 Ga0307513_10116986 Ga0307513_101169862 223
100 3300031507 Ga0307509_10000654 Ga0307509_1000065435 223
101 3300031616 Ga0307508_10000333 Ga0307508_1000033323 223
102 3300031730 Ga0307516_10009389 Ga0307516_100093899 223
103 3300033180 Ga0307510_10001775 Ga0307510_1000177511 223
104 3300041456 Ga0451795_0556773 Ga0451795_0556773_480_1199 223
105 3300041496 Ga0451839_1210773 Ga0451839_1210773_457_1176 223
106 3300041512 Ga0451853_3319420 Ga0451853_3319420_1295_2014 223
107 3300041997 Ga0439431_0004108 Ga0439431_0004108_133_891 223
108 3300046454 Ga0495592_0000967 Ga0495592_0000967_16164_16898 223
109 3300046471 Ga0495650_0018553 Ga0495650_0018553_606_1349 223
110 3300046512 Ga0495610_0013222 Ga0495610_0013222_2641_3360 223
111 3300046512 Ga0495610_0059906 Ga0495610_0059906_928_1662 223
112 3300046519 Ga0495632_0135921 Ga0495632_0135921_207_926 223
113 3300046522 Ga0495643_0209742 Ga0495643_0209742_131_850 223
114 3300046680 Ga0495646_0020409 Ga0495646_0020409_1049_1783 223
115 3300053088 Ga0500644_0006782 Ga0500644_0006782_147_881 223
116 3300053093 Ga0500651_0038676 Ga0500651_0038676_41_775 223
117 3300053118 Ga0500594_0004732 Ga0500594_0004732_1039_1773 223
118 3300031507 Ga0307509_10098125 Ga0307509_100981253 224
119 3300033179 Ga0307507_10064150 Ga0307507_100641503 224
120 3300042004 Ga0439445_0003396 Ga0439445_0003396_1841_2572 224
121 3300042115 Ga0450911_000104 Ga0450911_000104_33418_34149 224
122 3300046660 Ga0495625_0001586 Ga0495625_0001586_9306_10028 224
123 3300048927 Ga0496124_0254812 Ga0496124_0254812_462_1193 224
124 3300048928 Ga0496125_0008704 Ga0496125_0008704_5057_5788 224
125 iso_pu_bacteria 2643221569 2643859506 224
126 iso_pu_bacteria 2643221594 2643978806 224
127 iso_pu_bacteria 2643221609 2644060764 224
128 iso_pu_bacteria 2643221611 2644071634 224
129 iso_pu_bacteria 2687453129 2687578254 224
130 iso_pu_bacteria 2808606395 2809036437 224
131 iso_pu_bacteria 2857542790 2857545068 224
132 iso_pu_bacteria 2857576091 2857578410 224
133 iso_pu_bacteria 2881412998 2881414867 224
134 iso_pu_bacteria 2941479691 2941483339 224
135 3300006195 Ga0075366_10056113 Ga0075366_100561132 225
136 3300006353 Ga0075370_10019416 Ga0075370_100194165 225
137 3300048919 Ga0496116_0024989 Ga0496116_0024989_2963_3703 225
138 3300048924 Ga0496121_0068712 Ga0496121_0068712_1368_2108 225
139 3300048925 Ga0496122_0060756 Ga0496122_0060756_725_1441 225
140 3300048928 Ga0496125_0000101 Ga0496125_0000101_35916_36632 225
141 3300050489 nmdc:mga03683_105921_c1 nmdc:mga03683_105921_c1_539_1222 225
142 iso_pu_bacteria 2932410948 2932413823 225
143 iso_pu_bacteria 2932416698 2932417883 225
144 3300003791 Ga0055530_10005744 Ga0055530_100057445 226
145 3300005329 Ga0070683_100634969 Ga0070683_1006349691 226
146 3300005354 Ga0070675_100202229 Ga0070675_1002022292 226
147 3300025298 Ga0209050_1000178 Ga0209050_100017841 226
148 3300031616 Ga0307508_10436645 Ga0307508_104366452 226
149 3300041460 Ga0451802_0869575 Ga0451802_0869575_222_941 226
150 3300046458 Ga0495591_000023 Ga0495591_000023_182479_183225 226
151 3300046501 Ga0495607_0001514 Ga0495607_0001514_8372_9118 226
152 3300046520 Ga0495637_0014892 Ga0495637_0014892_586_1332 226
153 3300046542 Ga0495597_0001107 Ga0495597_0001107_8372_9118 226
154 3300046810 Ga0495660_0001495 Ga0495660_0001495_8358_9104 226
155 3300047320 Ga0495672_0022684 Ga0495672_0022684_2865_3611 226
156 3300048907 Ga0496104_0588534 Ga0496104_0588534_120_857 226
157 3300053092 Ga0500583_0117002 Ga0500583_0117002_459_1139 226
158 3300053096 Ga0500641_0059945 Ga0500641_0059945_241_921 226
159 3300053138 Ga0500564_146821 Ga0500564_146821_216_953 226
160 3300053156 Ga0500622_0014640 Ga0500622_0014640_549_1229 226
161 3300053177 Ga0500636_0005975 Ga0500636_0005975_4841_5578 226
162 3300003322 rootL2_10143669 rootL2_101436693 227
163 3300028794 Ga0307515_10002513 Ga0307515_1000251313 227
164 3300028794 Ga0307515_10020574 Ga0307515_100205745 227
165 3300028794 Ga0307515_10182403 Ga0307515_101824033 227
166 3300030522 Ga0307512_10010124 Ga0307512_100101249 227
167 3300031456 Ga0307513_10389383 Ga0307513_103893831 227
168 3300046506 Ga0495583_0000306 Ga0495583_0000306_3085_3822 227
169 3300046507 Ga0495606_0000644 Ga0495606_0000644_31714_32451 227
170 3300046660 Ga0495625_0009203 Ga0495625_0009203_763_1485 227
171 3300046694 Ga0495649_0000167 Ga0495649_0000167_55170_55907 227
172 3300053086 Ga0500578_0209435 Ga0500578_0209435_284_1021 227
173 3300053093 Ga0500651_0072617 Ga0500651_0072617_284_1021 227
174 3300053125 Ga0500618_001137 Ga0500618_001137_3167_3910 227
175 3300053730 Ga0500645_016986 Ga0500645_016986_454_1203 227
176 iso_pu_bacteria 2643221592 2643967139 227
177 iso_pu_bacteria 2643221625 2644139969 227
178 iso_pu_bacteria 2643221648 2644271209 227
179 3300006946 Ga0079104_1000014 Ga0079104_1000014189 228
180 3300013100 Ga0157373_10083632 Ga0157373_100836322 228
181 3300027111 Ga0209281_1000032 Ga0209281_1000032189 228
182 3300028794 Ga0307515_10000030 Ga0307515_10000030201 228
183 3300041997 Ga0439431_0046420 Ga0439431_0046420_401_1087 228
184 3300042007 Ga0439449_0020580 Ga0439449_0020580_738_1490 228
185 3300047472 Ga0495686_0005491 Ga0495686_0005491_8154_8846 228
186 3300050491 nmdc:mga00v17_53860_c1 nmdc:mga00v17_53860_c1_880_1569 228
187 3300050491 nmdc:mga00v17_7678_c1 nmdc:mga00v17_7678_c1_2964_3653 228
188 iso_pu_bacteria 643348564 643598654 228
189 3300005288 Ga0065714_10064788 Ga0065714_1006478810 229
190 3300009036 Ga0105244_10139950 Ga0105244_101399502 229
191 3300013306 Ga0163162_10135136 Ga0163162_101351363 229
192 3300014497 Ga0182008_10005923 Ga0182008_100059232 229
193 3300015261 Ga0182006_1000053 Ga0182006_1000053121 229
194 3300015262 Ga0182007_10000075 Ga0182007_1000007521 229
195 3300015265 Ga0182005_1000031 Ga0182005_100003191 229
196 3300044656 Ga0466969_0080316 Ga0466969_0080316_776_1465 229
197 3300044693 Ga0466961_0025923 Ga0466961_0025923_3047_3736 229
198 3300046452 Ga0495617_000044 Ga0495617_000044_69072_69761 229
199 3300046530 Ga0495654_0007188 Ga0495654_0007188_4209_4901 229
200 3300046558 Ga0495633_0000625 Ga0495633_0000625_24531_25223 229
201 3300048919 Ga0496116_0070269 Ga0496116_0070269_859_1551 229
202 3300048920 Ga0496117_0000032 Ga0496117_0000032_252362_253054 229
203 3300048921 Ga0496118_0000027 Ga0496118_0000027_122480_123172 229
204 3300048924 Ga0496121_0009084 Ga0496121_0009084_2580_3272 229
205 3300048924 Ga0496121_0010777 Ga0496121_0010777_233_925 229
206 3300048925 Ga0496122_0003391 Ga0496122_0003391_11674_12366 229
207 3300048926 Ga0496123_0007507 Ga0496123_0007507_9243_9935 229
208 3300048928 Ga0496125_0082680 Ga0496125_0082680_30_722 229
209 3300048928 Ga0496125_0221307 Ga0496125_0221307_30_722 229
210 3300049460 Ga0495682_0003529 Ga0495682_0003529_1630_2322 229
211 3300061719 Ga0466962_0067365 Ga0466962_0067365_584_1273 229
212 iso_pu_bacteria 2585428057 2587729077 229
213 iso_pu_bacteria 2606217733 2608384181 229
214 iso_pu_bacteria 2857542790 2857542907 229
215 iso_pu_bacteria 2932801729 2932802888 229
216 iso_pu_bacteria 2935883170 2935885228 229
217 iso_pu_bacteria 2599185292 2599904659 230
218 iso_pu_bacteria 2643221569 2643860966 230
219 iso_pu_bacteria 2643221594 2643981106 230
220 iso_pu_bacteria 2643221621 2644124568 230
221 iso_pu_bacteria 2808606395 2809034974 230
222 iso_pu_bacteria 2818991467 2819721881 230
223 iso_pu_bacteria 2831265667 2831271813 230
224 iso_pu_bacteria 2838054893 2838059604 230
225 iso_pu_bacteria 2841760612 2841764224 230
226 iso_pu_bacteria 2844104063 2844108321 230
227 iso_pu_bacteria 2851182111 2851185544 230
228 iso_pu_bacteria 2851246043 2851250659 230
229 iso_pu_bacteria 2885192300 2885196850 230
230 iso_pu_bacteria 2885198086 2885198700 230
231 iso_pu_bacteria 2885211737 2885211920 230
232 iso_pu_bacteria 2885366525 2885370240 230
233 iso_pu_bacteria 2928037797 2928041357 230
234 iso_pu_bacteria 2928044640 2928048199 230
235 iso_pu_bacteria 2928064002 2928066477 230
236 iso_pu_bacteria 2928084124 2928087673 230
237 iso_pu_bacteria 2941479691 2941485930 230
238 3300005262 Ga0065165_1000707 Ga0065165_10007076 231
239 3300005334 Ga0068869_100183386 Ga0068869_1001833862 231
240 3300005353 Ga0070669_100447370 Ga0070669_1004473702 231
241 3300005354 Ga0070675_100065901 Ga0070675_1000659014 231
242 3300005355 Ga0070671_100304832 Ga0070671_1003048322 231
243 3300005356 Ga0070674_100233356 Ga0070674_1002333562 231
244 3300005367 Ga0070667_100604933 Ga0070667_1006049331 231
245 3300005543 Ga0070672_100109110 Ga0070672_1001091103 231
246 3300013306 Ga0163162_10550796 Ga0163162_105507962 231
247 3300013308 Ga0157375_10231827 Ga0157375_102318272 231
248 3300021361 Ga0213872_10000681 Ga0213872_1000068115 231
249 3300025273 Ga0209673_1003402 Ga0209673_10034022 231
250 3300025931 Ga0207644_10173699 Ga0207644_101736992 231
251 3300025940 Ga0207691_10065263 Ga0207691_100652633 231
252 3300025942 Ga0207689_10198759 Ga0207689_101987591 231
253 3300028786 Ga0307517_10107801 Ga0307517_101078013 231
254 3300039447 Ga0436361_1111077 Ga0436361_1111077_4612_5310 231
255 3300042126 Ga0450888_020924 Ga0450888_020924_38_796 231
256 3300053086 Ga0500578_0000393 Ga0500578_0000393_2400_3098 231
257 3300053117 Ga0500593_106802 Ga0500593_106802_22_720 231
258 iso_pu_bacteria 2894023352 2894027605 231
259 iso_pu_bacteria 2932422444 2932424782 231
260 3300021361 Ga0213872_10003867 Ga0213872_100038676 232
261 3300025297 Ga0209758_1000213 Ga0209758_100021354 232
262 3300026121 Ga0207683_10501281 Ga0207683_105012811 232
263 3300033180 Ga0307510_10168688 Ga0307510_101686882 232
264 3300039447 Ga0436361_0044104 Ga0436361_0044104_20114_20863 232
265 3300046460 Ga0495638_0016815 Ga0495638_0016815_1695_2399 232
266 3300047315 Ga0495581_0273821 Ga0495581_0273821_23_730 232
267 iso_pu_bacteria 2547132374 2548499715 232
268 iso_pu_bacteria 2585428062 2587756455 232
269 iso_pu_bacteria 2643221717 2644644968 232
270 iso_pu_bacteria 2824704595 2824705453 232
271 3300002773 JGI25152J39213_1001016 JGI25152J39213_100101613 233
272 3300002774 JGI25150J39212_1005624 JGI25150J39212_10056243 233
273 3300003771 Ga0055526_1001310 Ga0055526_100131012 233
274 3300006051 Ga0075364_10028552 Ga0075364_100285523 233
275 3300025245 Ga0207425_1000328 Ga0207425_100032830 233
276 3300025258 Ga0209129_1000035 Ga0209129_1000035310 233
277 3300025273 Ga0209673_1012164 Ga0209673_10121642 233
278 3300025295 Ga0209564_1000024 Ga0209564_1000024504 233
279 3300025297 Ga0209758_1000066 Ga0209758_10000668 233
280 3300025299 Ga0209256_1011869 Ga0209256_10118693 233
281 3300025913 Ga0207695_10000006 Ga0207695_10000006541 233
282 3300031456 Ga0307513_10388942 Ga0307513_103889421 233
283 3300041452 Ga0451793_0300542 Ga0451793_0300542_2120_2824 233
284 3300041456 Ga0451795_0268819 Ga0451795_0268819_163_867 233
285 3300041458 Ga0451798_0006020 Ga0451798_0006020_125_829 233
286 3300041459 Ga0451800_0725212 Ga0451800_0725212_475_1179 233
287 3300041460 Ga0451802_1174236 Ga0451802_1174236_192_896 233
288 3300041463 Ga0451804_0208994 Ga0451804_0208994_1493_2197 233
289 3300041486 Ga0451807_1859406 Ga0451807_1859406_1508_2212 233
290 3300046519 Ga0495632_0003689 Ga0495632_0003689_4220_4924 233
291 3300048924 Ga0496121_0031856 Ga0496121_0031856_3463_4173 233
292 3300048927 Ga0496124_0000085 Ga0496124_0000085_119528_120238 233
293 3300050491 nmdc:mga00v17_8760_c1 nmdc:mga00v17_8760_c1_233_943 233
294 3300053098 Ga0500650_0018663 Ga0500650_0018663_1522_2226 233
295 3300053109 Ga0500569_059105 Ga0500569_059105_367_1071 233
296 3300053130 Ga0500642_0037532 Ga0500642_0037532_136_840 233
297 3300053131 Ga0500652_000629 Ga0500652_000629_6208_6912 233
298 3300053156 Ga0500622_0000232 Ga0500622_0000232_34027_34731 233
299 iso_pu_bacteria 2588253510 2588294036 233
300 iso_pu_bacteria 2738543013 2739248661 233
301 iso_pu_bacteria 2842677519 2842677637 233
302 iso_pu_bacteria 2945945610 2945946223 233
303 iso_pu_bacteria 2945972063 2945975825 233
304 3300001989 JGI24739J22299_10050406 JGI24739J22299_100504062 234
305 3300002987 JGI25159J45721_1001730 JGI25159J45721_10017306 234
306 3300003187 JGI25151J46595_10033571 JGI25151J46595_100335713 234
307 3300003215 JGI25153J46596_10000151 JGI25153J46596_1000015153 234
308 3300003781 Ga0055536_1029422 Ga0055536_10294221 234
309 3300003791 Ga0055530_10005422 Ga0055530_100054222 234
310 3300003794 Ga0055531_10002248 Ga0055531_1000224815 234
311 3300004625 Ga0055543_1006414 Ga0055543_10064142 234
312 3300005262 Ga0065165_1000229 Ga0065165_100022940 234
313 3300005262 Ga0065165_1086121 Ga0065165_10861211 234
314 3300005334 Ga0068869_100414763 Ga0068869_1004147632 234
315 3300005344 Ga0070661_100104326 Ga0070661_1001043262 234
316 3300005456 Ga0070678_100547491 Ga0070678_1005474912 234
317 3300005564 Ga0070664_100047658 Ga0070664_1000476584 234
318 3300005616 Ga0068852_100418916 Ga0068852_1004189162 234
319 3300006177 Ga0075362_10006362 Ga0075362_100063622 234
320 3300006177 Ga0075362_10013681 Ga0075362_100136812 234
321 3300006195 Ga0075366_10002875 Ga0075366_100028758 234
322 3300006195 Ga0075366_10129714 Ga0075366_101297142 234
323 3300006353 Ga0075370_10046452 Ga0075370_100464523 234
324 3300009036 Ga0105244_10010597 Ga0105244_100105973 234
325 3300009148 Ga0105243_10010819 Ga0105243_100108196 234
326 3300011119 Ga0105246_10820727 Ga0105246_108207271 234
327 3300012502 Ga0157347_1009801 Ga0157347_10098012 234
328 3300015262 Ga0182007_10006880 Ga0182007_100068805 234
329 3300025284 Ga0209130_1000045 Ga0209130_100004521 234
330 3300025292 Ga0209676_1001946 Ga0209676_10019468 234
331 3300025294 Ga0209025_1000893 Ga0209025_10008938 234
332 3300025297 Ga0209758_1000120 Ga0209758_100012096 234
333 3300025298 Ga0209050_1000460 Ga0209050_10004608 234
334 3300025299 Ga0209256_1014142 Ga0209256_10141423 234
335 3300025303 Ga0209051_1001862 Ga0209051_100186214 234
336 3300025304 Ga0209257_1000057 Ga0209257_1000057334 234
337 3300025728 Ga0207655_1003178 Ga0207655_10031785 234
338 3300025904 Ga0207647_10125275 Ga0207647_101252752 234
339 3300025933 Ga0207706_10016401 Ga0207706_100164015 234
340 3300025935 Ga0207709_10000491 Ga0207709_1000049111 234
341 3300025942 Ga0207689_10278214 Ga0207689_102782142 234
342 3300025945 Ga0207679_10041723 Ga0207679_100417232 234
343 3300026067 Ga0207678_10248208 Ga0207678_102482081 234
344 3300026116 Ga0207674_10101659 Ga0207674_101016593 234
345 3300026142 Ga0207698_10107910 Ga0207698_101079103 234
346 3300028794 Ga0307515_10002244 Ga0307515_1000224415 234
347 3300030500 Ga0268256_1011353 Ga0268256_10113532 234
348 3300031238 Ga0265332_10001568 Ga0265332_1000156811 234
349 3300031548 Ga0307408_100227105 Ga0307408_1002271052 234
350 3300031731 Ga0307405_10023955 Ga0307405_100239552 234
351 3300031911 Ga0307412_10070878 Ga0307412_100708783 234
352 3300041404 Ga0439436_0000486 Ga0439436_0000486_4401_5111 234
353 3300041406 Ga0439439_0009488 Ga0439439_0009488_666_1376 234
354 3300041413 Ga0439465_0141694 Ga0439465_0141694_49_759 234
355 3300042007 Ga0439449_0007725 Ga0439449_0007725_1785_2495 234
356 3300042127 Ga0450890_008032 Ga0450890_008032_186_896 234
357 3300042134 Ga0450898_012684 Ga0450898_012684_485_1195 234
358 3300042435 Ga0439434_0047894 Ga0439434_0047894_86_796 234
359 3300044683 Ga0466965_0013432 Ga0466965_0013432_1228_1938 234
360 3300048905 Ga0496102_0241533 Ga0496102_0241533_689_1399 234
361 3300048906 Ga0496103_0157530 Ga0496103_0157530_570_1280 234
362 3300048912 Ga0496109_0629337 Ga0496109_0629337_202_912 234
363 3300048919 Ga0496116_0103806 Ga0496116_0103806_791_1507 234
364 3300048920 Ga0496117_0019294 Ga0496117_0019294_3141_3851 234
365 3300048920 Ga0496117_0225350 Ga0496117_0225350_157_867 234
366 3300048921 Ga0496118_0056110 Ga0496118_0056110_1703_2419 234
367 3300048922 Ga0496119_0066278 Ga0496119_0066278_1257_1973 234
368 3300048922 Ga0496119_0073429 Ga0496119_0073429_640_1350 234
369 3300048924 Ga0496121_0002222 Ga0496121_0002222_24028_24744 234
370 3300048925 Ga0496122_0011489 Ga0496122_0011489_668_1378 234
371 3300048925 Ga0496122_0016952 Ga0496122_0016952_1155_1871 234
372 3300048925 Ga0496122_0102469 Ga0496122_0102469_430_1146 234
373 3300048926 Ga0496123_0013499 Ga0496123_0013499_4977_5693 234
374 3300048927 Ga0496124_0084981 Ga0496124_0084981_1180_1896 234
375 3300048927 Ga0496124_0147287 Ga0496124_0147287_513_1229 234
376 3300048928 Ga0496125_0000096 Ga0496125_0000096_4722_5438 234
377 3300049580 Ga0501046_0114541 Ga0501046_0114541_836_1543 234
378 3300049581 Ga0501047_0059974 Ga0501047_0059974_1892_2599 234
379 3300050489 nmdc:mga03683_11036_c1 nmdc:mga03683_11036_c1_2004_2714 234
380 3300050489 nmdc:mga03683_2013_c1 nmdc:mga03683_2013_c1_38_775 234
381 3300050493 nmdc:mga0k408_20723_c1 nmdc:mga0k408_20723_c1_559_1269 234
382 3300050496 nmdc:mga07m45_12677_c1 nmdc:mga07m45_12677_c1_905_1612 234
383 3300050496 nmdc:mga07m45_9001_c1 nmdc:mga07m45_9001_c1_399_1109 234
384 3300050516 nmdc:mga0sz30_91293_c1 nmdc:mga0sz30_91293_c1_235_945 234
385 iso_pu_bacteria 2904434214 2904434230 234
386 iso_pu_bacteria 2945909444 2945910210 234
387 iso_pu_bacteria 2945984333 2945987764 234
388 3300005455 Ga0070663_100149105 Ga0070663_1001491052 235
389 3300015683 Ga0183362_10001 Ga0183362_10001980 235
390 3300046501 Ga0495607_0001321 Ga0495607_0001321_6717_7463 235
391 3300047320 Ga0495672_0029944 Ga0495672_0029944_60_806 235
392 iso_pu_bacteria 2808606386 2808984121 235
393 iso_pu_bacteria 2808606415 2809132145 235
394 iso_pu_bacteria 2808606419 2809151718 235
395 iso_pu_bacteria 2852618963 2852623071 235
396 3300014497 Ga0182008_10000412 Ga0182008_1000041224 236
397 3300041404 Ga0439436_0004722 Ga0439436_0004722_1107_1832 236
398 3300041411 Ga0439466_0048484 Ga0439466_0048484_215_940 236
399 3300041997 Ga0439431_0001562 Ga0439431_0001562_885_1610 236
400 3300041999 Ga0439433_0003311 Ga0439433_0003311_375_1100 236
401 3300042004 Ga0439445_0009673 Ga0439445_0009673_216_941 236
402 3300042006 Ga0439432_005828 Ga0439432_005828_1108_1833 236
403 3300042007 Ga0439449_0005212 Ga0439449_0005212_3933_4658 236
404 3300042010 Ga0439452_001192 Ga0439452_001192_4809_5534 236
405 3300042015 Ga0439462_0014056 Ga0439462_0014056_1001_1726 236
406 3300042156 Ga0439446_0013356 Ga0439446_0013356_1155_1880 236
407 3300042435 Ga0439434_0062989 Ga0439434_0062989_96_821 236
408 3300048929 Ga0496126_0493835 Ga0496126_0493835_109_825 236
409 iso_pu_bacteria 2687453129 2687579196 236
410 iso_pu_bacteria 2738543012 2739241044 236
411 iso_pu_bacteria 2791355137 2792834528 236
412 3300003322 rootL2_10050359 rootL2_100503592 237
413 3300003784 Ga0055534_1001134 Ga0055534_100113410 237
414 3300005548 Ga0070665_100009677 Ga0070665_1000096776 237
415 3300006048 Ga0075363_100033189 Ga0075363_1000331892 237
416 3300006058 Ga0075432_10011587 Ga0075432_100115873 237
417 3300006177 Ga0075362_10033080 Ga0075362_100330803 237
418 3300006178 Ga0075367_10043998 Ga0075367_100439983 237
419 3300006948 Ga0099826_10190731 Ga0099826_101907312 237
420 3300009098 Ga0105245_10244713 Ga0105245_102447132 237
421 3300021361 Ga0213872_10015097 Ga0213872_100150973 237
422 3300025284 Ga0209130_1019026 Ga0209130_10190262 237
423 3300025291 Ga0209675_1000683 Ga0209675_100068316 237
424 3300025304 Ga0209257_1048255 Ga0209257_10482552 237
425 3300027907 Ga0207428_10257875 Ga0207428_102578752 237
426 3300028379 Ga0268266_10033588 Ga0268266_100335884 237
427 3300030732 Ga0316176_1214160 Ga0316176_12141602 237
428 3300031548 Ga0307408_100479725 Ga0307408_1004797252 237
429 3300031731 Ga0307405_10101759 Ga0307405_101017592 237
430 3300032005 Ga0307411_10051181 Ga0307411_100511813 237
431 3300032005 Ga0307411_10823714 Ga0307411_108237141 237
432 3300039447 Ga0436361_0716290 Ga0436361_0716290_38032_38751 237
433 3300041404 Ga0439436_0007676 Ga0439436_0007676_1350_2072 237
434 3300041411 Ga0439466_0018576 Ga0439466_0018576_394_1116 237
435 3300041413 Ga0439465_0011301 Ga0439465_0011301_1368_2090 237
436 3300042123 Ga0450921_001811 Ga0450921_001811_168_890 237
437 3300042134 Ga0450898_008877 Ga0450898_008877_602_1324 237
438 3300042184 Ga0450908_002904 Ga0450908_002904_994_1716 237
439 3300042435 Ga0439434_0010043 Ga0439434_0010043_541_1263 237
440 3300042531 Ga0450918_001241 Ga0450918_001241_4199_4921 237
441 3300046517 Ga0495630_0081240 Ga0495630_0081240_406_1140 237
442 3300046660 Ga0495625_0000661 Ga0495625_0000661_47711_48433 237
443 3300047319 Ga0495674_0005201 Ga0495674_0005201_3521_4255 237
444 3300048924 Ga0496121_0037742 Ga0496121_0037742_2755_3519 237
445 3300049679 Ga0501249_012357 Ga0501249_012357_804_1526 237
446 3300049705 Ga0501225_0019511 Ga0501225_0019511_528_1250 237
447 3300049759 Ga0501262_000152 Ga0501262_000152_7139_7861 237
448 3300050490 nmdc:mga03n38_63247_c1 nmdc:mga03n38_63247_c1_139_861 237
449 3300050491 nmdc:mga00v17_203009_c1 nmdc:mga00v17_203009_c1_70_792 237
450 3300050492 nmdc:mga0yw44_36724_c1 nmdc:mga0yw44_36724_c1_1291_2013 237
451 3300050493 nmdc:mga0k408_128812_c1 nmdc:mga0k408_128812_c1_90_812 237
452 3300050496 nmdc:mga07m45_10646_c1 nmdc:mga07m45_10646_c1_1571_2293 237
453 iso_pu_bacteria 2765235838 2765567209 237
454 iso_pu_bacteria 2816332133 2816471878 237
455 iso_pu_bacteria 2839094727 2839095149 237
456 iso_pu_bacteria 2904541872 2904545007 237
457 iso_pu_bacteria 2929160207 2929165180 237
458 3300005842 Ga0068858_100832898 Ga0068858_1008328981 238
459 3300053125 Ga0500618_005766 Ga0500618_005766_1487_2221 238
460 iso_pu_bacteria 2842348783 2842349902 238
461 iso_pu_bacteria 2842454564 2842454868 238
462 iso_pu_bacteria 2842843487 2842843640 238
463 3300003187 JGI25151J46595_10004189 JGI25151J46595_100041897 239
464 3300005614 Ga0068856_100476594 Ga0068856_1004765942 239
465 3300037068 Ga0373925_0387142 Ga0373925_0387142_82_837 239
466 3300044658 Ga0466972_0000708 Ga0466972_0000708_3523_4287 239
467 3300044683 Ga0466965_0354874 Ga0466965_0354874_11_775 239
468 3300044735 Ga0466968_0008282 Ga0466968_0008282_1644_2408 239
469 3300044901 Ga0466960_0007734 Ga0466960_0007734_2228_2992 239
470 3300053079 Ga0500610_0163268 Ga0500610_0163268_356_1084 239
471 3300005339 Ga0070660_100042053 Ga0070660_1000420532 240
472 3300005455 Ga0070663_100087966 Ga0070663_1000879663 240
473 3300005530 Ga0070679_100054296 Ga0070679_1000542963 240
474 3300005543 Ga0070672_100642816 Ga0070672_1006428162 240
475 3300005563 Ga0068855_100046805 Ga0068855_1000468053 240
476 3300009174 Ga0105241_10718906 Ga0105241_107189062 240
477 3300009551 Ga0105238_10246666 Ga0105238_102466662 240
478 3300015262 Ga0182007_10006376 Ga0182007_100063763 240
479 3300025909 Ga0207705_10015142 Ga0207705_100151426 240
480 3300025919 Ga0207657_10018853 Ga0207657_100188534 240
481 3300025921 Ga0207652_10110945 Ga0207652_101109453 240
482 3300025924 Ga0207694_10230685 Ga0207694_102306852 240
483 3300025949 Ga0207667_10099751 Ga0207667_100997512 240
484 3300031456 Ga0307513_10108752 Ga0307513_101087523 240
485 3300042007 Ga0439449_0002065 Ga0439449_0002065_1025_1774 240
486 3300042015 Ga0439462_0010395 Ga0439462_0010395_1025_1774 240
487 3300047472 Ga0495686_0012210 Ga0495686_0012210_2440_3177 240
488 3300053079 Ga0500610_0119794 Ga0500610_0119794_160_918 240
489 3300053121 Ga0500607_159665 Ga0500607_159665_209_940 240
490 3300053147 Ga0500589_100166 Ga0500589_100166_252_989 240
491 3300006178 Ga0075367_10080453 Ga0075367_100804532 241
492 3300006237 Ga0097621_100297213 Ga0097621_1002972132 241
493 3300006358 Ga0068871_100201548 Ga0068871_1002015483 241
494 3300025940 Ga0207691_10420480 Ga0207691_104204802 241
495 3300028573 Ga0265334_10060317 Ga0265334_100603171 241
496 3300028666 Ga0265336_10000013 Ga0265336_1000001321 241
497 3300031730 Ga0307516_10000136 Ga0307516_1000013643 241
498 3300046453 Ga0495627_017729 Ga0495627_017729_501_1289 241
499 3300046459 Ga0495629_0072486 Ga0495629_0072486_1136_1870 241
500 3300046462 Ga0495651_0186321 Ga0495651_0186321_686_1420 241
501 3300046463 Ga0495653_0002408 Ga0495653_0002408_10904_11638 241
502 3300046471 Ga0495650_0008643 Ga0495650_0008643_3950_4708 241
503 3300046471 Ga0495650_0030600 Ga0495650_0030600_1416_2150 241
504 3300046475 Ga0495639_0009042 Ga0495639_0009042_775_1509 241
505 3300046516 Ga0495628_0016052 Ga0495628_0016052_3254_3988 241
506 3300046516 Ga0495628_0422647 Ga0495628_0422647_86_820 241
507 3300046517 Ga0495630_0011618 Ga0495630_0011618_4743_5477 241
508 3300046526 Ga0495666_0000626 Ga0495666_0000626_2397_3131 241
509 3300046529 Ga0495652_0017183 Ga0495652_0017183_4468_5202 241
510 3300046529 Ga0495652_0312054 Ga0495652_0312054_224_958 241
511 3300046531 Ga0495665_0003521 Ga0495665_0003521_3456_4190 241
512 3300046538 Ga0495609_0057422 Ga0495609_0057422_691_1425 241
513 3300046642 Ga0495634_0086531 Ga0495634_0086531_162_896 241
514 3300046679 Ga0495623_0006265 Ga0495623_0006265_144_878 241
515 3300046690 Ga0495624_0005226 Ga0495624_0005226_3711_4445 241
516 3300047317 Ga0495604_0002262 Ga0495604_0002262_8637_9371 241
517 3300047319 Ga0495674_0005454 Ga0495674_0005454_10090_10824 241
518 3300047319 Ga0495674_0013440 Ga0495674_0013440_3677_4411 241
519 3300047321 Ga0495676_0002666 Ga0495676_0002666_3414_4148 241
520 3300047322 Ga0495680_0002100 Ga0495680_0002100_13747_14481 241
521 3300047444 Ga0495675_0005240 Ga0495675_0005240_6839_7573 241
522 3300047673 Ga0495593_0001905 Ga0495593_0001905_3303_4037 241
523 3300048088 Ga0495602_0006074 Ga0495602_0006074_6719_7453 241
524 3300048924 Ga0496121_0000233 Ga0496121_0000233_97545_98279 241
525 3300048926 Ga0496123_0024574 Ga0496123_0024574_2809_3597 241
526 3300048929 Ga0496126_0001857 Ga0496126_0001857_9080_9814 241
527 3300003187 JGI25151J46595_10000262 JGI25151J46595_1000026226 242
528 3300005355 Ga0070671_100061377 Ga0070671_1000613773 242
529 3300005617 Ga0068859_100212786 Ga0068859_1002127862 242
530 3300005841 Ga0068863_100116157 Ga0068863_1001161573 242
531 3300006931 Ga0097620_100212794 Ga0097620_1002127942 242
532 3300009098 Ga0105245_10130847 Ga0105245_101308472 242
533 3300013306 Ga0163162_10480458 Ga0163162_104804582 242
534 3300013308 Ga0157375_10108427 Ga0157375_101084273 242
535 3300025294 Ga0209025_1000057 Ga0209025_1000057232 242
536 3300046459 Ga0495629_0074081 Ga0495629_0074081_70_807 242
537 3300046463 Ga0495653_0073660 Ga0495653_0073660_652_1389 242
538 3300046472 Ga0495580_0001423 Ga0495580_0001423_3690_4427 242
539 3300046472 Ga0495580_0005484 Ga0495580_0005484_5655_6392 242
540 3300046473 Ga0495582_0027193 Ga0495582_0027193_725_1462 242
541 3300046477 Ga0495664_0085697 Ga0495664_0085697_430_1167 242
542 3300046499 Ga0495594_0067088 Ga0495594_0067088_730_1467 242
543 3300046507 Ga0495606_0156666 Ga0495606_0156666_552_1289 242
544 3300046514 Ga0495618_0008335 Ga0495618_0008335_1437_2174 242
545 3300046516 Ga0495628_0003496 Ga0495628_0003496_4094_4831 242
546 3300046516 Ga0495628_0003725 Ga0495628_0003725_3196_3933 242
547 3300046517 Ga0495630_0021337 Ga0495630_0021337_83_820 242
548 3300046524 Ga0495648_0001162 Ga0495648_0001162_11025_11762 242
549 3300046524 Ga0495648_0006300 Ga0495648_0006300_3844_4581 242
550 3300046531 Ga0495665_0137363 Ga0495665_0137363_159_896 242
551 3300046533 Ga0495640_0014104 Ga0495640_0014104_507_1244 242
552 3300046536 Ga0495587_0001168 Ga0495587_0001168_16010_16747 242
553 3300046543 Ga0495645_0022656 Ga0495645_0022656_3627_4364 242
554 3300046642 Ga0495634_0017659 Ga0495634_0017659_455_1192 242
555 3300046665 Ga0495661_0062290 Ga0495661_0062290_31_768 242
556 3300046674 Ga0495588_0011830 Ga0495588_0011830_2420_3157 242
557 3300046678 Ga0495599_0004856 Ga0495599_0004856_5689_6426 242
558 3300046679 Ga0495623_0012599 Ga0495623_0012599_1179_1916 242
559 3300046680 Ga0495646_0000413 Ga0495646_0000413_1472_2209 242
560 3300046689 Ga0495613_0111115 Ga0495613_0111115_159_896 242
561 3300046690 Ga0495624_0059569 Ga0495624_0059569_1571_2308 242
562 3300047315 Ga0495581_0003594 Ga0495581_0003594_5938_6675 242
563 3300047317 Ga0495604_0031408 Ga0495604_0031408_1421_2158 242
564 3300047319 Ga0495674_0021724 Ga0495674_0021724_159_896 242
565 3300047319 Ga0495674_0087164 Ga0495674_0087164_19_756 242
566 3300047321 Ga0495676_0006001 Ga0495676_0006001_6130_6867 242
567 3300047322 Ga0495680_0021405 Ga0495680_0021405_4647_5384 242
568 3300047444 Ga0495675_0103796 Ga0495675_0103796_10_747 242
569 3300047446 Ga0495679_000472 Ga0495679_000472_14684_15421 242
570 3300047471 Ga0495684_0037247 Ga0495684_0037247_135_872 242
571 3300047673 Ga0495593_0019945 Ga0495593_0019945_1443_2180 242
572 3300048088 Ga0495602_0066872 Ga0495602_0066872_1443_2180 242
573 3300048089 Ga0495614_0005110 Ga0495614_0005110_159_896 242
574 3300048922 Ga0496119_0000011 Ga0496119_0000011_208708_209445 242
575 3300048923 Ga0496120_0001187 Ga0496120_0001187_22188_22925 242
576 iso_pu_bacteria 2904541872 2904546135 242
577 iso_pu_bacteria 2904584206 2904586077 242
578 iso_pu_bacteria 2904589729 2904592110 242
579 iso_pu_bacteria 2904601388 2904601733 242
580 iso_pu_bacteria 2919079590 2919084812 242
581 iso_pu_bacteria 2929160207 2929163953 242
582 3300025931 Ga0207644_10163672 Ga0207644_101636722 243
583 3300026095 Ga0207676_10142739 Ga0207676_101427393 243
584 3300046452 Ga0495617_030769 Ga0495617_030769_212_958 243
585 3300046453 Ga0495627_000062 Ga0495627_000062_39269_40015 243
586 3300046458 Ga0495591_011049 Ga0495591_011049_915_1661 243
587 3300046463 Ga0495653_0000761 Ga0495653_0000761_14306_15052 243
588 3300046471 Ga0495650_0004823 Ga0495650_0004823_385_1131 243
589 3300046501 Ga0495607_0001124 Ga0495607_0001124_20865_21611 243
590 3300046507 Ga0495606_0001437 Ga0495606_0001437_7882_8628 243
591 3300046518 Ga0495631_0000773 Ga0495631_0000773_7960_8706 243
592 3300046519 Ga0495632_0028604 Ga0495632_0028604_622_1368 243
593 3300046530 Ga0495654_0000192 Ga0495654_0000192_25654_26400 243
594 3300046692 Ga0495671_0042585 Ga0495671_0042585_1135_1881 243
595 3300046810 Ga0495660_0004737 Ga0495660_0004737_6027_6773 243
596 3300047320 Ga0495672_0008368 Ga0495672_0008368_595_1341 243
597 3300047320 Ga0495672_0022359 Ga0495672_0022359_1364_2119 243
598 3300049459 Ga0495678_027017 Ga0495678_027017_289_1035 243
599 iso_pu_bacteria 2511231003 2511250493 243
600 iso_pu_bacteria 2515154123 2515691153 243
601 iso_pu_bacteria 2738541296 2738824353 243
602 iso_pu_bacteria 2738541298 2738836716 243
603 iso_pu_bacteria 2738541306 2738878247 243
604 iso_pu_bacteria 2738543002 2739189939 243
605 iso_pu_bacteria 2738543008 2739224840 243
606 iso_pu_bacteria 2818991450 2819622512 243
607 iso_pu_bacteria 2856287931 2856288044 243
608 iso_pu_bacteria 2857357740 2857358334 243
609 iso_pu_bacteria 2900634093 2900639981 243
610 iso_pu_bacteria 2921643360 2921645939 243
611 iso_pu_bacteria 2928108538 2928111925 243
612 iso_pu_bacteria 2928135762 2928139164 243
613 iso_pu_bacteria 2928503688 2928508868 243
614 iso_pu_bacteria 8055266321 8055273397 243
615 3300002773 JGI25152J39213_1000073 JGI25152J39213_100007344 244
616 3300002774 JGI25150J39212_1000062 JGI25150J39212_100006244 244
617 3300002987 JGI25159J45721_1000058 JGI25159J45721_100005828 244
618 3300003187 JGI25151J46595_10000255 JGI25151J46595_1000025526 244
619 3300003215 JGI25153J46596_10000165 JGI25153J46596_1000016544 244
620 3300003354 JGI25160J50197_1000181 JGI25160J50197_100018128 244
621 3300003374 JGI25161J50226_1000145 JGI25161J50226_100014526 244
622 3300003771 Ga0055526_1000146 Ga0055526_100014626 244
623 3300003773 Ga0055537_1000090 Ga0055537_100009044 244
624 3300003775 Ga0055524_1000195 Ga0055524_100019544 244
625 3300003784 Ga0055534_1000101 Ga0055534_100010144 244
626 3300003790 Ga0055528_1000111 Ga0055528_100011144 244
627 3300003794 Ga0055531_10001310 Ga0055531_1000131018 244
628 3300004625 Ga0055543_1000232 Ga0055543_100023215 244
629 3300005262 Ga0065165_1000683 Ga0065165_100068325 244
630 3300025245 Ga0207425_1000042 Ga0207425_100004252 244
631 3300025258 Ga0209129_1000058 Ga0209129_100005858 244
632 3300025263 Ga0209565_1000027 Ga0209565_100002773 244
633 3300025273 Ga0209673_1000031 Ga0209673_100003163 244
634 3300025284 Ga0209130_1000025 Ga0209130_100002558 244
635 3300025291 Ga0209675_1000064 Ga0209675_100006447 244
636 3300025292 Ga0209676_1000633 Ga0209676_100063319 244
637 3300025294 Ga0209025_1000075 Ga0209025_1000075233 244
638 3300025295 Ga0209564_1000040 Ga0209564_1000040156 244
639 3300025297 Ga0209758_1000050 Ga0209758_1000050281 244
640 3300025299 Ga0209256_1000023 Ga0209256_1000023281 244
641 3300025302 Ga0207426_1000118 Ga0207426_100011847 244
642 3300025303 Ga0209051_1001382 Ga0209051_100138218 244
643 3300025304 Ga0209257_1000188 Ga0209257_1000188126 244
644 3300031456 Ga0307513_10053784 Ga0307513_100537844 244
645 3300044656 Ga0466969_0007670 Ga0466969_0007670_1602_2345 244
646 3300044683 Ga0466965_0000290 Ga0466965_0000290_2610_3353 244
647 3300044684 Ga0466966_0028973 Ga0466966_0028973_2001_2744 244
648 3300044693 Ga0466961_0077753 Ga0466961_0077753_958_1701 244
649 3300044694 Ga0466963_0148113 Ga0466963_0148113_480_1223 244
650 3300044706 Ga0466964_0010149 Ga0466964_0010149_1175_1918 244
651 3300044719 Ga0466971_0009952 Ga0466971_0009952_1883_2626 244
652 3300044765 Ga0466970_0008244 Ga0466970_0008244_3536_4279 244
653 3300044842 Ga0466957_0001020 Ga0466957_0001020_736_1479 244
654 3300045049 Ga0466959_0002228 Ga0466959_0002228_9962_10705 244
655 3300045836 Ga0466958_0015767 Ga0466958_0015767_1609_2352 244
656 3300045976 Ga0466967_0051642 Ga0466967_0051642_2218_2961 244
657 3300046512 Ga0495610_0002534 Ga0495610_0002534_1829_2569 244
658 3300046665 Ga0495661_0000009 Ga0495661_0000009_271136_271876 244
659 3300047323 Ga0495683_0000004 Ga0495683_0000004_88553_89293 244
660 3300047469 Ga0495673_0002876 Ga0495673_0002876_9142_9882 244
661 3300047470 Ga0495681_0006549 Ga0495681_0006549_5638_6378 244
662 3300048925 Ga0496122_0025766 Ga0496122_0025766_4273_5013 244
663 3300048926 Ga0496123_0035073 Ga0496123_0035073_1018_1758 244
664 3300049459 Ga0495678_000014 Ga0495678_000014_225104_225844 244
665 3300061719 Ga0466962_0019388 Ga0466962_0019388_830_1573 244
666 iso_pu_bacteria 2508501050 2508730175 244
667 iso_pu_bacteria 2738541277 2738722602 244
668 iso_pu_bacteria 2738543019 2739283173 244
669 iso_pu_bacteria 2775506901 2776266414 244
670 iso_pu_bacteria 2844315083 2844322769 244
671 iso_pu_bacteria 2903727486 2903734715 244
672 iso_pu_bacteria 2906602504 2906604974 244
673 iso_pu_bacteria 3005594810 3005602636 244
674 iso_pu_bacteria 3005710791 3005716980 244
675 iso_pu_bacteria 3005718088 3005726106 244
676 iso_pu_bacteria 8056967851 8056976571 244
677 3300002704 JGI25155J39150_1000334 JGI25155J39150_10003347 245
678 3300002705 JGI25156J39149_1008436 JGI25156J39149_10084362 245
679 3300002738 JGI25154J39366_1000262 JGI25154J39366_100026219 245
680 3300003781 Ga0055536_1000113 Ga0055536_100011372 245
681 3300003792 Ga0055540_1000045 Ga0055540_100004554 245
682 3300003794 Ga0055531_10000149 Ga0055531_1000014955 245
683 3300005288 Ga0065714_10002413 Ga0065714_100024138 245
684 3300005288 Ga0065714_10091146 Ga0065714_100911463 245
685 3300005456 Ga0070678_100499699 Ga0070678_1004996992 245
686 3300005563 Ga0068855_100024941 Ga0068855_1000249416 245
687 3300005563 Ga0068855_100461994 Ga0068855_1004619942 245
688 3300006058 Ga0075432_10070482 Ga0075432_100704822 245
689 3300025206 Ga0209435_100104 Ga0209435_1001049 245
690 3300025228 Ga0209672_103796 Ga0209672_1037962 245
691 3300025246 Ga0209646_1000108 Ga0209646_1000108105 245
692 3300025250 Ga0209026_1002531 Ga0209026_10025316 245
693 3300025256 Ga0209759_1000173 Ga0209759_10001734 245
694 3300025292 Ga0209676_1000135 Ga0209676_1000135105 245
695 3300025298 Ga0209050_1000100 Ga0209050_100010079 245
696 3300025303 Ga0209051_1000067 Ga0209051_1000067148 245
697 3300025304 Ga0209257_1000095 Ga0209257_100009593 245
698 3300025909 Ga0207705_10317095 Ga0207705_103170952 245
699 3300025913 Ga0207695_10026593 Ga0207695_100265934 245
700 3300025949 Ga0207667_10002561 Ga0207667_100025616 245
701 3300025949 Ga0207667_10256617 Ga0207667_102566171 245
702 3300028794 Ga0307515_10096844 Ga0307515_100968443 245
703 3300031548 Ga0307408_100308081 Ga0307408_1003080812 245
704 3300032002 Ga0307416_100524000 Ga0307416_1005240002 245
705 3300032004 Ga0307414_10085437 Ga0307414_100854373 245
706 3300032004 Ga0307414_10189735 Ga0307414_101897352 245
707 3300037312 Ga0395899_0003953 Ga0395899_0003953_2070_2822 245
708 3300037418 Ga0395900_0013023 Ga0395900_0013023_7044_7796 245
709 3300037418 Ga0395900_0082740 Ga0395900_0082740_317_1069 245
710 3300037466 Ga0395898_0210532 Ga0395898_0210532_655_1407 245
711 3300037471 Ga0395905_0446154 Ga0395905_0446154_127_879 245
712 3300038443 Ga0395901_0044783 Ga0395901_0044783_316_1068 245
713 3300041486 Ga0451807_0874863 Ga0451807_0874863_141_917 245
714 3300046516 Ga0495628_0267383 Ga0495628_0267383_191_946 245
715 3300046529 Ga0495652_0012733 Ga0495652_0012733_5467_6222 245
716 3300046543 Ga0495645_0014660 Ga0495645_0014660_2421_3176 245
717 3300046680 Ga0495646_0011065 Ga0495646_0011065_2716_3471 245
718 3300048088 Ga0495602_0226379 Ga0495602_0226379_130_885 245
719 3300050493 nmdc:mga0k408_38_c1 nmdc:mga0k408_38_c1_250_1005 245
720 3300050516 nmdc:mga0sz30_43645_c1 nmdc:mga0sz30_43645_c1_512_1279 245
721 3300053087 Ga0500643_000694 Ga0500643_000694_15582_16343 245
722 3300053133 Ga0500655_000418 Ga0500655_000418_3654_4415 245
723 3300053141 Ga0500574_000052 Ga0500574_000052_3003_3764 245
724 iso_pu_bacteria 2738541307 2738881079 245
725 iso_pu_bacteria 8016583857 8016590204 245
726 3300003320 rootH2_10059852 rootH2_100598522 246
727 3300005563 Ga0068855_100014961 Ga0068855_10001496111 246
728 3300009101 Ga0105247_10240481 Ga0105247_102404812 246
729 3300009545 Ga0105237_10046055 Ga0105237_100460556 246
730 3300013250 Ga0171462_1015 Ga0171462_1015142 246
731 3300015261 Ga0182006_1002039 Ga0182006_10020394 246
732 3300025914 Ga0207671_10100189 Ga0207671_101001892 246
733 3300025914 Ga0207671_10256385 Ga0207671_102563852 246
734 3300025949 Ga0207667_10028495 Ga0207667_100284952 246
735 3300030521 Ga0307511_10044832 Ga0307511_100448324 246
736 3300030521 Ga0307511_10168026 Ga0307511_101680262 246
737 3300031507 Ga0307509_10065073 Ga0307509_100650732 246
738 3300031730 Ga0307516_10016230 Ga0307516_100162304 246
739 3300035692 Ga0373935_0038345 Ga0373935_0038345_1548_2300 246
740 3300035725 Ga0373947_0080970 Ga0373947_0080970_631_1383 246
741 3300037068 Ga0373925_0076610 Ga0373925_0076610_1554_2306 246
742 3300039447 Ga0436361_0455580 Ga0436361_0455580_343_1113 246
743 3300046454 Ga0495592_0259680 Ga0495592_0259680_290_1042 246
744 3300046518 Ga0495631_0131823 Ga0495631_0131823_201_959 246
745 3300046683 Ga0495658_0141246 Ga0495658_0141246_29_781 246
746 3300047320 Ga0495672_0005003 Ga0495672_0005003_8803_9549 246
747 3300047444 Ga0495675_0278561 Ga0495675_0278561_228_980 246
748 3300048909 Ga0496106_0003842 Ga0496106_0003842_1275_2027 246
749 3300048921 Ga0496118_0068269 Ga0496118_0068269_687_1439 246
750 3300048927 Ga0496124_0005442 Ga0496124_0005442_10555_11307 246
751 3300048927 Ga0496124_0351883 Ga0496124_0351883_144_953 246
752 3300048929 Ga0496126_0069745 Ga0496126_0069745_1044_1796 246
753 3300053080 Ga0500635_0040027 Ga0500635_0040027_334_1086 246
754 3300053094 Ga0500566_0106792 Ga0500566_0106792_612_1364 246
755 3300053140 Ga0500573_0011632 Ga0500573_0011632_1813_2565 246
756 3300053177 Ga0500636_0128468 Ga0500636_0128468_215_967 246
757 3300053735 Ga0500596_007476 Ga0500596_007476_409_1161 246
758 iso_pu_bacteria 2904666416 2904672415 246
759 iso_pu_bacteria 3005718088 3005721092 246
760 iso_pu_bacteria 8019648815 8019656835 246
761 iso_pu_bacteria 8056967851 8056968496 246
762 3300001989 JGI24739J22299_10000884 JGI24739J22299_100008846 247
763 3300002067 JGI24735J21928_10001089 JGI24735J21928_100010898 247
764 3300002705 JGI25156J39149_1001160 JGI25156J39149_10011604 247
765 3300003756 Ga0055533_1008674 Ga0055533_10086742 247
766 3300005354 Ga0070675_100623740 Ga0070675_1006237402 247
767 3300005367 Ga0070667_100100410 Ga0070667_1001004103 247
768 3300006058 Ga0075432_10111901 Ga0075432_101119012 247
769 3300006944 Ga0099823_1069269 Ga0099823_10692692 247
770 3300009011 Ga0105251_10000496 Ga0105251_1000049618 247
771 3300009094 Ga0111539_10933917 Ga0111539_109339171 247
772 3300010375 Ga0105239_10007556 Ga0105239_100075565 247
773 3300011119 Ga0105246_10259428 Ga0105246_102594282 247
774 3300011119 Ga0105246_10471430 Ga0105246_104714302 247
775 3300015262 Ga0182007_10002674 Ga0182007_100026743 247
776 3300021320 Ga0214544_1007467 Ga0214544_100746719 247
777 3300021321 Ga0214542_1020416 Ga0214542_10204163 247
778 3300021324 Ga0214545_1010456 Ga0214545_10104562 247
779 3300021327 Ga0214543_1008348 Ga0214543_10083485 247
780 3300025206 Ga0209435_101167 Ga0209435_1011672 247
781 3300025226 Ga0209674_100078 Ga0209674_100078133 247
782 3300025256 Ga0209759_1000087 Ga0209759_1000087110 247
783 3300025735 Ga0207713_1001113 Ga0207713_100111320 247
784 3300025904 Ga0207647_10004634 Ga0207647_1000463412 247
785 3300025904 Ga0207647_10031606 Ga0207647_100316063 247
786 3300025924 Ga0207694_10513345 Ga0207694_105133452 247
787 3300025986 Ga0207658_10129530 Ga0207658_101295302 247
788 3300027296 Ga0209389_1026550 Ga0209389_10265504 247
789 3300027361 Ga0209489_115028 Ga0209489_1150284 247
790 3300027363 Ga0209700_100026 Ga0209700_100026152 247
791 3300031730 Ga0307516_10001738 Ga0307516_1000173824 247
792 3300031911 Ga0307412_10000024 Ga0307412_10000024253 247
793 3300044656 Ga0466969_0004989 Ga0466969_0004989_320_1069 247
794 3300044684 Ga0466966_0025298 Ga0466966_0025298_1426_2175 247
795 3300044693 Ga0466961_0058919 Ga0466961_0058919_1491_2240 247
796 3300044765 Ga0466970_0020888 Ga0466970_0020888_1977_2726 247
797 3300044842 Ga0466957_0147842 Ga0466957_0147842_623_1381 247
798 3300045049 Ga0466959_0087184 Ga0466959_0087184_1261_2010 247
799 3300045976 Ga0466967_0000802 Ga0466967_0000802_6493_7251 247
800 3300046472 Ga0495580_0000252 Ga0495580_0000252_11863_12612 247
801 3300046472 Ga0495580_0000279 Ga0495580_0000279_22082_22831 247
802 3300046500 Ga0495596_0011373 Ga0495596_0011373_2619_3368 247
803 3300046507 Ga0495606_0089093 Ga0495606_0089093_769_1518 247
804 3300046517 Ga0495630_0155931 Ga0495630_0155931_960_1709 247
805 3300046520 Ga0495637_0004928 Ga0495637_0004928_2119_2880 247
806 3300046674 Ga0495588_0016167 Ga0495588_0016167_2582_3343 247
807 3300047323 Ga0495683_0038427 Ga0495683_0038427_440_1189 247
808 3300048088 Ga0495602_0033131 Ga0495602_0033131_3031_3780 247
809 3300048907 Ga0496104_0446086 Ga0496104_0446086_180_929 247
810 3300048919 Ga0496116_0010201 Ga0496116_0010201_4210_4959 247
811 3300048920 Ga0496117_0016574 Ga0496117_0016574_1208_1957 247
812 3300048920 Ga0496117_0109369 Ga0496117_0109369_783_1532 247
813 3300048921 Ga0496118_0016483 Ga0496118_0016483_2363_3112 247
814 3300053079 Ga0500610_0026635 Ga0500610_0026635_109_870 247
815 3300053125 Ga0500618_002201 Ga0500618_002201_3071_3841 247
816 3300053153 Ga0500616_0049392 Ga0500616_0049392_692_1447 247
817 3300001990 JGI24737J22298_10022393 JGI24737J22298_100223932 248
818 3300005366 Ga0070659_100170590 Ga0070659_1001705902 248
819 3300005457 Ga0070662_100420942 Ga0070662_1004209422 248
820 3300005471 Ga0070698_100671354 Ga0070698_1006713542 248
821 3300005578 Ga0068854_100373796 Ga0068854_1003737962 248
822 3300005614 Ga0068856_100505105 Ga0068856_1005051052 248
823 3300005616 Ga0068852_100000685 Ga0068852_10000068511 248
824 3300005843 Ga0068860_100003437 Ga0068860_10000343716 248
825 3300006237 Ga0097621_100236848 Ga0097621_1002368482 248
826 3300006358 Ga0068871_100141221 Ga0068871_1001412213 248
827 3300009093 Ga0105240_10001617 Ga0105240_1000161732 248
828 3300009098 Ga0105245_10019045 Ga0105245_100190454 248
829 3300009101 Ga0105247_10009542 Ga0105247_100095425 248
830 3300009174 Ga0105241_10002869 Ga0105241_100028696 248
831 3300009545 Ga0105237_10001263 Ga0105237_1000126322 248
832 3300010375 Ga0105239_10178708 Ga0105239_101787082 248
833 3300010375 Ga0105239_10728656 Ga0105239_107286562 248
834 3300013297 Ga0157378_10089005 Ga0157378_100890053 248
835 3300025900 Ga0207710_10015253 Ga0207710_100152533 248
836 3300025904 Ga0207647_10109369 Ga0207647_101093692 248
837 3300025913 Ga0207695_10000008 Ga0207695_10000008371 248
838 3300025914 Ga0207671_10009661 Ga0207671_100096612 248
839 3300025927 Ga0207687_10088279 Ga0207687_100882793 248
840 3300025927 Ga0207687_10396547 Ga0207687_103965472 248
841 3300025932 Ga0207690_10081721 Ga0207690_100817212 248
842 3300026142 Ga0207698_10128225 Ga0207698_101282252 248
843 3300028381 Ga0268264_10000020 Ga0268264_10000020347 248
844 3300028786 Ga0307517_10105455 Ga0307517_101054552 248
845 3300028794 Ga0307515_10000067 Ga0307515_10000067213 248
846 3300028794 Ga0307515_10011464 Ga0307515_100114645 248
847 3300028794 Ga0307515_10056827 Ga0307515_100568273 248
848 3300031456 Ga0307513_10011950 Ga0307513_100119502 248
849 3300031456 Ga0307513_10022166 Ga0307513_100221668 248
850 3300031507 Ga0307509_10077568 Ga0307509_100775684 248
851 3300031507 Ga0307509_10119904 Ga0307509_101199043 248
852 3300031616 Ga0307508_10175501 Ga0307508_101755012 248
853 3300031649 Ga0307514_10027913 Ga0307514_100279133 248
854 3300031730 Ga0307516_10006407 Ga0307516_100064078 248
855 3300033179 Ga0307507_10098070 Ga0307507_100980701 248
856 3300046530 Ga0495654_0000313 Ga0495654_0000313_18199_18948 248
857 3300046660 Ga0495625_0273150 Ga0495625_0273150_119_883 248
858 3300048924 Ga0496121_0100594 Ga0496121_0100594_1146_1907 248
859 3300048929 Ga0496126_0093716 Ga0496126_0093716_1139_1900 248
860 3300053108 Ga0500562_004783 Ga0500562_004783_561_1310 248
861 iso_pu_bacteria 2513020051 2513227018 248
862 iso_pu_bacteria 2599185214 2599627595 248
863 iso_pu_bacteria 2599185226 2599677806 248
864 iso_pu_bacteria 2599185227 2599685321 248
865 iso_pu_bacteria 2599185229 2599697030 248
866 iso_pu_bacteria 2643221628 2644161127 248
867 iso_pu_bacteria 2643221658 2644325923 248
868 iso_pu_bacteria 2643221672 2644397208 248
869 iso_pu_bacteria 2738541277 2738723847 248
870 iso_pu_bacteria 2738541307 2738880536 248
871 iso_pu_bacteria 2738543019 2739284578 248
872 iso_pu_bacteria 2838054893 2838061182 248
873 iso_pu_bacteria 2885198086 2885203231 248
874 iso_pu_bacteria 2885211737 2885216372 248
875 iso_pu_bacteria 2904449895 2904453355 248
876 iso_pu_bacteria 2904456579 2904459326 248
877 iso_pu_bacteria 2928070936 2928075154 248
878 iso_pu_bacteria 2928084124 2928090750 248
879 iso_pu_bacteria 2945945610 2945948361 248
880 iso_pu_bacteria 2945972063 2945972140 248
881 3300005434 Ga0070709_10000273 Ga0070709_1000027324 249
882 3300005435 Ga0070714_100005827 Ga0070714_1000058278 249
883 3300005437 Ga0070710_10000212 Ga0070710_100002127 249
884 3300005439 Ga0070711_100005770 Ga0070711_1000057703 249
885 3300006163 Ga0070715_10032928 Ga0070715_100329282 249
886 3300006173 Ga0070716_100002266 Ga0070716_1000022665 249
887 3300006175 Ga0070712_100025966 Ga0070712_1000259662 249
888 3300009551 Ga0105238_10336574 Ga0105238_103365742 249
889 3300014968 Ga0157379_10294327 Ga0157379_102943272 249
890 3300025898 Ga0207692_10000086 Ga0207692_1000008625 249
891 3300025905 Ga0207685_10017087 Ga0207685_100170872 249
892 3300025906 Ga0207699_10000515 Ga0207699_1000051513 249
893 3300025915 Ga0207693_10018998 Ga0207693_100189984 249
894 3300025916 Ga0207663_10001767 Ga0207663_100017673 249
895 3300025928 Ga0207700_10005674 Ga0207700_100056743 249
896 3300025929 Ga0207664_10299720 Ga0207664_102997202 249
897 3300025939 Ga0207665_10002776 Ga0207665_100027768 249
898 3300028794 Ga0307515_10001836 Ga0307515_1000183617 249
899 3300028794 Ga0307515_10012396 Ga0307515_100123963 249
900 3300030522 Ga0307512_10072907 Ga0307512_100729073 249
901 3300031507 Ga0307509_10004345 Ga0307509_1000434515 249
902 3300031507 Ga0307509_10004938 Ga0307509_100049388 249
903 3300031616 Ga0307508_10000204 Ga0307508_1000020463 249
904 3300033179 Ga0307507_10314934 Ga0307507_103149342 249
905 3300033180 Ga0307510_10200140 Ga0307510_102001402 249
906 3300033180 Ga0307510_10216151 Ga0307510_102161511 249
907 3300035112 Ga0373932_0036826 Ga0373932_0036826_11_778 249
908 3300037068 Ga0373925_0084469 Ga0373925_0084469_751_1518 249
909 3300046454 Ga0495592_0000131 Ga0495592_0000131_25133_25900 249
910 3300046477 Ga0495664_0006494 Ga0495664_0006494_2770_3525 249
911 3300046524 Ga0495648_0189720 Ga0495648_0189720_146_913 249
912 3300046543 Ga0495645_0015453 Ga0495645_0015453_3554_4309 249
913 3300046680 Ga0495646_0095715 Ga0495646_0095715_574_1341 249
914 3300047317 Ga0495604_0186335 Ga0495604_0186335_533_1300 249
915 3300047321 Ga0495676_0059007 Ga0495676_0059007_317_1084 249
916 3300048924 Ga0496121_0181769 Ga0496121_0181769_233_1000 249
917 3300048926 Ga0496123_0029756 Ga0496123_0029756_484_1260 249
918 3300048929 Ga0496126_0499397 Ga0496126_0499397_161_928 249
919 3300053121 Ga0500607_056728 Ga0500607_056728_267_1061 249
920 3300005288 Ga0065714_10100060 Ga0065714_101000602 250
921 3300005328 Ga0070676_10027658 Ga0070676_100276584 250
922 3300005333 Ga0070677_10037564 Ga0070677_100375643 250
923 3300005334 Ga0068869_100044913 Ga0068869_1000449134 250
924 3300005334 Ga0068869_100068719 Ga0068869_1000687191 250
925 3300005334 Ga0068869_100161450 Ga0068869_1001614503 250
926 3300005338 Ga0068868_100035446 Ga0068868_1000354465 250
927 3300005340 Ga0070689_100226629 Ga0070689_1002266292 250
928 3300005354 Ga0070675_100002236 Ga0070675_1000022369 250
929 3300005364 Ga0070673_100014369 Ga0070673_1000143695 250
930 3300005455 Ga0070663_100162118 Ga0070663_1001621182 250
931 3300005457 Ga0070662_100128024 Ga0070662_1001280243 250
932 3300005459 Ga0068867_100008131 Ga0068867_1000081313 250
933 3300005459 Ga0068867_100220837 Ga0068867_1002208373 250
934 3300005467 Ga0070706_100002001 Ga0070706_10000200112 250
935 3300005468 Ga0070707_100050329 Ga0070707_1000503294 250
936 3300005471 Ga0070698_100058198 Ga0070698_1000581985 250
937 3300005518 Ga0070699_100096827 Ga0070699_1000968272 250
938 3300005539 Ga0068853_100075902 Ga0068853_1000759022 250
939 3300005539 Ga0068853_100150267 Ga0068853_1001502673 250
940 3300005543 Ga0070672_100007481 Ga0070672_1000074813 250
941 3300005548 Ga0070665_100313470 Ga0070665_1003134702 250
942 3300005548 Ga0070665_100432335 Ga0070665_1004323351 250
943 3300005577 Ga0068857_100010180 Ga0068857_1000101804 250
944 3300005577 Ga0068857_100246547 Ga0068857_1002465472 250
945 3300005578 Ga0068854_100063721 Ga0068854_1000637212 250
946 3300005618 Ga0068864_100482027 Ga0068864_1004820272 250
947 3300006051 Ga0075364_10057494 Ga0075364_100574942 250
948 3300006177 Ga0075362_10000208 Ga0075362_100002082 250
949 3300006178 Ga0075367_10029978 Ga0075367_100299784 250
950 3300006178 Ga0075367_10108540 Ga0075367_101085402 250
951 3300006186 Ga0075369_10000489 Ga0075369_100004898 250
952 3300006186 Ga0075369_10013822 Ga0075369_100138224 250
953 3300006195 Ga0075366_10000903 Ga0075366_100009038 250
954 3300006195 Ga0075366_10011740 Ga0075366_100117403 250
955 3300006195 Ga0075366_10094136 Ga0075366_100941362 250
956 3300006237 Ga0097621_100288772 Ga0097621_1002887722 250
957 3300006353 Ga0075370_10033785 Ga0075370_100337852 250
958 3300006353 Ga0075370_10088581 Ga0075370_100885812 250
959 3300006358 Ga0068871_100185673 Ga0068871_1001856732 250
960 3300006881 Ga0068865_100274460 Ga0068865_1002744601 250
961 3300009093 Ga0105240_10029724 Ga0105240_100297248 250
962 3300009098 Ga0105245_10049156 Ga0105245_100491564 250
963 3300009098 Ga0105245_10116403 Ga0105245_101164032 250
964 3300009148 Ga0105243_10016506 Ga0105243_100165062 250
965 3300009148 Ga0105243_10096992 Ga0105243_100969923 250
966 3300009174 Ga0105241_10444866 Ga0105241_104448662 250
967 3300009177 Ga0105248_10506674 Ga0105248_105066742 250
968 3300010375 Ga0105239_10015359 Ga0105239_100153592 250
969 3300013306 Ga0163162_10046903 Ga0163162_100469032 250
970 3300013308 Ga0157375_10043012 Ga0157375_100430124 250
971 3300014969 Ga0157376_10000620 Ga0157376_100006208 250
972 3300014969 Ga0157376_10391564 Ga0157376_103915642 250
973 3300015262 Ga0182007_10001181 Ga0182007_100011814 250
974 3300025907 Ga0207645_10006283 Ga0207645_100062839 250
975 3300025907 Ga0207645_10100894 Ga0207645_101008942 250
976 3300025910 Ga0207684_10019493 Ga0207684_100194936 250
977 3300025913 Ga0207695_10161880 Ga0207695_101618802 250
978 3300025918 Ga0207662_10226742 Ga0207662_102267422 250
979 3300025925 Ga0207650_10017844 Ga0207650_100178444 250
980 3300025926 Ga0207659_10017903 Ga0207659_100179034 250
981 3300025927 Ga0207687_10039339 Ga0207687_100393394 250
982 3300025927 Ga0207687_10097146 Ga0207687_100971462 250
983 3300025931 Ga0207644_10072269 Ga0207644_100722693 250
984 3300025932 Ga0207690_10277869 Ga0207690_102778692 250
985 3300025933 Ga0207706_10313136 Ga0207706_103131362 250
986 3300025935 Ga0207709_10018580 Ga0207709_100185804 250
987 3300025935 Ga0207709_10021645 Ga0207709_100216453 250
988 3300025935 Ga0207709_10272932 Ga0207709_102729322 250
989 3300025936 Ga0207670_10247690 Ga0207670_102476902 250
990 3300025940 Ga0207691_10003629 Ga0207691_100036293 250
991 3300025942 Ga0207689_10027056 Ga0207689_100270562 250
992 3300025960 Ga0207651_10019311 Ga0207651_100193112 250
993 3300025981 Ga0207640_10113777 Ga0207640_101137772 250
994 3300025981 Ga0207640_10169229 Ga0207640_101692292 250
995 3300025986 Ga0207658_10015535 Ga0207658_100155354 250
996 3300025986 Ga0207658_10042781 Ga0207658_100427813 250
997 3300026023 Ga0207677_10016985 Ga0207677_100169852 250
998 3300026041 Ga0207639_10196053 Ga0207639_101960532 250
999 3300026067 Ga0207678_10019795 Ga0207678_100197956 250
1000 3300026089 Ga0207648_10003368 Ga0207648_100033688 250
1001 3300026095 Ga0207676_10554062 Ga0207676_105540622 250
1002 3300026116 Ga0207674_10008463 Ga0207674_1000846314 250
1003 3300026116 Ga0207674_10132788 Ga0207674_101327883 250
1004 3300026116 Ga0207674_10237780 Ga0207674_102377802 250
1005 3300026118 Ga0207675_100323106 Ga0207675_1003231062 250
1006 3300026121 Ga0207683_10712067 Ga0207683_107120671 250
1007 3300026142 Ga0207698_10327107 Ga0207698_103271072 250
1008 3300027866 Ga0209813_10058807 Ga0209813_100588072 250
1009 3300028379 Ga0268266_10401158 Ga0268266_104011582 250
1010 3300028380 Ga0268265_10054227 Ga0268265_100542273 250
1011 3300028786 Ga0307517_10003316 Ga0307517_1000331611 250
1012 3300028786 Ga0307517_10130465 Ga0307517_101304653 250
1013 3300030522 Ga0307512_10118509 Ga0307512_101185092 250
1014 3300031456 Ga0307513_10026537 Ga0307513_100265373 250
1015 3300031456 Ga0307513_10049682 Ga0307513_100496824 250
1016 3300031616 Ga0307508_10025899 Ga0307508_100258992 250
1017 3300031649 Ga0307514_10242734 Ga0307514_102427342 250
1018 3300031730 Ga0307516_10123686 Ga0307516_101236862 250
1019 3300037312 Ga0395899_0002715 Ga0395899_0002715_10867_11652 250
1020 3300037418 Ga0395900_0061151 Ga0395900_0061151_2764_3549 250
1021 3300037466 Ga0395898_0268045 Ga0395898_0268045_331_1116 250
1022 3300037471 Ga0395905_0078758 Ga0395905_0078758_811_1596 250
1023 3300038443 Ga0395901_0037138 Ga0395901_0037138_1490_2275 250
1024 3300039447 Ga0436361_0694654 Ga0436361_0694654_2782_3552 250
1025 3300039450 Ga0436363_1512662 Ga0436363_1512662_547_1320 250
1026 3300042007 Ga0439449_0000970 Ga0439449_0000970_2001_2783 250
1027 3300046457 Ga0495590_0036138 Ga0495590_0036138_247_1005 250
1028 3300046472 Ga0495580_0009254 Ga0495580_0009254_1883_2644 250
1029 3300046475 Ga0495639_0001601 Ga0495639_0001601_3916_4671 250
1030 3300046515 Ga0495620_0102600 Ga0495620_0102600_197_955 250
1031 3300046660 Ga0495625_0153394 Ga0495625_0153394_152_910 250
1032 3300046692 Ga0495671_0112566 Ga0495671_0112566_300_1058 250
1033 3300046694 Ga0495649_0001466 Ga0495649_0001466_849_1607 250
1034 3300047443 Ga0495687_048175 Ga0495687_048175_225_983 250
1035 3300047443 Ga0495687_048178 Ga0495687_048178_847_1605 250
1036 3300048903 Ga0496100_0002213 Ga0496100_0002213_739_1494 250
1037 3300048904 Ga0496101_0001976 Ga0496101_0001976_3997_4752 250
1038 3300048905 Ga0496102_0015674 Ga0496102_0015674_5448_6203 250
1039 3300048907 Ga0496104_0015072 Ga0496104_0015072_5350_6105 250
1040 3300048908 Ga0496105_0000980 Ga0496105_0000980_18325_19080 250
1041 3300048909 Ga0496106_0212778 Ga0496106_0212778_324_1079 250
1042 3300048913 Ga0496110_0234732 Ga0496110_0234732_498_1253 250
1043 3300048914 Ga0496111_0056450 Ga0496111_0056450_729_1484 250
1044 3300050489 nmdc:mga03683_21009_c1 nmdc:mga03683_21009_c1_640_1398 250
1045 3300050491 nmdc:mga00v17_54408_c1 nmdc:mga00v17_54408_c1_1135_1893 250
1046 3300050493 nmdc:mga0k408_123429_c1 nmdc:mga0k408_123429_c1_689_1447 250
1047 3300050493 nmdc:mga0k408_152409_c1 nmdc:mga0k408_152409_c1_181_939 250
1048 3300050493 nmdc:mga0k408_1592_c1 nmdc:mga0k408_1592_c1_4284_5042 250
1049 3300050493 nmdc:mga0k408_174746_c1 nmdc:mga0k408_174746_c1_343_1101 250
1050 3300050493 nmdc:mga0k408_47816_c1 nmdc:mga0k408_47816_c1_854_1612 250
1051 3300050493 nmdc:mga0k408_5814_c1 nmdc:mga0k408_5814_c1_1150_1911 250
1052 3300050493 nmdc:mga0k408_5920_c1 nmdc:mga0k408_5920_c1_3432_4190 250
1053 3300050493 nmdc:mga0k408_8640_c1 nmdc:mga0k408_8640_c1_3988_4746 250
1054 3300050494 nmdc:mga06z11_35089_c1 nmdc:mga06z11_35089_c1_964_1722 250
1055 3300050496 nmdc:mga07m45_33368_c1 nmdc:mga07m45_33368_c1_1198_1956 250
1056 3300002773 JGI25152J39213_1003342 JGI25152J39213_10033422 251
1057 3300002774 JGI25150J39212_1005437 JGI25150J39212_10054372 251
1058 3300002987 JGI25159J45721_1003524 JGI25159J45721_10035242 251
1059 3300003187 JGI25151J46595_10007131 JGI25151J46595_100071312 251
1060 3300003215 JGI25153J46596_10007202 JGI25153J46596_100072022 251
1061 3300003354 JGI25160J50197_1005126 JGI25160J50197_10051262 251
1062 3300003374 JGI25161J50226_1002037 JGI25161J50226_10020372 251
1063 3300003771 Ga0055526_1007739 Ga0055526_10077392 251
1064 3300003773 Ga0055537_1002874 Ga0055537_10028742 251
1065 3300003775 Ga0055524_1005712 Ga0055524_10057122 251
1066 3300003784 Ga0055534_1003029 Ga0055534_10030292 251
1067 3300003792 Ga0055540_1012321 Ga0055540_10123213 251
1068 3300004625 Ga0055543_1002768 Ga0055543_10027688 251
1069 3300005262 Ga0065165_1007205 Ga0065165_10072058 251
1070 3300005548 Ga0070665_100047941 Ga0070665_1000479414 251
1071 3300015265 Ga0182005_1020136 Ga0182005_10201363 251
1072 3300025208 Ga0209436_105070 Ga0209436_1050702 251
1073 3300025245 Ga0207425_1000116 Ga0207425_100011642 251
1074 3300025258 Ga0209129_1000247 Ga0209129_10002477 251
1075 3300025263 Ga0209565_1000256 Ga0209565_100025650 251
1076 3300025273 Ga0209673_1000592 Ga0209673_100059250 251
1077 3300025284 Ga0209130_1001347 Ga0209130_100134714 251
1078 3300025291 Ga0209675_1000397 Ga0209675_10003977 251
1079 3300025294 Ga0209025_1000710 Ga0209025_10007107 251
1080 3300025295 Ga0209564_1000596 Ga0209564_100059650 251
1081 3300025297 Ga0209758_1002886 Ga0209758_100288614 251
1082 3300025299 Ga0209256_1000516 Ga0209256_100051650 251
1083 3300025302 Ga0207426_1000710 Ga0207426_10007107 251
1084 3300025303 Ga0209051_1008202 Ga0209051_10082028 251
1085 3300025304 Ga0209257_1004070 Ga0209257_10040709 251
1086 3300025937 Ga0207669_10050596 Ga0207669_100505962 251
1087 3300025960 Ga0207651_10426802 Ga0207651_104268021 251
1088 3300026121 Ga0207683_10394660 Ga0207683_103946602 251
1089 3300028379 Ga0268266_10063810 Ga0268266_100638104 251
1090 3300028379 Ga0268266_10215669 Ga0268266_102156692 251
1091 3300041452 Ga0451793_0179075 Ga0451793_0179075_398_1156 251
1092 3300046522 Ga0495643_0127991 Ga0495643_0127991_59_817 251
1093 3300046528 Ga0495642_0150825 Ga0495642_0150825_88_843 251
1094 3300046539 Ga0495621_0004801 Ga0495621_0004801_1694_2449 251
1095 3300046615 Ga0495656_0002510 Ga0495656_0002510_998_1753 251
1096 3300046675 Ga0495657_0177716 Ga0495657_0177716_484_1239 251
1097 3300047318 Ga0495636_0148694 Ga0495636_0148694_196_951 251
1098 3300048914 Ga0496111_0014555 Ga0496111_0014555_2651_3406 251
1099 3300049581 Ga0501047_0030621 Ga0501047_0030621_3550_4338 251
1100 2162886007 SwRhRL2b_contig_3866527 SwRhRL2b_0741.00001530 252
1101 3300001989 JGI24739J22299_10008256 JGI24739J22299_100082566 252
1102 3300002739 JGI25158J39367_1004694 JGI25158J39367_10046944 252
1103 3300002773 JGI25152J39213_1017840 JGI25152J39213_10178402 252
1104 3300002987 JGI25159J45721_1007582 JGI25159J45721_10075822 252
1105 3300003215 JGI25153J46596_10044762 JGI25153J46596_100447622 252
1106 3300003323 rootH1_10107676 rootH1_101076762 252
1107 3300003354 JGI25160J50197_1011694 JGI25160J50197_10116942 252
1108 3300003374 JGI25161J50226_1006710 JGI25161J50226_10067102 252
1109 3300003578 Ga0006562J51391_1082376 Ga0006562J51391_10823762 252
1110 3300003771 Ga0055526_1004888 Ga0055526_10048882 252
1111 3300003773 Ga0055537_1000024 Ga0055537_100002454 252
1112 3300003773 Ga0055537_1012606 Ga0055537_10126062 252
1113 3300003775 Ga0055524_1003526 Ga0055524_10035267 252
1114 3300003781 Ga0055536_1014327 Ga0055536_10143272 252
1115 3300003781 Ga0055536_1049137 Ga0055536_10491371 252
1116 3300003784 Ga0055534_1000032 Ga0055534_100003260 252
1117 3300003784 Ga0055534_1001127 Ga0055534_10011279 252
1118 3300003790 Ga0055528_1000328 Ga0055528_100032818 252
1119 3300003790 Ga0055528_1039347 Ga0055528_10393472 252
1120 3300003791 Ga0055530_10003037 Ga0055530_100030379 252
1121 3300003791 Ga0055530_10013538 Ga0055530_100135382 252
1122 3300003792 Ga0055540_1006668 Ga0055540_10066685 252
1123 3300003792 Ga0055540_1011758 Ga0055540_10117582 252
1124 3300003794 Ga0055531_10004992 Ga0055531_100049928 252
1125 3300003794 Ga0055531_10019085 Ga0055531_100190852 252
1126 3300005288 Ga0065714_10006056 Ga0065714_100060564 252
1127 3300005289 Ga0065704_10007833 Ga0065704_100078333 252
1128 3300005327 Ga0070658_10100066 Ga0070658_101000662 252
1129 3300005334 Ga0068869_100424591 Ga0068869_1004245912 252
1130 3300005339 Ga0070660_100194430 Ga0070660_1001944302 252
1131 3300005366 Ga0070659_100252257 Ga0070659_1002522572 252
1132 3300005457 Ga0070662_100174454 Ga0070662_1001744542 252
1133 3300005563 Ga0068855_100212698 Ga0068855_1002126982 252
1134 3300005564 Ga0070664_100014177 Ga0070664_1000141775 252
1135 3300005577 Ga0068857_100593434 Ga0068857_1005934342 252
1136 3300005578 Ga0068854_100059290 Ga0068854_1000592903 252
1137 3300005616 Ga0068852_100328895 Ga0068852_1003288952 252
1138 3300005844 Ga0068862_100091402 Ga0068862_1000914023 252
1139 3300006038 Ga0075365_10060275 Ga0075365_100602753 252
1140 3300006048 Ga0075363_100051911 Ga0075363_1000519113 252
1141 3300006051 Ga0075364_10004709 Ga0075364_100047092 252
1142 3300006058 Ga0075432_10043274 Ga0075432_100432742 252
1143 3300006177 Ga0075362_10009615 Ga0075362_100096151 252
1144 3300006177 Ga0075362_10053163 Ga0075362_100531632 252
1145 3300006177 Ga0075362_10186859 Ga0075362_101868591 252
1146 3300006195 Ga0075366_10021430 Ga0075366_100214303 252
1147 3300006195 Ga0075366_10068257 Ga0075366_100682573 252
1148 3300006195 Ga0075366_10068393 Ga0075366_100683932 252
1149 3300006195 Ga0075366_10197337 Ga0075366_101973372 252
1150 3300006353 Ga0075370_10000837 Ga0075370_1000083712 252
1151 3300006353 Ga0075370_10025648 Ga0075370_100256482 252
1152 3300006358 Ga0068871_100364000 Ga0068871_1003640002 252
1153 3300006948 Ga0099826_10000060 Ga0099826_1000006061 252
1154 3300009036 Ga0105244_10018258 Ga0105244_100182583 252
1155 3300009093 Ga0105240_10125834 Ga0105240_101258342 252
1156 3300009148 Ga0105243_10021385 Ga0105243_100213853 252
1157 3300009176 Ga0105242_10099359 Ga0105242_100993593 252
1158 3300009545 Ga0105237_10266053 Ga0105237_102660532 252
1159 3300009551 Ga0105238_10378973 Ga0105238_103789732 252
1160 3300010375 Ga0105239_10358473 Ga0105239_103584732 252
1161 3300012502 Ga0157347_1001548 Ga0157347_10015482 252
1162 3300012505 Ga0157339_1003962 Ga0157339_10039622 252
1163 3300013100 Ga0157373_10021915 Ga0157373_100219156 252
1164 3300013104 Ga0157370_10194426 Ga0157370_101944262 252
1165 3300013105 Ga0157369_10015236 Ga0157369_100152364 252
1166 3300013306 Ga0163162_10192024 Ga0163162_101920242 252
1167 3300013308 Ga0157375_10397693 Ga0157375_103976932 252
1168 3300014497 Ga0182008_10006022 Ga0182008_100060222 252
1169 3300014497 Ga0182008_10026429 Ga0182008_100264293 252
1170 3300014969 Ga0157376_11031760 Ga0157376_110317601 252
1171 3300015261 Ga0182006_1013692 Ga0182006_10136922 252
1172 3300015683 Ga0183362_10011 Ga0183362_1001172 252
1173 3300025208 Ga0209436_108800 Ga0209436_1088003 252
1174 3300025245 Ga0207425_1001669 Ga0207425_10016693 252
1175 3300025258 Ga0209129_1003795 Ga0209129_10037957 252
1176 3300025263 Ga0209565_1000039 Ga0209565_100003960 252
1177 3300025273 Ga0209673_1000284 Ga0209673_100028470 252
1178 3300025273 Ga0209673_1000731 Ga0209673_100073139 252
1179 3300025284 Ga0209130_1000366 Ga0209130_10003664 252
1180 3300025291 Ga0209675_1000030 Ga0209675_100003060 252
1181 3300025291 Ga0209675_1003937 Ga0209675_10039374 252
1182 3300025292 Ga0209676_1000048 Ga0209676_1000048269 252
1183 3300025292 Ga0209676_1000123 Ga0209676_1000123187 252
1184 3300025294 Ga0209025_1000432 Ga0209025_10004327 252
1185 3300025294 Ga0209025_1020385 Ga0209025_10203854 252
1186 3300025295 Ga0209564_1001056 Ga0209564_100105628 252
1187 3300025298 Ga0209050_1000012 Ga0209050_1000012269 252
1188 3300025298 Ga0209050_1000617 Ga0209050_100061715 252
1189 3300025299 Ga0209256_1000679 Ga0209256_100067940 252
1190 3300025302 Ga0207426_1000058 Ga0207426_100005876 252
1191 3300025303 Ga0209051_1000019 Ga0209051_1000019188 252
1192 3300025303 Ga0209051_1000221 Ga0209051_100022179 252
1193 3300025303 Ga0209051_1000777 Ga0209051_10007778 252
1194 3300025304 Ga0209257_1000024 Ga0209257_1000024215 252
1195 3300025304 Ga0209257_1000057 Ga0209257_1000057145 252
1196 3300025304 Ga0209257_1000451 Ga0209257_10004519 252
1197 3300025728 Ga0207655_1010745 Ga0207655_10107453 252
1198 3300025909 Ga0207705_10138089 Ga0207705_101380891 252
1199 3300025919 Ga0207657_10434891 Ga0207657_104348911 252
1200 3300025924 Ga0207694_10184045 Ga0207694_101840451 252
1201 3300025933 Ga0207706_10113494 Ga0207706_101134942 252
1202 3300025935 Ga0207709_10003200 Ga0207709_100032005 252
1203 3300025942 Ga0207689_10336481 Ga0207689_103364812 252
1204 3300025945 Ga0207679_10018847 Ga0207679_100188475 252
1205 3300025949 Ga0207667_10152304 Ga0207667_101523043 252
1206 3300025981 Ga0207640_10058242 Ga0207640_100582422 252
1207 3300026067 Ga0207678_10356855 Ga0207678_103568552 252
1208 3300027666 Ga0209282_1000934 Ga0209282_10009348 252
1209 3300027907 Ga0207428_10150283 Ga0207428_101502832 252
1210 3300028794 Ga0307515_10000195 Ga0307515_10000195138 252
1211 3300031251 Ga0265327_10003656 Ga0265327_1000365610 252
1212 3300031548 Ga0307408_100001218 Ga0307408_1000012183 252
1213 3300031548 Ga0307408_100060611 Ga0307408_1000606113 252
1214 3300031548 Ga0307408_100258553 Ga0307408_1002585532 252
1215 3300031649 Ga0307514_10012268 Ga0307514_100122686 252
1216 3300031731 Ga0307405_10042528 Ga0307405_100425282 252
1217 3300031901 Ga0307406_10001377 Ga0307406_100013774 252
1218 3300031911 Ga0307412_10091879 Ga0307412_100918793 252
1219 3300032005 Ga0307411_10136556 Ga0307411_101365563 252
1220 3300041404 Ga0439436_0007083 Ga0439436_0007083_1741_2499 252
1221 3300041411 Ga0439466_0026452 Ga0439466_0026452_349_1107 252
1222 3300041411 Ga0439466_0066266 Ga0439466_0066266_379_1137 252
1223 3300041413 Ga0439465_0018713 Ga0439465_0018713_795_1553 252
1224 3300041999 Ga0439433_0012982 Ga0439433_0012982_532_1290 252
1225 3300042000 Ga0439437_008148 Ga0439437_008148_359_1150 252
1226 3300042002 Ga0439442_006072 Ga0439442_006072_346_1104 252
1227 3300042006 Ga0439432_016992 Ga0439432_016992_358_1116 252
1228 3300042007 Ga0439449_0001676 Ga0439449_0001676_3092_3850 252
1229 3300042007 Ga0439449_0006540 Ga0439449_0006540_1970_2728 252
1230 3300042014 Ga0439457_022857 Ga0439457_022857_189_947 252
1231 3300042125 Ga0450923_005039 Ga0450923_005039_566_1324 252
1232 3300042133 Ga0450896_010426 Ga0450896_010426_80_838 252
1233 3300042145 Ga0450906_005442 Ga0450906_005442_434_1192 252
1234 3300042185 Ga0450909_023806 Ga0450909_023806_132_890 252
1235 3300042435 Ga0439434_0006287 Ga0439434_0006287_339_1097 252
1236 3300042435 Ga0439434_0015320 Ga0439434_0015320_1408_2199 252
1237 3300042439 Ga0439464_0007442 Ga0439464_0007442_1177_1968 252
1238 3300042531 Ga0450918_001794 Ga0450918_001794_1054_1812 252
1239 3300044842 Ga0466957_0169246 Ga0466957_0169246_22_813 252
1240 3300046453 Ga0495627_004816 Ga0495627_004816_904_1662 252
1241 3300046460 Ga0495638_0099373 Ga0495638_0099373_282_1040 252
1242 3300046512 Ga0495610_0036516 Ga0495610_0036516_1229_1987 252
1243 3300046513 Ga0495616_0002465 Ga0495616_0002465_11036_11794 252
1244 3300046515 Ga0495620_0011399 Ga0495620_0011399_3845_4603 252
1245 3300046518 Ga0495631_0000883 Ga0495631_0000883_11011_11769 252
1246 3300046520 Ga0495637_0004267 Ga0495637_0004267_3320_4078 252
1247 3300046530 Ga0495654_0034731 Ga0495654_0034731_1682_2440 252
1248 3300046536 Ga0495587_0140819 Ga0495587_0140819_106_864 252
1249 3300046538 Ga0495609_0036123 Ga0495609_0036123_293_1051 252
1250 3300046543 Ga0495645_0325545 Ga0495645_0325545_205_963 252
1251 3300046660 Ga0495625_0000146 Ga0495625_0000146_64341_65099 252
1252 3300046660 Ga0495625_0171897 Ga0495625_0171897_26_784 252
1253 3300046663 Ga0495635_0217440 Ga0495635_0217440_245_1003 252
1254 3300046674 Ga0495588_0024531 Ga0495588_0024531_345_1103 252
1255 3300046691 Ga0495670_0174833 Ga0495670_0174833_151_909 252
1256 3300046692 Ga0495671_0001267 Ga0495671_0001267_2954_3712 252
1257 3300047321 Ga0495676_0066877 Ga0495676_0066877_1281_2039 252
1258 3300047673 Ga0495593_0038193 Ga0495593_0038193_982_1740 252
1259 3300048088 Ga0495602_0163284 Ga0495602_0163284_927_1685 252
1260 3300048904 Ga0496101_0424783 Ga0496101_0424783_95_853 252
1261 3300048919 Ga0496116_0011992 Ga0496116_0011992_6267_7025 252
1262 3300048920 Ga0496117_0022148 Ga0496117_0022148_1386_2144 252
1263 3300048921 Ga0496118_0062498 Ga0496118_0062498_511_1269 252
1264 3300048924 Ga0496121_0195470 Ga0496121_0195470_603_1361 252
1265 3300048926 Ga0496123_0094591 Ga0496123_0094591_385_1143 252
1266 3300048927 Ga0496124_0069827 Ga0496124_0069827_320_1078 252
1267 3300048928 Ga0496125_0057514 Ga0496125_0057514_379_1137 252
1268 3300050489 nmdc:mga03683_18307_c1 nmdc:mga03683_18307_c1_1010_1768 252
1269 3300050489 nmdc:mga03683_73173_c1 nmdc:mga03683_73173_c1_522_1280 252
1270 3300050490 nmdc:mga03n38_23409_c1 nmdc:mga03n38_23409_c1_1678_2436 252
1271 3300050490 nmdc:mga03n38_3064_c1 nmdc:mga03n38_3064_c1_651_1409 252
1272 3300050492 nmdc:mga0yw44_3952_c1 nmdc:mga0yw44_3952_c1_691_1449 252
1273 3300050493 nmdc:mga0k408_102039_c1 nmdc:mga0k408_102039_c1_527_1285 252
1274 3300050493 nmdc:mga0k408_10609_c1 nmdc:mga0k408_10609_c1_1226_1984 252
1275 3300050493 nmdc:mga0k408_4859_c1 nmdc:mga0k408_4859_c1_5986_6744 252
1276 3300050496 nmdc:mga07m45_31684_c1 nmdc:mga07m45_31684_c1_140_898 252
1277 3300050496 nmdc:mga07m45_6733_c1 nmdc:mga07m45_6733_c1_1374_2132 252
1278 3300050496 nmdc:mga07m45_89296_c1 nmdc:mga07m45_89296_c1_228_986 252
1279 3300050516 nmdc:mga0sz30_37259_c1 nmdc:mga0sz30_37259_c1_1059_1817 252
1280 3300053079 Ga0500610_0023764 Ga0500610_0023764_1547_2305 252
1281 3300053079 Ga0500610_0025324 Ga0500610_0025324_1466_2224 252
1282 3300053087 Ga0500643_012300 Ga0500643_012300_527_1285 252
1283 3300053093 Ga0500651_0000468 Ga0500651_0000468_6475_7233 252
1284 3300053110 Ga0500571_000217 Ga0500571_000217_13428_14186 252
1285 3300053117 Ga0500593_000365 Ga0500593_000365_14495_15253 252
1286 3300053118 Ga0500594_0000278 Ga0500594_0000278_11111_11869 252
1287 3300053121 Ga0500607_000889 Ga0500607_000889_2110_2868 252
1288 3300053122 Ga0500608_004592 Ga0500608_004592_798_1556 252
1289 3300053122 Ga0500608_060948 Ga0500608_060948_288_1046 252
1290 3300053125 Ga0500618_058862 Ga0500618_058862_89_847 252
1291 3300053128 Ga0500626_004723 Ga0500626_004723_34_792 252
1292 3300053133 Ga0500655_000301 Ga0500655_000301_3185_3943 252
1293 3300053134 Ga0500658_0000470 Ga0500658_0000470_15138_15896 252
1294 3300053134 Ga0500658_0004473 Ga0500658_0004473_1347_2105 252
1295 3300053136 Ga0500559_0027912 Ga0500559_0027912_555_1313 252
1296 3300053138 Ga0500564_044553 Ga0500564_044553_551_1309 252
1297 3300053153 Ga0500616_0016583 Ga0500616_0016583_453_1211 252
1298 3300053158 Ga0500627_0002314 Ga0500627_0002314_4497_5255 252
1299 3300053161 Ga0500634_0007218 Ga0500634_0007218_2595_3353 252
1300 3300053162 Ga0500638_007998 Ga0500638_007998_2722_3480 252
1301 3300053177 Ga0500636_0003095 Ga0500636_0003095_926_1684 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

37

227

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8147 5 224
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7944 5 224
3fh6-assembly2.cif.gz_H crystal structure of the resting state maltose transporter from e. coli 0.745 29 173
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.706 2 218
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6876 3 218
ID Description Score Start End Superfamily
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8464 4 229 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.836 4 229 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8327 8 227 1.10.3720.10
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8249 26 225 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8236 21 226 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2J5PXE5-F1-model_v4 Amino acid ABC transporter permease 0.9418 1 163 GO:0006865
GO:0022857
GO:0043190
AF-A0A336QLQ4-F1-model_v4 deleted 0.9364 5 165
AF-A0A378A824-F1-model_v4 Glutamate transport membrane-spanning protein 0.9321 1 168 GO:0006865
GO:0022857
GO:0043190
AF-A0A2J5PXE5-F1-model_v4 Amino acid ABC transporter permease 0.9308 1 163 GO:0006865
GO:0022857
GO:0043190
AF-X0SP61-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9167 1 174 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
77 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map