F492688

General Info

Members Datasets Scaffolds Average Seq Length
1296 649 1084 262

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10030239|Ga0081455_100302394
Length 261
Sequence MPSSPQKVALVTGAARGIGLATAKRFLAEGWKVALLDIEGELLHGAVAGLADPDNTLALHCDVSDAGAVANAISALNARFGRLDALVNNAGIAVFAPLLDTSDQDWSRILAVNLSGPFICTKAAAPLLREQGGAIVNITSISAVRASTLRSAYGTSKAGLAHLTKQLAVELASLGIRVNAVAPGPVETAMAKQVHTPEIRADYHDAIPLNRYGLEEELAEAIFFLCSERASYITGQILAVDGGFDAAGIGLPTLRGQRRNG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2791355199
32 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
35 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
36 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
37 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
38 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
39 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
40 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
43 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
47 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
48 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
49 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
50 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
51 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
52 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
53 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
54 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
64 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
65 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
66 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
67 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
68 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
69 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
70 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
71 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
72 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
73 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
74 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
75 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
76 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
77 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
78 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
85 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
86 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
89 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
90 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
91 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
92 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
93 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
94 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
95 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
96 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
97 2906610324
98 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
99 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
100 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
101 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
102 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
103 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
104 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
105 2922368715
106 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
107 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
108 2922425934
109 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
110 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
111 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
112 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
113 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
114 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
115 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
116 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
117 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
118 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
119 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
120 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
121 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
122 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
123 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
124 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
125 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
126 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
127 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
128 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
129 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
130 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
131 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
132 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
133 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
134 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
135 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
136 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
137 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
138 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
139 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
140 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
141 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
142 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
143 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
144 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
145 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
146 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
147 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
148 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
149 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
150 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
151 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
152 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
153 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
154 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
155 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
156 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
157 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
158 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
159 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
160 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
161 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
162 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
163 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
164 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
165 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
166 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
167 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
168 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
169 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
170 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
171 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
172 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
173 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
174 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
175 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
176 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
177 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
178 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
179 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
180 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
181 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
182 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
183 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
185 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
186 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
187 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
188 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
189 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
190 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
191 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
192 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
193 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
194 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
195 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
196 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
197 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
198 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
199 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
200 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
201 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
202 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
203 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
204 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
205 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
208 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
209 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
210 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
211 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
212 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
213 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
214 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
217 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
218 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
219 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
220 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
221 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
222 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
223 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
224 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
225 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
226 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
227 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
228 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
229 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
230 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
231 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
232 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
233 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
234 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
235 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
243 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
244 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
245 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
248 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
249 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
251 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
252 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
253 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
254 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
255 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
256 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
257 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
258 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
259 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
260 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
261 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
262 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
263 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
264 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
265 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
266 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
267 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
268 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
269 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
270 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
271 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
272 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
273 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
274 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
275 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
276 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
277 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
278 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
279 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
280 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
281 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
282 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
283 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
284 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
285 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
286 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
289 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
292 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
293 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
344 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
345 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
346 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
347 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
349 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
350 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
353 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
354 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
355 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
356 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
357 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
358 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
359 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
360 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
361 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
362 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
363 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
364 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
365 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
366 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
367 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
368 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
369 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
370 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
371 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
372 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
373 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
374 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
375 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
376 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
377 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
378 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
379 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
380 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
381 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
382 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
383 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
384 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
385 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
386 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
387 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
388 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
389 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
390 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
391 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
392 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
393 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
394 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
395 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
396 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
397 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
398 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
399 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
400 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
401 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
402 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
403 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
404 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
405 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
406 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
407 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
408 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
409 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
410 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
411 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
412 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
413 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
414 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
415 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
416 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
417 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
418 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
419 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
420 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
421 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
422 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
423 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
424 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
425 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
426 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
427 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
428 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
429 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
430 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
431 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
432 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
433 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
434 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
435 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
436 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
437 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
438 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
439 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
440 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
445 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
446 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
447 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
448 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
449 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
450 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
451 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
452 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
455 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
456 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
457 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
458 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
459 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
462 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
463 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
464 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
465 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
466 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
467 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
468 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
469 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
470 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
471 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
472 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
473 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
474 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
475 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
478 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
479 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
484 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
485 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
486 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
487 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
488 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
489 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
490 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
491 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
492 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
493 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
494 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
495 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
496 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
497 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
498 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
499 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
500 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
501 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
502 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
503 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
504 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
505 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
506 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
507 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
508 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
509 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
510 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
511 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
512 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
513 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
514 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
515 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
516 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
517 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
518 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
519 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
520 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
521 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
522 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
523 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
524 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
532 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
533 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
534 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
535 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
536 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
537 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
538 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
539 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
540 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
541 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
542 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
543 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
544 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
547 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
548 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
549 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
550 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
551 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
552 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
553 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
554 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
555 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
556 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
557 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
558 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
559 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
560 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
561 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
562 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
563 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
564 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
565 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
566 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
567 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
568 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
569 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
570 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
571 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
572 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
573 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
574 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
575 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
576 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
577 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
578 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
579 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
580 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
581 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
582 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
583 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
584 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
585 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
586 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
587 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
588 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
589 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
590 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
591 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
592 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
593 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
594 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
595 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
596 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
597 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
598 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
599 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
600 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
601 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
602 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
603 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
604 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
605 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
606 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
607 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
608 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
609 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
610 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
611 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
612 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
613 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
614 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
615 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
616 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
617 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
618 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
619 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
620 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
621 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
622 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
623 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
624 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
625 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
626 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
627 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
628 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
629 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
630 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
631 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
632 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
633 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
634 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
635 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
636 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
637 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
638 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
639 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
640 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
641 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
642 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
643 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
644 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
645 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
646 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
647 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
648 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
649 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.75
Metatranscriptomes 0.15
Isolates 16.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.43
Nodule 12.96
Rhizoplane 5.4
Rhizosphere 59.1
Stem 0
Stem Tuber 0
Unclassified 9.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10002347 3300001990 Bacteria 6747
2 JGI24738J21930_10034940 3300002075 Bacteria 1024
3 JGI25406J46586_10007816 3300003203 Bacteria 4864
4 JGI25406J46586_10008897 3300003203 Bacteria 4519
5 JGI25406J46586_10087741 3300003203 Bacteria 943
6 JGI25153J46596_10002507 3300003215 Bacteria 10538
7 JGI25153J46596_10002543 3300003215 Bacteria 10454
8 JGI25153J46596_10014752 3300003215 Bacteria 3229
9 JGI25153J46596_10019384 3300003215 Bacteria 2609
10 JGI25153J46596_10037348 3300003215 Bacteria 1545
11 JGI25160J50197_1001353 3300003354 Bacteria 12340
12 JGI25160J50197_1001493 3300003354 Bacteria 11619
13 JGI25160J50197_1022712 3300003354 Bacteria 1832
14 JGI25404J52841_10006534 3300003659 Bacteria 2446
15 JGI25404J52841_10014112 3300003659 Bacteria 1732
16 JGI25404J52841_10016780 3300003659 Bacteria 1588
17 Ga0055526_1024692 3300003771 Bacteria 1956
18 Ga0055531_10001939 3300003794 Bacteria 14453
19 Ga0055543_1004643 3300004625 Bacteria 3684
20 Ga0065165_1001641 3300005262 Bacteria 22770
21 Ga0065165_1003060 3300005262 Bacteria 12519
22 Ga0065165_1006123 3300005262 Bacteria 6438
23 Ga0065165_1010912 3300005262 Bacteria 3863
24 Ga0070676_10231611 3300005328 Bacteria 1225
25 Ga0070683_100002138 3300005329 Bacteria 15616
26 Ga0070683_100060360 3300005329 Bacteria 3524
27 Ga0070683_100103534 3300005329 Bacteria 2682
28 Ga0068869_100018734 3300005334 Bacteria 4718
29 Ga0068869_100242509 3300005334 Bacteria 1436
30 Ga0070666_10237029 3300005335 Bacteria 1289
31 Ga0070680_100001388 3300005336 Bacteria 17507
32 Ga0070680_100019162 3300005336 Bacteria 5420
33 Ga0070682_100447038 3300005337 Bacteria 989
34 Ga0068868_100051877 3300005338 Bacteria 3228
35 Ga0070691_10000536 3300005341 Bacteria 14322
36 Ga0070691_10176035 3300005341 Bacteria 1111
37 Ga0070661_100106670 3300005344 Bacteria 2089
38 Ga0070668_100030574 3300005347 Bacteria 4094
39 Ga0070668_100077506 3300005347 Bacteria 2598
40 Ga0070668_100287654 3300005347 Bacteria 1375
41 Ga0070675_100209354 3300005354 Bacteria 1695
42 Ga0070671_100026992 3300005355 Bacteria 4724
43 Ga0070671_100172984 3300005355 Bacteria 1827
44 Ga0070709_10006354 3300005434 Bacteria 6434
45 Ga0070709_10015776 3300005434 Bacteria 4302
46 Ga0070709_10135589 3300005434 Bacteria 1686
47 Ga0070714_100046252 3300005435 Bacteria 3691
48 Ga0070713_100001186 3300005436 Bacteria 16637
49 Ga0070713_100245356 3300005436 Bacteria 1632
50 Ga0070710_10223903 3300005437 Bacteria 1198
51 Ga0070711_100011149 3300005439 Bacteria 5575
52 Ga0070711_100048169 3300005439 Bacteria 2912
53 Ga0070711_100081742 3300005439 Bacteria 2303
54 Ga0070700_100144401 3300005441 Bacteria 1620
55 Ga0070663_100023603 3300005455 Bacteria 4124
56 Ga0070663_100082812 3300005455 Bacteria 2361
57 Ga0070663_100161409 3300005455 Bacteria 1725
58 Ga0070663_100178475 3300005455 Bacteria 1646
59 Ga0070678_100165551 3300005456 Bacteria 1796
60 Ga0070678_100197907 3300005456 Bacteria 1656
61 Ga0070662_100084789 3300005457 Bacteria 2367
62 Ga0070662_100124102 3300005457 Bacteria 1982
63 Ga0070681_10017662 3300005458 Bacteria 7129
64 Ga0070681_10024432 3300005458 Bacteria 6084
65 Ga0070681_10039710 3300005458 Bacteria 4716
66 Ga0070681_10057575 3300005458 Bacteria 3867
67 Ga0070681_10376412 3300005458 Bacteria 1330
68 Ga0068867_100148114 3300005459 Bacteria 1841
69 Ga0070699_100199189 3300005518 Bacteria 1780
70 Ga0070679_100003503 3300005530 Bacteria 14373
71 Ga0070679_100027556 3300005530 Bacteria 5593
72 Ga0070679_100147698 3300005530 Bacteria 2328
73 Ga0070679_100150437 3300005530 Bacteria 2304
74 Ga0070679_100174492 3300005530 Bacteria 2122
75 Ga0070679_100363504 3300005530 Bacteria 1394
76 Ga0070684_100001913 3300005535 Bacteria 15266
77 Ga0070684_100599759 3300005535 Bacteria 1024
78 Ga0070697_100060642 3300005536 Bacteria 3084
79 Ga0068853_100067183 3300005539 Bacteria 3114
80 Ga0068853_100097547 3300005539 Bacteria 2595
81 Ga0068853_100109439 3300005539 Bacteria 2452
82 Ga0068853_100528437 3300005539 Bacteria 1116
83 Ga0070665_100010041 3300005548 Bacteria 9577
84 Ga0070665_100104669 3300005548 Bacteria 2832
85 Ga0070665_100277172 3300005548 Bacteria 1679
86 Ga0070665_100307099 3300005548 Bacteria 1590
87 Ga0068855_100060900 3300005563 Bacteria 4411
88 Ga0068855_100181234 3300005563 Bacteria 2381
89 Ga0068855_100195710 3300005563 Bacteria 2278
90 Ga0068855_100220936 3300005563 Bacteria 2125
91 Ga0068855_100238531 3300005563 Bacteria 2033
92 Ga0070664_100113592 3300005564 Bacteria 2366
93 Ga0068857_100010136 3300005577 Bacteria 8189
94 Ga0068857_100103325 3300005577 Bacteria 2558
95 Ga0068857_100481631 3300005577 Bacteria 1163
96 Ga0068854_100393596 3300005578 Bacteria 1145
97 Ga0068856_100000055 3300005614 Bacteria 104152
98 Ga0068856_100124570 3300005614 Bacteria 2580
99 Ga0068852_100008698 3300005616 Bacteria 7503
100 Ga0068852_100016131 3300005616 Bacteria 5815
101 Ga0068852_100264694 3300005616 Bacteria 1652
102 Ga0068852_100357358 3300005616 Bacteria 1428
103 Ga0068859_100051912 3300005617 Bacteria 4122
104 Ga0068864_100096411 3300005618 Bacteria 2617
105 Ga0068864_100164489 3300005618 Bacteria 2019
106 Ga0068861_100048762 3300005719 Bacteria 3203
107 Ga0068861_100108102 3300005719 Bacteria 2224
108 Ga0068851_10003461 3300005834 Bacteria 7024
109 Ga0068851_10030046 3300005834 Bacteria 2693
110 Ga0068863_100252184 3300005841 Bacteria 1705
111 Ga0068863_100420327 3300005841 Bacteria 1309
112 Ga0068858_100169787 3300005842 Bacteria 2056
113 Ga0068858_100346960 3300005842 Bacteria 1421
114 Ga0068860_100127658 3300005843 Bacteria 2438
115 Ga0068860_100168421 3300005843 Bacteria 2115
116 Ga0068862_100151120 3300005844 Bacteria 2067
117 Ga0081455_10002785 3300005937 Bacteria 20594
118 Ga0081455_10005206 3300005937 Bacteria 14308
119 Ga0081455_10026606 3300005937 Bacteria 5315
120 Ga0081455_10030239 3300005937 Bacteria 4923
121 Ga0081455_10056015 3300005937 Bacteria 3350
122 Ga0081538_10022448 3300005981 Bacteria 4571
123 Ga0081540_1001339 3300005983 Bacteria 21460
124 Ga0081540_1002098 3300005983 Bacteria 16595
125 Ga0081540_1005216 3300005983 Bacteria 9725
126 Ga0081540_1006379 3300005983 Bacteria 8601
127 Ga0081540_1007306 3300005983 Bacteria 7903
128 Ga0081540_1012638 3300005983 Bacteria 5539
129 Ga0081540_1015748 3300005983 Bacteria 4771
130 Ga0081539_10000848 3300005985 Bacteria 58499
131 Ga0081539_10000950 3300005985 Bacteria 54335
132 Ga0081539_10012348 3300005985 Bacteria 6599
133 Ga0070717_10000460 3300006028 Bacteria 25862
134 Ga0070717_10050992 3300006028 Bacteria 3404
135 Ga0070717_10637808 3300006028 Bacteria 967
136 Ga0075365_10005251 3300006038 Bacteria 6967
137 Ga0075365_10182955 3300006038 Bacteria 1465
138 Ga0075365_10438560 3300006038 Bacteria 922
139 Ga0075368_10003948 3300006042 Bacteria 4995
140 Ga0075368_10039890 3300006042 Bacteria 1842
141 Ga0075363_100005438 3300006048 Bacteria 5665
142 Ga0075363_100021367 3300006048 Bacteria 3259
143 Ga0075363_100042092 3300006048 Bacteria 2412
144 Ga0075363_100043180 3300006048 Bacteria 2384
145 Ga0075364_10020794 3300006051 Bacteria 4130
146 Ga0075364_10110313 3300006051 Bacteria 1835
147 Ga0070712_100047202 3300006175 Bacteria 2980
148 Ga0070712_100069796 3300006175 Bacteria 2508
149 Ga0075362_10003691 3300006177 Bacteria 5405
150 Ga0075362_10062546 3300006177 Bacteria 1686
151 Ga0075362_10089718 3300006177 Bacteria 1426
152 Ga0075367_10004454 3300006178 Bacteria 6842
153 Ga0075367_10094223 3300006178 Bacteria 1825
154 Ga0075367_10140573 3300006178 Bacteria 1495
155 Ga0075367_10158117 3300006178 Bacteria 1409
156 Ga0075367_10205194 3300006178 Bacteria 1232
157 Ga0075367_10244491 3300006178 Bacteria 1125
158 Ga0075369_10000317 3300006186 Bacteria 14378
159 Ga0075369_10067389 3300006186 Bacteria 1571
160 Ga0075369_10078965 3300006186 Bacteria 1457
161 Ga0075369_10080358 3300006186 Bacteria 1445
162 Ga0075369_10183604 3300006186 Bacteria 963
163 Ga0075366_10015532 3300006195 Bacteria 4368
164 Ga0075366_10032143 3300006195 Bacteria 3089
165 Ga0097621_100160495 3300006237 Bacteria 1932
166 Ga0097621_100382136 3300006237 Bacteria 1258
167 Ga0075370_10024383 3300006353 Bacteria 3340
168 Ga0075370_10028738 3300006353 Bacteria 3092
169 Ga0075370_10039851 3300006353 Bacteria 2648
170 Ga0075434_100006248 3300006871 Bacteria 10910
171 Ga0068865_100427112 3300006881 Bacteria 1091
172 Ga0097620_100051911 3300006931 Bacteria 4122
173 Ga0099824_1012218 3300006942 Bacteria 9445
174 Ga0099822_1020991 3300006943 Bacteria 6383
175 Ga0099794_10025633 3300007265 Bacteria 2719
176 Ga0105240_10004901 3300009093 Bacteria 20151
177 Ga0105240_10016877 3300009093 Bacteria 9867
178 Ga0105240_10028049 3300009093 Bacteria 7362
179 Ga0105240_10047216 3300009093 Bacteria 5450
180 Ga0105240_10060225 3300009093 Bacteria 4733
181 Ga0105240_10143116 3300009093 Bacteria 2857
182 Ga0105240_10275726 3300009093 Bacteria 1934
183 Ga0111539_10175434 3300009094 Bacteria 2504
184 Ga0111539_10313290 3300009094 Bacteria 1826
185 Ga0105245_10010180 3300009098 Bacteria 8188
186 Ga0105245_10027248 3300009098 Bacteria 5035
187 Ga0105245_10030782 3300009098 Bacteria 4746
188 Ga0105245_10149162 3300009098 Bacteria 2209
189 Ga0105245_10773911 3300009098 Bacteria 997
190 Ga0114129_11019987 3300009147 Bacteria 1041
191 Ga0105243_10189133 3300009148 Bacteria 1797
192 Ga0105241_10010434 3300009174 Bacteria 6817
193 Ga0105241_10016990 3300009174 Bacteria 5340
194 Ga0105241_10027975 3300009174 Bacteria 4198
195 Ga0105241_10111787 3300009174 Bacteria 2188
196 Ga0105248_10099912 3300009177 Bacteria 3269
197 Ga0105248_10907454 3300009177 Bacteria 995
198 Ga0105237_10003690 3300009545 Bacteria 18050
199 Ga0105237_10018023 3300009545 Bacteria 7315
200 Ga0105237_10081744 3300009545 Bacteria 3222
201 Ga0105237_10111094 3300009545 Bacteria 2733
202 Ga0105237_10738019 3300009545 Bacteria 991
203 Ga0105238_10038154 3300009551 Bacteria 4880
204 Ga0105238_10123401 3300009551 Bacteria 2569
205 Ga0105238_10250775 3300009551 Bacteria 1748
206 Ga0105238_10269569 3300009551 Bacteria 1683
207 Ga0105249_10480820 3300009553 Bacteria 1285
208 Ga0105239_10015287 3300010375 Bacteria 8506
209 Ga0105239_10018873 3300010375 Bacteria 7619
210 Ga0105239_10049562 3300010375 Bacteria 4605
211 Ga0105239_10096921 3300010375 Bacteria 3259
212 Ga0105239_10111724 3300010375 Bacteria 3030
213 Ga0105239_10188800 3300010375 Bacteria 2307
214 Ga0105239_10317477 3300010375 Bacteria 1756
215 Ga0105246_10005026 3300011119 Bacteria 8045
216 Ga0105246_10017226 3300011119 Bacteria 4592
217 Ga0105246_10562493 3300011119 Bacteria 979
218 Ga0157371_10421709 3300013102 Bacteria 978
219 Ga0157370_10167354 3300013104 Bacteria 2044
220 Ga0157370_10180275 3300013104 Bacteria 1963
221 Ga0157369_10016812 3300013105 Bacteria 8222
222 Ga0157369_10037771 3300013105 Bacteria 5286
223 Ga0157369_10074657 3300013105 Bacteria 3636
224 Ga0157369_10086808 3300013105 Bacteria 3341
225 Ga0157374_10028177 3300013296 Bacteria 5072
226 Ga0157374_10053183 3300013296 Bacteria 3774
227 Ga0157374_10169641 3300013296 Bacteria 2128
228 Ga0157378_10232441 3300013297 Bacteria 1758
229 Ga0163162_10126279 3300013306 Bacteria 2664
230 Ga0163162_10232701 3300013306 Bacteria 1973
231 Ga0157372_10812022 3300013307 Bacteria 1086
232 Ga0157375_10081867 3300013308 Bacteria 3269
233 Ga0182008_10179028 3300014497 Bacteria 1072
234 Ga0157377_10071003 3300014745 Bacteria 2012
235 Ga0157377_10262661 3300014745 Bacteria 1124
236 Ga0157376_10023264 3300014969 Bacteria 4847
237 Ga0157376_10083788 3300014969 Bacteria 2744
238 Ga0157376_10401182 3300014969 Bacteria 1326
239 Ga0206354_11243179 3300020081 Bacteria 1652
240 Ga0206353_11151056 3300020082 Bacteria 2367
241 Ga0214544_1000005 3300021320 Bacteria 387675
242 Ga0214542_1000004 3300021321 Bacteria 415597
243 Ga0214545_1000005 3300021324 Bacteria 415590
244 Ga0214543_1000111 3300021327 Bacteria 106517
245 Ga0213873_10023750 3300021358 Bacteria 1465
246 Ga0213872_10060892 3300021361 Bacteria 1707
247 Ga0213876_10031811 3300021384 Bacteria 2783
248 Ga0213875_10116771 3300021388 Bacteria 1247
249 Ga0209677_106835 3300025253 Bacteria 2595
250 Ga0209148_1000235 3300025254 Bacteria 90398
251 Ga0209148_1013088 3300025254 Bacteria 1499
252 Ga0209233_1002060 3300025261 Bacteria 7618
253 Ga0209233_1003872 3300025261 Bacteria 5205
254 Ga0209233_1010292 3300025261 Bacteria 2810
255 Ga0209455_1000637 3300025272 Bacteria 21523
256 Ga0209455_1004708 3300025272 Bacteria 4389
257 Ga0209675_1003389 3300025291 Bacteria 7595
258 Ga0209564_1000755 3300025295 Bacteria 45779
259 Ga0209564_1005342 3300025295 Bacteria 7373
260 Ga0209564_1013065 3300025295 Bacteria 3557
261 Ga0209758_1000102 3300025297 Bacteria 224851
262 Ga0209758_1000580 3300025297 Bacteria 57122
263 Ga0209758_1000680 3300025297 Bacteria 50663
264 Ga0209758_1002859 3300025297 Bacteria 16761
265 Ga0209758_1003592 3300025297 Bacteria 13874
266 Ga0209758_1003725 3300025297 Bacteria 13511
267 Ga0209758_1008851 3300025297 Bacteria 6405
268 Ga0209758_1018366 3300025297 Bacteria 3429
269 Ga0209758_1037504 3300025297 Bacteria 1872
270 Ga0209256_1004953 3300025299 Bacteria 7982
271 Ga0209256_1035119 3300025299 Bacteria 1327
272 Ga0207426_1000532 3300025302 Bacteria 54755
273 Ga0207426_1002013 3300025302 Bacteria 14342
274 Ga0207426_1009466 3300025302 Bacteria 3852
275 Ga0209051_1044393 3300025303 Bacteria 1548
276 Ga0209051_1047917 3300025303 Bacteria 1454
277 Ga0209257_1003378 3300025304 Bacteria 13780
278 Ga0209257_1006352 3300025304 Bacteria 7675
279 Ga0207653_10041455 3300025885 Bacteria 1512
280 Ga0207642_10043735 3300025899 Bacteria 1978
281 Ga0207688_10046651 3300025901 Bacteria 2420
282 Ga0207680_10135522 3300025903 Bacteria 1627
283 Ga0207647_10001253 3300025904 Bacteria 19532
284 Ga0207699_10019382 3300025906 Bacteria 3626
285 Ga0207699_10036666 3300025906 Bacteria 2797
286 Ga0207645_10104474 3300025907 Bacteria 1829
287 Ga0207705_10048614 3300025909 Bacteria 3051
288 Ga0207705_10138983 3300025909 Bacteria 1813
289 Ga0207684_10150476 3300025910 Bacteria 2003
290 Ga0207654_10004638 3300025911 Bacteria 6941
291 Ga0207654_10017841 3300025911 Bacteria 3718
292 Ga0207707_10001016 3300025912 Bacteria 26912
293 Ga0207707_10019818 3300025912 Bacteria 5872
294 Ga0207707_10032842 3300025912 Bacteria 4542
295 Ga0207695_10000006 3300025913 Bacteria 1135309
296 Ga0207695_10007711 3300025913 Bacteria 13630
297 Ga0207695_10054420 3300025913 Bacteria 4179
298 Ga0207695_10067753 3300025913 Bacteria 3660
299 Ga0207695_10403698 3300025913 Bacteria 1251
300 Ga0207671_10014887 3300025914 Bacteria 6118
301 Ga0207671_10031054 3300025914 Bacteria 3983
302 Ga0207671_10071058 3300025914 Bacteria 2596
303 Ga0207671_10118439 3300025914 Bacteria 2022
304 Ga0207693_10009325 3300025915 Bacteria 8001
305 Ga0207693_10051019 3300025915 Bacteria 3248
306 Ga0207693_10060539 3300025915 Bacteria 2966
307 Ga0207663_10026393 3300025916 Bacteria 3371
308 Ga0207663_10206671 3300025916 Bacteria 1420
309 Ga0207660_10000924 3300025917 Bacteria 19378
310 Ga0207660_10427726 3300025917 Bacteria 1069
311 Ga0207657_10001391 3300025919 Bacteria 25799
312 Ga0207657_10427382 3300025919 Bacteria 1041
313 Ga0207649_10050880 3300025920 Bacteria 2564
314 Ga0207649_10073277 3300025920 Bacteria 2193
315 Ga0207652_10003893 3300025921 Bacteria 12209
316 Ga0207652_10004944 3300025921 Bacteria 10792
317 Ga0207652_10025815 3300025921 Bacteria 4888
318 Ga0207694_10195440 3300025924 Bacteria 1645
319 Ga0207694_10343030 3300025924 Bacteria 1235
320 Ga0207650_10172532 3300025925 Bacteria 1719
321 Ga0207687_10008945 3300025927 Bacteria 6546
322 Ga0207687_10189937 3300025927 Bacteria 1598
323 Ga0207700_10034028 3300025928 Bacteria 3653
324 Ga0207700_10127505 3300025928 Bacteria 2073
325 Ga0207644_10098468 3300025931 Bacteria 2192
326 Ga0207644_10166234 3300025931 Bacteria 1719
327 Ga0207644_10505516 3300025931 Bacteria 997
328 Ga0207706_10169512 3300025933 Bacteria 1918
329 Ga0207709_10134404 3300025935 Bacteria 1691
330 Ga0207665_10023296 3300025939 Bacteria 4078
331 Ga0207691_10562018 3300025940 Bacteria 967
332 Ga0207711_10058971 3300025941 Bacteria 3304
333 Ga0207711_10122248 3300025941 Bacteria 2325
334 Ga0207711_10269056 3300025941 Bacteria 1568
335 Ga0207689_10051839 3300025942 Bacteria 3383
336 Ga0207689_10202100 3300025942 Bacteria 1640
337 Ga0207661_10000421 3300025944 Bacteria 27342
338 Ga0207661_10127181 3300025944 Bacteria 2177
339 Ga0207661_10431918 3300025944 Bacteria 1197
340 Ga0207667_10015694 3300025949 Bacteria 8591
341 Ga0207667_10039623 3300025949 Bacteria 5021
342 Ga0207667_10300169 3300025949 Bacteria 1641
343 Ga0207667_10528887 3300025949 Bacteria 1194
344 Ga0207668_10257093 3300025972 Bacteria 1421
345 Ga0207658_10114099 3300025986 Bacteria 2142
346 Ga0207677_10056882 3300026023 Bacteria 2682
347 Ga0207639_10022760 3300026041 Bacteria 4517
348 Ga0207639_10038860 3300026041 Bacteria 3542
349 Ga0207639_10149330 3300026041 Bacteria 1956
350 Ga0207639_10226714 3300026041 Bacteria 1617
351 Ga0207678_10004216 3300026067 Bacteria 12904
352 Ga0207678_10017767 3300026067 Bacteria 6244
353 Ga0207678_10025952 3300026067 Bacteria 5112
354 Ga0207678_10033530 3300026067 Bacteria 4472
355 Ga0207678_10062172 3300026067 Bacteria 3211
356 Ga0207678_10083309 3300026067 Bacteria 2735
357 Ga0207678_10199184 3300026067 Bacteria 1712
358 Ga0207678_10260106 3300026067 Bacteria 1487
359 Ga0207678_10538291 3300026067 Bacteria 1021
360 Ga0207708_10144256 3300026075 Bacteria 1870
361 Ga0207702_10002502 3300026078 Bacteria 17348
362 Ga0207702_10151077 3300026078 Bacteria 2112
363 Ga0207641_10115607 3300026088 Bacteria 2386
364 Ga0207648_10214427 3300026089 Bacteria 1710
365 Ga0207676_10161141 3300026095 Bacteria 1943
366 Ga0207674_10016173 3300026116 Bacteria 8171
367 Ga0207674_10051452 3300026116 Bacteria 4203
368 Ga0207675_100092259 3300026118 Bacteria 2848
369 Ga0207683_10057608 3300026121 Bacteria 3410
370 Ga0207683_10242336 3300026121 Bacteria 1645
371 Ga0207698_10163292 3300026142 Bacteria 1951
372 Ga0207698_10280893 3300026142 Bacteria 1540
373 Ga0209389_1000021 3300027296 Bacteria 169506
374 Ga0209389_1000120 3300027296 Bacteria 70535
375 Ga0209589_1000005 3300027357 Bacteria 530958
376 Ga0209589_1000027 3300027357 Bacteria 155295
377 Ga0209489_100005 3300027361 Bacteria 530958
378 Ga0209489_100023 3300027361 Bacteria 198829
379 Ga0209489_100742 3300027361 Bacteria 64218
380 Ga0209700_100006 3300027363 Bacteria 530958
381 Ga0209700_100134 3300027363 Bacteria 112846
382 Ga0209588_1003932 3300027671 Bacteria 4156
383 Ga0209813_10026424 3300027866 Bacteria 1679
384 Ga0209813_10094012 3300027866 Bacteria 1010
385 Ga0207428_10325357 3300027907 Bacteria 1135
386 Ga0268266_10001136 3300028379 Bacteria 33101
387 Ga0268266_10003686 3300028379 Bacteria 15118
388 Ga0268266_10007696 3300028379 Bacteria 9673
389 Ga0268266_10048100 3300028379 Bacteria 3655
390 Ga0268266_10175012 3300028379 Bacteria 1950
391 Ga0268266_10538825 3300028379 Bacteria 1117
392 Ga0268266_10820899 3300028379 Bacteria 898
393 Ga0268265_10019321 3300028380 Bacteria 4733
394 Ga0268265_10140896 3300028380 Bacteria 2019
395 Ga0307517_10000098 3300028786 Bacteria 126044
396 Ga0307515_10098751 3300028794 Bacteria 3552
397 Ga0307515_10390958 3300028794 Bacteria 1020
398 Ga0307511_10000014 3300030521 Bacteria 127602
399 Ga0307511_10232289 3300030521 Bacteria 911
400 Ga0265325_10028710 3300031241 Bacteria 2995
401 Ga0265325_10075344 3300031241 Bacteria 1685
402 Ga0265339_10120058 3300031249 Bacteria 1352
403 Ga0265331_10104634 3300031250 Bacteria 1301
404 Ga0265331_10129459 3300031250 Bacteria 1152
405 Ga0265327_10035083 3300031251 Bacteria 2777
406 Ga0265316_10171724 3300031344 Bacteria 1617
407 Ga0265316_10204536 3300031344 Bacteria 1462
408 Ga0307513_10067968 3300031456 Bacteria 3735
409 Ga0307513_10203303 3300031456 Bacteria 1819
410 Ga0265313_10000710 3300031595 Bacteria 34401
411 Ga0265313_10065446 3300031595 Bacteria 1687
412 Ga0265314_10051287 3300031711 Bacteria 2875
413 Ga0307516_10046388 3300031730 Bacteria 4287
414 Ga0307405_10272364 3300031731 Bacteria 1270
415 Ga0307407_10140011 3300031903 Bacteria 1560
416 Ga0307412_10125422 3300031911 Bacteria 1856
417 Ga0307416_100856021 3300032002 Bacteria 1007
418 Ga0307411_10174325 3300032005 Bacteria 1625
419 Ga0307415_100173986 3300032126 Bacteria 1682
420 Ga0316583_10002297 3300032133 Bacteria 6590
421 Ga0307510_10007562 3300033180 Bacteria 12946
422 Ga0307510_10195621 3300033180 Bacteria 1564
423 Ga0315911_1000005 3300033442 Bacteria 426255
424 Ga0373950_0005653 3300034818 Bacteria 1875
425 Ga0373959_0021087 3300034820 Bacteria 1249
426 Ga0373938_0047277 3300034957 Bacteria 973
427 Ga0373928_0024812 3300035084 Bacteria 1288
428 Ga0373934_0035936 3300035086 Bacteria 1951
429 Ga0373934_0044113 3300035086 Bacteria 1762
430 Ga0373923_0001382 3300035111 Bacteria 6917
431 Ga0373923_0003036 3300035111 Bacteria 5306
432 Ga0373932_0027113 3300035112 Bacteria 1564
433 Ga0373932_0069945 3300035112 Bacteria 1086
434 Ga0373936_0049442 3300035113 Bacteria 1698
435 Ga0373936_0097111 3300035113 Bacteria 1240
436 Ga0373936_0129041 3300035113 Bacteria 1085
437 Ga0373941_0000606 3300035115 Bacteria 7250
438 Ga0373945_0005116 3300035116 Bacteria 4186
439 Ga0373953_0000985 3300035117 Bacteria 8003
440 Ga0373953_0100830 3300035117 Bacteria 1215
441 Ga0373954_0001160 3300035118 Bacteria 10599
442 Ga0373954_0008305 3300035118 Bacteria 4555
443 Ga0373954_0013014 3300035118 Bacteria 3704
444 Ga0373954_0058984 3300035118 Bacteria 1808
445 Ga0373954_0181020 3300035118 Bacteria 1033
446 Ga0373956_0001463 3300035119 Bacteria 9760
447 Ga0373956_0027829 3300035119 Bacteria 2457
448 Ga0373956_0241638 3300035119 Bacteria 858
449 Ga0373957_0030699 3300035120 Bacteria 1970
450 Ga0373957_0034940 3300035120 Bacteria 1865
451 Ga0373943_0010149 3300035170 Bacteria 4224
452 Ga0373946_0007962 3300035171 Bacteria 3892
453 Ga0373946_0064574 3300035171 Bacteria 1566
454 Ga0373955_0001372 3300035172 Bacteria 10349
455 Ga0373955_0018833 3300035172 Bacteria 3441
456 Ga0373955_0087441 3300035172 Bacteria 1771
457 Ga0373924_0011593 3300035410 Bacteria 3277
458 Ga0373924_0035360 3300035410 Bacteria 2026
459 Ga0373924_0040913 3300035410 Bacteria 1898
460 Ga0373931_0003428 3300035691 Bacteria 7118
461 Ga0373935_0000520 3300035692 Bacteria 20054
462 Ga0373927_0000046 3300035695 Bacteria 88401
463 Ga0373927_0005938 3300035695 Bacteria 8359
464 Ga0373927_0113941 3300035695 Bacteria 1762
465 Ga0373933_0019482 3300035724 Bacteria 3833
466 Ga0373933_0053835 3300035724 Bacteria 2410
467 Ga0373933_0123769 3300035724 Bacteria 1621
468 Ga0373947_0001392 3300035725 Bacteria 14902
469 Ga0373947_0002439 3300035725 Bacteria 11211
470 Ga0373947_0021349 3300035725 Bacteria 3747
471 Ga0373947_0027666 3300035725 Bacteria 3320
472 Ga0373947_0466112 3300035725 Bacteria 856
473 Ga0373937_0015298 3300036401 Bacteria 6784
474 Ga0373937_0016441 3300036401 Bacteria 6572
475 Ga0373937_0028218 3300036401 Bacteria 5077
476 Ga0373937_0051447 3300036401 Bacteria 3776
477 Ga0373937_0075827 3300036401 Bacteria 3105
478 Ga0373937_0103455 3300036401 Bacteria 2645
479 Ga0373937_0147334 3300036401 Bacteria 2204
480 Ga0373925_0009905 3300037068 Bacteria 6924
481 Ga0373925_0049532 3300037068 Bacteria 3131
482 Ga0373925_0183889 3300037068 Bacteria 1656
483 Ga0373925_0205583 3300037068 Bacteria 1567
484 Ga0373925_0219496 3300037068 Bacteria 1517
485 Ga0395899_0116459 3300037312 Bacteria 1917
486 Ga0395900_0016187 3300037418 Bacteria 7597
487 Ga0395900_0032079 3300037418 Bacteria 5401
488 Ga0395900_0290498 3300037418 Bacteria 1624
489 Ga0395898_0030023 3300037466 Bacteria 5442
490 Ga0395898_0143916 3300037466 Bacteria 2282
491 Ga0395898_0146208 3300037466 Bacteria 2262
492 Ga0395898_0252291 3300037466 Bacteria 1683
493 Ga0395905_0025920 3300037471 Bacteria 5526
494 Ga0395905_0033090 3300037471 Bacteria 4860
495 Ga0395905_0235405 3300037471 Bacteria 1712
496 Ga0436364_0166778 3300037853 Bacteria 1401
497 Ga0395901_0044922 3300038443 Bacteria 4583
498 Ga0395901_0097370 3300038443 Bacteria 3084
499 Ga0395901_0113876 3300038443 Bacteria 2841
500 Ga0395901_0254458 3300038443 Bacteria 1829
501 Ga0395901_0274779 3300038443 Bacteria 1752
502 Ga0436365_0107606 3300039437 Bacteria 5515
503 Ga0436365_0396839 3300039437 Bacteria 1979
504 Ga0436365_1044448 3300039437 Bacteria 2136
505 Ga0436365_1580006 3300039437 Bacteria 1039
506 Ga0436365_1607466 3300039437 Bacteria 1186
507 Ga0436361_0783902 3300039447 Bacteria 3211
508 Ga0436361_1109558 3300039447 Bacteria 1048
509 Ga0436362_1140786 3300039453 Bacteria 2256
510 Ga0451833_0606252 3300041491 Bacteria 1053
511 Ga0466969_0015917 3300044656 Bacteria 3941
512 Ga0466972_0000126 3300044658 Bacteria 64766
513 Ga0466966_0145138 3300044684 Bacteria 1449
514 Ga0466966_0190717 3300044684 Bacteria 1242
515 Ga0466961_0000025 3300044693 Bacteria 96344
516 Ga0466963_0011648 3300044694 Bacteria 5357
517 Ga0466963_0115616 3300044694 Bacteria 1843
518 Ga0466968_0053776 3300044735 Bacteria 1726
519 Ga0466968_0121279 3300044735 Bacteria 1183
520 Ga0466957_0169526 3300044842 Bacteria 1421
521 Ga0466957_0396019 3300044842 Bacteria 944
522 Ga0466957_0399259 3300044842 Bacteria 940
523 Ga0466959_0000873 3300045049 Bacteria 17751
524 Ga0466959_0163188 3300045049 Bacteria 1565
525 Ga0466959_0254451 3300045049 Bacteria 1211
526 Ga0451576_0018871 3300045051 Bacteria 7539
527 Ga0466967_0047331 3300045976 Bacteria 3748
528 Ga0466967_0090497 3300045976 Bacteria 2780
529 Ga0466967_0409122 3300045976 Bacteria 1321
530 Ga0495617_058231 3300046452 Bacteria 1280
531 Ga0495592_0001238 3300046454 Bacteria 17695
532 Ga0495592_0086276 3300046454 Bacteria 2261
533 Ga0495592_0124840 3300046454 Bacteria 1807
534 Ga0495592_0151994 3300046454 Bacteria 1600
535 Ga0495592_0156808 3300046454 Bacteria 1569
536 Ga0495603_0000051 3300046455 Bacteria 50402
537 Ga0495603_0105023 3300046455 Bacteria 1648
538 Ga0495603_0155784 3300046455 Bacteria 1326
539 Ga0495629_0000182 3300046459 Bacteria 56655
540 Ga0495629_0000750 3300046459 Bacteria 26239
541 Ga0495629_0043713 3300046459 Bacteria 3145
542 Ga0495638_0003938 3300046460 Bacteria 11448
543 Ga0495638_0013321 3300046460 Bacteria 5603
544 Ga0495638_0029466 3300046460 Bacteria 3539
545 Ga0495638_0054856 3300046460 Bacteria 2476
546 Ga0495638_0107663 3300046460 Bacteria 1659
547 Ga0495638_0116709 3300046460 Bacteria 1581
548 Ga0495641_0006374 3300046461 Bacteria 7658
549 Ga0495651_0049059 3300046462 Bacteria 3259
550 Ga0495651_0118365 3300046462 Bacteria 1949
551 Ga0495651_0141321 3300046462 Bacteria 1745
552 Ga0495651_0232686 3300046462 Bacteria 1268
553 Ga0495651_0431907 3300046462 Bacteria 854
554 Ga0495653_0014575 3300046463 Bacteria 6416
555 Ga0495653_0200069 3300046463 Bacteria 1356
556 Ga0495580_0004021 3300046472 Bacteria 12411
557 Ga0495580_0023405 3300046472 Bacteria 4536
558 Ga0495582_0000137 3300046473 Bacteria 39425
559 Ga0495582_0028788 3300046473 Bacteria 3049
560 Ga0495639_0000047 3300046475 Bacteria 53940
561 Ga0495639_0006474 3300046475 Bacteria 5036
562 Ga0495639_0016665 3300046475 Bacteria 3191
563 Ga0495639_0076376 3300046475 Bacteria 1554
564 Ga0495639_0110879 3300046475 Bacteria 1302
565 Ga0495662_0001496 3300046476 Bacteria 11578
566 Ga0495662_0016743 3300046476 Bacteria 3551
567 Ga0495664_0001335 3300046477 Bacteria 12989
568 Ga0495664_0023753 3300046477 Bacteria 3558
569 Ga0495664_0033799 3300046477 Bacteria 3006
570 Ga0495664_0034436 3300046477 Bacteria 2980
571 Ga0495664_0036584 3300046477 Bacteria 2894
572 Ga0495664_0061085 3300046477 Bacteria 2244
573 Ga0495664_0145246 3300046477 Bacteria 1438
574 Ga0495664_0352426 3300046477 Bacteria 886
575 Ga0495584_0044891 3300046491 Bacteria 2230
576 Ga0495584_0109348 3300046491 Bacteria 1398
577 Ga0495585_0037387 3300046492 Bacteria 2734
578 Ga0495594_0001833 3300046499 Bacteria 11057
579 Ga0495594_0055256 3300046499 Bacteria 2189
580 Ga0495594_0191194 3300046499 Bacteria 1166
581 Ga0495607_0077143 3300046501 Bacteria 1841
582 Ga0495606_0001505 3300046507 Bacteria 30975
583 Ga0495606_0023313 3300046507 Bacteria 4488
584 Ga0495606_0187297 3300046507 Bacteria 1189
585 Ga0495608_0012014 3300046511 Bacteria 6020
586 Ga0495608_0020960 3300046511 Bacteria 4488
587 Ga0495608_0035676 3300046511 Bacteria 3352
588 Ga0495608_0041836 3300046511 Bacteria 3065
589 Ga0495608_0084299 3300046511 Bacteria 2062
590 Ga0495618_0016660 3300046514 Bacteria 4501
591 Ga0495618_0036338 3300046514 Bacteria 3091
592 Ga0495618_0185823 3300046514 Bacteria 1319
593 Ga0495620_0023843 3300046515 Bacteria 2918
594 Ga0495620_0123525 3300046515 Bacteria 1019
595 Ga0495628_0030327 3300046516 Bacteria 4379
596 Ga0495628_0031595 3300046516 Bacteria 4282
597 Ga0495628_0065433 3300046516 Bacteria 2843
598 Ga0495630_0002625 3300046517 Bacteria 12446
599 Ga0495643_0155884 3300046522 Bacteria 1127
600 Ga0495644_0024756 3300046523 Bacteria 2283
601 Ga0495648_0037184 3300046524 Bacteria 3131
602 Ga0495648_0052154 3300046524 Bacteria 2487
603 Ga0495648_0145614 3300046524 Bacteria 1242
604 Ga0495666_0021412 3300046526 Bacteria 3200
605 Ga0495666_0072875 3300046526 Bacteria 1630
606 Ga0495642_0048876 3300046528 Bacteria 1736
607 Ga0495652_0024273 3300046529 Bacteria 5368
608 Ga0495652_0035614 3300046529 Bacteria 4331
609 Ga0495652_0116125 3300046529 Bacteria 2143
610 Ga0495654_0026918 3300046530 Bacteria 2952
611 Ga0495665_0001239 3300046531 Bacteria 13612
612 Ga0495640_0004375 3300046533 Bacteria 11274
613 Ga0495640_0039432 3300046533 Bacteria 3314
614 Ga0495640_0045852 3300046533 Bacteria 3032
615 Ga0495640_0206436 3300046533 Bacteria 1243
616 Ga0495586_0056945 3300046535 Bacteria 2121
617 Ga0495586_0251223 3300046535 Bacteria 1009
618 Ga0495587_0025522 3300046536 Bacteria 3611
619 Ga0495587_0027825 3300046536 Bacteria 3442
620 Ga0495587_0050017 3300046536 Bacteria 2473
621 Ga0495609_0095258 3300046538 Bacteria 1292
622 Ga0495597_0068617 3300046542 Bacteria 1532
623 Ga0495645_0006200 3300046543 Bacteria 8278
624 Ga0495645_0038038 3300046543 Bacteria 3509
625 Ga0495645_0083302 3300046543 Bacteria 2292
626 Ga0495622_0006199 3300046557 Bacteria 5554
627 Ga0495622_0019937 3300046557 Bacteria 3121
628 Ga0495622_0052256 3300046557 Bacteria 1896
629 Ga0495622_0087161 3300046557 Bacteria 1435
630 Ga0495633_0067115 3300046558 Bacteria 1675
631 Ga0495667_0011170 3300046559 Bacteria 6078
632 Ga0495667_0011352 3300046559 Bacteria 6031
633 Ga0495667_0014203 3300046559 Bacteria 5377
634 Ga0495667_0020913 3300046559 Bacteria 4416
635 Ga0495667_0231259 3300046559 Bacteria 1178
636 Ga0495667_0346272 3300046559 Bacteria 939
637 Ga0495668_0114481 3300046616 Bacteria 1475
638 Ga0495668_0281015 3300046616 Bacteria 912
639 Ga0495634_0002221 3300046642 Bacteria 16276
640 Ga0495634_0065576 3300046642 Bacteria 2406
641 Ga0495634_0080503 3300046642 Bacteria 2131
642 Ga0495634_0114296 3300046642 Bacteria 1733
643 Ga0495635_0001455 3300046663 Bacteria 15846
644 Ga0495635_0002383 3300046663 Bacteria 12797
645 Ga0495635_0015226 3300046663 Bacteria 5382
646 Ga0495635_0043906 3300046663 Bacteria 3084
647 Ga0495659_0017854 3300046664 Bacteria 2357
648 Ga0495661_0067748 3300046665 Bacteria 2096
649 Ga0495588_0009398 3300046674 Bacteria 4518
650 Ga0495588_0027119 3300046674 Bacteria 2862
651 Ga0495588_0082779 3300046674 Bacteria 1676
652 Ga0495657_0004131 3300046675 Bacteria 11623
653 Ga0495657_0006427 3300046675 Bacteria 9197
654 Ga0495657_0007196 3300046675 Bacteria 8628
655 Ga0495657_0031614 3300046675 Bacteria 3698
656 Ga0495657_0263483 3300046675 Bacteria 1035
657 Ga0495599_0004838 3300046678 Bacteria 8011
658 Ga0495599_0012226 3300046678 Bacteria 5288
659 Ga0495599_0021279 3300046678 Bacteria 4045
660 Ga0495599_0063521 3300046678 Bacteria 2307
661 Ga0495623_0022752 3300046679 Bacteria 4046
662 Ga0495623_0043882 3300046679 Bacteria 2843
663 Ga0495623_0047224 3300046679 Bacteria 2733
664 Ga0495623_0105003 3300046679 Bacteria 1717
665 Ga0495646_0019779 3300046680 Bacteria 4258
666 Ga0495646_0039661 3300046680 Bacteria 2903
667 Ga0495646_0157891 3300046680 Bacteria 1257
668 Ga0495646_0188503 3300046680 Bacteria 1128
669 Ga0495647_0000577 3300046681 Bacteria 10837
670 Ga0495658_0001786 3300046683 Bacteria 11096
671 Ga0495613_0007297 3300046689 Bacteria 8233
672 Ga0495613_0088477 3300046689 Bacteria 2244
673 Ga0495613_0279715 3300046689 Bacteria 1159
674 Ga0495624_0000898 3300046690 Bacteria 23624
675 Ga0495670_0007688 3300046691 Bacteria 5299
676 Ga0495649_0011437 3300046694 Bacteria 5203
677 Ga0495600_0007660 3300046809 Bacteria 6616
678 Ga0495600_0012921 3300046809 Bacteria 5233
679 Ga0495600_0046708 3300046809 Bacteria 2824
680 Ga0495600_0245128 3300046809 Bacteria 1141
681 Ga0495600_0402645 3300046809 Bacteria 851
682 Ga0495581_0101647 3300047315 Bacteria 1670
683 Ga0495581_0197040 3300047315 Bacteria 1178
684 Ga0495604_0013331 3300047317 Bacteria 6545
685 Ga0495604_0025793 3300047317 Bacteria 4681
686 Ga0495604_0032865 3300047317 Bacteria 4109
687 Ga0495674_0010092 3300047319 Bacteria 8948
688 Ga0495674_0030208 3300047319 Bacteria 4929
689 Ga0495674_0034564 3300047319 Bacteria 4571
690 Ga0495674_0053623 3300047319 Bacteria 3543
691 Ga0495672_0200326 3300047320 Bacteria 999
692 Ga0495676_0035661 3300047321 Bacteria 4159
693 Ga0495680_0003456 3300047322 Bacteria 15551
694 Ga0495680_0016657 3300047322 Bacteria 6307
695 Ga0495680_0025862 3300047322 Bacteria 4852
696 Ga0495683_0094120 3300047323 Bacteria 1448
697 Ga0495687_098245 3300047443 Bacteria 1105
698 Ga0495675_0011002 3300047444 Bacteria 5671
699 Ga0495675_0025339 3300047444 Bacteria 3781
700 Ga0495675_0097296 3300047444 Bacteria 1844
701 Ga0495673_0018535 3300047469 Bacteria 3505
702 Ga0495673_0079474 3300047469 Bacteria 1361
703 Ga0495684_0000643 3300047471 Bacteria 28074
704 Ga0495684_0007715 3300047471 Bacteria 8330
705 Ga0495684_0014553 3300047471 Bacteria 6055
706 Ga0495684_0024347 3300047471 Bacteria 4661
707 Ga0495686_0073735 3300047472 Bacteria 2096
708 Ga0495686_0152408 3300047472 Bacteria 1356
709 Ga0495593_0000469 3300047673 Bacteria 22695
710 Ga0495593_0006819 3300047673 Bacteria 6685
711 Ga0495602_0009739 3300048088 Bacteria 9983
712 Ga0495602_0175500 3300048088 Bacteria 1658
713 Ga0495602_0279037 3300048088 Bacteria 1232
714 Ga0495614_0001926 3300048089 Bacteria 9106
715 Ga0495626_0065248 3300048091 Bacteria 1648
716 Ga0496100_0001098 3300048903 Bacteria 13078
717 Ga0496100_0025314 3300048903 Bacteria 3629
718 Ga0496100_0611768 3300048903 Bacteria 847
719 Ga0496101_0007768 3300048904 Bacteria 6971
720 Ga0496101_0204607 3300048904 Bacteria 1527
721 Ga0496101_0209813 3300048904 Bacteria 1509
722 Ga0496101_0456393 3300048904 Bacteria 1008
723 Ga0496102_0008520 3300048905 Bacteria 8791
724 Ga0496102_0067033 3300048905 Bacteria 3291
725 Ga0496102_0092857 3300048905 Bacteria 2795
726 Ga0496103_0026822 3300048906 Bacteria 3487
727 Ga0496103_0031194 3300048906 Bacteria 3246
728 Ga0496103_0232949 3300048906 Bacteria 1185
729 Ga0496104_0021810 3300048907 Bacteria 5883
730 Ga0496104_0075775 3300048907 Bacteria 3203
731 Ga0496104_0103613 3300048907 Bacteria 2726
732 Ga0496104_0143993 3300048907 Bacteria 2289
733 Ga0496104_0156668 3300048907 Bacteria 2185
734 Ga0496104_0453855 3300048907 Bacteria 1193
735 Ga0496105_0050226 3300048908 Bacteria 3445
736 Ga0496105_0088994 3300048908 Bacteria 2550
737 Ga0496105_0302833 3300048908 Bacteria 1284
738 Ga0496105_0318889 3300048908 Bacteria 1246
739 Ga0496105_0444744 3300048908 Bacteria 1024
740 Ga0496106_0021872 3300048909 Bacteria 4750
741 Ga0496106_0031033 3300048909 Bacteria 3983
742 Ga0496106_0316315 3300048909 Bacteria 1253
743 Ga0496107_0006973 3300048910 Bacteria 7786
744 Ga0496107_0011332 3300048910 Bacteria 6205
745 Ga0496107_0017889 3300048910 Bacteria 4989
746 Ga0496107_0033519 3300048910 Bacteria 3675
747 Ga0496107_0150128 3300048910 Bacteria 1723
748 Ga0496107_0189283 3300048910 Bacteria 1529
749 Ga0496107_0429676 3300048910 Bacteria 982
750 Ga0496108_0000681 3300048911 Bacteria 26279
751 Ga0496108_0041142 3300048911 Bacteria 3856
752 Ga0496108_0068674 3300048911 Bacteria 2990
753 Ga0496108_0104755 3300048911 Bacteria 2414
754 Ga0496108_0235771 3300048911 Bacteria 1591
755 Ga0496108_0258706 3300048911 Bacteria 1515
756 Ga0496109_0000450 3300048912 Bacteria 35265
757 Ga0496109_0118426 3300048912 Bacteria 2465
758 Ga0496110_0009862 3300048913 Bacteria 7741
759 Ga0496110_0015912 3300048913 Bacteria 6273
760 Ga0496110_0061414 3300048913 Bacteria 3316
761 Ga0496110_0353492 3300048913 Bacteria 1339
762 Ga0496111_0026720 3300048914 Bacteria 4077
763 Ga0496111_0117031 3300048914 Bacteria 1966
764 Ga0496111_0143250 3300048914 Bacteria 1771
765 Ga0496111_0220909 3300048914 Bacteria 1408
766 Ga0496112_0000040 3300048915 Bacteria 89057
767 Ga0496112_0005466 3300048915 Bacteria 10997
768 Ga0496112_0012229 3300048915 Bacteria 7879
769 Ga0496112_0080070 3300048915 Bacteria 3230
770 Ga0496112_0099921 3300048915 Bacteria 2871
771 Ga0496112_0357155 3300048915 Bacteria 1403
772 Ga0496113_0073139 3300048916 Bacteria 2611
773 Ga0496113_0083237 3300048916 Bacteria 2455
774 Ga0496113_0268345 3300048916 Bacteria 1364
775 Ga0496114_0043733 3300048917 Bacteria 3714
776 Ga0496114_0073639 3300048917 Bacteria 2875
777 Ga0496114_0378150 3300048917 Bacteria 1254
778 Ga0496115_0019746 3300048918 Bacteria 5189
779 Ga0496115_0025021 3300048918 Bacteria 4644
780 Ga0496115_0078214 3300048918 Bacteria 2691
781 Ga0496115_0125033 3300048918 Bacteria 2118
782 Ga0496115_0138205 3300048918 Bacteria 2009
783 Ga0496115_0473303 3300048918 Bacteria 1009
784 Ga0496116_0013006 3300048919 Bacteria 6749
785 Ga0496116_0134361 3300048919 Bacteria 1404
786 Ga0496117_0042127 3300048920 Bacteria 3336
787 Ga0496118_0105601 3300048921 Bacteria 1887
788 Ga0496118_0221411 3300048921 Bacteria 1101
789 Ga0496118_0232281 3300048921 Bacteria 1063
790 Ga0496119_0096910 3300048922 Bacteria 1663
791 Ga0496119_0125484 3300048922 Bacteria 1405
792 Ga0496119_0159858 3300048922 Bacteria 1199
793 Ga0496120_0017558 3300048923 Bacteria 4632
794 Ga0496120_0047496 3300048923 Bacteria 2475
795 Ga0496121_0004144 3300048924 Bacteria 19837
796 Ga0496121_0004646 3300048924 Bacteria 18262
797 Ga0496121_0011273 3300048924 Bacteria 9960
798 Ga0496121_0011280 3300048924 Bacteria 9954
799 Ga0496121_0020673 3300048924 Bacteria 6497
800 Ga0496121_0054482 3300048924 Bacteria 3341
801 Ga0496121_0079161 3300048924 Bacteria 2610
802 Ga0496121_0387127 3300048924 Bacteria 920
803 Ga0496122_0027804 3300048925 Bacteria 4822
804 Ga0496123_0041988 3300048926 Bacteria 3163
805 Ga0496124_0117186 3300048927 Bacteria 2134
806 Ga0496124_0157120 3300048927 Bacteria 1777
807 Ga0496124_0175044 3300048927 Bacteria 1657
808 Ga0496124_0311890 3300048927 Bacteria 1131
809 Ga0496125_0014087 3300048928 Bacteria 7813
810 Ga0496125_0034884 3300048928 Bacteria 4426
811 Ga0496125_0239573 3300048928 Bacteria 1153
812 Ga0496125_0240716 3300048928 Bacteria 1149
813 Ga0496126_0007855 3300048929 Bacteria 11618
814 Ga0496126_0011852 3300048929 Bacteria 8969
815 Ga0496126_0020062 3300048929 Bacteria 6563
816 Ga0496126_0021191 3300048929 Bacteria 6355
817 Ga0496126_0050628 3300048929 Bacteria 3784
818 Ga0496126_0057447 3300048929 Bacteria 3513
819 Ga0496126_0123865 3300048929 Bacteria 2239
820 Ga0496126_0131840 3300048929 Bacteria 2159
821 Ga0496126_0180569 3300048929 Bacteria 1793
822 Ga0496126_0239287 3300048929 Bacteria 1517
823 Ga0496126_0351035 3300048929 Bacteria 1206
824 Ga0496126_0437592 3300048929 Bacteria 1054
825 Ga0495682_0045355 3300049460 Bacteria 1606
826 Ga0501031_0000157 3300049568 Bacteria 38675
827 Ga0501031_0134054 3300049568 Bacteria 1618
828 Ga0501032_0002373 3300049569 Bacteria 14704
829 Ga0501032_0041477 3300049569 Bacteria 3125
830 Ga0501032_0056621 3300049569 Bacteria 2635
831 Ga0501032_0147437 3300049569 Bacteria 1548
832 Ga0501033_0000175 3300049570 Bacteria 60845
833 Ga0501033_0015675 3300049570 Bacteria 5746
834 Ga0501033_0029845 3300049570 Bacteria 4098
835 Ga0501033_0137433 3300049570 Bacteria 1768
836 Ga0501033_0353094 3300049570 Bacteria 1030
837 Ga0501034_0000820 3300049571 Bacteria 46252
838 Ga0501034_0001125 3300049571 Bacteria 37359
839 Ga0501034_0006645 3300049571 Bacteria 12413
840 Ga0501034_0112713 3300049571 Bacteria 2709
841 Ga0501034_0132177 3300049571 Bacteria 2478
842 Ga0501034_0252111 3300049571 Bacteria 1709
843 Ga0501034_0271556 3300049571 Bacteria 1636
844 Ga0501034_0272484 3300049571 Bacteria 1633
845 Ga0501034_0320796 3300049571 Bacteria 1482
846 Ga0501036_0000216 3300049572 Bacteria 38518
847 Ga0501036_0014414 3300049572 Bacteria 6583
848 Ga0501036_0038499 3300049572 Bacteria 4047
849 Ga0501036_0054801 3300049572 Bacteria 3378
850 Ga0501036_0076808 3300049572 Bacteria 2825
851 Ga0501036_0088464 3300049572 Bacteria 2617
852 Ga0501036_0153801 3300049572 Bacteria 1940
853 Ga0501036_0185938 3300049572 Bacteria 1748
854 Ga0501036_0255863 3300049572 Bacteria 1467
855 Ga0501037_0000100 3300049573 Bacteria 81013
856 Ga0501037_0005146 3300049573 Bacteria 9514
857 Ga0501037_0064569 3300049573 Bacteria 2667
858 Ga0501037_0102430 3300049573 Bacteria 2065
859 Ga0501037_0104824 3300049573 Bacteria 2038
860 Ga0501037_0110016 3300049573 Bacteria 1985
861 Ga0501037_0249446 3300049573 Bacteria 1242
862 Ga0501038_0000157 3300049574 Bacteria 58169
863 Ga0501038_0006074 3300049574 Bacteria 11174
864 Ga0501038_0060880 3300049574 Bacteria 3229
865 Ga0501038_0169787 3300049574 Bacteria 1766
866 Ga0501039_0003135 3300049575 Bacteria 12366
867 Ga0501039_0060505 3300049575 Bacteria 2933
868 Ga0501039_0062906 3300049575 Bacteria 2875
869 Ga0501043_0001316 3300049579 Bacteria 21701
870 Ga0501043_0002528 3300049579 Bacteria 15463
871 Ga0501043_0062271 3300049579 Bacteria 2929
872 Ga0501043_0129543 3300049579 Bacteria 1977
873 Ga0501043_0147381 3300049579 Bacteria 1842
874 Ga0501043_0357670 3300049579 Bacteria 1108
875 Ga0501046_0000387 3300049580 Bacteria 44269
876 Ga0501046_0013980 3300049580 Bacteria 6780
877 Ga0501046_0032260 3300049580 Bacteria 4242
878 Ga0501046_0033348 3300049580 Bacteria 4161
879 Ga0501046_0043396 3300049580 Bacteria 3580
880 Ga0501046_0156191 3300049580 Bacteria 1718
881 Ga0501046_0311814 3300049580 Bacteria 1147
882 Ga0501047_0000124 3300049581 Bacteria 94721
883 Ga0501047_0000159 3300049581 Bacteria 82106
884 Ga0501047_0030311 3300049581 Bacteria 5216
885 Ga0501047_0171580 3300049581 Bacteria 2037
886 Ga0501047_0183419 3300049581 Bacteria 1959
887 Ga0501047_0289294 3300049581 Bacteria 1482
888 Ga0501047_0540566 3300049581 Bacteria 990
889 Ga0501048_0000375 3300049582 Bacteria 31006
890 Ga0501048_0000655 3300049582 Bacteria 24936
891 Ga0501067_0002717 3300049583 Bacteria 9749
892 Ga0501067_0102809 3300049583 Bacteria 1587
893 Ga0501068_0000168 3300049584 Bacteria 30562
894 Ga0501068_0005079 3300049584 Bacteria 7174
895 Ga0501068_0036229 3300049584 Bacteria 2949
896 Ga0501068_0065883 3300049584 Bacteria 2205
897 Ga0501068_0124115 3300049584 Bacteria 1612
898 Ga0501068_0206190 3300049584 Bacteria 1247
899 Ga0501068_0319300 3300049584 Bacteria 995
900 Ga0501069_0024244 3300049585 Bacteria 3308
901 Ga0501070_0000457 3300049586 Bacteria 37005
902 Ga0501070_0002236 3300049586 Bacteria 17009
903 Ga0501070_0004540 3300049586 Bacteria 11913
904 Ga0501070_0015967 3300049586 Bacteria 6311
905 Ga0501070_0030651 3300049586 Bacteria 4506
906 Ga0501070_0097587 3300049586 Bacteria 2430
907 Ga0501070_0103032 3300049586 Bacteria 2360
908 Ga0501070_0108875 3300049586 Bacteria 2289
909 Ga0501070_0172352 3300049586 Bacteria 1782
910 Ga0501070_0174936 3300049586 Bacteria 1767
911 Ga0501070_0216585 3300049586 Bacteria 1571
912 Ga0501070_0269611 3300049586 Bacteria 1390
913 Ga0501071_0070112 3300049587 Bacteria 2553
914 Ga0501071_0092696 3300049587 Bacteria 2220
915 Ga0501071_0210478 3300049587 Bacteria 1462
916 Ga0501072_0007209 3300049588 Bacteria 8438
917 Ga0501072_0166330 3300049588 Bacteria 1760
918 Ga0501073_0000239 3300049589 Bacteria 36296
919 Ga0501073_0102023 3300049589 Bacteria 1992
920 Ga0501073_0202250 3300049589 Bacteria 1373
921 Ga0501073_0466945 3300049589 Bacteria 872
922 Ga0501074_0000093 3300049590 Bacteria 42750
923 Ga0501074_0035328 3300049590 Bacteria 3621
924 Ga0501074_0068594 3300049590 Bacteria 2549
925 Ga0501074_0264566 3300049590 Bacteria 1222
926 Ga0501076_0391201 3300049592 Bacteria 1143
927 Ga0501079_0008383 3300049741 Bacteria 7835
928 Ga0501079_0066442 3300049741 Bacteria 2782
929 Ga0501079_0078617 3300049741 Bacteria 2551
930 Ga0501080_0000074 3300049742 Bacteria 66985
931 Ga0501080_0002523 3300049742 Bacteria 16045
932 Ga0501080_0005538 3300049742 Bacteria 11274
933 Ga0501080_0052826 3300049742 Bacteria 3782
934 Ga0501080_0063314 3300049742 Bacteria 3442
935 Ga0501080_0079849 3300049742 Bacteria 3041
936 Ga0501080_0299553 3300049742 Bacteria 1458
937 Ga0501080_0659194 3300049742 Bacteria 925
938 Ga0501081_0225355 3300049743 Bacteria 1364
939 Ga0501081_0260119 3300049743 Bacteria 1268
940 Ga0501083_0000485 3300049744 Bacteria 25494
941 Ga0501083_0009923 3300049744 Bacteria 6722
942 Ga0501083_0062919 3300049744 Bacteria 2475
943 Ga0501083_0073861 3300049744 Bacteria 2267
944 Ga0501083_0116804 3300049744 Bacteria 1751
945 Ga0501083_0138032 3300049744 Bacteria 1597
946 Ga0501083_0258354 3300049744 Bacteria 1133
947 Ga0501035_0000172 3300049822 Bacteria 79203
948 Ga0501035_0010744 3300049822 Bacteria 8477
949 Ga0501035_0045324 3300049822 Bacteria 3956
950 Ga0501044_0001469 3300049823 Bacteria 27682
951 Ga0501044_0011690 3300049823 Bacteria 9509
952 Ga0501044_0021657 3300049823 Bacteria 6853
953 Ga0501044_0025735 3300049823 Bacteria 6238
954 Ga0501044_0046842 3300049823 Bacteria 4475
955 Ga0501044_0092432 3300049823 Bacteria 3051
956 Ga0501044_0098148 3300049823 Bacteria 2949
957 Ga0501044_0120000 3300049823 Bacteria 2631
958 Ga0501044_0164958 3300049823 Bacteria 2190
959 Ga0501044_0177867 3300049823 Bacteria 2096
960 Ga0501044_0183147 3300049823 Bacteria 2060
961 Ga0501044_0212800 3300049823 Bacteria 1886
962 Ga0501044_0258634 3300049823 Bacteria 1680
963 Ga0501044_0324558 3300049823 Bacteria 1463
964 Ga0501045_0012933 3300049824 Bacteria 5883
965 nmdc:mga03683_11799_c1 3300050489 Bacteria 3175
966 nmdc:mga03683_1474_c1 3300050489 Bacteria 7023
967 nmdc:mga03683_3122_c1 3300050489 Bacteria 5275
968 nmdc:mga03n38_110804_c1 3300050490 Bacteria 1336
969 nmdc:mga03n38_55032_c1 3300050490 Bacteria 1791
970 nmdc:mga00v17_222206_c1 3300050491 Bacteria 1223
971 nmdc:mga0yw44_3010_c1 3300050492 Bacteria 7363
972 nmdc:mga0k408_332236_c1 3300050493 Bacteria 907
973 nmdc:mga0k408_43647_c1 3300050493 Bacteria 2584
974 nmdc:mga06z11_111400_c1 3300050494 Bacteria 1516
975 nmdc:mga06z11_233064_c1 3300050494 Bacteria 1079
976 nmdc:mga06z11_29164_c1 3300050494 Bacteria 2655
977 nmdc:mga06z11_59566_c1 3300050494 Bacteria 1985
978 nmdc:mga06z11_9341_c1 3300050494 Bacteria 4129
979 nmdc:mga04h51_111410_c1 3300050495 Bacteria 1009
980 nmdc:mga07m45_104987_c1 3300050496 Bacteria 1625
981 nmdc:mga07m45_117657_c1 3300050496 Bacteria 1534
982 nmdc:mga07m45_125034_c1 3300050496 Bacteria 1487
983 nmdc:mga08y16_484020_c1 3300050511 Bacteria 1259
984 nmdc:mga0n895_105724_c1 3300050512 Bacteria 2827
985 nmdc:mga0n895_19893_c1 3300050512 Bacteria 6250
986 nmdc:mga0n895_456373_c1 3300050512 Bacteria 1290
987 nmdc:mga0sz30_1915_c1 3300050516 Bacteria 7430
988 nmdc:mga0sz30_83144_c1 3300050516 Bacteria 1112
989 nmdc:mga0sz30_98535_c1 3300050516 Bacteria 1017
990 Ga0495601_0049011 3300053077 Bacteria 2662
991 Ga0495601_0071093 3300053077 Bacteria 2222
992 Ga0495601_0090397 3300053077 Bacteria 1969
993 Ga0495601_0094122 3300053077 Bacteria 1930
994 Ga0495612_0011691 3300053078 Bacteria 3538
995 Ga0495612_0012298 3300053078 Bacteria 3450
996 Ga0495612_0043035 3300053078 Bacteria 1844
997 Ga0500635_0015817 3300053080 Bacteria 2234
998 Ga0495655_0018998 3300053083 Bacteria 1520
999 Ga0495655_0081910 3300053083 Bacteria 924
1000 Ga0495595_0000332 3300053084 Bacteria 18218
1001 Ga0495595_0015233 3300053084 Bacteria 3276
1002 Ga0495619_0000633 3300053085 Bacteria 23194
1003 Ga0495619_0181288 3300053085 Bacteria 1457
1004 Ga0500578_0242366 3300053086 Bacteria 1089
1005 Ga0500643_000016 3300053087 Bacteria 309502
1006 Ga0500644_0120262 3300053088 Bacteria 1023
1007 Ga0500646_0001198 3300053090 Bacteria 6972
1008 Ga0500647_0060458 3300053091 Bacteria 1823
1009 Ga0500583_0011788 3300053092 Bacteria 3309
1010 Ga0500651_0007818 3300053093 Bacteria 6253
1011 Ga0500566_0000078 3300053094 Bacteria 47558
1012 Ga0500566_0000290 3300053094 Bacteria 26984
1013 Ga0500566_0003107 3300053094 Bacteria 9925
1014 Ga0500640_000121 3300053095 Bacteria 14580
1015 Ga0500641_0000385 3300053096 Bacteria 16362
1016 Ga0500641_0004079 3300053096 Bacteria 5155
1017 Ga0500641_0043383 3300053096 Bacteria 1825
1018 Ga0500641_0066567 3300053096 Bacteria 1509
1019 Ga0500641_0072315 3300053096 Bacteria 1453
1020 Ga0500650_0003982 3300053098 Bacteria 5254
1021 Ga0500555_006193 3300053103 Bacteria 3395
1022 Ga0500555_035862 3300053103 Bacteria 1392
1023 Ga0500556_0000195 3300053104 Bacteria 49800
1024 Ga0500557_000011 3300053105 Bacteria 117471
1025 Ga0500562_001257 3300053108 Bacteria 6255
1026 Ga0500569_047274 3300053109 Bacteria 1286
1027 Ga0500569_068215 3300053109 Bacteria 1114
1028 Ga0500572_000170 3300053111 Bacteria 22863
1029 Ga0500593_136427 3300053117 Bacteria 972
1030 Ga0500595_001017 3300053119 Bacteria 15747
1031 Ga0500595_001686 3300053119 Bacteria 11604
1032 Ga0500595_009585 3300053119 Bacteria 3901
1033 Ga0500595_050090 3300053119 Bacteria 1298
1034 Ga0500597_177569 3300053120 Bacteria 905
1035 Ga0500607_087138 3300053121 Bacteria 1579
1036 Ga0500608_046544 3300053122 Bacteria 2084
1037 Ga0500618_015074 3300053125 Bacteria 1960
1038 Ga0500642_0000012 3300053130 Bacteria 206424
1039 Ga0500642_0000090 3300053130 Bacteria 46849
1040 Ga0500642_0008061 3300053130 Bacteria 3580
1041 Ga0500642_0053707 3300053130 Bacteria 1787
1042 Ga0500642_0091731 3300053130 Bacteria 1405
1043 Ga0500652_000327 3300053131 Bacteria 17119
1044 Ga0500655_005192 3300053133 Bacteria 2349
1045 Ga0500559_0000421 3300053136 Bacteria 30317
1046 Ga0500559_0004643 3300053136 Bacteria 6478
1047 Ga0500559_0010249 3300053136 Bacteria 4029
1048 Ga0500568_0000614 3300053139 Bacteria 25738
1049 Ga0500568_0087628 3300053139 Bacteria 1176
1050 Ga0500577_0077582 3300053142 Bacteria 1317
1051 Ga0500586_000877 3300053145 Bacteria 6207
1052 Ga0500588_0027314 3300053146 Bacteria 1607
1053 Ga0500603_000081 3300053150 Bacteria 22182
1054 Ga0500603_001666 3300053150 Bacteria 5003
1055 Ga0500604_0002038 3300053151 Bacteria 5580
1056 Ga0500616_0000408 3300053153 Bacteria 58453
1057 Ga0500616_0004061 3300053153 Bacteria 10645
1058 Ga0500616_0093103 3300053153 Bacteria 1488
1059 Ga0500620_000984 3300053155 Bacteria 4988
1060 Ga0500622_0001313 3300053156 Bacteria 20208
1061 Ga0500622_0154692 3300053156 Bacteria 1080
1062 Ga0500627_0051787 3300053158 Bacteria 1791
1063 Ga0500630_004509 3300053159 Bacteria 6772
1064 Ga0500633_0076507 3300053160 Bacteria 1204
1065 Ga0500638_062165 3300053162 Bacteria 1793
1066 Ga0500639_000028 3300053163 Bacteria 77951
1067 Ga0500636_0001766 3300053177 Bacteria 11841
1068 Ga0500636_0004562 3300053177 Bacteria 7855
1069 Ga0500636_0021694 3300053177 Bacteria 3802
1070 Ga0500636_0090488 3300053177 Bacteria 1753
1071 Ga0500637_0112382 3300053178 Bacteria 1580
1072 Ga0500637_0174378 3300053178 Bacteria 1234
1073 Ga0500567_079370 3300053723 Bacteria 1420
1074 Ga0500625_040499 3300053729 Bacteria 2192
1075 Ga0500596_002436 3300053735 Bacteria 3666
1076 Ga0500599_000324 3300053736 Bacteria 4686
1077 Ga0500601_000049 3300053737 Bacteria 24772
1078 Ga0500601_007957 3300053737 Bacteria 1176
1079 Ga0501084_0070285 3300054114 Bacteria 2931
1080 Ga0501084_0665997 3300054114 Bacteria 878
1081 Ga0501082_0018897 3300060353 Bacteria 5937
1082 Ga0501082_0238783 3300060353 Bacteria 1581
1083 Ga0501082_0322313 3300060353 Bacteria 1346
1084 Ga0466962_0173859 3300061719 Bacteria 1049

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0437592 Ga0496126_0437592_233_1024 256
2 3300030521 Ga0307511_10000014 Ga0307511_1000001448 258
3 3300031251 Ga0265327_10035083 Ga0265327_100350834 258
4 3300048088 Ga0495602_0279037 Ga0495602_0279037_216_1013 258
5 3300053090 Ga0500646_0001198 Ga0500646_0001198_5800_6576 258
6 3300053103 Ga0500555_035862 Ga0500555_035862_188_964 258
7 3300053133 Ga0500655_005192 Ga0500655_005192_961_1737 258
8 3300053139 Ga0500568_0087628 Ga0500568_0087628_236_1012 258
9 iso_pu_bacteria 2507262055 2507511472 258
10 iso_pu_bacteria 2508501009 2508545280 258
11 iso_pu_bacteria 2508501042 2508694111 258
12 iso_pu_bacteria 2513237087 2513590907 258
13 iso_pu_bacteria 2513237092 2513624038 258
14 iso_pu_bacteria 2513237094 2513641000 258
15 iso_pu_bacteria 2513237095 2513648413 258
16 iso_pu_bacteria 2513237096 2513655367 258
17 iso_pu_bacteria 2513237101 2513696111 258
18 iso_pu_bacteria 2513237102 2513703637 258
19 iso_pu_bacteria 2513237104 2513716366 258
20 iso_pu_bacteria 2513237137 2513860069 258
21 iso_pu_bacteria 2513237139 2513875077 258
22 iso_pu_bacteria 2513237141 2513893108 258
23 iso_pu_bacteria 2513237145 2513916555 258
24 iso_pu_bacteria 2513237161 2514013849 258
25 iso_pu_bacteria 2515154112 2515624954 258
26 iso_pu_bacteria 2517093001 2517101238 258
27 iso_pu_bacteria 2517572143 2517889856 258
28 iso_pu_bacteria 2524023205 2524439820 258
29 iso_pu_bacteria 2524023210 2524465866 258
30 iso_pu_bacteria 2528768022 2528855416 258
31 iso_pu_bacteria 2617270741 2617374901 258
32 iso_pu_bacteria 2667528175 2671121123 258
33 iso_pu_bacteria 2721755755 2723848842 258
34 iso_pu_bacteria 2728368998 2728751749 258
35 iso_pu_bacteria 2744054633 2745075900 258
36 iso_pu_bacteria 2791355196 2793061369 258
37 iso_pu_bacteria 2791355197 2793073418 258
38 iso_pu_bacteria 2791355199 2793078840 258
39 iso_pu_bacteria 2802429603 2805916333 258
40 iso_pu_bacteria 2816332527 2818239995 258
41 iso_pu_bacteria 2824600985 2824607018 258
42 iso_pu_bacteria 2824609381 2824614311 258
43 iso_pu_bacteria 2824617872 2824622309 258
44 iso_pu_bacteria 2824626560 2824631478 258
45 iso_pu_bacteria 2824635225 2824637998 258
46 iso_pu_bacteria 2824644064 2824649750 258
47 iso_pu_bacteria 2824653114 2824656826 258
48 iso_pu_bacteria 2824661429 2824664146 258
49 iso_pu_bacteria 2824671348 2824674574 258
50 iso_pu_bacteria 2824679649 2824685740 258
51 iso_pu_bacteria 2824687955 2824690537 258
52 iso_pu_bacteria 2824696289 2824697883 258
53 iso_pu_bacteria 2824704595 2824713121 258
54 iso_pu_bacteria 2824714736 2824719700 258
55 iso_pu_bacteria 2824723954 2824726680 258
56 iso_pu_bacteria 2824732956 2824736394 258
57 iso_pu_bacteria 2824746037 2824752066 258
58 iso_pu_bacteria 2824753945 2824760844 258
59 iso_pu_bacteria 2824763712 2824770298 258
60 iso_pu_bacteria 2824773399 2824776238 258
61 iso_pu_bacteria 2838122688 2838130004 258
62 iso_pu_bacteria 2841941048 2841947043 258
63 iso_pu_bacteria 2841949485 2841955025 258
64 iso_pu_bacteria 2841957949 2841964956 258
65 iso_pu_bacteria 2841966195 2841969983 258
66 iso_pu_bacteria 2841974524 2841977375 258
67 iso_pu_bacteria 2841983080 2841990211 258
68 iso_pu_bacteria 2842038055 2842042213 258
69 iso_pu_bacteria 2842045827 2842050256 258
70 iso_pu_bacteria 2844315083 2844316436 258
71 iso_pu_bacteria 2847930680 2847939264 258
72 iso_pu_bacteria 2847939898 2847943771 258
73 iso_pu_bacteria 2849076700 2849081995 258
74 iso_pu_bacteria 2857509624 2857513526 258
75 iso_pu_bacteria 2874590934 2874594687 258
76 iso_pu_bacteria 2874604998 2874606025 258
77 iso_pu_bacteria 2874612657 2874615250 258
78 iso_pu_bacteria 2874620515 2874622656 258
79 iso_pu_bacteria 2874628541 2874633585 258
80 iso_pu_bacteria 2874645413 2874647264 258
81 iso_pu_bacteria 2876771140 2876773819 258
82 iso_pu_bacteria 2876808645 2876817811 258
83 iso_pu_bacteria 2876818435 2876819943 258
84 iso_pu_bacteria 2879074833 2879076062 258
85 iso_pu_bacteria 2879099564 2879104319 258
86 iso_pu_bacteria 2879110137 2879116813 258
87 iso_pu_bacteria 2879127579 2879129332 258
88 iso_pu_bacteria 2879142872 2879144094 258
89 iso_pu_bacteria 2881364244 2881369419 258
90 iso_pu_bacteria 2881665667 2881668270 258
91 iso_pu_bacteria 2885366525 2885373652 258
92 iso_pu_bacteria 2885374607 2885378572 258
93 iso_pu_bacteria 2885409591 2885411099 258
94 iso_pu_bacteria 2888388044 2888389733 258
95 iso_pu_bacteria 2888419890 2888421353 258
96 iso_pu_bacteria 2889033259 2889034466 258
97 iso_pu_bacteria 2903727486 2903732317 258
98 iso_pu_bacteria 2904666416 2904671337 258
99 iso_pu_bacteria 2904690495 2904692705 258
100 iso_pu_bacteria 2904711408 2904719637 258
101 iso_pu_bacteria 2906602504 2906606370 258
102 iso_pu_bacteria 2906610324 2906612411 258
103 iso_pu_bacteria 2906626472 2906626838 258
104 iso_pu_bacteria 2906635258 2906636758 258
105 iso_pu_bacteria 2906643746 2906649084 258
106 iso_pu_bacteria 2906660503 2906663453 258
107 iso_pu_bacteria 2908756301 2908757655 258
108 iso_pu_bacteria 2908775508 2908777385 258
109 iso_pu_bacteria 2922368715 2922377191 258
110 iso_pu_bacteria 2922386360 2922389528 258
111 iso_pu_bacteria 2922393267 2922398334 258
112 iso_pu_bacteria 2922425934 2922432958 258
113 iso_pu_bacteria 2929615660 2929623589 258
114 iso_pu_bacteria 2929624759 2929632708 258
115 iso_pu_bacteria 2932784394 2932793032 258
116 iso_pu_bacteria 2932794094 2932795841 258
117 iso_pu_bacteria 2932801729 2932802079 258
118 iso_pu_bacteria 2932809354 2932814697 258
119 iso_pu_bacteria 2932818245 2932823554 258
120 iso_pu_bacteria 2932828146 2932832991 258
121 iso_pu_bacteria 2933577622 2933585493 258
122 iso_pu_bacteria 2935608549 2935616337 258
123 iso_pu_bacteria 2935616580 2935623722 258
124 iso_pu_bacteria 2935630451 2935633044 258
125 iso_pu_bacteria 2935638405 2935639492 258
126 iso_pu_bacteria 2935648319 2935650732 258
127 iso_pu_bacteria 2935656913 2935662112 258
128 iso_pu_bacteria 2935665750 2935670437 258
129 iso_pu_bacteria 2935675223 2935679867 258
130 iso_pu_bacteria 2935684952 2935687437 258
131 iso_pu_bacteria 2935694250 2935696591 258
132 iso_pu_bacteria 2935703347 2935705409 258
133 iso_pu_bacteria 2935713505 2935718896 258
134 iso_pu_bacteria 2935722832 2935728548 258
135 iso_pu_bacteria 2935732158 2935736855 258
136 iso_pu_bacteria 2935741537 2935746142 258
137 iso_pu_bacteria 2935750917 2935753403 258
138 iso_pu_bacteria 2935760218 2935766204 258
139 iso_pu_bacteria 2935769743 2935770390 258
140 iso_pu_bacteria 2935777560 2935777579 258
141 iso_pu_bacteria 2935785616 2935786557 258
142 iso_pu_bacteria 2935793552 2935794612 258
143 iso_pu_bacteria 2935801545 2935807152 258
144 iso_pu_bacteria 2935810662 2935813934 258
145 iso_pu_bacteria 2935819856 2935827134 258
146 iso_pu_bacteria 2935827899 2935828975 258
147 iso_pu_bacteria 2935837841 2935844148 258
148 iso_pu_bacteria 2935847175 2935854315 258
149 iso_pu_bacteria 2935855204 2935862053 258
150 iso_pu_bacteria 2935864058 2935871617 258
151 iso_pu_bacteria 2935873716 2935880272 258
152 iso_pu_bacteria 2935883170 2935886267 258
153 iso_pu_bacteria 2935908558 2935913591 258
154 iso_pu_bacteria 2935926038 2935931092 258
155 iso_pu_bacteria 2935934488 2935935374 258
156 iso_pu_bacteria 2935942939 2935946940 258
157 iso_pu_bacteria 2935951376 2935953965 258
158 iso_pu_bacteria 2935959822 2935961400 258
159 iso_pu_bacteria 2935967501 2935968991 258
160 iso_pu_bacteria 2935975950 2935982361 258
161 iso_pu_bacteria 2935984226 2935985818 258
162 iso_pu_bacteria 2935992306 2935996938 258
163 iso_pu_bacteria 2936002035 2936005973 258
164 iso_pu_bacteria 2936011229 2936016306 258
165 iso_pu_bacteria 2936019824 2936025046 258
166 iso_pu_bacteria 2936028420 2936033611 258
167 iso_pu_bacteria 2936037263 2936039490 258
168 iso_pu_bacteria 2936046547 2936050957 258
169 iso_pu_bacteria 2936055302 2936057706 258
170 iso_pu_bacteria 2940556831 2940559316 258
171 iso_pu_bacteria 2941507105 2941509654 258
172 iso_pu_bacteria 2941515067 2941517483 258
173 iso_pu_bacteria 2941523033 2941526564 258
174 iso_pu_bacteria 2941531003 2941536912 258
175 iso_pu_bacteria 2941538514 2941542011 258
176 iso_pu_bacteria 3005474847 3005476067 258
177 iso_pu_bacteria 3005483717 3005491237 258
178 iso_pu_bacteria 3005506211 3005511082 258
179 iso_pu_bacteria 3005594810 3005596054 258
180 iso_pu_bacteria 3005710791 3005712007 258
181 iso_pu_bacteria 3005718088 3005719245 258
182 iso_pu_bacteria 8006926726 8006932927 258
183 iso_pu_bacteria 8006933436 8006937379 258
184 iso_pu_bacteria 8006964411 8006971091 258
185 iso_pu_bacteria 8006973647 8006977409 258
186 iso_pu_bacteria 8006984368 8006992957 258
187 iso_pu_bacteria 8006994254 8006996805 258
188 iso_pu_bacteria 8016511872 8016517060 258
189 iso_pu_bacteria 8016522445 8016524601 258
190 iso_pu_bacteria 8016530956 8016538163 258
191 iso_pu_bacteria 8016539877 8016542443 258
192 iso_pu_bacteria 8016557553 8016559245 258
193 iso_pu_bacteria 8016566248 8016567832 258
194 iso_pu_bacteria 8016575299 8016580519 258
195 iso_pu_bacteria 8016595262 8016597195 258
196 iso_pu_bacteria 8016603502 8016605078 258
197 iso_pu_bacteria 8016613128 8016619939 258
198 iso_pu_bacteria 8016622563 8016624160 258
199 iso_pu_bacteria 8016630954 8016637553 258
200 iso_pu_bacteria 8017057580 8017059522 258
201 iso_pu_bacteria 8019530166 8019537834 258
202 iso_pu_bacteria 8019538911 8019539464 258
203 iso_pu_bacteria 8019547302 8019551180 258
204 iso_pu_bacteria 8019555841 8019561252 258
205 iso_pu_bacteria 8019565922 8019571338 258
206 iso_pu_bacteria 8019576017 8019578985 258
207 iso_pu_bacteria 8019586578 8019597031 258
208 iso_pu_bacteria 8019597564 8019604652 258
209 iso_pu_bacteria 8019619141 8019624456 258
210 iso_pu_bacteria 8019659431 8019665515 258
211 iso_pu_bacteria 8019668869 8019675059 258
212 iso_pu_bacteria 8019678201 8019681039 258
213 iso_pu_bacteria 8019687851 8019694684 258
214 iso_pu_bacteria 8055742211 8055749750 258
215 iso_pu_bacteria 8056689827 8056692032 258
216 iso_pu_bacteria 8056967851 8056973961 258
217 3300005548 Ga0070665_100010041 Ga0070665_1000100418 259
218 3300021384 Ga0213876_10031811 Ga0213876_100318112 259
219 3300028379 Ga0268266_10007696 Ga0268266_100076962 259
220 3300037471 Ga0395905_0033090 Ga0395905_0033090_3883_4662 259
221 3300039437 Ga0436365_0107606 Ga0436365_0107606_1546_2325 259
222 3300044842 Ga0466957_0399259 Ga0466957_0399259_117_896 259
223 3300048913 Ga0496110_0353492 Ga0496110_0353492_174_953 259
224 3300049570 Ga0501033_0353094 Ga0501033_0353094_146_925 259
225 3300049580 Ga0501046_0156191 Ga0501046_0156191_34_813 259
226 3300049585 Ga0501069_0024244 Ga0501069_0024244_1743_2522 259
227 3300049586 Ga0501070_0000457 Ga0501070_0000457_14615_15394 259
228 3300049586 Ga0501070_0103032 Ga0501070_0103032_229_1008 259
229 3300049822 Ga0501035_0045324 Ga0501035_0045324_1536_2315 259
230 3300049823 Ga0501044_0324558 Ga0501044_0324558_462_1241 259
231 iso_pu_bacteria 2602042107 2603857471 259
232 iso_pu_bacteria 2857524615 2857526856 259
233 iso_pu_bacteria 2893066018 2893070015 259
234 iso_pu_bacteria 2919073203 2919077983 259
235 3300005459 Ga0068867_100148114 Ga0068867_1001481141 260
236 3300006178 Ga0075367_10094223 Ga0075367_100942232 260
237 3300010375 Ga0105239_10049562 Ga0105239_100495622 260
238 3300025931 Ga0207644_10166234 Ga0207644_101662341 260
239 3300025941 Ga0207711_10269056 Ga0207711_102690562 260
240 3300026041 Ga0207639_10149330 Ga0207639_101493303 260
241 3300026089 Ga0207648_10214427 Ga0207648_102144271 260
242 3300034957 Ga0373938_0047277 Ga0373938_0047277_70_858 260
243 3300035084 Ga0373928_0024812 Ga0373928_0024812_97_885 260
244 3300035112 Ga0373932_0027113 Ga0373932_0027113_326_1216 260
245 3300035691 Ga0373931_0003428 Ga0373931_0003428_3206_3994 260
246 3300048905 Ga0496102_0067033 Ga0496102_0067033_2079_2867 260
247 3300048906 Ga0496103_0026822 Ga0496103_0026822_2371_3159 260
248 3300048907 Ga0496104_0156668 Ga0496104_0156668_159_947 260
249 3300048910 Ga0496107_0017889 Ga0496107_0017889_1032_1820 260
250 3300048911 Ga0496108_0068674 Ga0496108_0068674_1782_2570 260
251 3300048915 Ga0496112_0012229 Ga0496112_0012229_3986_4774 260
252 3300048918 Ga0496115_0019746 Ga0496115_0019746_2196_2984 260
253 3300003203 JGI25406J46586_10008897 JGI25406J46586_100088976 261
254 3300005439 Ga0070711_100081742 Ga0070711_1000817422 261
255 3300005458 Ga0070681_10057575 Ga0070681_100575755 261
256 3300005530 Ga0070679_100363504 Ga0070679_1003635041 261
257 3300005937 Ga0081455_10002785 Ga0081455_100027853 261
258 3300005937 Ga0081455_10030239 Ga0081455_100302394 261
259 3300005981 Ga0081538_10022448 Ga0081538_100224483 261
260 3300005985 Ga0081539_10000950 Ga0081539_1000095053 261
261 3300005985 Ga0081539_10012348 Ga0081539_100123482 261
262 3300006028 Ga0070717_10050992 Ga0070717_100509922 261
263 3300006186 Ga0075369_10080358 Ga0075369_100803582 261
264 3300009545 Ga0105237_10738019 Ga0105237_107380191 261
265 3300009551 Ga0105238_10123401 Ga0105238_101234012 261
266 3300013102 Ga0157371_10421709 Ga0157371_104217091 261
267 3300013297 Ga0157378_10232441 Ga0157378_102324412 261
268 3300013306 Ga0163162_10126279 Ga0163162_101262793 261
269 3300013307 Ga0157372_10812022 Ga0157372_108120221 261
270 3300025261 Ga0209233_1002060 Ga0209233_10020604 261
271 3300025272 Ga0209455_1004708 Ga0209455_10047084 261
272 3300025297 Ga0209758_1000580 Ga0209758_100058046 261
273 3300025297 Ga0209758_1018366 Ga0209758_10183663 261
274 3300025910 Ga0207684_10150476 Ga0207684_101504762 261
275 3300025912 Ga0207707_10019818 Ga0207707_100198183 261
276 3300025913 Ga0207695_10067753 Ga0207695_100677532 261
277 3300025914 Ga0207671_10031054 Ga0207671_100310542 261
278 3300025916 Ga0207663_10026393 Ga0207663_100263933 261
279 3300025921 Ga0207652_10025815 Ga0207652_100258157 261
280 3300025928 Ga0207700_10127505 Ga0207700_101275052 261
281 3300034818 Ga0373950_0005653 Ga0373950_0005653_931_1716 261
282 3300035086 Ga0373934_0035936 Ga0373934_0035936_887_1672 261
283 3300035111 Ga0373923_0001382 Ga0373923_0001382_1930_2727 261
284 3300035111 Ga0373923_0003036 Ga0373923_0003036_210_995 261
285 3300035113 Ga0373936_0049442 Ga0373936_0049442_581_1366 261
286 3300035115 Ga0373941_0000606 Ga0373941_0000606_2174_2959 261
287 3300035117 Ga0373953_0000985 Ga0373953_0000985_6151_6948 261
288 3300035117 Ga0373953_0100830 Ga0373953_0100830_145_930 261
289 3300035118 Ga0373954_0001160 Ga0373954_0001160_3908_4705 261
290 3300035118 Ga0373954_0013014 Ga0373954_0013014_2693_3478 261
291 3300035118 Ga0373954_0058984 Ga0373954_0058984_931_1716 261
292 3300035118 Ga0373954_0181020 Ga0373954_0181020_108_893 261
293 3300035119 Ga0373956_0001463 Ga0373956_0001463_1479_2276 261
294 3300035119 Ga0373956_0241638 Ga0373956_0241638_60_845 261
295 3300035170 Ga0373943_0010149 Ga0373943_0010149_937_1722 261
296 3300035171 Ga0373946_0064574 Ga0373946_0064574_38_823 261
297 3300035172 Ga0373955_0001372 Ga0373955_0001372_1603_2400 261
298 3300035172 Ga0373955_0087441 Ga0373955_0087441_838_1623 261
299 3300035410 Ga0373924_0011593 Ga0373924_0011593_1698_2495 261
300 3300035410 Ga0373924_0040913 Ga0373924_0040913_836_1621 261
301 3300035724 Ga0373933_0019482 Ga0373933_0019482_1190_1987 261
302 3300035724 Ga0373933_0053835 Ga0373933_0053835_1606_2391 261
303 3300035724 Ga0373933_0123769 Ga0373933_0123769_513_1298 261
304 3300035725 Ga0373947_0002439 Ga0373947_0002439_8451_9236 261
305 3300035725 Ga0373947_0027666 Ga0373947_0027666_1453_2238 261
306 3300036401 Ga0373937_0015298 Ga0373937_0015298_1726_2523 261
307 3300036401 Ga0373937_0028218 Ga0373937_0028218_2161_2946 261
308 3300036401 Ga0373937_0051447 Ga0373937_0051447_320_1105 261
309 3300037068 Ga0373925_0049532 Ga0373925_0049532_413_1198 261
310 3300037068 Ga0373925_0183889 Ga0373925_0183889_14_799 261
311 3300037068 Ga0373925_0205583 Ga0373925_0205583_349_1134 261
312 3300045051 Ga0451576_0018871 Ga0451576_0018871_5940_6749 261
313 3300046452 Ga0495617_058231 Ga0495617_058231_440_1237 261
314 3300046454 Ga0495592_0001238 Ga0495592_0001238_15668_16465 261
315 3300046454 Ga0495592_0086276 Ga0495592_0086276_1443_2228 261
316 3300046459 Ga0495629_0000750 Ga0495629_0000750_10932_11729 261
317 3300046460 Ga0495638_0054856 Ga0495638_0054856_937_1734 261
318 3300046463 Ga0495653_0014575 Ga0495653_0014575_4144_4941 261
319 3300046472 Ga0495580_0023405 Ga0495580_0023405_3652_4437 261
320 3300046473 Ga0495582_0028788 Ga0495582_0028788_1201_1986 261
321 3300046475 Ga0495639_0006474 Ga0495639_0006474_3468_4253 261
322 3300046476 Ga0495662_0016743 Ga0495662_0016743_1018_1803 261
323 3300046477 Ga0495664_0033799 Ga0495664_0033799_587_1372 261
324 3300046492 Ga0495585_0037387 Ga0495585_0037387_1455_2252 261
325 3300046507 Ga0495606_0001505 Ga0495606_0001505_21416_22243 261
326 3300046511 Ga0495608_0012014 Ga0495608_0012014_3106_3891 261
327 3300046511 Ga0495608_0020960 Ga0495608_0020960_2060_2857 261
328 3300046511 Ga0495608_0084299 Ga0495608_0084299_224_1009 261
329 3300046514 Ga0495618_0016660 Ga0495618_0016660_2693_3490 261
330 3300046514 Ga0495618_0036338 Ga0495618_0036338_1263_2048 261
331 3300046526 Ga0495666_0021412 Ga0495666_0021412_1857_2642 261
332 3300046529 Ga0495652_0024273 Ga0495652_0024273_3733_4530 261
333 3300046533 Ga0495640_0045852 Ga0495640_0045852_953_1750 261
334 3300046533 Ga0495640_0206436 Ga0495640_0206436_419_1204 261
335 3300046536 Ga0495587_0027825 Ga0495587_0027825_612_1397 261
336 3300046559 Ga0495667_0014203 Ga0495667_0014203_1959_2756 261
337 3300046559 Ga0495667_0020913 Ga0495667_0020913_2259_3044 261
338 3300046642 Ga0495634_0065576 Ga0495634_0065576_1040_1825 261
339 3300046663 Ga0495635_0002383 Ga0495635_0002383_10939_11736 261
340 3300046663 Ga0495635_0015226 Ga0495635_0015226_2983_3768 261
341 3300046675 Ga0495657_0004131 Ga0495657_0004131_3957_4754 261
342 3300046675 Ga0495657_0031614 Ga0495657_0031614_987_1772 261
343 3300046678 Ga0495599_0021279 Ga0495599_0021279_2410_3207 261
344 3300046679 Ga0495623_0022752 Ga0495623_0022752_839_1636 261
345 3300046680 Ga0495646_0039661 Ga0495646_0039661_1613_2398 261
346 3300046680 Ga0495646_0157891 Ga0495646_0157891_52_849 261
347 3300046689 Ga0495613_0088477 Ga0495613_0088477_692_1489 261
348 3300046809 Ga0495600_0012921 Ga0495600_0012921_2711_3508 261
349 3300047315 Ga0495581_0101647 Ga0495581_0101647_283_1068 261
350 3300047317 Ga0495604_0013331 Ga0495604_0013331_4687_5484 261
351 3300047319 Ga0495674_0034564 Ga0495674_0034564_2596_3393 261
352 3300047319 Ga0495674_0053623 Ga0495674_0053623_910_1695 261
353 3300047322 Ga0495680_0025862 Ga0495680_0025862_3639_4424 261
354 3300047444 Ga0495675_0011002 Ga0495675_0011002_2450_3235 261
355 3300047471 Ga0495684_0000643 Ga0495684_0000643_26088_26885 261
356 3300047471 Ga0495684_0007715 Ga0495684_0007715_3261_4046 261
357 3300047673 Ga0495593_0006819 Ga0495593_0006819_4696_5493 261
358 3300048091 Ga0495626_0065248 Ga0495626_0065248_263_1060 261
359 3300048915 Ga0496112_0000040 Ga0496112_0000040_86850_87635 261
360 3300048924 Ga0496121_0011280 Ga0496121_0011280_7686_8492 261
361 3300048929 Ga0496126_0011852 Ga0496126_0011852_7324_8109 261
362 3300049568 Ga0501031_0000157 Ga0501031_0000157_37246_38073 261
363 3300049568 Ga0501031_0134054 Ga0501031_0134054_705_1490 261
364 3300049569 Ga0501032_0002373 Ga0501032_0002373_13255_14082 261
365 3300049569 Ga0501032_0041477 Ga0501032_0041477_68_856 261
366 3300049569 Ga0501032_0056621 Ga0501032_0056621_619_1407 261
367 3300049569 Ga0501032_0147437 Ga0501032_0147437_139_924 261
368 3300049570 Ga0501033_0000175 Ga0501033_0000175_34441_35268 261
369 3300049570 Ga0501033_0015675 Ga0501033_0015675_3868_4653 261
370 3300049570 Ga0501033_0029845 Ga0501033_0029845_704_1492 261
371 3300049571 Ga0501034_0000820 Ga0501034_0000820_22780_23568 261
372 3300049571 Ga0501034_0001125 Ga0501034_0001125_7989_8846 261
373 3300049571 Ga0501034_0006645 Ga0501034_0006645_639_1466 261
374 3300049571 Ga0501034_0112713 Ga0501034_0112713_505_1290 261
375 3300049571 Ga0501034_0132177 Ga0501034_0132177_1084_1869 261
376 3300049571 Ga0501034_0252111 Ga0501034_0252111_469_1257 261
377 3300049571 Ga0501034_0272484 Ga0501034_0272484_475_1332 261
378 3300049571 Ga0501034_0320796 Ga0501034_0320796_241_1029 261
379 3300049572 Ga0501036_0000216 Ga0501036_0000216_22340_23128 261
380 3300049572 Ga0501036_0014414 Ga0501036_0014414_4194_4979 261
381 3300049572 Ga0501036_0038499 Ga0501036_0038499_2627_3454 261
382 3300049572 Ga0501036_0054801 Ga0501036_0054801_1392_2177 261
383 3300049572 Ga0501036_0076808 Ga0501036_0076808_494_1282 261
384 3300049572 Ga0501036_0088464 Ga0501036_0088464_114_899 261
385 3300049572 Ga0501036_0185938 Ga0501036_0185938_806_1591 261
386 3300049573 Ga0501037_0000100 Ga0501037_0000100_77303_78130 261
387 3300049573 Ga0501037_0005146 Ga0501037_0005146_7358_8146 261
388 3300049573 Ga0501037_0064569 Ga0501037_0064569_474_1259 261
389 3300049573 Ga0501037_0102430 Ga0501037_0102430_637_1425 261
390 3300049573 Ga0501037_0104824 Ga0501037_0104824_671_1456 261
391 3300049573 Ga0501037_0110016 Ga0501037_0110016_198_986 261
392 3300049573 Ga0501037_0249446 Ga0501037_0249446_313_1098 261
393 3300049574 Ga0501038_0000157 Ga0501038_0000157_34426_35253 261
394 3300049574 Ga0501038_0006074 Ga0501038_0006074_8000_8785 261
395 3300049574 Ga0501038_0060880 Ga0501038_0060880_2393_3181 261
396 3300049574 Ga0501038_0169787 Ga0501038_0169787_873_1658 261
397 3300049575 Ga0501039_0003135 Ga0501039_0003135_605_1432 261
398 3300049575 Ga0501039_0060505 Ga0501039_0060505_418_1203 261
399 3300049575 Ga0501039_0062906 Ga0501039_0062906_691_1476 261
400 3300049579 Ga0501043_0001316 Ga0501043_0001316_8988_9815 261
401 3300049579 Ga0501043_0002528 Ga0501043_0002528_3272_4060 261
402 3300049579 Ga0501043_0062271 Ga0501043_0062271_1733_2518 261
403 3300049579 Ga0501043_0129543 Ga0501043_0129543_1140_1925 261
404 3300049579 Ga0501043_0147381 Ga0501043_0147381_736_1521 261
405 3300049579 Ga0501043_0357670 Ga0501043_0357670_74_859 261
406 3300049580 Ga0501046_0000387 Ga0501046_0000387_25904_26731 261
407 3300049580 Ga0501046_0013980 Ga0501046_0013980_4249_5034 261
408 3300049580 Ga0501046_0033348 Ga0501046_0033348_3174_3962 261
409 3300049580 Ga0501046_0043396 Ga0501046_0043396_821_1606 261
410 3300049580 Ga0501046_0311814 Ga0501046_0311814_236_1021 261
411 3300049581 Ga0501047_0000124 Ga0501047_0000124_61270_62058 261
412 3300049581 Ga0501047_0000159 Ga0501047_0000159_534_1361 261
413 3300049581 Ga0501047_0030311 Ga0501047_0030311_22_810 261
414 3300049581 Ga0501047_0171580 Ga0501047_0171580_58_843 261
415 3300049581 Ga0501047_0289294 Ga0501047_0289294_90_878 261
416 3300049581 Ga0501047_0540566 Ga0501047_0540566_80_937 261
417 3300049582 Ga0501048_0000375 Ga0501048_0000375_19523_20311 261
418 3300049582 Ga0501048_0000655 Ga0501048_0000655_10948_11775 261
419 3300049583 Ga0501067_0002717 Ga0501067_0002717_6638_7465 261
420 3300049583 Ga0501067_0102809 Ga0501067_0102809_115_900 261
421 3300049584 Ga0501068_0000168 Ga0501068_0000168_24449_25276 261
422 3300049584 Ga0501068_0005079 Ga0501068_0005079_743_1528 261
423 3300049584 Ga0501068_0036229 Ga0501068_0036229_1070_1855 261
424 3300049584 Ga0501068_0065883 Ga0501068_0065883_617_1402 261
425 3300049584 Ga0501068_0124115 Ga0501068_0124115_453_1241 261
426 3300049584 Ga0501068_0206190 Ga0501068_0206190_116_901 261
427 3300049584 Ga0501068_0319300 Ga0501068_0319300_74_859 261
428 3300049586 Ga0501070_0002236 Ga0501070_0002236_12344_13171 261
429 3300049586 Ga0501070_0015967 Ga0501070_0015967_2299_3087 261
430 3300049586 Ga0501070_0030651 Ga0501070_0030651_2496_3284 261
431 3300049586 Ga0501070_0097587 Ga0501070_0097587_1078_1863 261
432 3300049586 Ga0501070_0108875 Ga0501070_0108875_691_1476 261
433 3300049586 Ga0501070_0174936 Ga0501070_0174936_858_1643 261
434 3300049586 Ga0501070_0269611 Ga0501070_0269611_278_1066 261
435 3300049587 Ga0501071_0092696 Ga0501071_0092696_902_1687 261
436 3300049588 Ga0501072_0007209 Ga0501072_0007209_1874_2701 261
437 3300049588 Ga0501072_0166330 Ga0501072_0166330_629_1417 261
438 3300049589 Ga0501073_0000239 Ga0501073_0000239_636_1463 261
439 3300049589 Ga0501073_0102023 Ga0501073_0102023_874_1659 261
440 3300049589 Ga0501073_0202250 Ga0501073_0202250_400_1185 261
441 3300049589 Ga0501073_0466945 Ga0501073_0466945_31_819 261
442 3300049590 Ga0501074_0000093 Ga0501074_0000093_38309_39136 261
443 3300049590 Ga0501074_0068594 Ga0501074_0068594_1699_2487 261
444 3300049590 Ga0501074_0264566 Ga0501074_0264566_241_1026 261
445 3300049741 Ga0501079_0008383 Ga0501079_0008383_243_1070 261
446 3300049741 Ga0501079_0066442 Ga0501079_0066442_26_811 261
447 3300049741 Ga0501079_0078617 Ga0501079_0078617_945_1730 261
448 3300049742 Ga0501080_0000074 Ga0501080_0000074_35214_36002 261
449 3300049742 Ga0501080_0002523 Ga0501080_0002523_7237_8064 261
450 3300049742 Ga0501080_0052826 Ga0501080_0052826_2188_2973 261
451 3300049742 Ga0501080_0063314 Ga0501080_0063314_633_1418 261
452 3300049742 Ga0501080_0299553 Ga0501080_0299553_506_1294 261
453 3300049742 Ga0501080_0659194 Ga0501080_0659194_87_872 261
454 3300049743 Ga0501081_0260119 Ga0501081_0260119_215_1042 261
455 3300049744 Ga0501083_0000485 Ga0501083_0000485_14962_15750 261
456 3300049744 Ga0501083_0062919 Ga0501083_0062919_1214_1999 261
457 3300049744 Ga0501083_0073861 Ga0501083_0073861_826_1653 261
458 3300049744 Ga0501083_0116804 Ga0501083_0116804_611_1396 261
459 3300049744 Ga0501083_0138032 Ga0501083_0138032_702_1490 261
460 3300049744 Ga0501083_0258354 Ga0501083_0258354_31_816 261
461 3300049822 Ga0501035_0000172 Ga0501035_0000172_43779_44606 261
462 3300049822 Ga0501035_0010744 Ga0501035_0010744_7161_7946 261
463 3300049823 Ga0501044_0001469 Ga0501044_0001469_5302_6090 261
464 3300049823 Ga0501044_0011690 Ga0501044_0011690_2161_2988 261
465 3300049823 Ga0501044_0021657 Ga0501044_0021657_5326_6111 261
466 3300049823 Ga0501044_0025735 Ga0501044_0025735_556_1344 261
467 3300049823 Ga0501044_0098148 Ga0501044_0098148_1355_2140 261
468 3300049823 Ga0501044_0177867 Ga0501044_0177867_157_945 261
469 3300049823 Ga0501044_0183147 Ga0501044_0183147_1048_1833 261
470 3300049823 Ga0501044_0212800 Ga0501044_0212800_657_1442 261
471 3300049823 Ga0501044_0258634 Ga0501044_0258634_460_1248 261
472 3300049824 Ga0501045_0012933 Ga0501045_0012933_615_1442 261
473 3300050494 nmdc:mga06z11_9341_c1 nmdc:mga06z11_9341_c1_1258_2043 261
474 3300050516 nmdc:mga0sz30_1915_c1 nmdc:mga0sz30_1915_c1_4484_5269 261
475 3300053077 Ga0495601_0094122 Ga0495601_0094122_335_1120 261
476 3300053078 Ga0495612_0011691 Ga0495612_0011691_2606_3391 261
477 3300053078 Ga0495612_0043035 Ga0495612_0043035_32_817 261
478 3300053083 Ga0495655_0018998 Ga0495655_0018998_667_1464 261
479 3300053084 Ga0495595_0000332 Ga0495595_0000332_15220_16017 261
480 3300053084 Ga0495595_0015233 Ga0495595_0015233_2157_2942 261
481 3300053085 Ga0495619_0000633 Ga0495619_0000633_4651_5448 261
482 3300053142 Ga0500577_0077582 Ga0500577_0077582_433_1239 261
483 3300054114 Ga0501084_0070285 Ga0501084_0070285_1506_2333 261
484 3300060353 Ga0501082_0018897 Ga0501082_0018897_4476_5303 261
485 3300060353 Ga0501082_0238783 Ga0501082_0238783_696_1481 261
486 3300060353 Ga0501082_0322313 Ga0501082_0322313_505_1290 261
487 3300001990 JGI24737J22298_10002347 JGI24737J22298_100023471 262
488 3300002075 JGI24738J21930_10034940 JGI24738J21930_100349402 262
489 3300003203 JGI25406J46586_10007816 JGI25406J46586_100078161 262
490 3300003203 JGI25406J46586_10087741 JGI25406J46586_100877411 262
491 3300003215 JGI25153J46596_10002507 JGI25153J46596_100025075 262
492 3300003215 JGI25153J46596_10002543 JGI25153J46596_1000254310 262
493 3300003215 JGI25153J46596_10014752 JGI25153J46596_100147522 262
494 3300003215 JGI25153J46596_10019384 JGI25153J46596_100193842 262
495 3300003215 JGI25153J46596_10037348 JGI25153J46596_100373482 262
496 3300003354 JGI25160J50197_1001353 JGI25160J50197_10013531 262
497 3300003354 JGI25160J50197_1001493 JGI25160J50197_100149310 262
498 3300003354 JGI25160J50197_1022712 JGI25160J50197_10227122 262
499 3300003659 JGI25404J52841_10006534 JGI25404J52841_100065341 262
500 3300003659 JGI25404J52841_10014112 JGI25404J52841_100141122 262
501 3300003659 JGI25404J52841_10016780 JGI25404J52841_100167802 262
502 3300003771 Ga0055526_1024692 Ga0055526_10246922 262
503 3300003794 Ga0055531_10001939 Ga0055531_100019397 262
504 3300004625 Ga0055543_1004643 Ga0055543_10046434 262
505 3300005262 Ga0065165_1001641 Ga0065165_100164116 262
506 3300005262 Ga0065165_1003060 Ga0065165_10030608 262
507 3300005262 Ga0065165_1006123 Ga0065165_10061235 262
508 3300005262 Ga0065165_1010912 Ga0065165_10109122 262
509 3300005328 Ga0070676_10231611 Ga0070676_102316111 262
510 3300005329 Ga0070683_100002138 Ga0070683_10000213810 262
511 3300005329 Ga0070683_100060360 Ga0070683_1000603603 262
512 3300005329 Ga0070683_100103534 Ga0070683_1001035342 262
513 3300005334 Ga0068869_100018734 Ga0068869_1000187344 262
514 3300005334 Ga0068869_100242509 Ga0068869_1002425092 262
515 3300005335 Ga0070666_10237029 Ga0070666_102370291 262
516 3300005336 Ga0070680_100001388 Ga0070680_1000013889 262
517 3300005336 Ga0070680_100019162 Ga0070680_1000191623 262
518 3300005337 Ga0070682_100447038 Ga0070682_1004470381 262
519 3300005338 Ga0068868_100051877 Ga0068868_1000518771 262
520 3300005341 Ga0070691_10000536 Ga0070691_1000053614 262
521 3300005341 Ga0070691_10176035 Ga0070691_101760351 262
522 3300005344 Ga0070661_100106670 Ga0070661_1001066702 262
523 3300005347 Ga0070668_100030574 Ga0070668_1000305746 262
524 3300005347 Ga0070668_100077506 Ga0070668_1000775062 262
525 3300005347 Ga0070668_100287654 Ga0070668_1002876542 262
526 3300005354 Ga0070675_100209354 Ga0070675_1002093542 262
527 3300005355 Ga0070671_100026992 Ga0070671_1000269926 262
528 3300005355 Ga0070671_100172984 Ga0070671_1001729843 262
529 3300005434 Ga0070709_10006354 Ga0070709_1000635410 262
530 3300005434 Ga0070709_10015776 Ga0070709_100157763 262
531 3300005434 Ga0070709_10135589 Ga0070709_101355892 262
532 3300005435 Ga0070714_100046252 Ga0070714_1000462522 262
533 3300005436 Ga0070713_100001186 Ga0070713_1000011864 262
534 3300005436 Ga0070713_100245356 Ga0070713_1002453561 262
535 3300005437 Ga0070710_10223903 Ga0070710_102239032 262
536 3300005439 Ga0070711_100011149 Ga0070711_1000111491 262
537 3300005439 Ga0070711_100048169 Ga0070711_1000481693 262
538 3300005441 Ga0070700_100144401 Ga0070700_1001444012 262
539 3300005455 Ga0070663_100023603 Ga0070663_1000236032 262
540 3300005455 Ga0070663_100082812 Ga0070663_1000828122 262
541 3300005455 Ga0070663_100161409 Ga0070663_1001614091 262
542 3300005455 Ga0070663_100178475 Ga0070663_1001784753 262
543 3300005456 Ga0070678_100165551 Ga0070678_1001655512 262
544 3300005456 Ga0070678_100197907 Ga0070678_1001979072 262
545 3300005457 Ga0070662_100084789 Ga0070662_1000847891 262
546 3300005457 Ga0070662_100124102 Ga0070662_1001241023 262
547 3300005458 Ga0070681_10017662 Ga0070681_100176623 262
548 3300005458 Ga0070681_10024432 Ga0070681_100244329 262
549 3300005458 Ga0070681_10039710 Ga0070681_100397106 262
550 3300005458 Ga0070681_10376412 Ga0070681_103764122 262
551 3300005518 Ga0070699_100199189 Ga0070699_1001991892 262
552 3300005530 Ga0070679_100003503 Ga0070679_1000035037 262
553 3300005530 Ga0070679_100027556 Ga0070679_1000275562 262
554 3300005530 Ga0070679_100147698 Ga0070679_1001476983 262
555 3300005530 Ga0070679_100150437 Ga0070679_1001504374 262
556 3300005530 Ga0070679_100174492 Ga0070679_1001744923 262
557 3300005535 Ga0070684_100001913 Ga0070684_1000019132 262
558 3300005535 Ga0070684_100599759 Ga0070684_1005997592 262
559 3300005536 Ga0070697_100060642 Ga0070697_1000606421 262
560 3300005539 Ga0068853_100067183 Ga0068853_1000671832 262
561 3300005539 Ga0068853_100097547 Ga0068853_1000975472 262
562 3300005539 Ga0068853_100109439 Ga0068853_1001094393 262
563 3300005539 Ga0068853_100528437 Ga0068853_1005284371 262
564 3300005548 Ga0070665_100104669 Ga0070665_1001046694 262
565 3300005548 Ga0070665_100277172 Ga0070665_1002771722 262
566 3300005548 Ga0070665_100307099 Ga0070665_1003070992 262
567 3300005563 Ga0068855_100060900 Ga0068855_1000609006 262
568 3300005563 Ga0068855_100181234 Ga0068855_1001812341 262
569 3300005563 Ga0068855_100195710 Ga0068855_1001957102 262
570 3300005563 Ga0068855_100220936 Ga0068855_1002209362 262
571 3300005563 Ga0068855_100238531 Ga0068855_1002385312 262
572 3300005564 Ga0070664_100113592 Ga0070664_1001135922 262
573 3300005577 Ga0068857_100010136 Ga0068857_1000101365 262
574 3300005577 Ga0068857_100103325 Ga0068857_1001033253 262
575 3300005577 Ga0068857_100481631 Ga0068857_1004816312 262
576 3300005578 Ga0068854_100393596 Ga0068854_1003935961 262
577 3300005614 Ga0068856_100000055 Ga0068856_10000005540 262
578 3300005614 Ga0068856_100124570 Ga0068856_1001245704 262
579 3300005616 Ga0068852_100008698 Ga0068852_1000086986 262
580 3300005616 Ga0068852_100016131 Ga0068852_1000161313 262
581 3300005616 Ga0068852_100264694 Ga0068852_1002646943 262
582 3300005616 Ga0068852_100357358 Ga0068852_1003573582 262
583 3300005617 Ga0068859_100051912 Ga0068859_1000519122 262
584 3300005618 Ga0068864_100096411 Ga0068864_1000964112 262
585 3300005618 Ga0068864_100164489 Ga0068864_1001644892 262
586 3300005719 Ga0068861_100048762 Ga0068861_1000487625 262
587 3300005719 Ga0068861_100108102 Ga0068861_1001081022 262
588 3300005834 Ga0068851_10003461 Ga0068851_100034618 262
589 3300005834 Ga0068851_10030046 Ga0068851_100300461 262
590 3300005841 Ga0068863_100252184 Ga0068863_1002521842 262
591 3300005841 Ga0068863_100420327 Ga0068863_1004203272 262
592 3300005842 Ga0068858_100169787 Ga0068858_1001697872 262
593 3300005842 Ga0068858_100346960 Ga0068858_1003469602 262
594 3300005843 Ga0068860_100127658 Ga0068860_1001276582 262
595 3300005843 Ga0068860_100168421 Ga0068860_1001684211 262
596 3300005844 Ga0068862_100151120 Ga0068862_1001511202 262
597 3300005937 Ga0081455_10005206 Ga0081455_100052063 262
598 3300005937 Ga0081455_10026606 Ga0081455_100266065 262
599 3300005937 Ga0081455_10056015 Ga0081455_100560153 262
600 3300005983 Ga0081540_1001339 Ga0081540_100133915 262
601 3300005983 Ga0081540_1002098 Ga0081540_10020987 262
602 3300005983 Ga0081540_1005216 Ga0081540_10052165 262
603 3300005983 Ga0081540_1006379 Ga0081540_100637910 262
604 3300005983 Ga0081540_1007306 Ga0081540_10073065 262
605 3300005983 Ga0081540_1012638 Ga0081540_10126383 262
606 3300005983 Ga0081540_1015748 Ga0081540_10157486 262
607 3300005985 Ga0081539_10000848 Ga0081539_1000084830 262
608 3300006028 Ga0070717_10000460 Ga0070717_1000046020 262
609 3300006028 Ga0070717_10637808 Ga0070717_106378081 262
610 3300006038 Ga0075365_10005251 Ga0075365_100052511 262
611 3300006038 Ga0075365_10182955 Ga0075365_101829551 262
612 3300006038 Ga0075365_10438560 Ga0075365_104385601 262
613 3300006042 Ga0075368_10003948 Ga0075368_100039485 262
614 3300006042 Ga0075368_10039890 Ga0075368_100398901 262
615 3300006048 Ga0075363_100005438 Ga0075363_1000054383 262
616 3300006048 Ga0075363_100021367 Ga0075363_1000213673 262
617 3300006048 Ga0075363_100042092 Ga0075363_1000420923 262
618 3300006048 Ga0075363_100043180 Ga0075363_1000431802 262
619 3300006051 Ga0075364_10020794 Ga0075364_100207943 262
620 3300006051 Ga0075364_10110313 Ga0075364_101103132 262
621 3300006175 Ga0070712_100047202 Ga0070712_1000472024 262
622 3300006175 Ga0070712_100069796 Ga0070712_1000697964 262
623 3300006177 Ga0075362_10003691 Ga0075362_100036912 262
624 3300006177 Ga0075362_10062546 Ga0075362_100625462 262
625 3300006177 Ga0075362_10089718 Ga0075362_100897182 262
626 3300006178 Ga0075367_10004454 Ga0075367_100044543 262
627 3300006178 Ga0075367_10140573 Ga0075367_101405732 262
628 3300006178 Ga0075367_10158117 Ga0075367_101581171 262
629 3300006178 Ga0075367_10205194 Ga0075367_102051941 262
630 3300006178 Ga0075367_10244491 Ga0075367_102444911 262
631 3300006186 Ga0075369_10000317 Ga0075369_1000031711 262
632 3300006186 Ga0075369_10067389 Ga0075369_100673892 262
633 3300006186 Ga0075369_10078965 Ga0075369_100789652 262
634 3300006186 Ga0075369_10183604 Ga0075369_101836041 262
635 3300006195 Ga0075366_10015532 Ga0075366_100155322 262
636 3300006195 Ga0075366_10032143 Ga0075366_100321433 262
637 3300006237 Ga0097621_100160495 Ga0097621_1001604951 262
638 3300006237 Ga0097621_100382136 Ga0097621_1003821362 262
639 3300006353 Ga0075370_10024383 Ga0075370_100243832 262
640 3300006353 Ga0075370_10028738 Ga0075370_100287383 262
641 3300006353 Ga0075370_10039851 Ga0075370_100398515 262
642 3300006871 Ga0075434_100006248 Ga0075434_1000062484 262
643 3300006881 Ga0068865_100427112 Ga0068865_1004271122 262
644 3300006931 Ga0097620_100051911 Ga0097620_1000519115 262
645 3300006942 Ga0099824_1012218 Ga0099824_10122185 262
646 3300006943 Ga0099822_1020991 Ga0099822_10209917 262
647 3300007265 Ga0099794_10025633 Ga0099794_100256332 262
648 3300009093 Ga0105240_10004901 Ga0105240_100049017 262
649 3300009093 Ga0105240_10016877 Ga0105240_100168779 262
650 3300009093 Ga0105240_10028049 Ga0105240_100280499 262
651 3300009093 Ga0105240_10047216 Ga0105240_100472162 262
652 3300009093 Ga0105240_10060225 Ga0105240_100602254 262
653 3300009093 Ga0105240_10143116 Ga0105240_101431165 262
654 3300009093 Ga0105240_10275726 Ga0105240_102757261 262
655 3300009094 Ga0111539_10175434 Ga0111539_101754342 262
656 3300009094 Ga0111539_10313290 Ga0111539_103132901 262
657 3300009098 Ga0105245_10010180 Ga0105245_100101806 262
658 3300009098 Ga0105245_10027248 Ga0105245_100272485 262
659 3300009098 Ga0105245_10030782 Ga0105245_100307824 262
660 3300009098 Ga0105245_10149162 Ga0105245_101491622 262
661 3300009098 Ga0105245_10773911 Ga0105245_107739111 262
662 3300009147 Ga0114129_11019987 Ga0114129_110199871 262
663 3300009148 Ga0105243_10189133 Ga0105243_101891331 262
664 3300009174 Ga0105241_10010434 Ga0105241_100104343 262
665 3300009174 Ga0105241_10016990 Ga0105241_100169906 262
666 3300009174 Ga0105241_10027975 Ga0105241_100279752 262
667 3300009174 Ga0105241_10111787 Ga0105241_101117872 262
668 3300009177 Ga0105248_10099912 Ga0105248_100999122 262
669 3300009177 Ga0105248_10907454 Ga0105248_109074542 262
670 3300009545 Ga0105237_10003690 Ga0105237_1000369010 262
671 3300009545 Ga0105237_10018023 Ga0105237_100180237 262
672 3300009545 Ga0105237_10081744 Ga0105237_100817441 262
673 3300009545 Ga0105237_10111094 Ga0105237_101110942 262
674 3300009551 Ga0105238_10038154 Ga0105238_100381542 262
675 3300009551 Ga0105238_10250775 Ga0105238_102507752 262
676 3300009551 Ga0105238_10269569 Ga0105238_102695692 262
677 3300009553 Ga0105249_10480820 Ga0105249_104808202 262
678 3300010375 Ga0105239_10015287 Ga0105239_100152876 262
679 3300010375 Ga0105239_10018873 Ga0105239_100188736 262
680 3300010375 Ga0105239_10096921 Ga0105239_100969213 262
681 3300010375 Ga0105239_10111724 Ga0105239_101117241 262
682 3300010375 Ga0105239_10188800 Ga0105239_101888003 262
683 3300010375 Ga0105239_10317477 Ga0105239_103174773 262
684 3300011119 Ga0105246_10005026 Ga0105246_1000502612 262
685 3300011119 Ga0105246_10017226 Ga0105246_100172262 262
686 3300011119 Ga0105246_10562493 Ga0105246_105624931 262
687 3300013104 Ga0157370_10167354 Ga0157370_101673542 262
688 3300013104 Ga0157370_10180275 Ga0157370_101802752 262
689 3300013105 Ga0157369_10016812 Ga0157369_100168125 262
690 3300013105 Ga0157369_10037771 Ga0157369_100377711 262
691 3300013105 Ga0157369_10074657 Ga0157369_100746572 262
692 3300013105 Ga0157369_10086808 Ga0157369_100868082 262
693 3300013296 Ga0157374_10028177 Ga0157374_100281773 262
694 3300013296 Ga0157374_10053183 Ga0157374_100531836 262
695 3300013296 Ga0157374_10169641 Ga0157374_101696413 262
696 3300013306 Ga0163162_10232701 Ga0163162_102327012 262
697 3300013308 Ga0157375_10081867 Ga0157375_100818672 262
698 3300014497 Ga0182008_10179028 Ga0182008_101790281 262
699 3300014745 Ga0157377_10071003 Ga0157377_100710032 262
700 3300014745 Ga0157377_10262661 Ga0157377_102626612 262
701 3300014969 Ga0157376_10023264 Ga0157376_100232644 262
702 3300014969 Ga0157376_10083788 Ga0157376_100837882 262
703 3300014969 Ga0157376_10401182 Ga0157376_104011822 262
704 3300020081 Ga0206354_11243179 Ga0206354_112431792 262
705 3300020082 Ga0206353_11151056 Ga0206353_111510562 262
706 3300021320 Ga0214544_1000005 Ga0214544_100000541 262
707 3300021321 Ga0214542_1000004 Ga0214542_100000445 262
708 3300021324 Ga0214545_1000005 Ga0214545_1000005352 262
709 3300021327 Ga0214543_1000111 Ga0214543_100011163 262
710 3300021358 Ga0213873_10023750 Ga0213873_100237502 262
711 3300021361 Ga0213872_10060892 Ga0213872_100608923 262
712 3300021388 Ga0213875_10116771 Ga0213875_101167712 262
713 3300025253 Ga0209677_106835 Ga0209677_1068352 262
714 3300025254 Ga0209148_1000235 Ga0209148_100023572 262
715 3300025254 Ga0209148_1013088 Ga0209148_10130882 262
716 3300025261 Ga0209233_1003872 Ga0209233_10038724 262
717 3300025261 Ga0209233_1010292 Ga0209233_10102926 262
718 3300025272 Ga0209455_1000637 Ga0209455_100063715 262
719 3300025291 Ga0209675_1003389 Ga0209675_10033897 262
720 3300025295 Ga0209564_1000755 Ga0209564_100075538 262
721 3300025295 Ga0209564_1005342 Ga0209564_10053421 262
722 3300025295 Ga0209564_1013065 Ga0209564_10130653 262
723 3300025297 Ga0209758_1000102 Ga0209758_1000102174 262
724 3300025297 Ga0209758_1000680 Ga0209758_100068049 262
725 3300025297 Ga0209758_1002859 Ga0209758_10028591 262
726 3300025297 Ga0209758_1003592 Ga0209758_10035929 262
727 3300025297 Ga0209758_1003725 Ga0209758_10037259 262
728 3300025297 Ga0209758_1008851 Ga0209758_10088512 262
729 3300025297 Ga0209758_1037504 Ga0209758_10375042 262
730 3300025299 Ga0209256_1004953 Ga0209256_10049539 262
731 3300025299 Ga0209256_1035119 Ga0209256_10351192 262
732 3300025302 Ga0207426_1000532 Ga0207426_100053244 262
733 3300025302 Ga0207426_1002013 Ga0207426_100201313 262
734 3300025302 Ga0207426_1009466 Ga0207426_10094663 262
735 3300025303 Ga0209051_1044393 Ga0209051_10443931 262
736 3300025303 Ga0209051_1047917 Ga0209051_10479172 262
737 3300025304 Ga0209257_1003378 Ga0209257_10033785 262
738 3300025304 Ga0209257_1006352 Ga0209257_100635210 262
739 3300025885 Ga0207653_10041455 Ga0207653_100414553 262
740 3300025899 Ga0207642_10043735 Ga0207642_100437353 262
741 3300025901 Ga0207688_10046651 Ga0207688_100466512 262
742 3300025903 Ga0207680_10135522 Ga0207680_101355221 262
743 3300025904 Ga0207647_10001253 Ga0207647_100012536 262
744 3300025906 Ga0207699_10019382 Ga0207699_100193824 262
745 3300025906 Ga0207699_10036666 Ga0207699_100366664 262
746 3300025907 Ga0207645_10104474 Ga0207645_101044742 262
747 3300025909 Ga0207705_10048614 Ga0207705_100486141 262
748 3300025909 Ga0207705_10138983 Ga0207705_101389832 262
749 3300025911 Ga0207654_10004638 Ga0207654_100046384 262
750 3300025911 Ga0207654_10017841 Ga0207654_100178413 262
751 3300025912 Ga0207707_10001016 Ga0207707_1000101613 262
752 3300025912 Ga0207707_10032842 Ga0207707_100328424 262
753 3300025913 Ga0207695_10000006 Ga0207695_10000006763 262
754 3300025913 Ga0207695_10007711 Ga0207695_1000771112 262
755 3300025913 Ga0207695_10054420 Ga0207695_100544202 262
756 3300025913 Ga0207695_10403698 Ga0207695_104036981 262
757 3300025914 Ga0207671_10014887 Ga0207671_100148878 262
758 3300025914 Ga0207671_10071058 Ga0207671_100710582 262
759 3300025914 Ga0207671_10118439 Ga0207671_101184394 262
760 3300025915 Ga0207693_10009325 Ga0207693_100093255 262
761 3300025915 Ga0207693_10051019 Ga0207693_100510193 262
762 3300025915 Ga0207693_10060539 Ga0207693_100605392 262
763 3300025916 Ga0207663_10206671 Ga0207663_102066712 262
764 3300025917 Ga0207660_10000924 Ga0207660_1000092414 262
765 3300025917 Ga0207660_10427726 Ga0207660_104277261 262
766 3300025919 Ga0207657_10001391 Ga0207657_1000139125 262
767 3300025919 Ga0207657_10427382 Ga0207657_104273821 262
768 3300025920 Ga0207649_10050880 Ga0207649_100508802 262
769 3300025920 Ga0207649_10073277 Ga0207649_100732774 262
770 3300025921 Ga0207652_10003893 Ga0207652_1000389314 262
771 3300025921 Ga0207652_10004944 Ga0207652_100049445 262
772 3300025924 Ga0207694_10195440 Ga0207694_101954402 262
773 3300025924 Ga0207694_10343030 Ga0207694_103430302 262
774 3300025925 Ga0207650_10172532 Ga0207650_101725323 262
775 3300025927 Ga0207687_10008945 Ga0207687_100089454 262
776 3300025927 Ga0207687_10189937 Ga0207687_101899371 262
777 3300025928 Ga0207700_10034028 Ga0207700_100340284 262
778 3300025931 Ga0207644_10098468 Ga0207644_100984683 262
779 3300025931 Ga0207644_10505516 Ga0207644_105055162 262
780 3300025933 Ga0207706_10169512 Ga0207706_101695124 262
781 3300025935 Ga0207709_10134404 Ga0207709_101344042 262
782 3300025939 Ga0207665_10023296 Ga0207665_100232961 262
783 3300025940 Ga0207691_10562018 Ga0207691_105620181 262
784 3300025941 Ga0207711_10058971 Ga0207711_100589712 262
785 3300025941 Ga0207711_10122248 Ga0207711_101222483 262
786 3300025942 Ga0207689_10051839 Ga0207689_100518392 262
787 3300025942 Ga0207689_10202100 Ga0207689_102021001 262
788 3300025944 Ga0207661_10000421 Ga0207661_1000042110 262
789 3300025944 Ga0207661_10127181 Ga0207661_101271813 262
790 3300025944 Ga0207661_10431918 Ga0207661_104319182 262
791 3300025949 Ga0207667_10015694 Ga0207667_100156948 262
792 3300025949 Ga0207667_10039623 Ga0207667_100396232 262
793 3300025949 Ga0207667_10300169 Ga0207667_103001693 262
794 3300025949 Ga0207667_10528887 Ga0207667_105288872 262
795 3300025972 Ga0207668_10257093 Ga0207668_102570932 262
796 3300025986 Ga0207658_10114099 Ga0207658_101140991 262
797 3300026023 Ga0207677_10056882 Ga0207677_100568822 262
798 3300026041 Ga0207639_10022760 Ga0207639_100227603 262
799 3300026041 Ga0207639_10038860 Ga0207639_100388603 262
800 3300026041 Ga0207639_10226714 Ga0207639_102267142 262
801 3300026067 Ga0207678_10004216 Ga0207678_100042169 262
802 3300026067 Ga0207678_10017767 Ga0207678_100177675 262
803 3300026067 Ga0207678_10025952 Ga0207678_100259523 262
804 3300026067 Ga0207678_10033530 Ga0207678_100335308 262
805 3300026067 Ga0207678_10062172 Ga0207678_100621722 262
806 3300026067 Ga0207678_10083309 Ga0207678_100833091 262
807 3300026067 Ga0207678_10199184 Ga0207678_101991843 262
808 3300026067 Ga0207678_10260106 Ga0207678_102601062 262
809 3300026067 Ga0207678_10538291 Ga0207678_105382911 262
810 3300026075 Ga0207708_10144256 Ga0207708_101442562 262
811 3300026078 Ga0207702_10002502 Ga0207702_100025028 262
812 3300026078 Ga0207702_10151077 Ga0207702_101510772 262
813 3300026088 Ga0207641_10115607 Ga0207641_101156073 262
814 3300026095 Ga0207676_10161141 Ga0207676_101611412 262
815 3300026116 Ga0207674_10016173 Ga0207674_100161736 262
816 3300026116 Ga0207674_10051452 Ga0207674_100514524 262
817 3300026118 Ga0207675_100092259 Ga0207675_1000922593 262
818 3300026121 Ga0207683_10057608 Ga0207683_100576083 262
819 3300026121 Ga0207683_10242336 Ga0207683_102423361 262
820 3300026142 Ga0207698_10163292 Ga0207698_101632922 262
821 3300026142 Ga0207698_10280893 Ga0207698_102808931 262
822 3300027296 Ga0209389_1000021 Ga0209389_1000021123 262
823 3300027296 Ga0209389_1000120 Ga0209389_100012023 262
824 3300027357 Ga0209589_1000005 Ga0209589_1000005294 262
825 3300027357 Ga0209589_1000027 Ga0209589_1000027106 262
826 3300027361 Ga0209489_100005 Ga0209489_100005294 262
827 3300027361 Ga0209489_100023 Ga0209489_10002322 262
828 3300027361 Ga0209489_100742 Ga0209489_10074240 262
829 3300027363 Ga0209700_100006 Ga0209700_100006294 262
830 3300027363 Ga0209700_100134 Ga0209700_10013493 262
831 3300027671 Ga0209588_1003932 Ga0209588_10039325 262
832 3300027866 Ga0209813_10026424 Ga0209813_100264242 262
833 3300027866 Ga0209813_10094012 Ga0209813_100940121 262
834 3300027907 Ga0207428_10325357 Ga0207428_103253571 262
835 3300028379 Ga0268266_10001136 Ga0268266_1000113613 262
836 3300028379 Ga0268266_10003686 Ga0268266_1000368611 262
837 3300028379 Ga0268266_10048100 Ga0268266_100481002 262
838 3300028379 Ga0268266_10175012 Ga0268266_101750122 262
839 3300028379 Ga0268266_10538825 Ga0268266_105388252 262
840 3300028379 Ga0268266_10820899 Ga0268266_108208991 262
841 3300028380 Ga0268265_10019321 Ga0268265_100193212 262
842 3300028380 Ga0268265_10140896 Ga0268265_101408962 262
843 3300028786 Ga0307517_10000098 Ga0307517_10000098113 262
844 3300028794 Ga0307515_10098751 Ga0307515_100987513 262
845 3300028794 Ga0307515_10390958 Ga0307515_103909581 262
846 3300030521 Ga0307511_10232289 Ga0307511_102322891 262
847 3300031241 Ga0265325_10028710 Ga0265325_100287102 262
848 3300031241 Ga0265325_10075344 Ga0265325_100753442 262
849 3300031249 Ga0265339_10120058 Ga0265339_101200581 262
850 3300031250 Ga0265331_10104634 Ga0265331_101046341 262
851 3300031250 Ga0265331_10129459 Ga0265331_101294592 262
852 3300031344 Ga0265316_10171724 Ga0265316_101717242 262
853 3300031344 Ga0265316_10204536 Ga0265316_102045361 262
854 3300031456 Ga0307513_10067968 Ga0307513_100679682 262
855 3300031456 Ga0307513_10203303 Ga0307513_102033032 262
856 3300031595 Ga0265313_10000710 Ga0265313_1000071018 262
857 3300031595 Ga0265313_10065446 Ga0265313_100654462 262
858 3300031711 Ga0265314_10051287 Ga0265314_100512874 262
859 3300031730 Ga0307516_10046388 Ga0307516_100463888 262
860 3300031731 Ga0307405_10272364 Ga0307405_102723642 262
861 3300031903 Ga0307407_10140011 Ga0307407_101400112 262
862 3300031911 Ga0307412_10125422 Ga0307412_101254223 262
863 3300032002 Ga0307416_100856021 Ga0307416_1008560211 262
864 3300032005 Ga0307411_10174325 Ga0307411_101743252 262
865 3300032126 Ga0307415_100173986 Ga0307415_1001739862 262
866 3300032133 Ga0316583_10002297 Ga0316583_100022972 262
867 3300033180 Ga0307510_10007562 Ga0307510_100075626 262
868 3300033180 Ga0307510_10195621 Ga0307510_101956211 262
869 3300033442 Ga0315911_1000005 Ga0315911_1000005248 262
870 3300034820 Ga0373959_0021087 Ga0373959_0021087_59_847 262
871 3300035086 Ga0373934_0044113 Ga0373934_0044113_11_799 262
872 3300035112 Ga0373932_0069945 Ga0373932_0069945_259_1047 262
873 3300035113 Ga0373936_0097111 Ga0373936_0097111_396_1184 262
874 3300035113 Ga0373936_0129041 Ga0373936_0129041_176_964 262
875 3300035116 Ga0373945_0005116 Ga0373945_0005116_584_1372 262
876 3300035118 Ga0373954_0008305 Ga0373954_0008305_216_1004 262
877 3300035119 Ga0373956_0027829 Ga0373956_0027829_669_1457 262
878 3300035120 Ga0373957_0030699 Ga0373957_0030699_493_1281 262
879 3300035120 Ga0373957_0034940 Ga0373957_0034940_863_1651 262
880 3300035171 Ga0373946_0007962 Ga0373946_0007962_2311_3099 262
881 3300035172 Ga0373955_0018833 Ga0373955_0018833_724_1512 262
882 3300035410 Ga0373924_0035360 Ga0373924_0035360_599_1387 262
883 3300035692 Ga0373935_0000520 Ga0373935_0000520_12355_13143 262
884 3300035695 Ga0373927_0000046 Ga0373927_0000046_49276_50064 262
885 3300035695 Ga0373927_0005938 Ga0373927_0005938_6519_7307 262
886 3300035695 Ga0373927_0113941 Ga0373927_0113941_665_1453 262
887 3300035725 Ga0373947_0001392 Ga0373947_0001392_7314_8102 262
888 3300035725 Ga0373947_0021349 Ga0373947_0021349_2935_3723 262
889 3300035725 Ga0373947_0466112 Ga0373947_0466112_44_832 262
890 3300036401 Ga0373937_0016441 Ga0373937_0016441_4340_5128 262
891 3300036401 Ga0373937_0075827 Ga0373937_0075827_1059_1847 262
892 3300036401 Ga0373937_0103455 Ga0373937_0103455_1432_2220 262
893 3300036401 Ga0373937_0147334 Ga0373937_0147334_1278_2066 262
894 3300037068 Ga0373925_0009905 Ga0373925_0009905_4984_5772 262
895 3300037068 Ga0373925_0219496 Ga0373925_0219496_599_1387 262
896 3300037312 Ga0395899_0116459 Ga0395899_0116459_275_1063 262
897 3300037418 Ga0395900_0016187 Ga0395900_0016187_3669_4457 262
898 3300037418 Ga0395900_0032079 Ga0395900_0032079_1534_2322 262
899 3300037418 Ga0395900_0290498 Ga0395900_0290498_654_1454 262
900 3300037466 Ga0395898_0030023 Ga0395898_0030023_4505_5293 262
901 3300037466 Ga0395898_0143916 Ga0395898_0143916_715_1503 262
902 3300037466 Ga0395898_0146208 Ga0395898_0146208_871_1659 262
903 3300037466 Ga0395898_0252291 Ga0395898_0252291_269_1057 262
904 3300037471 Ga0395905_0025920 Ga0395905_0025920_4600_5388 262
905 3300037471 Ga0395905_0235405 Ga0395905_0235405_407_1207 262
906 3300037853 Ga0436364_0166778 Ga0436364_0166778_382_1170 262
907 3300038443 Ga0395901_0044922 Ga0395901_0044922_3442_4230 262
908 3300038443 Ga0395901_0097370 Ga0395901_0097370_743_1531 262
909 3300038443 Ga0395901_0113876 Ga0395901_0113876_18_806 262
910 3300038443 Ga0395901_0254458 Ga0395901_0254458_533_1321 262
911 3300038443 Ga0395901_0274779 Ga0395901_0274779_357_1154 262
912 3300039437 Ga0436365_0396839 Ga0436365_0396839_428_1216 262
913 3300039437 Ga0436365_1044448 Ga0436365_1044448_715_1503 262
914 3300039437 Ga0436365_1580006 Ga0436365_1580006_126_914 262
915 3300039437 Ga0436365_1607466 Ga0436365_1607466_14_802 262
916 3300039447 Ga0436361_0783902 Ga0436361_0783902_2000_2788 262
917 3300039447 Ga0436361_1109558 Ga0436361_1109558_131_919 262
918 3300039453 Ga0436362_1140786 Ga0436362_1140786_190_978 262
919 3300041491 Ga0451833_0606252 Ga0451833_0606252_206_994 262
920 3300044656 Ga0466969_0015917 Ga0466969_0015917_3080_3898 262
921 3300044658 Ga0466972_0000126 Ga0466972_0000126_55438_56226 262
922 3300044684 Ga0466966_0145138 Ga0466966_0145138_47_835 262
923 3300044684 Ga0466966_0190717 Ga0466966_0190717_172_960 262
924 3300044693 Ga0466961_0000025 Ga0466961_0000025_17334_18224 262
925 3300044694 Ga0466963_0011648 Ga0466963_0011648_2252_3040 262
926 3300044694 Ga0466963_0115616 Ga0466963_0115616_318_1106 262
927 3300044735 Ga0466968_0053776 Ga0466968_0053776_535_1323 262
928 3300044735 Ga0466968_0121279 Ga0466968_0121279_79_867 262
929 3300044842 Ga0466957_0169526 Ga0466957_0169526_502_1290 262
930 3300044842 Ga0466957_0396019 Ga0466957_0396019_73_861 262
931 3300045049 Ga0466959_0000873 Ga0466959_0000873_11123_12013 262
932 3300045049 Ga0466959_0163188 Ga0466959_0163188_101_889 262
933 3300045049 Ga0466959_0254451 Ga0466959_0254451_205_993 262
934 3300045976 Ga0466967_0047331 Ga0466967_0047331_529_1317 262
935 3300045976 Ga0466967_0090497 Ga0466967_0090497_1486_2274 262
936 3300045976 Ga0466967_0409122 Ga0466967_0409122_290_1078 262
937 3300046454 Ga0495592_0124840 Ga0495592_0124840_104_892 262
938 3300046454 Ga0495592_0151994 Ga0495592_0151994_632_1420 262
939 3300046454 Ga0495592_0156808 Ga0495592_0156808_86_874 262
940 3300046455 Ga0495603_0000051 Ga0495603_0000051_12437_13225 262
941 3300046455 Ga0495603_0105023 Ga0495603_0105023_700_1488 262
942 3300046455 Ga0495603_0155784 Ga0495603_0155784_29_817 262
943 3300046459 Ga0495629_0000182 Ga0495629_0000182_40329_41117 262
944 3300046459 Ga0495629_0043713 Ga0495629_0043713_1656_2444 262
945 3300046460 Ga0495638_0003938 Ga0495638_0003938_4810_5598 262
946 3300046460 Ga0495638_0013321 Ga0495638_0013321_3345_4148 262
947 3300046460 Ga0495638_0029466 Ga0495638_0029466_2304_3107 262
948 3300046460 Ga0495638_0107663 Ga0495638_0107663_614_1417 262
949 3300046460 Ga0495638_0116709 Ga0495638_0116709_601_1416 262
950 3300046461 Ga0495641_0006374 Ga0495641_0006374_5412_6200 262
951 3300046462 Ga0495651_0049059 Ga0495651_0049059_1249_2037 262
952 3300046462 Ga0495651_0118365 Ga0495651_0118365_1098_1886 262
953 3300046462 Ga0495651_0141321 Ga0495651_0141321_234_1022 262
954 3300046462 Ga0495651_0232686 Ga0495651_0232686_264_1052 262
955 3300046462 Ga0495651_0431907 Ga0495651_0431907_47_835 262
956 3300046463 Ga0495653_0200069 Ga0495653_0200069_216_1004 262
957 3300046472 Ga0495580_0004021 Ga0495580_0004021_4910_5698 262
958 3300046473 Ga0495582_0000137 Ga0495582_0000137_28989_29777 262
959 3300046475 Ga0495639_0000047 Ga0495639_0000047_50742_51530 262
960 3300046475 Ga0495639_0016665 Ga0495639_0016665_309_1103 262
961 3300046475 Ga0495639_0076376 Ga0495639_0076376_72_860 262
962 3300046475 Ga0495639_0110879 Ga0495639_0110879_26_814 262
963 3300046476 Ga0495662_0001496 Ga0495662_0001496_2554_3342 262
964 3300046477 Ga0495664_0001335 Ga0495664_0001335_971_1759 262
965 3300046477 Ga0495664_0023753 Ga0495664_0023753_1978_2766 262
966 3300046477 Ga0495664_0034436 Ga0495664_0034436_1235_2038 262
967 3300046477 Ga0495664_0036584 Ga0495664_0036584_752_1552 262
968 3300046477 Ga0495664_0061085 Ga0495664_0061085_1239_2027 262
969 3300046477 Ga0495664_0145246 Ga0495664_0145246_250_1038 262
970 3300046477 Ga0495664_0352426 Ga0495664_0352426_21_809 262
971 3300046491 Ga0495584_0044891 Ga0495584_0044891_533_1321 262
972 3300046491 Ga0495584_0109348 Ga0495584_0109348_452_1240 262
973 3300046499 Ga0495594_0001833 Ga0495594_0001833_5241_6029 262
974 3300046499 Ga0495594_0055256 Ga0495594_0055256_534_1322 262
975 3300046499 Ga0495594_0191194 Ga0495594_0191194_195_983 262
976 3300046501 Ga0495607_0077143 Ga0495607_0077143_95_898 262
977 3300046507 Ga0495606_0023313 Ga0495606_0023313_2003_2791 262
978 3300046507 Ga0495606_0187297 Ga0495606_0187297_247_1050 262
979 3300046511 Ga0495608_0035676 Ga0495608_0035676_721_1509 262
980 3300046511 Ga0495608_0041836 Ga0495608_0041836_338_1126 262
981 3300046514 Ga0495618_0185823 Ga0495618_0185823_144_932 262
982 3300046515 Ga0495620_0023843 Ga0495620_0023843_969_1772 262
983 3300046515 Ga0495620_0123525 Ga0495620_0123525_155_943 262
984 3300046516 Ga0495628_0030327 Ga0495628_0030327_1129_1917 262
985 3300046516 Ga0495628_0031595 Ga0495628_0031595_1292_2080 262
986 3300046516 Ga0495628_0065433 Ga0495628_0065433_602_1390 262
987 3300046517 Ga0495630_0002625 Ga0495630_0002625_6797_7585 262
988 3300046522 Ga0495643_0155884 Ga0495643_0155884_325_1113 262
989 3300046523 Ga0495644_0024756 Ga0495644_0024756_793_1581 262
990 3300046524 Ga0495648_0037184 Ga0495648_0037184_1792_2595 262
991 3300046524 Ga0495648_0052154 Ga0495648_0052154_1057_1872 262
992 3300046524 Ga0495648_0145614 Ga0495648_0145614_56_844 262
993 3300046526 Ga0495666_0072875 Ga0495666_0072875_662_1450 262
994 3300046528 Ga0495642_0048876 Ga0495642_0048876_918_1706 262
995 3300046529 Ga0495652_0035614 Ga0495652_0035614_3154_3942 262
996 3300046529 Ga0495652_0116125 Ga0495652_0116125_845_1633 262
997 3300046530 Ga0495654_0026918 Ga0495654_0026918_894_1697 262
998 3300046531 Ga0495665_0001239 Ga0495665_0001239_5076_5864 262
999 3300046533 Ga0495640_0004375 Ga0495640_0004375_4286_5074 262
1000 3300046533 Ga0495640_0039432 Ga0495640_0039432_121_909 262
1001 3300046535 Ga0495586_0056945 Ga0495586_0056945_132_920 262
1002 3300046535 Ga0495586_0251223 Ga0495586_0251223_176_964 262
1003 3300046536 Ga0495587_0025522 Ga0495587_0025522_2313_3101 262
1004 3300046536 Ga0495587_0050017 Ga0495587_0050017_574_1362 262
1005 3300046538 Ga0495609_0095258 Ga0495609_0095258_78_866 262
1006 3300046542 Ga0495597_0068617 Ga0495597_0068617_400_1188 262
1007 3300046543 Ga0495645_0006200 Ga0495645_0006200_5931_6719 262
1008 3300046543 Ga0495645_0038038 Ga0495645_0038038_2154_2942 262
1009 3300046543 Ga0495645_0083302 Ga0495645_0083302_761_1549 262
1010 3300046557 Ga0495622_0006199 Ga0495622_0006199_586_1374 262
1011 3300046557 Ga0495622_0019937 Ga0495622_0019937_1798_2586 262
1012 3300046557 Ga0495622_0052256 Ga0495622_0052256_534_1322 262
1013 3300046557 Ga0495622_0087161 Ga0495622_0087161_259_1047 262
1014 3300046558 Ga0495633_0067115 Ga0495633_0067115_265_1053 262
1015 3300046559 Ga0495667_0011170 Ga0495667_0011170_3250_4038 262
1016 3300046559 Ga0495667_0011352 Ga0495667_0011352_4532_5320 262
1017 3300046559 Ga0495667_0231259 Ga0495667_0231259_120_908 262
1018 3300046559 Ga0495667_0346272 Ga0495667_0346272_59_847 262
1019 3300046616 Ga0495668_0114481 Ga0495668_0114481_598_1386 262
1020 3300046616 Ga0495668_0281015 Ga0495668_0281015_76_864 262
1021 3300046642 Ga0495634_0002221 Ga0495634_0002221_6609_7397 262
1022 3300046642 Ga0495634_0080503 Ga0495634_0080503_1061_1849 262
1023 3300046642 Ga0495634_0114296 Ga0495634_0114296_912_1700 262
1024 3300046663 Ga0495635_0001455 Ga0495635_0001455_6755_7543 262
1025 3300046663 Ga0495635_0043906 Ga0495635_0043906_1762_2550 262
1026 3300046664 Ga0495659_0017854 Ga0495659_0017854_105_893 262
1027 3300046665 Ga0495661_0067748 Ga0495661_0067748_959_1747 262
1028 3300046674 Ga0495588_0009398 Ga0495588_0009398_668_1456 262
1029 3300046674 Ga0495588_0027119 Ga0495588_0027119_856_1644 262
1030 3300046674 Ga0495588_0082779 Ga0495588_0082779_530_1318 262
1031 3300046675 Ga0495657_0006427 Ga0495657_0006427_1311_2099 262
1032 3300046675 Ga0495657_0007196 Ga0495657_0007196_1915_2703 262
1033 3300046675 Ga0495657_0263483 Ga0495657_0263483_12_800 262
1034 3300046678 Ga0495599_0004838 Ga0495599_0004838_5093_5881 262
1035 3300046678 Ga0495599_0012226 Ga0495599_0012226_4185_4973 262
1036 3300046678 Ga0495599_0063521 Ga0495599_0063521_602_1390 262
1037 3300046679 Ga0495623_0043882 Ga0495623_0043882_1990_2778 262
1038 3300046679 Ga0495623_0047224 Ga0495623_0047224_1041_1829 262
1039 3300046679 Ga0495623_0105003 Ga0495623_0105003_777_1565 262
1040 3300046680 Ga0495646_0019779 Ga0495646_0019779_1225_2013 262
1041 3300046680 Ga0495646_0188503 Ga0495646_0188503_246_1034 262
1042 3300046681 Ga0495647_0000577 Ga0495647_0000577_8736_9524 262
1043 3300046683 Ga0495658_0001786 Ga0495658_0001786_8785_9573 262
1044 3300046689 Ga0495613_0007297 Ga0495613_0007297_2333_3121 262
1045 3300046689 Ga0495613_0279715 Ga0495613_0279715_160_948 262
1046 3300046690 Ga0495624_0000898 Ga0495624_0000898_8762_9550 262
1047 3300046691 Ga0495670_0007688 Ga0495670_0007688_1249_2052 262
1048 3300046694 Ga0495649_0011437 Ga0495649_0011437_1843_2631 262
1049 3300046809 Ga0495600_0007660 Ga0495600_0007660_760_1548 262
1050 3300046809 Ga0495600_0046708 Ga0495600_0046708_1562_2350 262
1051 3300046809 Ga0495600_0245128 Ga0495600_0245128_39_827 262
1052 3300046809 Ga0495600_0402645 Ga0495600_0402645_31_819 262
1053 3300047315 Ga0495581_0197040 Ga0495581_0197040_29_817 262
1054 3300047317 Ga0495604_0025793 Ga0495604_0025793_870_1658 262
1055 3300047317 Ga0495604_0032865 Ga0495604_0032865_952_1740 262
1056 3300047319 Ga0495674_0010092 Ga0495674_0010092_6500_7288 262
1057 3300047319 Ga0495674_0030208 Ga0495674_0030208_525_1313 262
1058 3300047320 Ga0495672_0200326 Ga0495672_0200326_49_837 262
1059 3300047321 Ga0495676_0035661 Ga0495676_0035661_476_1264 262
1060 3300047322 Ga0495680_0003456 Ga0495680_0003456_12893_13681 262
1061 3300047322 Ga0495680_0016657 Ga0495680_0016657_3468_4256 262
1062 3300047323 Ga0495683_0094120 Ga0495683_0094120_384_1172 262
1063 3300047443 Ga0495687_098245 Ga0495687_098245_268_1056 262
1064 3300047444 Ga0495675_0025339 Ga0495675_0025339_2391_3179 262
1065 3300047444 Ga0495675_0097296 Ga0495675_0097296_804_1592 262
1066 3300047469 Ga0495673_0018535 Ga0495673_0018535_659_1447 262
1067 3300047469 Ga0495673_0079474 Ga0495673_0079474_126_914 262
1068 3300047471 Ga0495684_0014553 Ga0495684_0014553_3119_3907 262
1069 3300047471 Ga0495684_0024347 Ga0495684_0024347_594_1382 262
1070 3300047472 Ga0495686_0073735 Ga0495686_0073735_484_1272 262
1071 3300047472 Ga0495686_0152408 Ga0495686_0152408_73_861 262
1072 3300047673 Ga0495593_0000469 Ga0495593_0000469_20086_20874 262
1073 3300048088 Ga0495602_0009739 Ga0495602_0009739_2792_3580 262
1074 3300048088 Ga0495602_0175500 Ga0495602_0175500_188_976 262
1075 3300048089 Ga0495614_0001926 Ga0495614_0001926_4208_4996 262
1076 3300048903 Ga0496100_0001098 Ga0496100_0001098_11640_12428 262
1077 3300048903 Ga0496100_0025314 Ga0496100_0025314_2202_2990 262
1078 3300048903 Ga0496100_0611768 Ga0496100_0611768_30_818 262
1079 3300048904 Ga0496101_0007768 Ga0496101_0007768_4454_5242 262
1080 3300048904 Ga0496101_0204607 Ga0496101_0204607_235_1023 262
1081 3300048904 Ga0496101_0209813 Ga0496101_0209813_351_1139 262
1082 3300048904 Ga0496101_0456393 Ga0496101_0456393_137_925 262
1083 3300048905 Ga0496102_0008520 Ga0496102_0008520_4540_5328 262
1084 3300048905 Ga0496102_0092857 Ga0496102_0092857_1616_2404 262
1085 3300048906 Ga0496103_0031194 Ga0496103_0031194_750_1538 262
1086 3300048906 Ga0496103_0232949 Ga0496103_0232949_128_916 262
1087 3300048907 Ga0496104_0021810 Ga0496104_0021810_2118_2906 262
1088 3300048907 Ga0496104_0075775 Ga0496104_0075775_1466_2254 262
1089 3300048907 Ga0496104_0103613 Ga0496104_0103613_272_1060 262
1090 3300048907 Ga0496104_0143993 Ga0496104_0143993_882_1670 262
1091 3300048907 Ga0496104_0453855 Ga0496104_0453855_157_945 262
1092 3300048908 Ga0496105_0050226 Ga0496105_0050226_483_1271 262
1093 3300048908 Ga0496105_0088994 Ga0496105_0088994_186_974 262
1094 3300048908 Ga0496105_0302833 Ga0496105_0302833_435_1232 262
1095 3300048908 Ga0496105_0318889 Ga0496105_0318889_343_1131 262
1096 3300048908 Ga0496105_0444744 Ga0496105_0444744_42_830 262
1097 3300048909 Ga0496106_0021872 Ga0496106_0021872_2114_2902 262
1098 3300048909 Ga0496106_0031033 Ga0496106_0031033_803_1591 262
1099 3300048909 Ga0496106_0316315 Ga0496106_0316315_91_879 262
1100 3300048910 Ga0496107_0006973 Ga0496107_0006973_5085_5873 262
1101 3300048910 Ga0496107_0011332 Ga0496107_0011332_1787_2575 262
1102 3300048910 Ga0496107_0033519 Ga0496107_0033519_410_1210 262
1103 3300048910 Ga0496107_0150128 Ga0496107_0150128_702_1490 262
1104 3300048910 Ga0496107_0189283 Ga0496107_0189283_628_1416 262
1105 3300048910 Ga0496107_0429676 Ga0496107_0429676_91_879 262
1106 3300048911 Ga0496108_0000681 Ga0496108_0000681_21706_22494 262
1107 3300048911 Ga0496108_0041142 Ga0496108_0041142_752_1540 262
1108 3300048911 Ga0496108_0104755 Ga0496108_0104755_1151_1939 262
1109 3300048911 Ga0496108_0235771 Ga0496108_0235771_54_842 262
1110 3300048911 Ga0496108_0258706 Ga0496108_0258706_168_956 262
1111 3300048912 Ga0496109_0000450 Ga0496109_0000450_30651_31439 262
1112 3300048912 Ga0496109_0118426 Ga0496109_0118426_66_854 262
1113 3300048913 Ga0496110_0009862 Ga0496110_0009862_3359_4147 262
1114 3300048913 Ga0496110_0015912 Ga0496110_0015912_80_868 262
1115 3300048913 Ga0496110_0061414 Ga0496110_0061414_2381_3181 262
1116 3300048914 Ga0496111_0026720 Ga0496111_0026720_35_835 262
1117 3300048914 Ga0496111_0117031 Ga0496111_0117031_85_873 262
1118 3300048914 Ga0496111_0143250 Ga0496111_0143250_720_1508 262
1119 3300048914 Ga0496111_0220909 Ga0496111_0220909_344_1132 262
1120 3300048915 Ga0496112_0005466 Ga0496112_0005466_3814_4602 262
1121 3300048915 Ga0496112_0080070 Ga0496112_0080070_1775_2563 262
1122 3300048915 Ga0496112_0099921 Ga0496112_0099921_1914_2702 262
1123 3300048915 Ga0496112_0357155 Ga0496112_0357155_40_828 262
1124 3300048916 Ga0496113_0073139 Ga0496113_0073139_473_1261 262
1125 3300048916 Ga0496113_0083237 Ga0496113_0083237_1323_2111 262
1126 3300048916 Ga0496113_0268345 Ga0496113_0268345_73_861 262
1127 3300048917 Ga0496114_0043733 Ga0496114_0043733_1688_2476 262
1128 3300048917 Ga0496114_0073639 Ga0496114_0073639_1427_2227 262
1129 3300048917 Ga0496114_0378150 Ga0496114_0378150_147_935 262
1130 3300048918 Ga0496115_0025021 Ga0496115_0025021_1197_1985 262
1131 3300048918 Ga0496115_0078214 Ga0496115_0078214_1389_2189 262
1132 3300048918 Ga0496115_0125033 Ga0496115_0125033_201_989 262
1133 3300048918 Ga0496115_0138205 Ga0496115_0138205_130_918 262
1134 3300048918 Ga0496115_0473303 Ga0496115_0473303_169_957 262
1135 3300048919 Ga0496116_0013006 Ga0496116_0013006_2448_3251 262
1136 3300048919 Ga0496116_0134361 Ga0496116_0134361_454_1242 262
1137 3300048920 Ga0496117_0042127 Ga0496117_0042127_1365_2153 262
1138 3300048921 Ga0496118_0105601 Ga0496118_0105601_43_846 262
1139 3300048921 Ga0496118_0221411 Ga0496118_0221411_55_843 262
1140 3300048921 Ga0496118_0232281 Ga0496118_0232281_138_926 262
1141 3300048922 Ga0496119_0096910 Ga0496119_0096910_733_1521 262
1142 3300048922 Ga0496119_0125484 Ga0496119_0125484_540_1328 262
1143 3300048922 Ga0496119_0159858 Ga0496119_0159858_358_1161 262
1144 3300048923 Ga0496120_0017558 Ga0496120_0017558_3630_4418 262
1145 3300048923 Ga0496120_0047496 Ga0496120_0047496_362_1165 262
1146 3300048924 Ga0496121_0004144 Ga0496121_0004144_18935_19750 262
1147 3300048924 Ga0496121_0004646 Ga0496121_0004646_12024_12851 262
1148 3300048924 Ga0496121_0011273 Ga0496121_0011273_2190_2978 262
1149 3300048924 Ga0496121_0020673 Ga0496121_0020673_5279_6067 262
1150 3300048924 Ga0496121_0054482 Ga0496121_0054482_1515_2303 262
1151 3300048924 Ga0496121_0079161 Ga0496121_0079161_1266_2054 262
1152 3300048924 Ga0496121_0387127 Ga0496121_0387127_92_880 262
1153 3300048925 Ga0496122_0027804 Ga0496122_0027804_1689_2492 262
1154 3300048926 Ga0496123_0041988 Ga0496123_0041988_2145_2948 262
1155 3300048927 Ga0496124_0117186 Ga0496124_0117186_391_1179 262
1156 3300048927 Ga0496124_0157120 Ga0496124_0157120_390_1178 262
1157 3300048927 Ga0496124_0175044 Ga0496124_0175044_354_1157 262
1158 3300048927 Ga0496124_0311890 Ga0496124_0311890_296_1084 262
1159 3300048928 Ga0496125_0014087 Ga0496125_0014087_6158_6961 262
1160 3300048928 Ga0496125_0034884 Ga0496125_0034884_54_842 262
1161 3300048928 Ga0496125_0239573 Ga0496125_0239573_87_875 262
1162 3300048928 Ga0496125_0240716 Ga0496125_0240716_146_934 262
1163 3300048929 Ga0496126_0007855 Ga0496126_0007855_8348_9136 262
1164 3300048929 Ga0496126_0020062 Ga0496126_0020062_1214_2002 262
1165 3300048929 Ga0496126_0021191 Ga0496126_0021191_5108_5896 262
1166 3300048929 Ga0496126_0050628 Ga0496126_0050628_2814_3602 262
1167 3300048929 Ga0496126_0057447 Ga0496126_0057447_2241_3029 262
1168 3300048929 Ga0496126_0123865 Ga0496126_0123865_58_846 262
1169 3300048929 Ga0496126_0131840 Ga0496126_0131840_489_1277 262
1170 3300048929 Ga0496126_0180569 Ga0496126_0180569_565_1353 262
1171 3300048929 Ga0496126_0239287 Ga0496126_0239287_32_820 262
1172 3300048929 Ga0496126_0351035 Ga0496126_0351035_231_1019 262
1173 3300049460 Ga0495682_0045355 Ga0495682_0045355_694_1482 262
1174 3300049570 Ga0501033_0137433 Ga0501033_0137433_541_1329 262
1175 3300049571 Ga0501034_0271556 Ga0501034_0271556_607_1398 262
1176 3300049572 Ga0501036_0153801 Ga0501036_0153801_930_1718 262
1177 3300049572 Ga0501036_0255863 Ga0501036_0255863_11_802 262
1178 3300049580 Ga0501046_0032260 Ga0501046_0032260_3158_3946 262
1179 3300049581 Ga0501047_0183419 Ga0501047_0183419_1085_1873 262
1180 3300049586 Ga0501070_0004540 Ga0501070_0004540_9884_10672 262
1181 3300049586 Ga0501070_0172352 Ga0501070_0172352_588_1376 262
1182 3300049586 Ga0501070_0216585 Ga0501070_0216585_48_839 262
1183 3300049587 Ga0501071_0070112 Ga0501071_0070112_442_1230 262
1184 3300049587 Ga0501071_0210478 Ga0501071_0210478_65_859 262
1185 3300049590 Ga0501074_0035328 Ga0501074_0035328_739_1527 262
1186 3300049592 Ga0501076_0391201 Ga0501076_0391201_243_1031 262
1187 3300049742 Ga0501080_0005538 Ga0501080_0005538_4358_5146 262
1188 3300049742 Ga0501080_0079849 Ga0501080_0079849_1367_2158 262
1189 3300049743 Ga0501081_0225355 Ga0501081_0225355_272_1060 262
1190 3300049744 Ga0501083_0009923 Ga0501083_0009923_323_1114 262
1191 3300049823 Ga0501044_0046842 Ga0501044_0046842_185_973 262
1192 3300049823 Ga0501044_0092432 Ga0501044_0092432_1441_2229 262
1193 3300049823 Ga0501044_0120000 Ga0501044_0120000_1324_2112 262
1194 3300049823 Ga0501044_0164958 Ga0501044_0164958_423_1235 262
1195 3300050489 nmdc:mga03683_11799_c1 nmdc:mga03683_11799_c1_2082_2870 262
1196 3300050489 nmdc:mga03683_1474_c1 nmdc:mga03683_1474_c1_4983_5771 262
1197 3300050489 nmdc:mga03683_3122_c1 nmdc:mga03683_3122_c1_2558_3346 262
1198 3300050490 nmdc:mga03n38_110804_c1 nmdc:mga03n38_110804_c1_446_1234 262
1199 3300050490 nmdc:mga03n38_55032_c1 nmdc:mga03n38_55032_c1_735_1523 262
1200 3300050491 nmdc:mga00v17_222206_c1 nmdc:mga00v17_222206_c1_51_839 262
1201 3300050492 nmdc:mga0yw44_3010_c1 nmdc:mga0yw44_3010_c1_4363_5151 262
1202 3300050493 nmdc:mga0k408_332236_c1 nmdc:mga0k408_332236_c1_73_861 262
1203 3300050493 nmdc:mga0k408_43647_c1 nmdc:mga0k408_43647_c1_1404_2192 262
1204 3300050494 nmdc:mga06z11_111400_c1 nmdc:mga06z11_111400_c1_593_1381 262
1205 3300050494 nmdc:mga06z11_233064_c1 nmdc:mga06z11_233064_c1_135_923 262
1206 3300050494 nmdc:mga06z11_29164_c1 nmdc:mga06z11_29164_c1_1285_2073 262
1207 3300050494 nmdc:mga06z11_59566_c1 nmdc:mga06z11_59566_c1_142_930 262
1208 3300050495 nmdc:mga04h51_111410_c1 nmdc:mga04h51_111410_c1_29_817 262
1209 3300050496 nmdc:mga07m45_104987_c1 nmdc:mga07m45_104987_c1_225_1013 262
1210 3300050496 nmdc:mga07m45_117657_c1 nmdc:mga07m45_117657_c1_525_1313 262
1211 3300050496 nmdc:mga07m45_125034_c1 nmdc:mga07m45_125034_c1_77_865 262
1212 3300050511 nmdc:mga08y16_484020_c1 nmdc:mga08y16_484020_c1_443_1231 262
1213 3300050512 nmdc:mga0n895_105724_c1 nmdc:mga0n895_105724_c1_1392_2180 262
1214 3300050512 nmdc:mga0n895_19893_c1 nmdc:mga0n895_19893_c1_2055_2843 262
1215 3300050512 nmdc:mga0n895_456373_c1 nmdc:mga0n895_456373_c1_167_955 262
1216 3300050516 nmdc:mga0sz30_83144_c1 nmdc:mga0sz30_83144_c1_267_1055 262
1217 3300050516 nmdc:mga0sz30_98535_c1 nmdc:mga0sz30_98535_c1_161_964 262
1218 3300053077 Ga0495601_0049011 Ga0495601_0049011_773_1561 262
1219 3300053077 Ga0495601_0071093 Ga0495601_0071093_996_1784 262
1220 3300053077 Ga0495601_0090397 Ga0495601_0090397_802_1590 262
1221 3300053078 Ga0495612_0012298 Ga0495612_0012298_1126_1914 262
1222 3300053080 Ga0500635_0015817 Ga0500635_0015817_1141_1929 262
1223 3300053083 Ga0495655_0081910 Ga0495655_0081910_56_844 262
1224 3300053085 Ga0495619_0181288 Ga0495619_0181288_212_1021 262
1225 3300053086 Ga0500578_0242366 Ga0500578_0242366_156_944 262
1226 3300053087 Ga0500643_000016 Ga0500643_000016_48069_48857 262
1227 3300053088 Ga0500644_0120262 Ga0500644_0120262_101_889 262
1228 3300053091 Ga0500647_0060458 Ga0500647_0060458_154_942 262
1229 3300053092 Ga0500583_0011788 Ga0500583_0011788_2435_3223 262
1230 3300053093 Ga0500651_0007818 Ga0500651_0007818_1990_2958 262
1231 3300053094 Ga0500566_0000078 Ga0500566_0000078_35960_36748 262
1232 3300053094 Ga0500566_0000290 Ga0500566_0000290_20171_20959 262
1233 3300053094 Ga0500566_0003107 Ga0500566_0003107_4200_5003 262
1234 3300053095 Ga0500640_000121 Ga0500640_000121_13550_14338 262
1235 3300053096 Ga0500641_0000385 Ga0500641_0000385_10345_11133 262
1236 3300053096 Ga0500641_0004079 Ga0500641_0004079_172_960 262
1237 3300053096 Ga0500641_0043383 Ga0500641_0043383_1008_1811 262
1238 3300053096 Ga0500641_0066567 Ga0500641_0066567_282_1070 262
1239 3300053096 Ga0500641_0072315 Ga0500641_0072315_548_1336 262
1240 3300053098 Ga0500650_0003982 Ga0500650_0003982_54_857 262
1241 3300053103 Ga0500555_006193 Ga0500555_006193_2325_3113 262
1242 3300053104 Ga0500556_0000195 Ga0500556_0000195_5469_6272 262
1243 3300053105 Ga0500557_000011 Ga0500557_000011_45581_46369 262
1244 3300053108 Ga0500562_001257 Ga0500562_001257_368_1171 262
1245 3300053109 Ga0500569_047274 Ga0500569_047274_486_1274 262
1246 3300053109 Ga0500569_068215 Ga0500569_068215_121_909 262
1247 3300053111 Ga0500572_000170 Ga0500572_000170_5531_6319 262
1248 3300053117 Ga0500593_136427 Ga0500593_136427_36_839 262
1249 3300053119 Ga0500595_001017 Ga0500595_001017_4041_4829 262
1250 3300053119 Ga0500595_001686 Ga0500595_001686_4318_5106 262
1251 3300053119 Ga0500595_009585 Ga0500595_009585_95_883 262
1252 3300053119 Ga0500595_050090 Ga0500595_050090_372_1160 262
1253 3300053120 Ga0500597_177569 Ga0500597_177569_40_828 262
1254 3300053121 Ga0500607_087138 Ga0500607_087138_375_1163 262
1255 3300053122 Ga0500608_046544 Ga0500608_046544_119_907 262
1256 3300053125 Ga0500618_015074 Ga0500618_015074_922_1725 262
1257 3300053130 Ga0500642_0000012 Ga0500642_0000012_5385_6212 262
1258 3300053130 Ga0500642_0000090 Ga0500642_0000090_5814_6602 262
1259 3300053130 Ga0500642_0008061 Ga0500642_0008061_2777_3565 262
1260 3300053130 Ga0500642_0053707 Ga0500642_0053707_519_1307 262
1261 3300053130 Ga0500642_0091731 Ga0500642_0091731_477_1265 262
1262 3300053131 Ga0500652_000327 Ga0500652_000327_5347_6150 262
1263 3300053136 Ga0500559_0000421 Ga0500559_0000421_11387_12190 262
1264 3300053136 Ga0500559_0004643 Ga0500559_0004643_160_948 262
1265 3300053136 Ga0500559_0010249 Ga0500559_0010249_428_1216 262
1266 3300053139 Ga0500568_0000614 Ga0500568_0000614_7659_8462 262
1267 3300053145 Ga0500586_000877 Ga0500586_000877_365_1162 262
1268 3300053146 Ga0500588_0027314 Ga0500588_0027314_326_1114 262
1269 3300053150 Ga0500603_000081 Ga0500603_000081_5531_6319 262
1270 3300053150 Ga0500603_001666 Ga0500603_001666_3893_4681 262
1271 3300053151 Ga0500604_0002038 Ga0500604_0002038_4422_5225 262
1272 3300053153 Ga0500616_0000408 Ga0500616_0000408_37284_38072 262
1273 3300053153 Ga0500616_0004061 Ga0500616_0004061_5470_6297 262
1274 3300053153 Ga0500616_0093103 Ga0500616_0093103_455_1243 262
1275 3300053155 Ga0500620_000984 Ga0500620_000984_1347_2186 262
1276 3300053156 Ga0500622_0001313 Ga0500622_0001313_15182_15985 262
1277 3300053156 Ga0500622_0154692 Ga0500622_0154692_264_1052 262
1278 3300053158 Ga0500627_0051787 Ga0500627_0051787_127_930 262
1279 3300053159 Ga0500630_004509 Ga0500630_004509_433_1221 262
1280 3300053160 Ga0500633_0076507 Ga0500633_0076507_95_922 262
1281 3300053162 Ga0500638_062165 Ga0500638_062165_845_1633 262
1282 3300053163 Ga0500639_000028 Ga0500639_000028_65238_66026 262
1283 3300053177 Ga0500636_0001766 Ga0500636_0001766_2835_3623 262
1284 3300053177 Ga0500636_0004562 Ga0500636_0004562_3469_4272 262
1285 3300053177 Ga0500636_0021694 Ga0500636_0021694_44_832 262
1286 3300053177 Ga0500636_0090488 Ga0500636_0090488_673_1461 262
1287 3300053178 Ga0500637_0112382 Ga0500637_0112382_358_1146 262
1288 3300053178 Ga0500637_0174378 Ga0500637_0174378_405_1193 262
1289 3300053723 Ga0500567_079370 Ga0500567_079370_493_1290 262
1290 3300053729 Ga0500625_040499 Ga0500625_040499_340_1128 262
1291 3300053735 Ga0500596_002436 Ga0500596_002436_638_1426 262
1292 3300053736 Ga0500599_000324 Ga0500599_000324_1519_2307 262
1293 3300053737 Ga0500601_000049 Ga0500601_000049_20198_20986 262
1294 3300053737 Ga0500601_007957 Ga0500601_007957_337_1125 262
1295 3300054114 Ga0501084_0665997 Ga0501084_0665997_74_862 262
1296 3300061719 Ga0466962_0173859 Ga0466962_0173859_119_907 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

245

0.98

PF00106

adh_short

short chain dehydrogenase

7

199

0.97

PF08659

KR

KR domain

8

188

0.83

PF23441

6

244

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_A the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9437 7 245
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.943 6 244
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9409 6 244
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.9405 6 244
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9399 6 244
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 6 243 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9491 7 81 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9409 7 244 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 6 244 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9321 7 241 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A833GAE2-F1-model_v4 SDR family oxidoreductase 0.9596 6 188 GO:0016491
AF-A0A1Q6KX94-F1-model_v4 deleted 0.9523 7 178
AF-A0A833GAE2-F1-model_v4 SDR family oxidoreductase 0.9444 6 188 GO:0016491
AF-A0A4R2KVD1-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9438 7 245 GO:0016616
AF-A0A5D0SRJ3-F1-model_v4 SDR family oxidoreductase 0.9437 5 244 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map