F492688
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1296 | 649 | 1084 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10030239|Ga0081455_100302394 |
| Length | 261 |
| Sequence | MPSSPQKVALVTGAARGIGLATAKRFLAEGWKVALLDIEGELLHGAVAGLADPDNTLALHCDVSDAGAVANAISALNARFGRLDALVNNAGIAVFAPLLDTSDQDWSRILAVNLSGPFICTKAAAPLLREQGGAIVNITSISAVRASTLRSAYGTSKAGLAHLTKQLAVELASLGIRVNAVAPGPVETAMAKQVHTPEIRADYHDAIPLNRYGLEEELAEAIFFLCSERASYITGQILAVDGGFDAAGIGLPTLRGQRRNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 27 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 28 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 31 | 2791355199 | |||
| 32 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 33 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 34 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 35 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 36 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 37 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 38 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 39 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 40 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 41 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 42 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 43 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 44 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 45 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 46 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 47 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 48 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 49 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 50 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 51 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 52 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 53 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 54 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 55 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 56 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 57 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 58 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 59 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 60 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 61 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 62 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 63 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 64 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 65 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 66 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 67 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 68 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 69 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 70 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 71 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 72 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 73 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 74 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 75 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 76 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 77 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 78 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 79 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 80 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 81 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 82 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 83 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 84 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 85 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 86 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 89 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 90 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 91 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 92 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 93 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 94 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 95 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 96 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 97 | 2906610324 | |||
| 98 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 99 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 100 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 101 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 102 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 103 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 104 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 105 | 2922368715 | |||
| 106 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 107 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 108 | 2922425934 | |||
| 109 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 110 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 111 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 112 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 113 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 114 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 115 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 116 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 117 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 118 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 119 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 120 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 121 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 122 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 123 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 124 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 125 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 126 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 127 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 128 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 129 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 130 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 131 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 132 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 133 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 134 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 135 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 136 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 137 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 138 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 139 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 140 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 141 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 142 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 143 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 144 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 145 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 146 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 147 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 148 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 149 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 150 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 151 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 152 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 153 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 154 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 155 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 156 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 157 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 158 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 159 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 160 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 161 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 162 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 163 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 164 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 165 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 166 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 167 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 168 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 169 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 170 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 171 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 172 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 173 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 174 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 175 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 176 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 177 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 178 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 179 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 180 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 181 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 182 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 183 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 184 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 185 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 186 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 187 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 188 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 190 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 191 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 194 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 195 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 203 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 204 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 206 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 210 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 211 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 213 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 214 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 216 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 218 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 220 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 221 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 222 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 223 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 224 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 225 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 226 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 227 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 228 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 229 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 230 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 231 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 232 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 233 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 234 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 235 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 237 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 238 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 239 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 240 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 242 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 243 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 244 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 245 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 247 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 248 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 249 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 251 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 252 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 253 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 274 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 277 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 278 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 279 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 280 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 281 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 282 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 283 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 284 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 285 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 286 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 291 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 292 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 344 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 345 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 346 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 347 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 350 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 353 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 354 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 355 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 356 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 357 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 358 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 359 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 360 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 361 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 362 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 363 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 364 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 365 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 366 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 367 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 368 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 369 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 370 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 371 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 372 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 373 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 374 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 375 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 376 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 377 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 378 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 379 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 380 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 381 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 382 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 383 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 384 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 385 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 386 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 387 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 388 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 389 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 390 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 391 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 392 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 393 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 394 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 395 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 396 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 397 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 398 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 399 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 400 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 401 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 402 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 403 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 404 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 405 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 406 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 407 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 408 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 409 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 410 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 411 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 412 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 413 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 414 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 415 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 416 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 417 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 418 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 494 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 495 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 496 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 497 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 498 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 499 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 500 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 501 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 502 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 503 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 504 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 505 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 506 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 507 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 508 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 509 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 510 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 511 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 512 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 513 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 514 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 515 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 516 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 517 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 518 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 520 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 521 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 530 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 543 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 548 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 549 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 550 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 551 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 552 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 553 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 554 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 555 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 558 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 561 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 565 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 566 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 567 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 568 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 569 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 570 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 571 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 572 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 573 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 574 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 575 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 576 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 577 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 578 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 579 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 580 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 581 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 582 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 583 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 584 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 585 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 586 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 587 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 588 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 589 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 590 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 591 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 592 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 593 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 594 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 595 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 596 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 597 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 599 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 600 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 601 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 602 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 603 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 604 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 605 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 606 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 607 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 608 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 609 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 610 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 611 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 612 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 615 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 616 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 617 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 618 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 619 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 620 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 621 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 622 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 623 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 624 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 625 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 626 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 627 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 628 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 629 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 630 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 631 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 632 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 633 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 634 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 635 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 636 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 637 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 638 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 639 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 640 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 641 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 642 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 643 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 644 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 645 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 646 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 647 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 648 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 649 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.75 |
| Metatranscriptomes | 0.15 |
| Isolates | 16.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.43 |
| Nodule | 12.96 |
| Rhizoplane | 5.4 |
| Rhizosphere | 59.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10002347 | 3300001990 | Bacteria | 6747 |
| 2 | JGI24738J21930_10034940 | 3300002075 | Bacteria | 1024 |
| 3 | JGI25406J46586_10007816 | 3300003203 | Bacteria | 4864 |
| 4 | JGI25406J46586_10008897 | 3300003203 | Bacteria | 4519 |
| 5 | JGI25406J46586_10087741 | 3300003203 | Bacteria | 943 |
| 6 | JGI25153J46596_10002507 | 3300003215 | Bacteria | 10538 |
| 7 | JGI25153J46596_10002543 | 3300003215 | Bacteria | 10454 |
| 8 | JGI25153J46596_10014752 | 3300003215 | Bacteria | 3229 |
| 9 | JGI25153J46596_10019384 | 3300003215 | Bacteria | 2609 |
| 10 | JGI25153J46596_10037348 | 3300003215 | Bacteria | 1545 |
| 11 | JGI25160J50197_1001353 | 3300003354 | Bacteria | 12340 |
| 12 | JGI25160J50197_1001493 | 3300003354 | Bacteria | 11619 |
| 13 | JGI25160J50197_1022712 | 3300003354 | Bacteria | 1832 |
| 14 | JGI25404J52841_10006534 | 3300003659 | Bacteria | 2446 |
| 15 | JGI25404J52841_10014112 | 3300003659 | Bacteria | 1732 |
| 16 | JGI25404J52841_10016780 | 3300003659 | Bacteria | 1588 |
| 17 | Ga0055526_1024692 | 3300003771 | Bacteria | 1956 |
| 18 | Ga0055531_10001939 | 3300003794 | Bacteria | 14453 |
| 19 | Ga0055543_1004643 | 3300004625 | Bacteria | 3684 |
| 20 | Ga0065165_1001641 | 3300005262 | Bacteria | 22770 |
| 21 | Ga0065165_1003060 | 3300005262 | Bacteria | 12519 |
| 22 | Ga0065165_1006123 | 3300005262 | Bacteria | 6438 |
| 23 | Ga0065165_1010912 | 3300005262 | Bacteria | 3863 |
| 24 | Ga0070676_10231611 | 3300005328 | Bacteria | 1225 |
| 25 | Ga0070683_100002138 | 3300005329 | Bacteria | 15616 |
| 26 | Ga0070683_100060360 | 3300005329 | Bacteria | 3524 |
| 27 | Ga0070683_100103534 | 3300005329 | Bacteria | 2682 |
| 28 | Ga0068869_100018734 | 3300005334 | Bacteria | 4718 |
| 29 | Ga0068869_100242509 | 3300005334 | Bacteria | 1436 |
| 30 | Ga0070666_10237029 | 3300005335 | Bacteria | 1289 |
| 31 | Ga0070680_100001388 | 3300005336 | Bacteria | 17507 |
| 32 | Ga0070680_100019162 | 3300005336 | Bacteria | 5420 |
| 33 | Ga0070682_100447038 | 3300005337 | Bacteria | 989 |
| 34 | Ga0068868_100051877 | 3300005338 | Bacteria | 3228 |
| 35 | Ga0070691_10000536 | 3300005341 | Bacteria | 14322 |
| 36 | Ga0070691_10176035 | 3300005341 | Bacteria | 1111 |
| 37 | Ga0070661_100106670 | 3300005344 | Bacteria | 2089 |
| 38 | Ga0070668_100030574 | 3300005347 | Bacteria | 4094 |
| 39 | Ga0070668_100077506 | 3300005347 | Bacteria | 2598 |
| 40 | Ga0070668_100287654 | 3300005347 | Bacteria | 1375 |
| 41 | Ga0070675_100209354 | 3300005354 | Bacteria | 1695 |
| 42 | Ga0070671_100026992 | 3300005355 | Bacteria | 4724 |
| 43 | Ga0070671_100172984 | 3300005355 | Bacteria | 1827 |
| 44 | Ga0070709_10006354 | 3300005434 | Bacteria | 6434 |
| 45 | Ga0070709_10015776 | 3300005434 | Bacteria | 4302 |
| 46 | Ga0070709_10135589 | 3300005434 | Bacteria | 1686 |
| 47 | Ga0070714_100046252 | 3300005435 | Bacteria | 3691 |
| 48 | Ga0070713_100001186 | 3300005436 | Bacteria | 16637 |
| 49 | Ga0070713_100245356 | 3300005436 | Bacteria | 1632 |
| 50 | Ga0070710_10223903 | 3300005437 | Bacteria | 1198 |
| 51 | Ga0070711_100011149 | 3300005439 | Bacteria | 5575 |
| 52 | Ga0070711_100048169 | 3300005439 | Bacteria | 2912 |
| 53 | Ga0070711_100081742 | 3300005439 | Bacteria | 2303 |
| 54 | Ga0070700_100144401 | 3300005441 | Bacteria | 1620 |
| 55 | Ga0070663_100023603 | 3300005455 | Bacteria | 4124 |
| 56 | Ga0070663_100082812 | 3300005455 | Bacteria | 2361 |
| 57 | Ga0070663_100161409 | 3300005455 | Bacteria | 1725 |
| 58 | Ga0070663_100178475 | 3300005455 | Bacteria | 1646 |
| 59 | Ga0070678_100165551 | 3300005456 | Bacteria | 1796 |
| 60 | Ga0070678_100197907 | 3300005456 | Bacteria | 1656 |
| 61 | Ga0070662_100084789 | 3300005457 | Bacteria | 2367 |
| 62 | Ga0070662_100124102 | 3300005457 | Bacteria | 1982 |
| 63 | Ga0070681_10017662 | 3300005458 | Bacteria | 7129 |
| 64 | Ga0070681_10024432 | 3300005458 | Bacteria | 6084 |
| 65 | Ga0070681_10039710 | 3300005458 | Bacteria | 4716 |
| 66 | Ga0070681_10057575 | 3300005458 | Bacteria | 3867 |
| 67 | Ga0070681_10376412 | 3300005458 | Bacteria | 1330 |
| 68 | Ga0068867_100148114 | 3300005459 | Bacteria | 1841 |
| 69 | Ga0070699_100199189 | 3300005518 | Bacteria | 1780 |
| 70 | Ga0070679_100003503 | 3300005530 | Bacteria | 14373 |
| 71 | Ga0070679_100027556 | 3300005530 | Bacteria | 5593 |
| 72 | Ga0070679_100147698 | 3300005530 | Bacteria | 2328 |
| 73 | Ga0070679_100150437 | 3300005530 | Bacteria | 2304 |
| 74 | Ga0070679_100174492 | 3300005530 | Bacteria | 2122 |
| 75 | Ga0070679_100363504 | 3300005530 | Bacteria | 1394 |
| 76 | Ga0070684_100001913 | 3300005535 | Bacteria | 15266 |
| 77 | Ga0070684_100599759 | 3300005535 | Bacteria | 1024 |
| 78 | Ga0070697_100060642 | 3300005536 | Bacteria | 3084 |
| 79 | Ga0068853_100067183 | 3300005539 | Bacteria | 3114 |
| 80 | Ga0068853_100097547 | 3300005539 | Bacteria | 2595 |
| 81 | Ga0068853_100109439 | 3300005539 | Bacteria | 2452 |
| 82 | Ga0068853_100528437 | 3300005539 | Bacteria | 1116 |
| 83 | Ga0070665_100010041 | 3300005548 | Bacteria | 9577 |
| 84 | Ga0070665_100104669 | 3300005548 | Bacteria | 2832 |
| 85 | Ga0070665_100277172 | 3300005548 | Bacteria | 1679 |
| 86 | Ga0070665_100307099 | 3300005548 | Bacteria | 1590 |
| 87 | Ga0068855_100060900 | 3300005563 | Bacteria | 4411 |
| 88 | Ga0068855_100181234 | 3300005563 | Bacteria | 2381 |
| 89 | Ga0068855_100195710 | 3300005563 | Bacteria | 2278 |
| 90 | Ga0068855_100220936 | 3300005563 | Bacteria | 2125 |
| 91 | Ga0068855_100238531 | 3300005563 | Bacteria | 2033 |
| 92 | Ga0070664_100113592 | 3300005564 | Bacteria | 2366 |
| 93 | Ga0068857_100010136 | 3300005577 | Bacteria | 8189 |
| 94 | Ga0068857_100103325 | 3300005577 | Bacteria | 2558 |
| 95 | Ga0068857_100481631 | 3300005577 | Bacteria | 1163 |
| 96 | Ga0068854_100393596 | 3300005578 | Bacteria | 1145 |
| 97 | Ga0068856_100000055 | 3300005614 | Bacteria | 104152 |
| 98 | Ga0068856_100124570 | 3300005614 | Bacteria | 2580 |
| 99 | Ga0068852_100008698 | 3300005616 | Bacteria | 7503 |
| 100 | Ga0068852_100016131 | 3300005616 | Bacteria | 5815 |
| 101 | Ga0068852_100264694 | 3300005616 | Bacteria | 1652 |
| 102 | Ga0068852_100357358 | 3300005616 | Bacteria | 1428 |
| 103 | Ga0068859_100051912 | 3300005617 | Bacteria | 4122 |
| 104 | Ga0068864_100096411 | 3300005618 | Bacteria | 2617 |
| 105 | Ga0068864_100164489 | 3300005618 | Bacteria | 2019 |
| 106 | Ga0068861_100048762 | 3300005719 | Bacteria | 3203 |
| 107 | Ga0068861_100108102 | 3300005719 | Bacteria | 2224 |
| 108 | Ga0068851_10003461 | 3300005834 | Bacteria | 7024 |
| 109 | Ga0068851_10030046 | 3300005834 | Bacteria | 2693 |
| 110 | Ga0068863_100252184 | 3300005841 | Bacteria | 1705 |
| 111 | Ga0068863_100420327 | 3300005841 | Bacteria | 1309 |
| 112 | Ga0068858_100169787 | 3300005842 | Bacteria | 2056 |
| 113 | Ga0068858_100346960 | 3300005842 | Bacteria | 1421 |
| 114 | Ga0068860_100127658 | 3300005843 | Bacteria | 2438 |
| 115 | Ga0068860_100168421 | 3300005843 | Bacteria | 2115 |
| 116 | Ga0068862_100151120 | 3300005844 | Bacteria | 2067 |
| 117 | Ga0081455_10002785 | 3300005937 | Bacteria | 20594 |
| 118 | Ga0081455_10005206 | 3300005937 | Bacteria | 14308 |
| 119 | Ga0081455_10026606 | 3300005937 | Bacteria | 5315 |
| 120 | Ga0081455_10030239 | 3300005937 | Bacteria | 4923 |
| 121 | Ga0081455_10056015 | 3300005937 | Bacteria | 3350 |
| 122 | Ga0081538_10022448 | 3300005981 | Bacteria | 4571 |
| 123 | Ga0081540_1001339 | 3300005983 | Bacteria | 21460 |
| 124 | Ga0081540_1002098 | 3300005983 | Bacteria | 16595 |
| 125 | Ga0081540_1005216 | 3300005983 | Bacteria | 9725 |
| 126 | Ga0081540_1006379 | 3300005983 | Bacteria | 8601 |
| 127 | Ga0081540_1007306 | 3300005983 | Bacteria | 7903 |
| 128 | Ga0081540_1012638 | 3300005983 | Bacteria | 5539 |
| 129 | Ga0081540_1015748 | 3300005983 | Bacteria | 4771 |
| 130 | Ga0081539_10000848 | 3300005985 | Bacteria | 58499 |
| 131 | Ga0081539_10000950 | 3300005985 | Bacteria | 54335 |
| 132 | Ga0081539_10012348 | 3300005985 | Bacteria | 6599 |
| 133 | Ga0070717_10000460 | 3300006028 | Bacteria | 25862 |
| 134 | Ga0070717_10050992 | 3300006028 | Bacteria | 3404 |
| 135 | Ga0070717_10637808 | 3300006028 | Bacteria | 967 |
| 136 | Ga0075365_10005251 | 3300006038 | Bacteria | 6967 |
| 137 | Ga0075365_10182955 | 3300006038 | Bacteria | 1465 |
| 138 | Ga0075365_10438560 | 3300006038 | Bacteria | 922 |
| 139 | Ga0075368_10003948 | 3300006042 | Bacteria | 4995 |
| 140 | Ga0075368_10039890 | 3300006042 | Bacteria | 1842 |
| 141 | Ga0075363_100005438 | 3300006048 | Bacteria | 5665 |
| 142 | Ga0075363_100021367 | 3300006048 | Bacteria | 3259 |
| 143 | Ga0075363_100042092 | 3300006048 | Bacteria | 2412 |
| 144 | Ga0075363_100043180 | 3300006048 | Bacteria | 2384 |
| 145 | Ga0075364_10020794 | 3300006051 | Bacteria | 4130 |
| 146 | Ga0075364_10110313 | 3300006051 | Bacteria | 1835 |
| 147 | Ga0070712_100047202 | 3300006175 | Bacteria | 2980 |
| 148 | Ga0070712_100069796 | 3300006175 | Bacteria | 2508 |
| 149 | Ga0075362_10003691 | 3300006177 | Bacteria | 5405 |
| 150 | Ga0075362_10062546 | 3300006177 | Bacteria | 1686 |
| 151 | Ga0075362_10089718 | 3300006177 | Bacteria | 1426 |
| 152 | Ga0075367_10004454 | 3300006178 | Bacteria | 6842 |
| 153 | Ga0075367_10094223 | 3300006178 | Bacteria | 1825 |
| 154 | Ga0075367_10140573 | 3300006178 | Bacteria | 1495 |
| 155 | Ga0075367_10158117 | 3300006178 | Bacteria | 1409 |
| 156 | Ga0075367_10205194 | 3300006178 | Bacteria | 1232 |
| 157 | Ga0075367_10244491 | 3300006178 | Bacteria | 1125 |
| 158 | Ga0075369_10000317 | 3300006186 | Bacteria | 14378 |
| 159 | Ga0075369_10067389 | 3300006186 | Bacteria | 1571 |
| 160 | Ga0075369_10078965 | 3300006186 | Bacteria | 1457 |
| 161 | Ga0075369_10080358 | 3300006186 | Bacteria | 1445 |
| 162 | Ga0075369_10183604 | 3300006186 | Bacteria | 963 |
| 163 | Ga0075366_10015532 | 3300006195 | Bacteria | 4368 |
| 164 | Ga0075366_10032143 | 3300006195 | Bacteria | 3089 |
| 165 | Ga0097621_100160495 | 3300006237 | Bacteria | 1932 |
| 166 | Ga0097621_100382136 | 3300006237 | Bacteria | 1258 |
| 167 | Ga0075370_10024383 | 3300006353 | Bacteria | 3340 |
| 168 | Ga0075370_10028738 | 3300006353 | Bacteria | 3092 |
| 169 | Ga0075370_10039851 | 3300006353 | Bacteria | 2648 |
| 170 | Ga0075434_100006248 | 3300006871 | Bacteria | 10910 |
| 171 | Ga0068865_100427112 | 3300006881 | Bacteria | 1091 |
| 172 | Ga0097620_100051911 | 3300006931 | Bacteria | 4122 |
| 173 | Ga0099824_1012218 | 3300006942 | Bacteria | 9445 |
| 174 | Ga0099822_1020991 | 3300006943 | Bacteria | 6383 |
| 175 | Ga0099794_10025633 | 3300007265 | Bacteria | 2719 |
| 176 | Ga0105240_10004901 | 3300009093 | Bacteria | 20151 |
| 177 | Ga0105240_10016877 | 3300009093 | Bacteria | 9867 |
| 178 | Ga0105240_10028049 | 3300009093 | Bacteria | 7362 |
| 179 | Ga0105240_10047216 | 3300009093 | Bacteria | 5450 |
| 180 | Ga0105240_10060225 | 3300009093 | Bacteria | 4733 |
| 181 | Ga0105240_10143116 | 3300009093 | Bacteria | 2857 |
| 182 | Ga0105240_10275726 | 3300009093 | Bacteria | 1934 |
| 183 | Ga0111539_10175434 | 3300009094 | Bacteria | 2504 |
| 184 | Ga0111539_10313290 | 3300009094 | Bacteria | 1826 |
| 185 | Ga0105245_10010180 | 3300009098 | Bacteria | 8188 |
| 186 | Ga0105245_10027248 | 3300009098 | Bacteria | 5035 |
| 187 | Ga0105245_10030782 | 3300009098 | Bacteria | 4746 |
| 188 | Ga0105245_10149162 | 3300009098 | Bacteria | 2209 |
| 189 | Ga0105245_10773911 | 3300009098 | Bacteria | 997 |
| 190 | Ga0114129_11019987 | 3300009147 | Bacteria | 1041 |
| 191 | Ga0105243_10189133 | 3300009148 | Bacteria | 1797 |
| 192 | Ga0105241_10010434 | 3300009174 | Bacteria | 6817 |
| 193 | Ga0105241_10016990 | 3300009174 | Bacteria | 5340 |
| 194 | Ga0105241_10027975 | 3300009174 | Bacteria | 4198 |
| 195 | Ga0105241_10111787 | 3300009174 | Bacteria | 2188 |
| 196 | Ga0105248_10099912 | 3300009177 | Bacteria | 3269 |
| 197 | Ga0105248_10907454 | 3300009177 | Bacteria | 995 |
| 198 | Ga0105237_10003690 | 3300009545 | Bacteria | 18050 |
| 199 | Ga0105237_10018023 | 3300009545 | Bacteria | 7315 |
| 200 | Ga0105237_10081744 | 3300009545 | Bacteria | 3222 |
| 201 | Ga0105237_10111094 | 3300009545 | Bacteria | 2733 |
| 202 | Ga0105237_10738019 | 3300009545 | Bacteria | 991 |
| 203 | Ga0105238_10038154 | 3300009551 | Bacteria | 4880 |
| 204 | Ga0105238_10123401 | 3300009551 | Bacteria | 2569 |
| 205 | Ga0105238_10250775 | 3300009551 | Bacteria | 1748 |
| 206 | Ga0105238_10269569 | 3300009551 | Bacteria | 1683 |
| 207 | Ga0105249_10480820 | 3300009553 | Bacteria | 1285 |
| 208 | Ga0105239_10015287 | 3300010375 | Bacteria | 8506 |
| 209 | Ga0105239_10018873 | 3300010375 | Bacteria | 7619 |
| 210 | Ga0105239_10049562 | 3300010375 | Bacteria | 4605 |
| 211 | Ga0105239_10096921 | 3300010375 | Bacteria | 3259 |
| 212 | Ga0105239_10111724 | 3300010375 | Bacteria | 3030 |
| 213 | Ga0105239_10188800 | 3300010375 | Bacteria | 2307 |
| 214 | Ga0105239_10317477 | 3300010375 | Bacteria | 1756 |
| 215 | Ga0105246_10005026 | 3300011119 | Bacteria | 8045 |
| 216 | Ga0105246_10017226 | 3300011119 | Bacteria | 4592 |
| 217 | Ga0105246_10562493 | 3300011119 | Bacteria | 979 |
| 218 | Ga0157371_10421709 | 3300013102 | Bacteria | 978 |
| 219 | Ga0157370_10167354 | 3300013104 | Bacteria | 2044 |
| 220 | Ga0157370_10180275 | 3300013104 | Bacteria | 1963 |
| 221 | Ga0157369_10016812 | 3300013105 | Bacteria | 8222 |
| 222 | Ga0157369_10037771 | 3300013105 | Bacteria | 5286 |
| 223 | Ga0157369_10074657 | 3300013105 | Bacteria | 3636 |
| 224 | Ga0157369_10086808 | 3300013105 | Bacteria | 3341 |
| 225 | Ga0157374_10028177 | 3300013296 | Bacteria | 5072 |
| 226 | Ga0157374_10053183 | 3300013296 | Bacteria | 3774 |
| 227 | Ga0157374_10169641 | 3300013296 | Bacteria | 2128 |
| 228 | Ga0157378_10232441 | 3300013297 | Bacteria | 1758 |
| 229 | Ga0163162_10126279 | 3300013306 | Bacteria | 2664 |
| 230 | Ga0163162_10232701 | 3300013306 | Bacteria | 1973 |
| 231 | Ga0157372_10812022 | 3300013307 | Bacteria | 1086 |
| 232 | Ga0157375_10081867 | 3300013308 | Bacteria | 3269 |
| 233 | Ga0182008_10179028 | 3300014497 | Bacteria | 1072 |
| 234 | Ga0157377_10071003 | 3300014745 | Bacteria | 2012 |
| 235 | Ga0157377_10262661 | 3300014745 | Bacteria | 1124 |
| 236 | Ga0157376_10023264 | 3300014969 | Bacteria | 4847 |
| 237 | Ga0157376_10083788 | 3300014969 | Bacteria | 2744 |
| 238 | Ga0157376_10401182 | 3300014969 | Bacteria | 1326 |
| 239 | Ga0206354_11243179 | 3300020081 | Bacteria | 1652 |
| 240 | Ga0206353_11151056 | 3300020082 | Bacteria | 2367 |
| 241 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 242 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 243 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 244 | Ga0214543_1000111 | 3300021327 | Bacteria | 106517 |
| 245 | Ga0213873_10023750 | 3300021358 | Bacteria | 1465 |
| 246 | Ga0213872_10060892 | 3300021361 | Bacteria | 1707 |
| 247 | Ga0213876_10031811 | 3300021384 | Bacteria | 2783 |
| 248 | Ga0213875_10116771 | 3300021388 | Bacteria | 1247 |
| 249 | Ga0209677_106835 | 3300025253 | Bacteria | 2595 |
| 250 | Ga0209148_1000235 | 3300025254 | Bacteria | 90398 |
| 251 | Ga0209148_1013088 | 3300025254 | Bacteria | 1499 |
| 252 | Ga0209233_1002060 | 3300025261 | Bacteria | 7618 |
| 253 | Ga0209233_1003872 | 3300025261 | Bacteria | 5205 |
| 254 | Ga0209233_1010292 | 3300025261 | Bacteria | 2810 |
| 255 | Ga0209455_1000637 | 3300025272 | Bacteria | 21523 |
| 256 | Ga0209455_1004708 | 3300025272 | Bacteria | 4389 |
| 257 | Ga0209675_1003389 | 3300025291 | Bacteria | 7595 |
| 258 | Ga0209564_1000755 | 3300025295 | Bacteria | 45779 |
| 259 | Ga0209564_1005342 | 3300025295 | Bacteria | 7373 |
| 260 | Ga0209564_1013065 | 3300025295 | Bacteria | 3557 |
| 261 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 262 | Ga0209758_1000580 | 3300025297 | Bacteria | 57122 |
| 263 | Ga0209758_1000680 | 3300025297 | Bacteria | 50663 |
| 264 | Ga0209758_1002859 | 3300025297 | Bacteria | 16761 |
| 265 | Ga0209758_1003592 | 3300025297 | Bacteria | 13874 |
| 266 | Ga0209758_1003725 | 3300025297 | Bacteria | 13511 |
| 267 | Ga0209758_1008851 | 3300025297 | Bacteria | 6405 |
| 268 | Ga0209758_1018366 | 3300025297 | Bacteria | 3429 |
| 269 | Ga0209758_1037504 | 3300025297 | Bacteria | 1872 |
| 270 | Ga0209256_1004953 | 3300025299 | Bacteria | 7982 |
| 271 | Ga0209256_1035119 | 3300025299 | Bacteria | 1327 |
| 272 | Ga0207426_1000532 | 3300025302 | Bacteria | 54755 |
| 273 | Ga0207426_1002013 | 3300025302 | Bacteria | 14342 |
| 274 | Ga0207426_1009466 | 3300025302 | Bacteria | 3852 |
| 275 | Ga0209051_1044393 | 3300025303 | Bacteria | 1548 |
| 276 | Ga0209051_1047917 | 3300025303 | Bacteria | 1454 |
| 277 | Ga0209257_1003378 | 3300025304 | Bacteria | 13780 |
| 278 | Ga0209257_1006352 | 3300025304 | Bacteria | 7675 |
| 279 | Ga0207653_10041455 | 3300025885 | Bacteria | 1512 |
| 280 | Ga0207642_10043735 | 3300025899 | Bacteria | 1978 |
| 281 | Ga0207688_10046651 | 3300025901 | Bacteria | 2420 |
| 282 | Ga0207680_10135522 | 3300025903 | Bacteria | 1627 |
| 283 | Ga0207647_10001253 | 3300025904 | Bacteria | 19532 |
| 284 | Ga0207699_10019382 | 3300025906 | Bacteria | 3626 |
| 285 | Ga0207699_10036666 | 3300025906 | Bacteria | 2797 |
| 286 | Ga0207645_10104474 | 3300025907 | Bacteria | 1829 |
| 287 | Ga0207705_10048614 | 3300025909 | Bacteria | 3051 |
| 288 | Ga0207705_10138983 | 3300025909 | Bacteria | 1813 |
| 289 | Ga0207684_10150476 | 3300025910 | Bacteria | 2003 |
| 290 | Ga0207654_10004638 | 3300025911 | Bacteria | 6941 |
| 291 | Ga0207654_10017841 | 3300025911 | Bacteria | 3718 |
| 292 | Ga0207707_10001016 | 3300025912 | Bacteria | 26912 |
| 293 | Ga0207707_10019818 | 3300025912 | Bacteria | 5872 |
| 294 | Ga0207707_10032842 | 3300025912 | Bacteria | 4542 |
| 295 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 296 | Ga0207695_10007711 | 3300025913 | Bacteria | 13630 |
| 297 | Ga0207695_10054420 | 3300025913 | Bacteria | 4179 |
| 298 | Ga0207695_10067753 | 3300025913 | Bacteria | 3660 |
| 299 | Ga0207695_10403698 | 3300025913 | Bacteria | 1251 |
| 300 | Ga0207671_10014887 | 3300025914 | Bacteria | 6118 |
| 301 | Ga0207671_10031054 | 3300025914 | Bacteria | 3983 |
| 302 | Ga0207671_10071058 | 3300025914 | Bacteria | 2596 |
| 303 | Ga0207671_10118439 | 3300025914 | Bacteria | 2022 |
| 304 | Ga0207693_10009325 | 3300025915 | Bacteria | 8001 |
| 305 | Ga0207693_10051019 | 3300025915 | Bacteria | 3248 |
| 306 | Ga0207693_10060539 | 3300025915 | Bacteria | 2966 |
| 307 | Ga0207663_10026393 | 3300025916 | Bacteria | 3371 |
| 308 | Ga0207663_10206671 | 3300025916 | Bacteria | 1420 |
| 309 | Ga0207660_10000924 | 3300025917 | Bacteria | 19378 |
| 310 | Ga0207660_10427726 | 3300025917 | Bacteria | 1069 |
| 311 | Ga0207657_10001391 | 3300025919 | Bacteria | 25799 |
| 312 | Ga0207657_10427382 | 3300025919 | Bacteria | 1041 |
| 313 | Ga0207649_10050880 | 3300025920 | Bacteria | 2564 |
| 314 | Ga0207649_10073277 | 3300025920 | Bacteria | 2193 |
| 315 | Ga0207652_10003893 | 3300025921 | Bacteria | 12209 |
| 316 | Ga0207652_10004944 | 3300025921 | Bacteria | 10792 |
| 317 | Ga0207652_10025815 | 3300025921 | Bacteria | 4888 |
| 318 | Ga0207694_10195440 | 3300025924 | Bacteria | 1645 |
| 319 | Ga0207694_10343030 | 3300025924 | Bacteria | 1235 |
| 320 | Ga0207650_10172532 | 3300025925 | Bacteria | 1719 |
| 321 | Ga0207687_10008945 | 3300025927 | Bacteria | 6546 |
| 322 | Ga0207687_10189937 | 3300025927 | Bacteria | 1598 |
| 323 | Ga0207700_10034028 | 3300025928 | Bacteria | 3653 |
| 324 | Ga0207700_10127505 | 3300025928 | Bacteria | 2073 |
| 325 | Ga0207644_10098468 | 3300025931 | Bacteria | 2192 |
| 326 | Ga0207644_10166234 | 3300025931 | Bacteria | 1719 |
| 327 | Ga0207644_10505516 | 3300025931 | Bacteria | 997 |
| 328 | Ga0207706_10169512 | 3300025933 | Bacteria | 1918 |
| 329 | Ga0207709_10134404 | 3300025935 | Bacteria | 1691 |
| 330 | Ga0207665_10023296 | 3300025939 | Bacteria | 4078 |
| 331 | Ga0207691_10562018 | 3300025940 | Bacteria | 967 |
| 332 | Ga0207711_10058971 | 3300025941 | Bacteria | 3304 |
| 333 | Ga0207711_10122248 | 3300025941 | Bacteria | 2325 |
| 334 | Ga0207711_10269056 | 3300025941 | Bacteria | 1568 |
| 335 | Ga0207689_10051839 | 3300025942 | Bacteria | 3383 |
| 336 | Ga0207689_10202100 | 3300025942 | Bacteria | 1640 |
| 337 | Ga0207661_10000421 | 3300025944 | Bacteria | 27342 |
| 338 | Ga0207661_10127181 | 3300025944 | Bacteria | 2177 |
| 339 | Ga0207661_10431918 | 3300025944 | Bacteria | 1197 |
| 340 | Ga0207667_10015694 | 3300025949 | Bacteria | 8591 |
| 341 | Ga0207667_10039623 | 3300025949 | Bacteria | 5021 |
| 342 | Ga0207667_10300169 | 3300025949 | Bacteria | 1641 |
| 343 | Ga0207667_10528887 | 3300025949 | Bacteria | 1194 |
| 344 | Ga0207668_10257093 | 3300025972 | Bacteria | 1421 |
| 345 | Ga0207658_10114099 | 3300025986 | Bacteria | 2142 |
| 346 | Ga0207677_10056882 | 3300026023 | Bacteria | 2682 |
| 347 | Ga0207639_10022760 | 3300026041 | Bacteria | 4517 |
| 348 | Ga0207639_10038860 | 3300026041 | Bacteria | 3542 |
| 349 | Ga0207639_10149330 | 3300026041 | Bacteria | 1956 |
| 350 | Ga0207639_10226714 | 3300026041 | Bacteria | 1617 |
| 351 | Ga0207678_10004216 | 3300026067 | Bacteria | 12904 |
| 352 | Ga0207678_10017767 | 3300026067 | Bacteria | 6244 |
| 353 | Ga0207678_10025952 | 3300026067 | Bacteria | 5112 |
| 354 | Ga0207678_10033530 | 3300026067 | Bacteria | 4472 |
| 355 | Ga0207678_10062172 | 3300026067 | Bacteria | 3211 |
| 356 | Ga0207678_10083309 | 3300026067 | Bacteria | 2735 |
| 357 | Ga0207678_10199184 | 3300026067 | Bacteria | 1712 |
| 358 | Ga0207678_10260106 | 3300026067 | Bacteria | 1487 |
| 359 | Ga0207678_10538291 | 3300026067 | Bacteria | 1021 |
| 360 | Ga0207708_10144256 | 3300026075 | Bacteria | 1870 |
| 361 | Ga0207702_10002502 | 3300026078 | Bacteria | 17348 |
| 362 | Ga0207702_10151077 | 3300026078 | Bacteria | 2112 |
| 363 | Ga0207641_10115607 | 3300026088 | Bacteria | 2386 |
| 364 | Ga0207648_10214427 | 3300026089 | Bacteria | 1710 |
| 365 | Ga0207676_10161141 | 3300026095 | Bacteria | 1943 |
| 366 | Ga0207674_10016173 | 3300026116 | Bacteria | 8171 |
| 367 | Ga0207674_10051452 | 3300026116 | Bacteria | 4203 |
| 368 | Ga0207675_100092259 | 3300026118 | Bacteria | 2848 |
| 369 | Ga0207683_10057608 | 3300026121 | Bacteria | 3410 |
| 370 | Ga0207683_10242336 | 3300026121 | Bacteria | 1645 |
| 371 | Ga0207698_10163292 | 3300026142 | Bacteria | 1951 |
| 372 | Ga0207698_10280893 | 3300026142 | Bacteria | 1540 |
| 373 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 374 | Ga0209389_1000120 | 3300027296 | Bacteria | 70535 |
| 375 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 376 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 377 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 378 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 379 | Ga0209489_100742 | 3300027361 | Bacteria | 64218 |
| 380 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 381 | Ga0209700_100134 | 3300027363 | Bacteria | 112846 |
| 382 | Ga0209588_1003932 | 3300027671 | Bacteria | 4156 |
| 383 | Ga0209813_10026424 | 3300027866 | Bacteria | 1679 |
| 384 | Ga0209813_10094012 | 3300027866 | Bacteria | 1010 |
| 385 | Ga0207428_10325357 | 3300027907 | Bacteria | 1135 |
| 386 | Ga0268266_10001136 | 3300028379 | Bacteria | 33101 |
| 387 | Ga0268266_10003686 | 3300028379 | Bacteria | 15118 |
| 388 | Ga0268266_10007696 | 3300028379 | Bacteria | 9673 |
| 389 | Ga0268266_10048100 | 3300028379 | Bacteria | 3655 |
| 390 | Ga0268266_10175012 | 3300028379 | Bacteria | 1950 |
| 391 | Ga0268266_10538825 | 3300028379 | Bacteria | 1117 |
| 392 | Ga0268266_10820899 | 3300028379 | Bacteria | 898 |
| 393 | Ga0268265_10019321 | 3300028380 | Bacteria | 4733 |
| 394 | Ga0268265_10140896 | 3300028380 | Bacteria | 2019 |
| 395 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 396 | Ga0307515_10098751 | 3300028794 | Bacteria | 3552 |
| 397 | Ga0307515_10390958 | 3300028794 | Bacteria | 1020 |
| 398 | Ga0307511_10000014 | 3300030521 | Bacteria | 127602 |
| 399 | Ga0307511_10232289 | 3300030521 | Bacteria | 911 |
| 400 | Ga0265325_10028710 | 3300031241 | Bacteria | 2995 |
| 401 | Ga0265325_10075344 | 3300031241 | Bacteria | 1685 |
| 402 | Ga0265339_10120058 | 3300031249 | Bacteria | 1352 |
| 403 | Ga0265331_10104634 | 3300031250 | Bacteria | 1301 |
| 404 | Ga0265331_10129459 | 3300031250 | Bacteria | 1152 |
| 405 | Ga0265327_10035083 | 3300031251 | Bacteria | 2777 |
| 406 | Ga0265316_10171724 | 3300031344 | Bacteria | 1617 |
| 407 | Ga0265316_10204536 | 3300031344 | Bacteria | 1462 |
| 408 | Ga0307513_10067968 | 3300031456 | Bacteria | 3735 |
| 409 | Ga0307513_10203303 | 3300031456 | Bacteria | 1819 |
| 410 | Ga0265313_10000710 | 3300031595 | Bacteria | 34401 |
| 411 | Ga0265313_10065446 | 3300031595 | Bacteria | 1687 |
| 412 | Ga0265314_10051287 | 3300031711 | Bacteria | 2875 |
| 413 | Ga0307516_10046388 | 3300031730 | Bacteria | 4287 |
| 414 | Ga0307405_10272364 | 3300031731 | Bacteria | 1270 |
| 415 | Ga0307407_10140011 | 3300031903 | Bacteria | 1560 |
| 416 | Ga0307412_10125422 | 3300031911 | Bacteria | 1856 |
| 417 | Ga0307416_100856021 | 3300032002 | Bacteria | 1007 |
| 418 | Ga0307411_10174325 | 3300032005 | Bacteria | 1625 |
| 419 | Ga0307415_100173986 | 3300032126 | Bacteria | 1682 |
| 420 | Ga0316583_10002297 | 3300032133 | Bacteria | 6590 |
| 421 | Ga0307510_10007562 | 3300033180 | Bacteria | 12946 |
| 422 | Ga0307510_10195621 | 3300033180 | Bacteria | 1564 |
| 423 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 424 | Ga0373950_0005653 | 3300034818 | Bacteria | 1875 |
| 425 | Ga0373959_0021087 | 3300034820 | Bacteria | 1249 |
| 426 | Ga0373938_0047277 | 3300034957 | Bacteria | 973 |
| 427 | Ga0373928_0024812 | 3300035084 | Bacteria | 1288 |
| 428 | Ga0373934_0035936 | 3300035086 | Bacteria | 1951 |
| 429 | Ga0373934_0044113 | 3300035086 | Bacteria | 1762 |
| 430 | Ga0373923_0001382 | 3300035111 | Bacteria | 6917 |
| 431 | Ga0373923_0003036 | 3300035111 | Bacteria | 5306 |
| 432 | Ga0373932_0027113 | 3300035112 | Bacteria | 1564 |
| 433 | Ga0373932_0069945 | 3300035112 | Bacteria | 1086 |
| 434 | Ga0373936_0049442 | 3300035113 | Bacteria | 1698 |
| 435 | Ga0373936_0097111 | 3300035113 | Bacteria | 1240 |
| 436 | Ga0373936_0129041 | 3300035113 | Bacteria | 1085 |
| 437 | Ga0373941_0000606 | 3300035115 | Bacteria | 7250 |
| 438 | Ga0373945_0005116 | 3300035116 | Bacteria | 4186 |
| 439 | Ga0373953_0000985 | 3300035117 | Bacteria | 8003 |
| 440 | Ga0373953_0100830 | 3300035117 | Bacteria | 1215 |
| 441 | Ga0373954_0001160 | 3300035118 | Bacteria | 10599 |
| 442 | Ga0373954_0008305 | 3300035118 | Bacteria | 4555 |
| 443 | Ga0373954_0013014 | 3300035118 | Bacteria | 3704 |
| 444 | Ga0373954_0058984 | 3300035118 | Bacteria | 1808 |
| 445 | Ga0373954_0181020 | 3300035118 | Bacteria | 1033 |
| 446 | Ga0373956_0001463 | 3300035119 | Bacteria | 9760 |
| 447 | Ga0373956_0027829 | 3300035119 | Bacteria | 2457 |
| 448 | Ga0373956_0241638 | 3300035119 | Bacteria | 858 |
| 449 | Ga0373957_0030699 | 3300035120 | Bacteria | 1970 |
| 450 | Ga0373957_0034940 | 3300035120 | Bacteria | 1865 |
| 451 | Ga0373943_0010149 | 3300035170 | Bacteria | 4224 |
| 452 | Ga0373946_0007962 | 3300035171 | Bacteria | 3892 |
| 453 | Ga0373946_0064574 | 3300035171 | Bacteria | 1566 |
| 454 | Ga0373955_0001372 | 3300035172 | Bacteria | 10349 |
| 455 | Ga0373955_0018833 | 3300035172 | Bacteria | 3441 |
| 456 | Ga0373955_0087441 | 3300035172 | Bacteria | 1771 |
| 457 | Ga0373924_0011593 | 3300035410 | Bacteria | 3277 |
| 458 | Ga0373924_0035360 | 3300035410 | Bacteria | 2026 |
| 459 | Ga0373924_0040913 | 3300035410 | Bacteria | 1898 |
| 460 | Ga0373931_0003428 | 3300035691 | Bacteria | 7118 |
| 461 | Ga0373935_0000520 | 3300035692 | Bacteria | 20054 |
| 462 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 463 | Ga0373927_0005938 | 3300035695 | Bacteria | 8359 |
| 464 | Ga0373927_0113941 | 3300035695 | Bacteria | 1762 |
| 465 | Ga0373933_0019482 | 3300035724 | Bacteria | 3833 |
| 466 | Ga0373933_0053835 | 3300035724 | Bacteria | 2410 |
| 467 | Ga0373933_0123769 | 3300035724 | Bacteria | 1621 |
| 468 | Ga0373947_0001392 | 3300035725 | Bacteria | 14902 |
| 469 | Ga0373947_0002439 | 3300035725 | Bacteria | 11211 |
| 470 | Ga0373947_0021349 | 3300035725 | Bacteria | 3747 |
| 471 | Ga0373947_0027666 | 3300035725 | Bacteria | 3320 |
| 472 | Ga0373947_0466112 | 3300035725 | Bacteria | 856 |
| 473 | Ga0373937_0015298 | 3300036401 | Bacteria | 6784 |
| 474 | Ga0373937_0016441 | 3300036401 | Bacteria | 6572 |
| 475 | Ga0373937_0028218 | 3300036401 | Bacteria | 5077 |
| 476 | Ga0373937_0051447 | 3300036401 | Bacteria | 3776 |
| 477 | Ga0373937_0075827 | 3300036401 | Bacteria | 3105 |
| 478 | Ga0373937_0103455 | 3300036401 | Bacteria | 2645 |
| 479 | Ga0373937_0147334 | 3300036401 | Bacteria | 2204 |
| 480 | Ga0373925_0009905 | 3300037068 | Bacteria | 6924 |
| 481 | Ga0373925_0049532 | 3300037068 | Bacteria | 3131 |
| 482 | Ga0373925_0183889 | 3300037068 | Bacteria | 1656 |
| 483 | Ga0373925_0205583 | 3300037068 | Bacteria | 1567 |
| 484 | Ga0373925_0219496 | 3300037068 | Bacteria | 1517 |
| 485 | Ga0395899_0116459 | 3300037312 | Bacteria | 1917 |
| 486 | Ga0395900_0016187 | 3300037418 | Bacteria | 7597 |
| 487 | Ga0395900_0032079 | 3300037418 | Bacteria | 5401 |
| 488 | Ga0395900_0290498 | 3300037418 | Bacteria | 1624 |
| 489 | Ga0395898_0030023 | 3300037466 | Bacteria | 5442 |
| 490 | Ga0395898_0143916 | 3300037466 | Bacteria | 2282 |
| 491 | Ga0395898_0146208 | 3300037466 | Bacteria | 2262 |
| 492 | Ga0395898_0252291 | 3300037466 | Bacteria | 1683 |
| 493 | Ga0395905_0025920 | 3300037471 | Bacteria | 5526 |
| 494 | Ga0395905_0033090 | 3300037471 | Bacteria | 4860 |
| 495 | Ga0395905_0235405 | 3300037471 | Bacteria | 1712 |
| 496 | Ga0436364_0166778 | 3300037853 | Bacteria | 1401 |
| 497 | Ga0395901_0044922 | 3300038443 | Bacteria | 4583 |
| 498 | Ga0395901_0097370 | 3300038443 | Bacteria | 3084 |
| 499 | Ga0395901_0113876 | 3300038443 | Bacteria | 2841 |
| 500 | Ga0395901_0254458 | 3300038443 | Bacteria | 1829 |
| 501 | Ga0395901_0274779 | 3300038443 | Bacteria | 1752 |
| 502 | Ga0436365_0107606 | 3300039437 | Bacteria | 5515 |
| 503 | Ga0436365_0396839 | 3300039437 | Bacteria | 1979 |
| 504 | Ga0436365_1044448 | 3300039437 | Bacteria | 2136 |
| 505 | Ga0436365_1580006 | 3300039437 | Bacteria | 1039 |
| 506 | Ga0436365_1607466 | 3300039437 | Bacteria | 1186 |
| 507 | Ga0436361_0783902 | 3300039447 | Bacteria | 3211 |
| 508 | Ga0436361_1109558 | 3300039447 | Bacteria | 1048 |
| 509 | Ga0436362_1140786 | 3300039453 | Bacteria | 2256 |
| 510 | Ga0451833_0606252 | 3300041491 | Bacteria | 1053 |
| 511 | Ga0466969_0015917 | 3300044656 | Bacteria | 3941 |
| 512 | Ga0466972_0000126 | 3300044658 | Bacteria | 64766 |
| 513 | Ga0466966_0145138 | 3300044684 | Bacteria | 1449 |
| 514 | Ga0466966_0190717 | 3300044684 | Bacteria | 1242 |
| 515 | Ga0466961_0000025 | 3300044693 | Bacteria | 96344 |
| 516 | Ga0466963_0011648 | 3300044694 | Bacteria | 5357 |
| 517 | Ga0466963_0115616 | 3300044694 | Bacteria | 1843 |
| 518 | Ga0466968_0053776 | 3300044735 | Bacteria | 1726 |
| 519 | Ga0466968_0121279 | 3300044735 | Bacteria | 1183 |
| 520 | Ga0466957_0169526 | 3300044842 | Bacteria | 1421 |
| 521 | Ga0466957_0396019 | 3300044842 | Bacteria | 944 |
| 522 | Ga0466957_0399259 | 3300044842 | Bacteria | 940 |
| 523 | Ga0466959_0000873 | 3300045049 | Bacteria | 17751 |
| 524 | Ga0466959_0163188 | 3300045049 | Bacteria | 1565 |
| 525 | Ga0466959_0254451 | 3300045049 | Bacteria | 1211 |
| 526 | Ga0451576_0018871 | 3300045051 | Bacteria | 7539 |
| 527 | Ga0466967_0047331 | 3300045976 | Bacteria | 3748 |
| 528 | Ga0466967_0090497 | 3300045976 | Bacteria | 2780 |
| 529 | Ga0466967_0409122 | 3300045976 | Bacteria | 1321 |
| 530 | Ga0495617_058231 | 3300046452 | Bacteria | 1280 |
| 531 | Ga0495592_0001238 | 3300046454 | Bacteria | 17695 |
| 532 | Ga0495592_0086276 | 3300046454 | Bacteria | 2261 |
| 533 | Ga0495592_0124840 | 3300046454 | Bacteria | 1807 |
| 534 | Ga0495592_0151994 | 3300046454 | Bacteria | 1600 |
| 535 | Ga0495592_0156808 | 3300046454 | Bacteria | 1569 |
| 536 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 537 | Ga0495603_0105023 | 3300046455 | Bacteria | 1648 |
| 538 | Ga0495603_0155784 | 3300046455 | Bacteria | 1326 |
| 539 | Ga0495629_0000182 | 3300046459 | Bacteria | 56655 |
| 540 | Ga0495629_0000750 | 3300046459 | Bacteria | 26239 |
| 541 | Ga0495629_0043713 | 3300046459 | Bacteria | 3145 |
| 542 | Ga0495638_0003938 | 3300046460 | Bacteria | 11448 |
| 543 | Ga0495638_0013321 | 3300046460 | Bacteria | 5603 |
| 544 | Ga0495638_0029466 | 3300046460 | Bacteria | 3539 |
| 545 | Ga0495638_0054856 | 3300046460 | Bacteria | 2476 |
| 546 | Ga0495638_0107663 | 3300046460 | Bacteria | 1659 |
| 547 | Ga0495638_0116709 | 3300046460 | Bacteria | 1581 |
| 548 | Ga0495641_0006374 | 3300046461 | Bacteria | 7658 |
| 549 | Ga0495651_0049059 | 3300046462 | Bacteria | 3259 |
| 550 | Ga0495651_0118365 | 3300046462 | Bacteria | 1949 |
| 551 | Ga0495651_0141321 | 3300046462 | Bacteria | 1745 |
| 552 | Ga0495651_0232686 | 3300046462 | Bacteria | 1268 |
| 553 | Ga0495651_0431907 | 3300046462 | Bacteria | 854 |
| 554 | Ga0495653_0014575 | 3300046463 | Bacteria | 6416 |
| 555 | Ga0495653_0200069 | 3300046463 | Bacteria | 1356 |
| 556 | Ga0495580_0004021 | 3300046472 | Bacteria | 12411 |
| 557 | Ga0495580_0023405 | 3300046472 | Bacteria | 4536 |
| 558 | Ga0495582_0000137 | 3300046473 | Bacteria | 39425 |
| 559 | Ga0495582_0028788 | 3300046473 | Bacteria | 3049 |
| 560 | Ga0495639_0000047 | 3300046475 | Bacteria | 53940 |
| 561 | Ga0495639_0006474 | 3300046475 | Bacteria | 5036 |
| 562 | Ga0495639_0016665 | 3300046475 | Bacteria | 3191 |
| 563 | Ga0495639_0076376 | 3300046475 | Bacteria | 1554 |
| 564 | Ga0495639_0110879 | 3300046475 | Bacteria | 1302 |
| 565 | Ga0495662_0001496 | 3300046476 | Bacteria | 11578 |
| 566 | Ga0495662_0016743 | 3300046476 | Bacteria | 3551 |
| 567 | Ga0495664_0001335 | 3300046477 | Bacteria | 12989 |
| 568 | Ga0495664_0023753 | 3300046477 | Bacteria | 3558 |
| 569 | Ga0495664_0033799 | 3300046477 | Bacteria | 3006 |
| 570 | Ga0495664_0034436 | 3300046477 | Bacteria | 2980 |
| 571 | Ga0495664_0036584 | 3300046477 | Bacteria | 2894 |
| 572 | Ga0495664_0061085 | 3300046477 | Bacteria | 2244 |
| 573 | Ga0495664_0145246 | 3300046477 | Bacteria | 1438 |
| 574 | Ga0495664_0352426 | 3300046477 | Bacteria | 886 |
| 575 | Ga0495584_0044891 | 3300046491 | Bacteria | 2230 |
| 576 | Ga0495584_0109348 | 3300046491 | Bacteria | 1398 |
| 577 | Ga0495585_0037387 | 3300046492 | Bacteria | 2734 |
| 578 | Ga0495594_0001833 | 3300046499 | Bacteria | 11057 |
| 579 | Ga0495594_0055256 | 3300046499 | Bacteria | 2189 |
| 580 | Ga0495594_0191194 | 3300046499 | Bacteria | 1166 |
| 581 | Ga0495607_0077143 | 3300046501 | Bacteria | 1841 |
| 582 | Ga0495606_0001505 | 3300046507 | Bacteria | 30975 |
| 583 | Ga0495606_0023313 | 3300046507 | Bacteria | 4488 |
| 584 | Ga0495606_0187297 | 3300046507 | Bacteria | 1189 |
| 585 | Ga0495608_0012014 | 3300046511 | Bacteria | 6020 |
| 586 | Ga0495608_0020960 | 3300046511 | Bacteria | 4488 |
| 587 | Ga0495608_0035676 | 3300046511 | Bacteria | 3352 |
| 588 | Ga0495608_0041836 | 3300046511 | Bacteria | 3065 |
| 589 | Ga0495608_0084299 | 3300046511 | Bacteria | 2062 |
| 590 | Ga0495618_0016660 | 3300046514 | Bacteria | 4501 |
| 591 | Ga0495618_0036338 | 3300046514 | Bacteria | 3091 |
| 592 | Ga0495618_0185823 | 3300046514 | Bacteria | 1319 |
| 593 | Ga0495620_0023843 | 3300046515 | Bacteria | 2918 |
| 594 | Ga0495620_0123525 | 3300046515 | Bacteria | 1019 |
| 595 | Ga0495628_0030327 | 3300046516 | Bacteria | 4379 |
| 596 | Ga0495628_0031595 | 3300046516 | Bacteria | 4282 |
| 597 | Ga0495628_0065433 | 3300046516 | Bacteria | 2843 |
| 598 | Ga0495630_0002625 | 3300046517 | Bacteria | 12446 |
| 599 | Ga0495643_0155884 | 3300046522 | Bacteria | 1127 |
| 600 | Ga0495644_0024756 | 3300046523 | Bacteria | 2283 |
| 601 | Ga0495648_0037184 | 3300046524 | Bacteria | 3131 |
| 602 | Ga0495648_0052154 | 3300046524 | Bacteria | 2487 |
| 603 | Ga0495648_0145614 | 3300046524 | Bacteria | 1242 |
| 604 | Ga0495666_0021412 | 3300046526 | Bacteria | 3200 |
| 605 | Ga0495666_0072875 | 3300046526 | Bacteria | 1630 |
| 606 | Ga0495642_0048876 | 3300046528 | Bacteria | 1736 |
| 607 | Ga0495652_0024273 | 3300046529 | Bacteria | 5368 |
| 608 | Ga0495652_0035614 | 3300046529 | Bacteria | 4331 |
| 609 | Ga0495652_0116125 | 3300046529 | Bacteria | 2143 |
| 610 | Ga0495654_0026918 | 3300046530 | Bacteria | 2952 |
| 611 | Ga0495665_0001239 | 3300046531 | Bacteria | 13612 |
| 612 | Ga0495640_0004375 | 3300046533 | Bacteria | 11274 |
| 613 | Ga0495640_0039432 | 3300046533 | Bacteria | 3314 |
| 614 | Ga0495640_0045852 | 3300046533 | Bacteria | 3032 |
| 615 | Ga0495640_0206436 | 3300046533 | Bacteria | 1243 |
| 616 | Ga0495586_0056945 | 3300046535 | Bacteria | 2121 |
| 617 | Ga0495586_0251223 | 3300046535 | Bacteria | 1009 |
| 618 | Ga0495587_0025522 | 3300046536 | Bacteria | 3611 |
| 619 | Ga0495587_0027825 | 3300046536 | Bacteria | 3442 |
| 620 | Ga0495587_0050017 | 3300046536 | Bacteria | 2473 |
| 621 | Ga0495609_0095258 | 3300046538 | Bacteria | 1292 |
| 622 | Ga0495597_0068617 | 3300046542 | Bacteria | 1532 |
| 623 | Ga0495645_0006200 | 3300046543 | Bacteria | 8278 |
| 624 | Ga0495645_0038038 | 3300046543 | Bacteria | 3509 |
| 625 | Ga0495645_0083302 | 3300046543 | Bacteria | 2292 |
| 626 | Ga0495622_0006199 | 3300046557 | Bacteria | 5554 |
| 627 | Ga0495622_0019937 | 3300046557 | Bacteria | 3121 |
| 628 | Ga0495622_0052256 | 3300046557 | Bacteria | 1896 |
| 629 | Ga0495622_0087161 | 3300046557 | Bacteria | 1435 |
| 630 | Ga0495633_0067115 | 3300046558 | Bacteria | 1675 |
| 631 | Ga0495667_0011170 | 3300046559 | Bacteria | 6078 |
| 632 | Ga0495667_0011352 | 3300046559 | Bacteria | 6031 |
| 633 | Ga0495667_0014203 | 3300046559 | Bacteria | 5377 |
| 634 | Ga0495667_0020913 | 3300046559 | Bacteria | 4416 |
| 635 | Ga0495667_0231259 | 3300046559 | Bacteria | 1178 |
| 636 | Ga0495667_0346272 | 3300046559 | Bacteria | 939 |
| 637 | Ga0495668_0114481 | 3300046616 | Bacteria | 1475 |
| 638 | Ga0495668_0281015 | 3300046616 | Bacteria | 912 |
| 639 | Ga0495634_0002221 | 3300046642 | Bacteria | 16276 |
| 640 | Ga0495634_0065576 | 3300046642 | Bacteria | 2406 |
| 641 | Ga0495634_0080503 | 3300046642 | Bacteria | 2131 |
| 642 | Ga0495634_0114296 | 3300046642 | Bacteria | 1733 |
| 643 | Ga0495635_0001455 | 3300046663 | Bacteria | 15846 |
| 644 | Ga0495635_0002383 | 3300046663 | Bacteria | 12797 |
| 645 | Ga0495635_0015226 | 3300046663 | Bacteria | 5382 |
| 646 | Ga0495635_0043906 | 3300046663 | Bacteria | 3084 |
| 647 | Ga0495659_0017854 | 3300046664 | Bacteria | 2357 |
| 648 | Ga0495661_0067748 | 3300046665 | Bacteria | 2096 |
| 649 | Ga0495588_0009398 | 3300046674 | Bacteria | 4518 |
| 650 | Ga0495588_0027119 | 3300046674 | Bacteria | 2862 |
| 651 | Ga0495588_0082779 | 3300046674 | Bacteria | 1676 |
| 652 | Ga0495657_0004131 | 3300046675 | Bacteria | 11623 |
| 653 | Ga0495657_0006427 | 3300046675 | Bacteria | 9197 |
| 654 | Ga0495657_0007196 | 3300046675 | Bacteria | 8628 |
| 655 | Ga0495657_0031614 | 3300046675 | Bacteria | 3698 |
| 656 | Ga0495657_0263483 | 3300046675 | Bacteria | 1035 |
| 657 | Ga0495599_0004838 | 3300046678 | Bacteria | 8011 |
| 658 | Ga0495599_0012226 | 3300046678 | Bacteria | 5288 |
| 659 | Ga0495599_0021279 | 3300046678 | Bacteria | 4045 |
| 660 | Ga0495599_0063521 | 3300046678 | Bacteria | 2307 |
| 661 | Ga0495623_0022752 | 3300046679 | Bacteria | 4046 |
| 662 | Ga0495623_0043882 | 3300046679 | Bacteria | 2843 |
| 663 | Ga0495623_0047224 | 3300046679 | Bacteria | 2733 |
| 664 | Ga0495623_0105003 | 3300046679 | Bacteria | 1717 |
| 665 | Ga0495646_0019779 | 3300046680 | Bacteria | 4258 |
| 666 | Ga0495646_0039661 | 3300046680 | Bacteria | 2903 |
| 667 | Ga0495646_0157891 | 3300046680 | Bacteria | 1257 |
| 668 | Ga0495646_0188503 | 3300046680 | Bacteria | 1128 |
| 669 | Ga0495647_0000577 | 3300046681 | Bacteria | 10837 |
| 670 | Ga0495658_0001786 | 3300046683 | Bacteria | 11096 |
| 671 | Ga0495613_0007297 | 3300046689 | Bacteria | 8233 |
| 672 | Ga0495613_0088477 | 3300046689 | Bacteria | 2244 |
| 673 | Ga0495613_0279715 | 3300046689 | Bacteria | 1159 |
| 674 | Ga0495624_0000898 | 3300046690 | Bacteria | 23624 |
| 675 | Ga0495670_0007688 | 3300046691 | Bacteria | 5299 |
| 676 | Ga0495649_0011437 | 3300046694 | Bacteria | 5203 |
| 677 | Ga0495600_0007660 | 3300046809 | Bacteria | 6616 |
| 678 | Ga0495600_0012921 | 3300046809 | Bacteria | 5233 |
| 679 | Ga0495600_0046708 | 3300046809 | Bacteria | 2824 |
| 680 | Ga0495600_0245128 | 3300046809 | Bacteria | 1141 |
| 681 | Ga0495600_0402645 | 3300046809 | Bacteria | 851 |
| 682 | Ga0495581_0101647 | 3300047315 | Bacteria | 1670 |
| 683 | Ga0495581_0197040 | 3300047315 | Bacteria | 1178 |
| 684 | Ga0495604_0013331 | 3300047317 | Bacteria | 6545 |
| 685 | Ga0495604_0025793 | 3300047317 | Bacteria | 4681 |
| 686 | Ga0495604_0032865 | 3300047317 | Bacteria | 4109 |
| 687 | Ga0495674_0010092 | 3300047319 | Bacteria | 8948 |
| 688 | Ga0495674_0030208 | 3300047319 | Bacteria | 4929 |
| 689 | Ga0495674_0034564 | 3300047319 | Bacteria | 4571 |
| 690 | Ga0495674_0053623 | 3300047319 | Bacteria | 3543 |
| 691 | Ga0495672_0200326 | 3300047320 | Bacteria | 999 |
| 692 | Ga0495676_0035661 | 3300047321 | Bacteria | 4159 |
| 693 | Ga0495680_0003456 | 3300047322 | Bacteria | 15551 |
| 694 | Ga0495680_0016657 | 3300047322 | Bacteria | 6307 |
| 695 | Ga0495680_0025862 | 3300047322 | Bacteria | 4852 |
| 696 | Ga0495683_0094120 | 3300047323 | Bacteria | 1448 |
| 697 | Ga0495687_098245 | 3300047443 | Bacteria | 1105 |
| 698 | Ga0495675_0011002 | 3300047444 | Bacteria | 5671 |
| 699 | Ga0495675_0025339 | 3300047444 | Bacteria | 3781 |
| 700 | Ga0495675_0097296 | 3300047444 | Bacteria | 1844 |
| 701 | Ga0495673_0018535 | 3300047469 | Bacteria | 3505 |
| 702 | Ga0495673_0079474 | 3300047469 | Bacteria | 1361 |
| 703 | Ga0495684_0000643 | 3300047471 | Bacteria | 28074 |
| 704 | Ga0495684_0007715 | 3300047471 | Bacteria | 8330 |
| 705 | Ga0495684_0014553 | 3300047471 | Bacteria | 6055 |
| 706 | Ga0495684_0024347 | 3300047471 | Bacteria | 4661 |
| 707 | Ga0495686_0073735 | 3300047472 | Bacteria | 2096 |
| 708 | Ga0495686_0152408 | 3300047472 | Bacteria | 1356 |
| 709 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 710 | Ga0495593_0006819 | 3300047673 | Bacteria | 6685 |
| 711 | Ga0495602_0009739 | 3300048088 | Bacteria | 9983 |
| 712 | Ga0495602_0175500 | 3300048088 | Bacteria | 1658 |
| 713 | Ga0495602_0279037 | 3300048088 | Bacteria | 1232 |
| 714 | Ga0495614_0001926 | 3300048089 | Bacteria | 9106 |
| 715 | Ga0495626_0065248 | 3300048091 | Bacteria | 1648 |
| 716 | Ga0496100_0001098 | 3300048903 | Bacteria | 13078 |
| 717 | Ga0496100_0025314 | 3300048903 | Bacteria | 3629 |
| 718 | Ga0496100_0611768 | 3300048903 | Bacteria | 847 |
| 719 | Ga0496101_0007768 | 3300048904 | Bacteria | 6971 |
| 720 | Ga0496101_0204607 | 3300048904 | Bacteria | 1527 |
| 721 | Ga0496101_0209813 | 3300048904 | Bacteria | 1509 |
| 722 | Ga0496101_0456393 | 3300048904 | Bacteria | 1008 |
| 723 | Ga0496102_0008520 | 3300048905 | Bacteria | 8791 |
| 724 | Ga0496102_0067033 | 3300048905 | Bacteria | 3291 |
| 725 | Ga0496102_0092857 | 3300048905 | Bacteria | 2795 |
| 726 | Ga0496103_0026822 | 3300048906 | Bacteria | 3487 |
| 727 | Ga0496103_0031194 | 3300048906 | Bacteria | 3246 |
| 728 | Ga0496103_0232949 | 3300048906 | Bacteria | 1185 |
| 729 | Ga0496104_0021810 | 3300048907 | Bacteria | 5883 |
| 730 | Ga0496104_0075775 | 3300048907 | Bacteria | 3203 |
| 731 | Ga0496104_0103613 | 3300048907 | Bacteria | 2726 |
| 732 | Ga0496104_0143993 | 3300048907 | Bacteria | 2289 |
| 733 | Ga0496104_0156668 | 3300048907 | Bacteria | 2185 |
| 734 | Ga0496104_0453855 | 3300048907 | Bacteria | 1193 |
| 735 | Ga0496105_0050226 | 3300048908 | Bacteria | 3445 |
| 736 | Ga0496105_0088994 | 3300048908 | Bacteria | 2550 |
| 737 | Ga0496105_0302833 | 3300048908 | Bacteria | 1284 |
| 738 | Ga0496105_0318889 | 3300048908 | Bacteria | 1246 |
| 739 | Ga0496105_0444744 | 3300048908 | Bacteria | 1024 |
| 740 | Ga0496106_0021872 | 3300048909 | Bacteria | 4750 |
| 741 | Ga0496106_0031033 | 3300048909 | Bacteria | 3983 |
| 742 | Ga0496106_0316315 | 3300048909 | Bacteria | 1253 |
| 743 | Ga0496107_0006973 | 3300048910 | Bacteria | 7786 |
| 744 | Ga0496107_0011332 | 3300048910 | Bacteria | 6205 |
| 745 | Ga0496107_0017889 | 3300048910 | Bacteria | 4989 |
| 746 | Ga0496107_0033519 | 3300048910 | Bacteria | 3675 |
| 747 | Ga0496107_0150128 | 3300048910 | Bacteria | 1723 |
| 748 | Ga0496107_0189283 | 3300048910 | Bacteria | 1529 |
| 749 | Ga0496107_0429676 | 3300048910 | Bacteria | 982 |
| 750 | Ga0496108_0000681 | 3300048911 | Bacteria | 26279 |
| 751 | Ga0496108_0041142 | 3300048911 | Bacteria | 3856 |
| 752 | Ga0496108_0068674 | 3300048911 | Bacteria | 2990 |
| 753 | Ga0496108_0104755 | 3300048911 | Bacteria | 2414 |
| 754 | Ga0496108_0235771 | 3300048911 | Bacteria | 1591 |
| 755 | Ga0496108_0258706 | 3300048911 | Bacteria | 1515 |
| 756 | Ga0496109_0000450 | 3300048912 | Bacteria | 35265 |
| 757 | Ga0496109_0118426 | 3300048912 | Bacteria | 2465 |
| 758 | Ga0496110_0009862 | 3300048913 | Bacteria | 7741 |
| 759 | Ga0496110_0015912 | 3300048913 | Bacteria | 6273 |
| 760 | Ga0496110_0061414 | 3300048913 | Bacteria | 3316 |
| 761 | Ga0496110_0353492 | 3300048913 | Bacteria | 1339 |
| 762 | Ga0496111_0026720 | 3300048914 | Bacteria | 4077 |
| 763 | Ga0496111_0117031 | 3300048914 | Bacteria | 1966 |
| 764 | Ga0496111_0143250 | 3300048914 | Bacteria | 1771 |
| 765 | Ga0496111_0220909 | 3300048914 | Bacteria | 1408 |
| 766 | Ga0496112_0000040 | 3300048915 | Bacteria | 89057 |
| 767 | Ga0496112_0005466 | 3300048915 | Bacteria | 10997 |
| 768 | Ga0496112_0012229 | 3300048915 | Bacteria | 7879 |
| 769 | Ga0496112_0080070 | 3300048915 | Bacteria | 3230 |
| 770 | Ga0496112_0099921 | 3300048915 | Bacteria | 2871 |
| 771 | Ga0496112_0357155 | 3300048915 | Bacteria | 1403 |
| 772 | Ga0496113_0073139 | 3300048916 | Bacteria | 2611 |
| 773 | Ga0496113_0083237 | 3300048916 | Bacteria | 2455 |
| 774 | Ga0496113_0268345 | 3300048916 | Bacteria | 1364 |
| 775 | Ga0496114_0043733 | 3300048917 | Bacteria | 3714 |
| 776 | Ga0496114_0073639 | 3300048917 | Bacteria | 2875 |
| 777 | Ga0496114_0378150 | 3300048917 | Bacteria | 1254 |
| 778 | Ga0496115_0019746 | 3300048918 | Bacteria | 5189 |
| 779 | Ga0496115_0025021 | 3300048918 | Bacteria | 4644 |
| 780 | Ga0496115_0078214 | 3300048918 | Bacteria | 2691 |
| 781 | Ga0496115_0125033 | 3300048918 | Bacteria | 2118 |
| 782 | Ga0496115_0138205 | 3300048918 | Bacteria | 2009 |
| 783 | Ga0496115_0473303 | 3300048918 | Bacteria | 1009 |
| 784 | Ga0496116_0013006 | 3300048919 | Bacteria | 6749 |
| 785 | Ga0496116_0134361 | 3300048919 | Bacteria | 1404 |
| 786 | Ga0496117_0042127 | 3300048920 | Bacteria | 3336 |
| 787 | Ga0496118_0105601 | 3300048921 | Bacteria | 1887 |
| 788 | Ga0496118_0221411 | 3300048921 | Bacteria | 1101 |
| 789 | Ga0496118_0232281 | 3300048921 | Bacteria | 1063 |
| 790 | Ga0496119_0096910 | 3300048922 | Bacteria | 1663 |
| 791 | Ga0496119_0125484 | 3300048922 | Bacteria | 1405 |
| 792 | Ga0496119_0159858 | 3300048922 | Bacteria | 1199 |
| 793 | Ga0496120_0017558 | 3300048923 | Bacteria | 4632 |
| 794 | Ga0496120_0047496 | 3300048923 | Bacteria | 2475 |
| 795 | Ga0496121_0004144 | 3300048924 | Bacteria | 19837 |
| 796 | Ga0496121_0004646 | 3300048924 | Bacteria | 18262 |
| 797 | Ga0496121_0011273 | 3300048924 | Bacteria | 9960 |
| 798 | Ga0496121_0011280 | 3300048924 | Bacteria | 9954 |
| 799 | Ga0496121_0020673 | 3300048924 | Bacteria | 6497 |
| 800 | Ga0496121_0054482 | 3300048924 | Bacteria | 3341 |
| 801 | Ga0496121_0079161 | 3300048924 | Bacteria | 2610 |
| 802 | Ga0496121_0387127 | 3300048924 | Bacteria | 920 |
| 803 | Ga0496122_0027804 | 3300048925 | Bacteria | 4822 |
| 804 | Ga0496123_0041988 | 3300048926 | Bacteria | 3163 |
| 805 | Ga0496124_0117186 | 3300048927 | Bacteria | 2134 |
| 806 | Ga0496124_0157120 | 3300048927 | Bacteria | 1777 |
| 807 | Ga0496124_0175044 | 3300048927 | Bacteria | 1657 |
| 808 | Ga0496124_0311890 | 3300048927 | Bacteria | 1131 |
| 809 | Ga0496125_0014087 | 3300048928 | Bacteria | 7813 |
| 810 | Ga0496125_0034884 | 3300048928 | Bacteria | 4426 |
| 811 | Ga0496125_0239573 | 3300048928 | Bacteria | 1153 |
| 812 | Ga0496125_0240716 | 3300048928 | Bacteria | 1149 |
| 813 | Ga0496126_0007855 | 3300048929 | Bacteria | 11618 |
| 814 | Ga0496126_0011852 | 3300048929 | Bacteria | 8969 |
| 815 | Ga0496126_0020062 | 3300048929 | Bacteria | 6563 |
| 816 | Ga0496126_0021191 | 3300048929 | Bacteria | 6355 |
| 817 | Ga0496126_0050628 | 3300048929 | Bacteria | 3784 |
| 818 | Ga0496126_0057447 | 3300048929 | Bacteria | 3513 |
| 819 | Ga0496126_0123865 | 3300048929 | Bacteria | 2239 |
| 820 | Ga0496126_0131840 | 3300048929 | Bacteria | 2159 |
| 821 | Ga0496126_0180569 | 3300048929 | Bacteria | 1793 |
| 822 | Ga0496126_0239287 | 3300048929 | Bacteria | 1517 |
| 823 | Ga0496126_0351035 | 3300048929 | Bacteria | 1206 |
| 824 | Ga0496126_0437592 | 3300048929 | Bacteria | 1054 |
| 825 | Ga0495682_0045355 | 3300049460 | Bacteria | 1606 |
| 826 | Ga0501031_0000157 | 3300049568 | Bacteria | 38675 |
| 827 | Ga0501031_0134054 | 3300049568 | Bacteria | 1618 |
| 828 | Ga0501032_0002373 | 3300049569 | Bacteria | 14704 |
| 829 | Ga0501032_0041477 | 3300049569 | Bacteria | 3125 |
| 830 | Ga0501032_0056621 | 3300049569 | Bacteria | 2635 |
| 831 | Ga0501032_0147437 | 3300049569 | Bacteria | 1548 |
| 832 | Ga0501033_0000175 | 3300049570 | Bacteria | 60845 |
| 833 | Ga0501033_0015675 | 3300049570 | Bacteria | 5746 |
| 834 | Ga0501033_0029845 | 3300049570 | Bacteria | 4098 |
| 835 | Ga0501033_0137433 | 3300049570 | Bacteria | 1768 |
| 836 | Ga0501033_0353094 | 3300049570 | Bacteria | 1030 |
| 837 | Ga0501034_0000820 | 3300049571 | Bacteria | 46252 |
| 838 | Ga0501034_0001125 | 3300049571 | Bacteria | 37359 |
| 839 | Ga0501034_0006645 | 3300049571 | Bacteria | 12413 |
| 840 | Ga0501034_0112713 | 3300049571 | Bacteria | 2709 |
| 841 | Ga0501034_0132177 | 3300049571 | Bacteria | 2478 |
| 842 | Ga0501034_0252111 | 3300049571 | Bacteria | 1709 |
| 843 | Ga0501034_0271556 | 3300049571 | Bacteria | 1636 |
| 844 | Ga0501034_0272484 | 3300049571 | Bacteria | 1633 |
| 845 | Ga0501034_0320796 | 3300049571 | Bacteria | 1482 |
| 846 | Ga0501036_0000216 | 3300049572 | Bacteria | 38518 |
| 847 | Ga0501036_0014414 | 3300049572 | Bacteria | 6583 |
| 848 | Ga0501036_0038499 | 3300049572 | Bacteria | 4047 |
| 849 | Ga0501036_0054801 | 3300049572 | Bacteria | 3378 |
| 850 | Ga0501036_0076808 | 3300049572 | Bacteria | 2825 |
| 851 | Ga0501036_0088464 | 3300049572 | Bacteria | 2617 |
| 852 | Ga0501036_0153801 | 3300049572 | Bacteria | 1940 |
| 853 | Ga0501036_0185938 | 3300049572 | Bacteria | 1748 |
| 854 | Ga0501036_0255863 | 3300049572 | Bacteria | 1467 |
| 855 | Ga0501037_0000100 | 3300049573 | Bacteria | 81013 |
| 856 | Ga0501037_0005146 | 3300049573 | Bacteria | 9514 |
| 857 | Ga0501037_0064569 | 3300049573 | Bacteria | 2667 |
| 858 | Ga0501037_0102430 | 3300049573 | Bacteria | 2065 |
| 859 | Ga0501037_0104824 | 3300049573 | Bacteria | 2038 |
| 860 | Ga0501037_0110016 | 3300049573 | Bacteria | 1985 |
| 861 | Ga0501037_0249446 | 3300049573 | Bacteria | 1242 |
| 862 | Ga0501038_0000157 | 3300049574 | Bacteria | 58169 |
| 863 | Ga0501038_0006074 | 3300049574 | Bacteria | 11174 |
| 864 | Ga0501038_0060880 | 3300049574 | Bacteria | 3229 |
| 865 | Ga0501038_0169787 | 3300049574 | Bacteria | 1766 |
| 866 | Ga0501039_0003135 | 3300049575 | Bacteria | 12366 |
| 867 | Ga0501039_0060505 | 3300049575 | Bacteria | 2933 |
| 868 | Ga0501039_0062906 | 3300049575 | Bacteria | 2875 |
| 869 | Ga0501043_0001316 | 3300049579 | Bacteria | 21701 |
| 870 | Ga0501043_0002528 | 3300049579 | Bacteria | 15463 |
| 871 | Ga0501043_0062271 | 3300049579 | Bacteria | 2929 |
| 872 | Ga0501043_0129543 | 3300049579 | Bacteria | 1977 |
| 873 | Ga0501043_0147381 | 3300049579 | Bacteria | 1842 |
| 874 | Ga0501043_0357670 | 3300049579 | Bacteria | 1108 |
| 875 | Ga0501046_0000387 | 3300049580 | Bacteria | 44269 |
| 876 | Ga0501046_0013980 | 3300049580 | Bacteria | 6780 |
| 877 | Ga0501046_0032260 | 3300049580 | Bacteria | 4242 |
| 878 | Ga0501046_0033348 | 3300049580 | Bacteria | 4161 |
| 879 | Ga0501046_0043396 | 3300049580 | Bacteria | 3580 |
| 880 | Ga0501046_0156191 | 3300049580 | Bacteria | 1718 |
| 881 | Ga0501046_0311814 | 3300049580 | Bacteria | 1147 |
| 882 | Ga0501047_0000124 | 3300049581 | Bacteria | 94721 |
| 883 | Ga0501047_0000159 | 3300049581 | Bacteria | 82106 |
| 884 | Ga0501047_0030311 | 3300049581 | Bacteria | 5216 |
| 885 | Ga0501047_0171580 | 3300049581 | Bacteria | 2037 |
| 886 | Ga0501047_0183419 | 3300049581 | Bacteria | 1959 |
| 887 | Ga0501047_0289294 | 3300049581 | Bacteria | 1482 |
| 888 | Ga0501047_0540566 | 3300049581 | Bacteria | 990 |
| 889 | Ga0501048_0000375 | 3300049582 | Bacteria | 31006 |
| 890 | Ga0501048_0000655 | 3300049582 | Bacteria | 24936 |
| 891 | Ga0501067_0002717 | 3300049583 | Bacteria | 9749 |
| 892 | Ga0501067_0102809 | 3300049583 | Bacteria | 1587 |
| 893 | Ga0501068_0000168 | 3300049584 | Bacteria | 30562 |
| 894 | Ga0501068_0005079 | 3300049584 | Bacteria | 7174 |
| 895 | Ga0501068_0036229 | 3300049584 | Bacteria | 2949 |
| 896 | Ga0501068_0065883 | 3300049584 | Bacteria | 2205 |
| 897 | Ga0501068_0124115 | 3300049584 | Bacteria | 1612 |
| 898 | Ga0501068_0206190 | 3300049584 | Bacteria | 1247 |
| 899 | Ga0501068_0319300 | 3300049584 | Bacteria | 995 |
| 900 | Ga0501069_0024244 | 3300049585 | Bacteria | 3308 |
| 901 | Ga0501070_0000457 | 3300049586 | Bacteria | 37005 |
| 902 | Ga0501070_0002236 | 3300049586 | Bacteria | 17009 |
| 903 | Ga0501070_0004540 | 3300049586 | Bacteria | 11913 |
| 904 | Ga0501070_0015967 | 3300049586 | Bacteria | 6311 |
| 905 | Ga0501070_0030651 | 3300049586 | Bacteria | 4506 |
| 906 | Ga0501070_0097587 | 3300049586 | Bacteria | 2430 |
| 907 | Ga0501070_0103032 | 3300049586 | Bacteria | 2360 |
| 908 | Ga0501070_0108875 | 3300049586 | Bacteria | 2289 |
| 909 | Ga0501070_0172352 | 3300049586 | Bacteria | 1782 |
| 910 | Ga0501070_0174936 | 3300049586 | Bacteria | 1767 |
| 911 | Ga0501070_0216585 | 3300049586 | Bacteria | 1571 |
| 912 | Ga0501070_0269611 | 3300049586 | Bacteria | 1390 |
| 913 | Ga0501071_0070112 | 3300049587 | Bacteria | 2553 |
| 914 | Ga0501071_0092696 | 3300049587 | Bacteria | 2220 |
| 915 | Ga0501071_0210478 | 3300049587 | Bacteria | 1462 |
| 916 | Ga0501072_0007209 | 3300049588 | Bacteria | 8438 |
| 917 | Ga0501072_0166330 | 3300049588 | Bacteria | 1760 |
| 918 | Ga0501073_0000239 | 3300049589 | Bacteria | 36296 |
| 919 | Ga0501073_0102023 | 3300049589 | Bacteria | 1992 |
| 920 | Ga0501073_0202250 | 3300049589 | Bacteria | 1373 |
| 921 | Ga0501073_0466945 | 3300049589 | Bacteria | 872 |
| 922 | Ga0501074_0000093 | 3300049590 | Bacteria | 42750 |
| 923 | Ga0501074_0035328 | 3300049590 | Bacteria | 3621 |
| 924 | Ga0501074_0068594 | 3300049590 | Bacteria | 2549 |
| 925 | Ga0501074_0264566 | 3300049590 | Bacteria | 1222 |
| 926 | Ga0501076_0391201 | 3300049592 | Bacteria | 1143 |
| 927 | Ga0501079_0008383 | 3300049741 | Bacteria | 7835 |
| 928 | Ga0501079_0066442 | 3300049741 | Bacteria | 2782 |
| 929 | Ga0501079_0078617 | 3300049741 | Bacteria | 2551 |
| 930 | Ga0501080_0000074 | 3300049742 | Bacteria | 66985 |
| 931 | Ga0501080_0002523 | 3300049742 | Bacteria | 16045 |
| 932 | Ga0501080_0005538 | 3300049742 | Bacteria | 11274 |
| 933 | Ga0501080_0052826 | 3300049742 | Bacteria | 3782 |
| 934 | Ga0501080_0063314 | 3300049742 | Bacteria | 3442 |
| 935 | Ga0501080_0079849 | 3300049742 | Bacteria | 3041 |
| 936 | Ga0501080_0299553 | 3300049742 | Bacteria | 1458 |
| 937 | Ga0501080_0659194 | 3300049742 | Bacteria | 925 |
| 938 | Ga0501081_0225355 | 3300049743 | Bacteria | 1364 |
| 939 | Ga0501081_0260119 | 3300049743 | Bacteria | 1268 |
| 940 | Ga0501083_0000485 | 3300049744 | Bacteria | 25494 |
| 941 | Ga0501083_0009923 | 3300049744 | Bacteria | 6722 |
| 942 | Ga0501083_0062919 | 3300049744 | Bacteria | 2475 |
| 943 | Ga0501083_0073861 | 3300049744 | Bacteria | 2267 |
| 944 | Ga0501083_0116804 | 3300049744 | Bacteria | 1751 |
| 945 | Ga0501083_0138032 | 3300049744 | Bacteria | 1597 |
| 946 | Ga0501083_0258354 | 3300049744 | Bacteria | 1133 |
| 947 | Ga0501035_0000172 | 3300049822 | Bacteria | 79203 |
| 948 | Ga0501035_0010744 | 3300049822 | Bacteria | 8477 |
| 949 | Ga0501035_0045324 | 3300049822 | Bacteria | 3956 |
| 950 | Ga0501044_0001469 | 3300049823 | Bacteria | 27682 |
| 951 | Ga0501044_0011690 | 3300049823 | Bacteria | 9509 |
| 952 | Ga0501044_0021657 | 3300049823 | Bacteria | 6853 |
| 953 | Ga0501044_0025735 | 3300049823 | Bacteria | 6238 |
| 954 | Ga0501044_0046842 | 3300049823 | Bacteria | 4475 |
| 955 | Ga0501044_0092432 | 3300049823 | Bacteria | 3051 |
| 956 | Ga0501044_0098148 | 3300049823 | Bacteria | 2949 |
| 957 | Ga0501044_0120000 | 3300049823 | Bacteria | 2631 |
| 958 | Ga0501044_0164958 | 3300049823 | Bacteria | 2190 |
| 959 | Ga0501044_0177867 | 3300049823 | Bacteria | 2096 |
| 960 | Ga0501044_0183147 | 3300049823 | Bacteria | 2060 |
| 961 | Ga0501044_0212800 | 3300049823 | Bacteria | 1886 |
| 962 | Ga0501044_0258634 | 3300049823 | Bacteria | 1680 |
| 963 | Ga0501044_0324558 | 3300049823 | Bacteria | 1463 |
| 964 | Ga0501045_0012933 | 3300049824 | Bacteria | 5883 |
| 965 | nmdc:mga03683_11799_c1 | 3300050489 | Bacteria | 3175 |
| 966 | nmdc:mga03683_1474_c1 | 3300050489 | Bacteria | 7023 |
| 967 | nmdc:mga03683_3122_c1 | 3300050489 | Bacteria | 5275 |
| 968 | nmdc:mga03n38_110804_c1 | 3300050490 | Bacteria | 1336 |
| 969 | nmdc:mga03n38_55032_c1 | 3300050490 | Bacteria | 1791 |
| 970 | nmdc:mga00v17_222206_c1 | 3300050491 | Bacteria | 1223 |
| 971 | nmdc:mga0yw44_3010_c1 | 3300050492 | Bacteria | 7363 |
| 972 | nmdc:mga0k408_332236_c1 | 3300050493 | Bacteria | 907 |
| 973 | nmdc:mga0k408_43647_c1 | 3300050493 | Bacteria | 2584 |
| 974 | nmdc:mga06z11_111400_c1 | 3300050494 | Bacteria | 1516 |
| 975 | nmdc:mga06z11_233064_c1 | 3300050494 | Bacteria | 1079 |
| 976 | nmdc:mga06z11_29164_c1 | 3300050494 | Bacteria | 2655 |
| 977 | nmdc:mga06z11_59566_c1 | 3300050494 | Bacteria | 1985 |
| 978 | nmdc:mga06z11_9341_c1 | 3300050494 | Bacteria | 4129 |
| 979 | nmdc:mga04h51_111410_c1 | 3300050495 | Bacteria | 1009 |
| 980 | nmdc:mga07m45_104987_c1 | 3300050496 | Bacteria | 1625 |
| 981 | nmdc:mga07m45_117657_c1 | 3300050496 | Bacteria | 1534 |
| 982 | nmdc:mga07m45_125034_c1 | 3300050496 | Bacteria | 1487 |
| 983 | nmdc:mga08y16_484020_c1 | 3300050511 | Bacteria | 1259 |
| 984 | nmdc:mga0n895_105724_c1 | 3300050512 | Bacteria | 2827 |
| 985 | nmdc:mga0n895_19893_c1 | 3300050512 | Bacteria | 6250 |
| 986 | nmdc:mga0n895_456373_c1 | 3300050512 | Bacteria | 1290 |
| 987 | nmdc:mga0sz30_1915_c1 | 3300050516 | Bacteria | 7430 |
| 988 | nmdc:mga0sz30_83144_c1 | 3300050516 | Bacteria | 1112 |
| 989 | nmdc:mga0sz30_98535_c1 | 3300050516 | Bacteria | 1017 |
| 990 | Ga0495601_0049011 | 3300053077 | Bacteria | 2662 |
| 991 | Ga0495601_0071093 | 3300053077 | Bacteria | 2222 |
| 992 | Ga0495601_0090397 | 3300053077 | Bacteria | 1969 |
| 993 | Ga0495601_0094122 | 3300053077 | Bacteria | 1930 |
| 994 | Ga0495612_0011691 | 3300053078 | Bacteria | 3538 |
| 995 | Ga0495612_0012298 | 3300053078 | Bacteria | 3450 |
| 996 | Ga0495612_0043035 | 3300053078 | Bacteria | 1844 |
| 997 | Ga0500635_0015817 | 3300053080 | Bacteria | 2234 |
| 998 | Ga0495655_0018998 | 3300053083 | Bacteria | 1520 |
| 999 | Ga0495655_0081910 | 3300053083 | Bacteria | 924 |
| 1000 | Ga0495595_0000332 | 3300053084 | Bacteria | 18218 |
| 1001 | Ga0495595_0015233 | 3300053084 | Bacteria | 3276 |
| 1002 | Ga0495619_0000633 | 3300053085 | Bacteria | 23194 |
| 1003 | Ga0495619_0181288 | 3300053085 | Bacteria | 1457 |
| 1004 | Ga0500578_0242366 | 3300053086 | Bacteria | 1089 |
| 1005 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 1006 | Ga0500644_0120262 | 3300053088 | Bacteria | 1023 |
| 1007 | Ga0500646_0001198 | 3300053090 | Bacteria | 6972 |
| 1008 | Ga0500647_0060458 | 3300053091 | Bacteria | 1823 |
| 1009 | Ga0500583_0011788 | 3300053092 | Bacteria | 3309 |
| 1010 | Ga0500651_0007818 | 3300053093 | Bacteria | 6253 |
| 1011 | Ga0500566_0000078 | 3300053094 | Bacteria | 47558 |
| 1012 | Ga0500566_0000290 | 3300053094 | Bacteria | 26984 |
| 1013 | Ga0500566_0003107 | 3300053094 | Bacteria | 9925 |
| 1014 | Ga0500640_000121 | 3300053095 | Bacteria | 14580 |
| 1015 | Ga0500641_0000385 | 3300053096 | Bacteria | 16362 |
| 1016 | Ga0500641_0004079 | 3300053096 | Bacteria | 5155 |
| 1017 | Ga0500641_0043383 | 3300053096 | Bacteria | 1825 |
| 1018 | Ga0500641_0066567 | 3300053096 | Bacteria | 1509 |
| 1019 | Ga0500641_0072315 | 3300053096 | Bacteria | 1453 |
| 1020 | Ga0500650_0003982 | 3300053098 | Bacteria | 5254 |
| 1021 | Ga0500555_006193 | 3300053103 | Bacteria | 3395 |
| 1022 | Ga0500555_035862 | 3300053103 | Bacteria | 1392 |
| 1023 | Ga0500556_0000195 | 3300053104 | Bacteria | 49800 |
| 1024 | Ga0500557_000011 | 3300053105 | Bacteria | 117471 |
| 1025 | Ga0500562_001257 | 3300053108 | Bacteria | 6255 |
| 1026 | Ga0500569_047274 | 3300053109 | Bacteria | 1286 |
| 1027 | Ga0500569_068215 | 3300053109 | Bacteria | 1114 |
| 1028 | Ga0500572_000170 | 3300053111 | Bacteria | 22863 |
| 1029 | Ga0500593_136427 | 3300053117 | Bacteria | 972 |
| 1030 | Ga0500595_001017 | 3300053119 | Bacteria | 15747 |
| 1031 | Ga0500595_001686 | 3300053119 | Bacteria | 11604 |
| 1032 | Ga0500595_009585 | 3300053119 | Bacteria | 3901 |
| 1033 | Ga0500595_050090 | 3300053119 | Bacteria | 1298 |
| 1034 | Ga0500597_177569 | 3300053120 | Bacteria | 905 |
| 1035 | Ga0500607_087138 | 3300053121 | Bacteria | 1579 |
| 1036 | Ga0500608_046544 | 3300053122 | Bacteria | 2084 |
| 1037 | Ga0500618_015074 | 3300053125 | Bacteria | 1960 |
| 1038 | Ga0500642_0000012 | 3300053130 | Bacteria | 206424 |
| 1039 | Ga0500642_0000090 | 3300053130 | Bacteria | 46849 |
| 1040 | Ga0500642_0008061 | 3300053130 | Bacteria | 3580 |
| 1041 | Ga0500642_0053707 | 3300053130 | Bacteria | 1787 |
| 1042 | Ga0500642_0091731 | 3300053130 | Bacteria | 1405 |
| 1043 | Ga0500652_000327 | 3300053131 | Bacteria | 17119 |
| 1044 | Ga0500655_005192 | 3300053133 | Bacteria | 2349 |
| 1045 | Ga0500559_0000421 | 3300053136 | Bacteria | 30317 |
| 1046 | Ga0500559_0004643 | 3300053136 | Bacteria | 6478 |
| 1047 | Ga0500559_0010249 | 3300053136 | Bacteria | 4029 |
| 1048 | Ga0500568_0000614 | 3300053139 | Bacteria | 25738 |
| 1049 | Ga0500568_0087628 | 3300053139 | Bacteria | 1176 |
| 1050 | Ga0500577_0077582 | 3300053142 | Bacteria | 1317 |
| 1051 | Ga0500586_000877 | 3300053145 | Bacteria | 6207 |
| 1052 | Ga0500588_0027314 | 3300053146 | Bacteria | 1607 |
| 1053 | Ga0500603_000081 | 3300053150 | Bacteria | 22182 |
| 1054 | Ga0500603_001666 | 3300053150 | Bacteria | 5003 |
| 1055 | Ga0500604_0002038 | 3300053151 | Bacteria | 5580 |
| 1056 | Ga0500616_0000408 | 3300053153 | Bacteria | 58453 |
| 1057 | Ga0500616_0004061 | 3300053153 | Bacteria | 10645 |
| 1058 | Ga0500616_0093103 | 3300053153 | Bacteria | 1488 |
| 1059 | Ga0500620_000984 | 3300053155 | Bacteria | 4988 |
| 1060 | Ga0500622_0001313 | 3300053156 | Bacteria | 20208 |
| 1061 | Ga0500622_0154692 | 3300053156 | Bacteria | 1080 |
| 1062 | Ga0500627_0051787 | 3300053158 | Bacteria | 1791 |
| 1063 | Ga0500630_004509 | 3300053159 | Bacteria | 6772 |
| 1064 | Ga0500633_0076507 | 3300053160 | Bacteria | 1204 |
| 1065 | Ga0500638_062165 | 3300053162 | Bacteria | 1793 |
| 1066 | Ga0500639_000028 | 3300053163 | Bacteria | 77951 |
| 1067 | Ga0500636_0001766 | 3300053177 | Bacteria | 11841 |
| 1068 | Ga0500636_0004562 | 3300053177 | Bacteria | 7855 |
| 1069 | Ga0500636_0021694 | 3300053177 | Bacteria | 3802 |
| 1070 | Ga0500636_0090488 | 3300053177 | Bacteria | 1753 |
| 1071 | Ga0500637_0112382 | 3300053178 | Bacteria | 1580 |
| 1072 | Ga0500637_0174378 | 3300053178 | Bacteria | 1234 |
| 1073 | Ga0500567_079370 | 3300053723 | Bacteria | 1420 |
| 1074 | Ga0500625_040499 | 3300053729 | Bacteria | 2192 |
| 1075 | Ga0500596_002436 | 3300053735 | Bacteria | 3666 |
| 1076 | Ga0500599_000324 | 3300053736 | Bacteria | 4686 |
| 1077 | Ga0500601_000049 | 3300053737 | Bacteria | 24772 |
| 1078 | Ga0500601_007957 | 3300053737 | Bacteria | 1176 |
| 1079 | Ga0501084_0070285 | 3300054114 | Bacteria | 2931 |
| 1080 | Ga0501084_0665997 | 3300054114 | Bacteria | 878 |
| 1081 | Ga0501082_0018897 | 3300060353 | Bacteria | 5937 |
| 1082 | Ga0501082_0238783 | 3300060353 | Bacteria | 1581 |
| 1083 | Ga0501082_0322313 | 3300060353 | Bacteria | 1346 |
| 1084 | Ga0466962_0173859 | 3300061719 | Bacteria | 1049 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0437592 | Ga0496126_0437592_233_1024 | 256 |
| 2 | 3300030521 | Ga0307511_10000014 | Ga0307511_1000001448 | 258 |
| 3 | 3300031251 | Ga0265327_10035083 | Ga0265327_100350834 | 258 |
| 4 | 3300048088 | Ga0495602_0279037 | Ga0495602_0279037_216_1013 | 258 |
| 5 | 3300053090 | Ga0500646_0001198 | Ga0500646_0001198_5800_6576 | 258 |
| 6 | 3300053103 | Ga0500555_035862 | Ga0500555_035862_188_964 | 258 |
| 7 | 3300053133 | Ga0500655_005192 | Ga0500655_005192_961_1737 | 258 |
| 8 | 3300053139 | Ga0500568_0087628 | Ga0500568_0087628_236_1012 | 258 |
| 9 | iso_pu_bacteria | 2507262055 | 2507511472 | 258 |
| 10 | iso_pu_bacteria | 2508501009 | 2508545280 | 258 |
| 11 | iso_pu_bacteria | 2508501042 | 2508694111 | 258 |
| 12 | iso_pu_bacteria | 2513237087 | 2513590907 | 258 |
| 13 | iso_pu_bacteria | 2513237092 | 2513624038 | 258 |
| 14 | iso_pu_bacteria | 2513237094 | 2513641000 | 258 |
| 15 | iso_pu_bacteria | 2513237095 | 2513648413 | 258 |
| 16 | iso_pu_bacteria | 2513237096 | 2513655367 | 258 |
| 17 | iso_pu_bacteria | 2513237101 | 2513696111 | 258 |
| 18 | iso_pu_bacteria | 2513237102 | 2513703637 | 258 |
| 19 | iso_pu_bacteria | 2513237104 | 2513716366 | 258 |
| 20 | iso_pu_bacteria | 2513237137 | 2513860069 | 258 |
| 21 | iso_pu_bacteria | 2513237139 | 2513875077 | 258 |
| 22 | iso_pu_bacteria | 2513237141 | 2513893108 | 258 |
| 23 | iso_pu_bacteria | 2513237145 | 2513916555 | 258 |
| 24 | iso_pu_bacteria | 2513237161 | 2514013849 | 258 |
| 25 | iso_pu_bacteria | 2515154112 | 2515624954 | 258 |
| 26 | iso_pu_bacteria | 2517093001 | 2517101238 | 258 |
| 27 | iso_pu_bacteria | 2517572143 | 2517889856 | 258 |
| 28 | iso_pu_bacteria | 2524023205 | 2524439820 | 258 |
| 29 | iso_pu_bacteria | 2524023210 | 2524465866 | 258 |
| 30 | iso_pu_bacteria | 2528768022 | 2528855416 | 258 |
| 31 | iso_pu_bacteria | 2617270741 | 2617374901 | 258 |
| 32 | iso_pu_bacteria | 2667528175 | 2671121123 | 258 |
| 33 | iso_pu_bacteria | 2721755755 | 2723848842 | 258 |
| 34 | iso_pu_bacteria | 2728368998 | 2728751749 | 258 |
| 35 | iso_pu_bacteria | 2744054633 | 2745075900 | 258 |
| 36 | iso_pu_bacteria | 2791355196 | 2793061369 | 258 |
| 37 | iso_pu_bacteria | 2791355197 | 2793073418 | 258 |
| 38 | iso_pu_bacteria | 2791355199 | 2793078840 | 258 |
| 39 | iso_pu_bacteria | 2802429603 | 2805916333 | 258 |
| 40 | iso_pu_bacteria | 2816332527 | 2818239995 | 258 |
| 41 | iso_pu_bacteria | 2824600985 | 2824607018 | 258 |
| 42 | iso_pu_bacteria | 2824609381 | 2824614311 | 258 |
| 43 | iso_pu_bacteria | 2824617872 | 2824622309 | 258 |
| 44 | iso_pu_bacteria | 2824626560 | 2824631478 | 258 |
| 45 | iso_pu_bacteria | 2824635225 | 2824637998 | 258 |
| 46 | iso_pu_bacteria | 2824644064 | 2824649750 | 258 |
| 47 | iso_pu_bacteria | 2824653114 | 2824656826 | 258 |
| 48 | iso_pu_bacteria | 2824661429 | 2824664146 | 258 |
| 49 | iso_pu_bacteria | 2824671348 | 2824674574 | 258 |
| 50 | iso_pu_bacteria | 2824679649 | 2824685740 | 258 |
| 51 | iso_pu_bacteria | 2824687955 | 2824690537 | 258 |
| 52 | iso_pu_bacteria | 2824696289 | 2824697883 | 258 |
| 53 | iso_pu_bacteria | 2824704595 | 2824713121 | 258 |
| 54 | iso_pu_bacteria | 2824714736 | 2824719700 | 258 |
| 55 | iso_pu_bacteria | 2824723954 | 2824726680 | 258 |
| 56 | iso_pu_bacteria | 2824732956 | 2824736394 | 258 |
| 57 | iso_pu_bacteria | 2824746037 | 2824752066 | 258 |
| 58 | iso_pu_bacteria | 2824753945 | 2824760844 | 258 |
| 59 | iso_pu_bacteria | 2824763712 | 2824770298 | 258 |
| 60 | iso_pu_bacteria | 2824773399 | 2824776238 | 258 |
| 61 | iso_pu_bacteria | 2838122688 | 2838130004 | 258 |
| 62 | iso_pu_bacteria | 2841941048 | 2841947043 | 258 |
| 63 | iso_pu_bacteria | 2841949485 | 2841955025 | 258 |
| 64 | iso_pu_bacteria | 2841957949 | 2841964956 | 258 |
| 65 | iso_pu_bacteria | 2841966195 | 2841969983 | 258 |
| 66 | iso_pu_bacteria | 2841974524 | 2841977375 | 258 |
| 67 | iso_pu_bacteria | 2841983080 | 2841990211 | 258 |
| 68 | iso_pu_bacteria | 2842038055 | 2842042213 | 258 |
| 69 | iso_pu_bacteria | 2842045827 | 2842050256 | 258 |
| 70 | iso_pu_bacteria | 2844315083 | 2844316436 | 258 |
| 71 | iso_pu_bacteria | 2847930680 | 2847939264 | 258 |
| 72 | iso_pu_bacteria | 2847939898 | 2847943771 | 258 |
| 73 | iso_pu_bacteria | 2849076700 | 2849081995 | 258 |
| 74 | iso_pu_bacteria | 2857509624 | 2857513526 | 258 |
| 75 | iso_pu_bacteria | 2874590934 | 2874594687 | 258 |
| 76 | iso_pu_bacteria | 2874604998 | 2874606025 | 258 |
| 77 | iso_pu_bacteria | 2874612657 | 2874615250 | 258 |
| 78 | iso_pu_bacteria | 2874620515 | 2874622656 | 258 |
| 79 | iso_pu_bacteria | 2874628541 | 2874633585 | 258 |
| 80 | iso_pu_bacteria | 2874645413 | 2874647264 | 258 |
| 81 | iso_pu_bacteria | 2876771140 | 2876773819 | 258 |
| 82 | iso_pu_bacteria | 2876808645 | 2876817811 | 258 |
| 83 | iso_pu_bacteria | 2876818435 | 2876819943 | 258 |
| 84 | iso_pu_bacteria | 2879074833 | 2879076062 | 258 |
| 85 | iso_pu_bacteria | 2879099564 | 2879104319 | 258 |
| 86 | iso_pu_bacteria | 2879110137 | 2879116813 | 258 |
| 87 | iso_pu_bacteria | 2879127579 | 2879129332 | 258 |
| 88 | iso_pu_bacteria | 2879142872 | 2879144094 | 258 |
| 89 | iso_pu_bacteria | 2881364244 | 2881369419 | 258 |
| 90 | iso_pu_bacteria | 2881665667 | 2881668270 | 258 |
| 91 | iso_pu_bacteria | 2885366525 | 2885373652 | 258 |
| 92 | iso_pu_bacteria | 2885374607 | 2885378572 | 258 |
| 93 | iso_pu_bacteria | 2885409591 | 2885411099 | 258 |
| 94 | iso_pu_bacteria | 2888388044 | 2888389733 | 258 |
| 95 | iso_pu_bacteria | 2888419890 | 2888421353 | 258 |
| 96 | iso_pu_bacteria | 2889033259 | 2889034466 | 258 |
| 97 | iso_pu_bacteria | 2903727486 | 2903732317 | 258 |
| 98 | iso_pu_bacteria | 2904666416 | 2904671337 | 258 |
| 99 | iso_pu_bacteria | 2904690495 | 2904692705 | 258 |
| 100 | iso_pu_bacteria | 2904711408 | 2904719637 | 258 |
| 101 | iso_pu_bacteria | 2906602504 | 2906606370 | 258 |
| 102 | iso_pu_bacteria | 2906610324 | 2906612411 | 258 |
| 103 | iso_pu_bacteria | 2906626472 | 2906626838 | 258 |
| 104 | iso_pu_bacteria | 2906635258 | 2906636758 | 258 |
| 105 | iso_pu_bacteria | 2906643746 | 2906649084 | 258 |
| 106 | iso_pu_bacteria | 2906660503 | 2906663453 | 258 |
| 107 | iso_pu_bacteria | 2908756301 | 2908757655 | 258 |
| 108 | iso_pu_bacteria | 2908775508 | 2908777385 | 258 |
| 109 | iso_pu_bacteria | 2922368715 | 2922377191 | 258 |
| 110 | iso_pu_bacteria | 2922386360 | 2922389528 | 258 |
| 111 | iso_pu_bacteria | 2922393267 | 2922398334 | 258 |
| 112 | iso_pu_bacteria | 2922425934 | 2922432958 | 258 |
| 113 | iso_pu_bacteria | 2929615660 | 2929623589 | 258 |
| 114 | iso_pu_bacteria | 2929624759 | 2929632708 | 258 |
| 115 | iso_pu_bacteria | 2932784394 | 2932793032 | 258 |
| 116 | iso_pu_bacteria | 2932794094 | 2932795841 | 258 |
| 117 | iso_pu_bacteria | 2932801729 | 2932802079 | 258 |
| 118 | iso_pu_bacteria | 2932809354 | 2932814697 | 258 |
| 119 | iso_pu_bacteria | 2932818245 | 2932823554 | 258 |
| 120 | iso_pu_bacteria | 2932828146 | 2932832991 | 258 |
| 121 | iso_pu_bacteria | 2933577622 | 2933585493 | 258 |
| 122 | iso_pu_bacteria | 2935608549 | 2935616337 | 258 |
| 123 | iso_pu_bacteria | 2935616580 | 2935623722 | 258 |
| 124 | iso_pu_bacteria | 2935630451 | 2935633044 | 258 |
| 125 | iso_pu_bacteria | 2935638405 | 2935639492 | 258 |
| 126 | iso_pu_bacteria | 2935648319 | 2935650732 | 258 |
| 127 | iso_pu_bacteria | 2935656913 | 2935662112 | 258 |
| 128 | iso_pu_bacteria | 2935665750 | 2935670437 | 258 |
| 129 | iso_pu_bacteria | 2935675223 | 2935679867 | 258 |
| 130 | iso_pu_bacteria | 2935684952 | 2935687437 | 258 |
| 131 | iso_pu_bacteria | 2935694250 | 2935696591 | 258 |
| 132 | iso_pu_bacteria | 2935703347 | 2935705409 | 258 |
| 133 | iso_pu_bacteria | 2935713505 | 2935718896 | 258 |
| 134 | iso_pu_bacteria | 2935722832 | 2935728548 | 258 |
| 135 | iso_pu_bacteria | 2935732158 | 2935736855 | 258 |
| 136 | iso_pu_bacteria | 2935741537 | 2935746142 | 258 |
| 137 | iso_pu_bacteria | 2935750917 | 2935753403 | 258 |
| 138 | iso_pu_bacteria | 2935760218 | 2935766204 | 258 |
| 139 | iso_pu_bacteria | 2935769743 | 2935770390 | 258 |
| 140 | iso_pu_bacteria | 2935777560 | 2935777579 | 258 |
| 141 | iso_pu_bacteria | 2935785616 | 2935786557 | 258 |
| 142 | iso_pu_bacteria | 2935793552 | 2935794612 | 258 |
| 143 | iso_pu_bacteria | 2935801545 | 2935807152 | 258 |
| 144 | iso_pu_bacteria | 2935810662 | 2935813934 | 258 |
| 145 | iso_pu_bacteria | 2935819856 | 2935827134 | 258 |
| 146 | iso_pu_bacteria | 2935827899 | 2935828975 | 258 |
| 147 | iso_pu_bacteria | 2935837841 | 2935844148 | 258 |
| 148 | iso_pu_bacteria | 2935847175 | 2935854315 | 258 |
| 149 | iso_pu_bacteria | 2935855204 | 2935862053 | 258 |
| 150 | iso_pu_bacteria | 2935864058 | 2935871617 | 258 |
| 151 | iso_pu_bacteria | 2935873716 | 2935880272 | 258 |
| 152 | iso_pu_bacteria | 2935883170 | 2935886267 | 258 |
| 153 | iso_pu_bacteria | 2935908558 | 2935913591 | 258 |
| 154 | iso_pu_bacteria | 2935926038 | 2935931092 | 258 |
| 155 | iso_pu_bacteria | 2935934488 | 2935935374 | 258 |
| 156 | iso_pu_bacteria | 2935942939 | 2935946940 | 258 |
| 157 | iso_pu_bacteria | 2935951376 | 2935953965 | 258 |
| 158 | iso_pu_bacteria | 2935959822 | 2935961400 | 258 |
| 159 | iso_pu_bacteria | 2935967501 | 2935968991 | 258 |
| 160 | iso_pu_bacteria | 2935975950 | 2935982361 | 258 |
| 161 | iso_pu_bacteria | 2935984226 | 2935985818 | 258 |
| 162 | iso_pu_bacteria | 2935992306 | 2935996938 | 258 |
| 163 | iso_pu_bacteria | 2936002035 | 2936005973 | 258 |
| 164 | iso_pu_bacteria | 2936011229 | 2936016306 | 258 |
| 165 | iso_pu_bacteria | 2936019824 | 2936025046 | 258 |
| 166 | iso_pu_bacteria | 2936028420 | 2936033611 | 258 |
| 167 | iso_pu_bacteria | 2936037263 | 2936039490 | 258 |
| 168 | iso_pu_bacteria | 2936046547 | 2936050957 | 258 |
| 169 | iso_pu_bacteria | 2936055302 | 2936057706 | 258 |
| 170 | iso_pu_bacteria | 2940556831 | 2940559316 | 258 |
| 171 | iso_pu_bacteria | 2941507105 | 2941509654 | 258 |
| 172 | iso_pu_bacteria | 2941515067 | 2941517483 | 258 |
| 173 | iso_pu_bacteria | 2941523033 | 2941526564 | 258 |
| 174 | iso_pu_bacteria | 2941531003 | 2941536912 | 258 |
| 175 | iso_pu_bacteria | 2941538514 | 2941542011 | 258 |
| 176 | iso_pu_bacteria | 3005474847 | 3005476067 | 258 |
| 177 | iso_pu_bacteria | 3005483717 | 3005491237 | 258 |
| 178 | iso_pu_bacteria | 3005506211 | 3005511082 | 258 |
| 179 | iso_pu_bacteria | 3005594810 | 3005596054 | 258 |
| 180 | iso_pu_bacteria | 3005710791 | 3005712007 | 258 |
| 181 | iso_pu_bacteria | 3005718088 | 3005719245 | 258 |
| 182 | iso_pu_bacteria | 8006926726 | 8006932927 | 258 |
| 183 | iso_pu_bacteria | 8006933436 | 8006937379 | 258 |
| 184 | iso_pu_bacteria | 8006964411 | 8006971091 | 258 |
| 185 | iso_pu_bacteria | 8006973647 | 8006977409 | 258 |
| 186 | iso_pu_bacteria | 8006984368 | 8006992957 | 258 |
| 187 | iso_pu_bacteria | 8006994254 | 8006996805 | 258 |
| 188 | iso_pu_bacteria | 8016511872 | 8016517060 | 258 |
| 189 | iso_pu_bacteria | 8016522445 | 8016524601 | 258 |
| 190 | iso_pu_bacteria | 8016530956 | 8016538163 | 258 |
| 191 | iso_pu_bacteria | 8016539877 | 8016542443 | 258 |
| 192 | iso_pu_bacteria | 8016557553 | 8016559245 | 258 |
| 193 | iso_pu_bacteria | 8016566248 | 8016567832 | 258 |
| 194 | iso_pu_bacteria | 8016575299 | 8016580519 | 258 |
| 195 | iso_pu_bacteria | 8016595262 | 8016597195 | 258 |
| 196 | iso_pu_bacteria | 8016603502 | 8016605078 | 258 |
| 197 | iso_pu_bacteria | 8016613128 | 8016619939 | 258 |
| 198 | iso_pu_bacteria | 8016622563 | 8016624160 | 258 |
| 199 | iso_pu_bacteria | 8016630954 | 8016637553 | 258 |
| 200 | iso_pu_bacteria | 8017057580 | 8017059522 | 258 |
| 201 | iso_pu_bacteria | 8019530166 | 8019537834 | 258 |
| 202 | iso_pu_bacteria | 8019538911 | 8019539464 | 258 |
| 203 | iso_pu_bacteria | 8019547302 | 8019551180 | 258 |
| 204 | iso_pu_bacteria | 8019555841 | 8019561252 | 258 |
| 205 | iso_pu_bacteria | 8019565922 | 8019571338 | 258 |
| 206 | iso_pu_bacteria | 8019576017 | 8019578985 | 258 |
| 207 | iso_pu_bacteria | 8019586578 | 8019597031 | 258 |
| 208 | iso_pu_bacteria | 8019597564 | 8019604652 | 258 |
| 209 | iso_pu_bacteria | 8019619141 | 8019624456 | 258 |
| 210 | iso_pu_bacteria | 8019659431 | 8019665515 | 258 |
| 211 | iso_pu_bacteria | 8019668869 | 8019675059 | 258 |
| 212 | iso_pu_bacteria | 8019678201 | 8019681039 | 258 |
| 213 | iso_pu_bacteria | 8019687851 | 8019694684 | 258 |
| 214 | iso_pu_bacteria | 8055742211 | 8055749750 | 258 |
| 215 | iso_pu_bacteria | 8056689827 | 8056692032 | 258 |
| 216 | iso_pu_bacteria | 8056967851 | 8056973961 | 258 |
| 217 | 3300005548 | Ga0070665_100010041 | Ga0070665_1000100418 | 259 |
| 218 | 3300021384 | Ga0213876_10031811 | Ga0213876_100318112 | 259 |
| 219 | 3300028379 | Ga0268266_10007696 | Ga0268266_100076962 | 259 |
| 220 | 3300037471 | Ga0395905_0033090 | Ga0395905_0033090_3883_4662 | 259 |
| 221 | 3300039437 | Ga0436365_0107606 | Ga0436365_0107606_1546_2325 | 259 |
| 222 | 3300044842 | Ga0466957_0399259 | Ga0466957_0399259_117_896 | 259 |
| 223 | 3300048913 | Ga0496110_0353492 | Ga0496110_0353492_174_953 | 259 |
| 224 | 3300049570 | Ga0501033_0353094 | Ga0501033_0353094_146_925 | 259 |
| 225 | 3300049580 | Ga0501046_0156191 | Ga0501046_0156191_34_813 | 259 |
| 226 | 3300049585 | Ga0501069_0024244 | Ga0501069_0024244_1743_2522 | 259 |
| 227 | 3300049586 | Ga0501070_0000457 | Ga0501070_0000457_14615_15394 | 259 |
| 228 | 3300049586 | Ga0501070_0103032 | Ga0501070_0103032_229_1008 | 259 |
| 229 | 3300049822 | Ga0501035_0045324 | Ga0501035_0045324_1536_2315 | 259 |
| 230 | 3300049823 | Ga0501044_0324558 | Ga0501044_0324558_462_1241 | 259 |
| 231 | iso_pu_bacteria | 2602042107 | 2603857471 | 259 |
| 232 | iso_pu_bacteria | 2857524615 | 2857526856 | 259 |
| 233 | iso_pu_bacteria | 2893066018 | 2893070015 | 259 |
| 234 | iso_pu_bacteria | 2919073203 | 2919077983 | 259 |
| 235 | 3300005459 | Ga0068867_100148114 | Ga0068867_1001481141 | 260 |
| 236 | 3300006178 | Ga0075367_10094223 | Ga0075367_100942232 | 260 |
| 237 | 3300010375 | Ga0105239_10049562 | Ga0105239_100495622 | 260 |
| 238 | 3300025931 | Ga0207644_10166234 | Ga0207644_101662341 | 260 |
| 239 | 3300025941 | Ga0207711_10269056 | Ga0207711_102690562 | 260 |
| 240 | 3300026041 | Ga0207639_10149330 | Ga0207639_101493303 | 260 |
| 241 | 3300026089 | Ga0207648_10214427 | Ga0207648_102144271 | 260 |
| 242 | 3300034957 | Ga0373938_0047277 | Ga0373938_0047277_70_858 | 260 |
| 243 | 3300035084 | Ga0373928_0024812 | Ga0373928_0024812_97_885 | 260 |
| 244 | 3300035112 | Ga0373932_0027113 | Ga0373932_0027113_326_1216 | 260 |
| 245 | 3300035691 | Ga0373931_0003428 | Ga0373931_0003428_3206_3994 | 260 |
| 246 | 3300048905 | Ga0496102_0067033 | Ga0496102_0067033_2079_2867 | 260 |
| 247 | 3300048906 | Ga0496103_0026822 | Ga0496103_0026822_2371_3159 | 260 |
| 248 | 3300048907 | Ga0496104_0156668 | Ga0496104_0156668_159_947 | 260 |
| 249 | 3300048910 | Ga0496107_0017889 | Ga0496107_0017889_1032_1820 | 260 |
| 250 | 3300048911 | Ga0496108_0068674 | Ga0496108_0068674_1782_2570 | 260 |
| 251 | 3300048915 | Ga0496112_0012229 | Ga0496112_0012229_3986_4774 | 260 |
| 252 | 3300048918 | Ga0496115_0019746 | Ga0496115_0019746_2196_2984 | 260 |
| 253 | 3300003203 | JGI25406J46586_10008897 | JGI25406J46586_100088976 | 261 |
| 254 | 3300005439 | Ga0070711_100081742 | Ga0070711_1000817422 | 261 |
| 255 | 3300005458 | Ga0070681_10057575 | Ga0070681_100575755 | 261 |
| 256 | 3300005530 | Ga0070679_100363504 | Ga0070679_1003635041 | 261 |
| 257 | 3300005937 | Ga0081455_10002785 | Ga0081455_100027853 | 261 |
| 258 | 3300005937 | Ga0081455_10030239 | Ga0081455_100302394 | 261 |
| 259 | 3300005981 | Ga0081538_10022448 | Ga0081538_100224483 | 261 |
| 260 | 3300005985 | Ga0081539_10000950 | Ga0081539_1000095053 | 261 |
| 261 | 3300005985 | Ga0081539_10012348 | Ga0081539_100123482 | 261 |
| 262 | 3300006028 | Ga0070717_10050992 | Ga0070717_100509922 | 261 |
| 263 | 3300006186 | Ga0075369_10080358 | Ga0075369_100803582 | 261 |
| 264 | 3300009545 | Ga0105237_10738019 | Ga0105237_107380191 | 261 |
| 265 | 3300009551 | Ga0105238_10123401 | Ga0105238_101234012 | 261 |
| 266 | 3300013102 | Ga0157371_10421709 | Ga0157371_104217091 | 261 |
| 267 | 3300013297 | Ga0157378_10232441 | Ga0157378_102324412 | 261 |
| 268 | 3300013306 | Ga0163162_10126279 | Ga0163162_101262793 | 261 |
| 269 | 3300013307 | Ga0157372_10812022 | Ga0157372_108120221 | 261 |
| 270 | 3300025261 | Ga0209233_1002060 | Ga0209233_10020604 | 261 |
| 271 | 3300025272 | Ga0209455_1004708 | Ga0209455_10047084 | 261 |
| 272 | 3300025297 | Ga0209758_1000580 | Ga0209758_100058046 | 261 |
| 273 | 3300025297 | Ga0209758_1018366 | Ga0209758_10183663 | 261 |
| 274 | 3300025910 | Ga0207684_10150476 | Ga0207684_101504762 | 261 |
| 275 | 3300025912 | Ga0207707_10019818 | Ga0207707_100198183 | 261 |
| 276 | 3300025913 | Ga0207695_10067753 | Ga0207695_100677532 | 261 |
| 277 | 3300025914 | Ga0207671_10031054 | Ga0207671_100310542 | 261 |
| 278 | 3300025916 | Ga0207663_10026393 | Ga0207663_100263933 | 261 |
| 279 | 3300025921 | Ga0207652_10025815 | Ga0207652_100258157 | 261 |
| 280 | 3300025928 | Ga0207700_10127505 | Ga0207700_101275052 | 261 |
| 281 | 3300034818 | Ga0373950_0005653 | Ga0373950_0005653_931_1716 | 261 |
| 282 | 3300035086 | Ga0373934_0035936 | Ga0373934_0035936_887_1672 | 261 |
| 283 | 3300035111 | Ga0373923_0001382 | Ga0373923_0001382_1930_2727 | 261 |
| 284 | 3300035111 | Ga0373923_0003036 | Ga0373923_0003036_210_995 | 261 |
| 285 | 3300035113 | Ga0373936_0049442 | Ga0373936_0049442_581_1366 | 261 |
| 286 | 3300035115 | Ga0373941_0000606 | Ga0373941_0000606_2174_2959 | 261 |
| 287 | 3300035117 | Ga0373953_0000985 | Ga0373953_0000985_6151_6948 | 261 |
| 288 | 3300035117 | Ga0373953_0100830 | Ga0373953_0100830_145_930 | 261 |
| 289 | 3300035118 | Ga0373954_0001160 | Ga0373954_0001160_3908_4705 | 261 |
| 290 | 3300035118 | Ga0373954_0013014 | Ga0373954_0013014_2693_3478 | 261 |
| 291 | 3300035118 | Ga0373954_0058984 | Ga0373954_0058984_931_1716 | 261 |
| 292 | 3300035118 | Ga0373954_0181020 | Ga0373954_0181020_108_893 | 261 |
| 293 | 3300035119 | Ga0373956_0001463 | Ga0373956_0001463_1479_2276 | 261 |
| 294 | 3300035119 | Ga0373956_0241638 | Ga0373956_0241638_60_845 | 261 |
| 295 | 3300035170 | Ga0373943_0010149 | Ga0373943_0010149_937_1722 | 261 |
| 296 | 3300035171 | Ga0373946_0064574 | Ga0373946_0064574_38_823 | 261 |
| 297 | 3300035172 | Ga0373955_0001372 | Ga0373955_0001372_1603_2400 | 261 |
| 298 | 3300035172 | Ga0373955_0087441 | Ga0373955_0087441_838_1623 | 261 |
| 299 | 3300035410 | Ga0373924_0011593 | Ga0373924_0011593_1698_2495 | 261 |
| 300 | 3300035410 | Ga0373924_0040913 | Ga0373924_0040913_836_1621 | 261 |
| 301 | 3300035724 | Ga0373933_0019482 | Ga0373933_0019482_1190_1987 | 261 |
| 302 | 3300035724 | Ga0373933_0053835 | Ga0373933_0053835_1606_2391 | 261 |
| 303 | 3300035724 | Ga0373933_0123769 | Ga0373933_0123769_513_1298 | 261 |
| 304 | 3300035725 | Ga0373947_0002439 | Ga0373947_0002439_8451_9236 | 261 |
| 305 | 3300035725 | Ga0373947_0027666 | Ga0373947_0027666_1453_2238 | 261 |
| 306 | 3300036401 | Ga0373937_0015298 | Ga0373937_0015298_1726_2523 | 261 |
| 307 | 3300036401 | Ga0373937_0028218 | Ga0373937_0028218_2161_2946 | 261 |
| 308 | 3300036401 | Ga0373937_0051447 | Ga0373937_0051447_320_1105 | 261 |
| 309 | 3300037068 | Ga0373925_0049532 | Ga0373925_0049532_413_1198 | 261 |
| 310 | 3300037068 | Ga0373925_0183889 | Ga0373925_0183889_14_799 | 261 |
| 311 | 3300037068 | Ga0373925_0205583 | Ga0373925_0205583_349_1134 | 261 |
| 312 | 3300045051 | Ga0451576_0018871 | Ga0451576_0018871_5940_6749 | 261 |
| 313 | 3300046452 | Ga0495617_058231 | Ga0495617_058231_440_1237 | 261 |
| 314 | 3300046454 | Ga0495592_0001238 | Ga0495592_0001238_15668_16465 | 261 |
| 315 | 3300046454 | Ga0495592_0086276 | Ga0495592_0086276_1443_2228 | 261 |
| 316 | 3300046459 | Ga0495629_0000750 | Ga0495629_0000750_10932_11729 | 261 |
| 317 | 3300046460 | Ga0495638_0054856 | Ga0495638_0054856_937_1734 | 261 |
| 318 | 3300046463 | Ga0495653_0014575 | Ga0495653_0014575_4144_4941 | 261 |
| 319 | 3300046472 | Ga0495580_0023405 | Ga0495580_0023405_3652_4437 | 261 |
| 320 | 3300046473 | Ga0495582_0028788 | Ga0495582_0028788_1201_1986 | 261 |
| 321 | 3300046475 | Ga0495639_0006474 | Ga0495639_0006474_3468_4253 | 261 |
| 322 | 3300046476 | Ga0495662_0016743 | Ga0495662_0016743_1018_1803 | 261 |
| 323 | 3300046477 | Ga0495664_0033799 | Ga0495664_0033799_587_1372 | 261 |
| 324 | 3300046492 | Ga0495585_0037387 | Ga0495585_0037387_1455_2252 | 261 |
| 325 | 3300046507 | Ga0495606_0001505 | Ga0495606_0001505_21416_22243 | 261 |
| 326 | 3300046511 | Ga0495608_0012014 | Ga0495608_0012014_3106_3891 | 261 |
| 327 | 3300046511 | Ga0495608_0020960 | Ga0495608_0020960_2060_2857 | 261 |
| 328 | 3300046511 | Ga0495608_0084299 | Ga0495608_0084299_224_1009 | 261 |
| 329 | 3300046514 | Ga0495618_0016660 | Ga0495618_0016660_2693_3490 | 261 |
| 330 | 3300046514 | Ga0495618_0036338 | Ga0495618_0036338_1263_2048 | 261 |
| 331 | 3300046526 | Ga0495666_0021412 | Ga0495666_0021412_1857_2642 | 261 |
| 332 | 3300046529 | Ga0495652_0024273 | Ga0495652_0024273_3733_4530 | 261 |
| 333 | 3300046533 | Ga0495640_0045852 | Ga0495640_0045852_953_1750 | 261 |
| 334 | 3300046533 | Ga0495640_0206436 | Ga0495640_0206436_419_1204 | 261 |
| 335 | 3300046536 | Ga0495587_0027825 | Ga0495587_0027825_612_1397 | 261 |
| 336 | 3300046559 | Ga0495667_0014203 | Ga0495667_0014203_1959_2756 | 261 |
| 337 | 3300046559 | Ga0495667_0020913 | Ga0495667_0020913_2259_3044 | 261 |
| 338 | 3300046642 | Ga0495634_0065576 | Ga0495634_0065576_1040_1825 | 261 |
| 339 | 3300046663 | Ga0495635_0002383 | Ga0495635_0002383_10939_11736 | 261 |
| 340 | 3300046663 | Ga0495635_0015226 | Ga0495635_0015226_2983_3768 | 261 |
| 341 | 3300046675 | Ga0495657_0004131 | Ga0495657_0004131_3957_4754 | 261 |
| 342 | 3300046675 | Ga0495657_0031614 | Ga0495657_0031614_987_1772 | 261 |
| 343 | 3300046678 | Ga0495599_0021279 | Ga0495599_0021279_2410_3207 | 261 |
| 344 | 3300046679 | Ga0495623_0022752 | Ga0495623_0022752_839_1636 | 261 |
| 345 | 3300046680 | Ga0495646_0039661 | Ga0495646_0039661_1613_2398 | 261 |
| 346 | 3300046680 | Ga0495646_0157891 | Ga0495646_0157891_52_849 | 261 |
| 347 | 3300046689 | Ga0495613_0088477 | Ga0495613_0088477_692_1489 | 261 |
| 348 | 3300046809 | Ga0495600_0012921 | Ga0495600_0012921_2711_3508 | 261 |
| 349 | 3300047315 | Ga0495581_0101647 | Ga0495581_0101647_283_1068 | 261 |
| 350 | 3300047317 | Ga0495604_0013331 | Ga0495604_0013331_4687_5484 | 261 |
| 351 | 3300047319 | Ga0495674_0034564 | Ga0495674_0034564_2596_3393 | 261 |
| 352 | 3300047319 | Ga0495674_0053623 | Ga0495674_0053623_910_1695 | 261 |
| 353 | 3300047322 | Ga0495680_0025862 | Ga0495680_0025862_3639_4424 | 261 |
| 354 | 3300047444 | Ga0495675_0011002 | Ga0495675_0011002_2450_3235 | 261 |
| 355 | 3300047471 | Ga0495684_0000643 | Ga0495684_0000643_26088_26885 | 261 |
| 356 | 3300047471 | Ga0495684_0007715 | Ga0495684_0007715_3261_4046 | 261 |
| 357 | 3300047673 | Ga0495593_0006819 | Ga0495593_0006819_4696_5493 | 261 |
| 358 | 3300048091 | Ga0495626_0065248 | Ga0495626_0065248_263_1060 | 261 |
| 359 | 3300048915 | Ga0496112_0000040 | Ga0496112_0000040_86850_87635 | 261 |
| 360 | 3300048924 | Ga0496121_0011280 | Ga0496121_0011280_7686_8492 | 261 |
| 361 | 3300048929 | Ga0496126_0011852 | Ga0496126_0011852_7324_8109 | 261 |
| 362 | 3300049568 | Ga0501031_0000157 | Ga0501031_0000157_37246_38073 | 261 |
| 363 | 3300049568 | Ga0501031_0134054 | Ga0501031_0134054_705_1490 | 261 |
| 364 | 3300049569 | Ga0501032_0002373 | Ga0501032_0002373_13255_14082 | 261 |
| 365 | 3300049569 | Ga0501032_0041477 | Ga0501032_0041477_68_856 | 261 |
| 366 | 3300049569 | Ga0501032_0056621 | Ga0501032_0056621_619_1407 | 261 |
| 367 | 3300049569 | Ga0501032_0147437 | Ga0501032_0147437_139_924 | 261 |
| 368 | 3300049570 | Ga0501033_0000175 | Ga0501033_0000175_34441_35268 | 261 |
| 369 | 3300049570 | Ga0501033_0015675 | Ga0501033_0015675_3868_4653 | 261 |
| 370 | 3300049570 | Ga0501033_0029845 | Ga0501033_0029845_704_1492 | 261 |
| 371 | 3300049571 | Ga0501034_0000820 | Ga0501034_0000820_22780_23568 | 261 |
| 372 | 3300049571 | Ga0501034_0001125 | Ga0501034_0001125_7989_8846 | 261 |
| 373 | 3300049571 | Ga0501034_0006645 | Ga0501034_0006645_639_1466 | 261 |
| 374 | 3300049571 | Ga0501034_0112713 | Ga0501034_0112713_505_1290 | 261 |
| 375 | 3300049571 | Ga0501034_0132177 | Ga0501034_0132177_1084_1869 | 261 |
| 376 | 3300049571 | Ga0501034_0252111 | Ga0501034_0252111_469_1257 | 261 |
| 377 | 3300049571 | Ga0501034_0272484 | Ga0501034_0272484_475_1332 | 261 |
| 378 | 3300049571 | Ga0501034_0320796 | Ga0501034_0320796_241_1029 | 261 |
| 379 | 3300049572 | Ga0501036_0000216 | Ga0501036_0000216_22340_23128 | 261 |
| 380 | 3300049572 | Ga0501036_0014414 | Ga0501036_0014414_4194_4979 | 261 |
| 381 | 3300049572 | Ga0501036_0038499 | Ga0501036_0038499_2627_3454 | 261 |
| 382 | 3300049572 | Ga0501036_0054801 | Ga0501036_0054801_1392_2177 | 261 |
| 383 | 3300049572 | Ga0501036_0076808 | Ga0501036_0076808_494_1282 | 261 |
| 384 | 3300049572 | Ga0501036_0088464 | Ga0501036_0088464_114_899 | 261 |
| 385 | 3300049572 | Ga0501036_0185938 | Ga0501036_0185938_806_1591 | 261 |
| 386 | 3300049573 | Ga0501037_0000100 | Ga0501037_0000100_77303_78130 | 261 |
| 387 | 3300049573 | Ga0501037_0005146 | Ga0501037_0005146_7358_8146 | 261 |
| 388 | 3300049573 | Ga0501037_0064569 | Ga0501037_0064569_474_1259 | 261 |
| 389 | 3300049573 | Ga0501037_0102430 | Ga0501037_0102430_637_1425 | 261 |
| 390 | 3300049573 | Ga0501037_0104824 | Ga0501037_0104824_671_1456 | 261 |
| 391 | 3300049573 | Ga0501037_0110016 | Ga0501037_0110016_198_986 | 261 |
| 392 | 3300049573 | Ga0501037_0249446 | Ga0501037_0249446_313_1098 | 261 |
| 393 | 3300049574 | Ga0501038_0000157 | Ga0501038_0000157_34426_35253 | 261 |
| 394 | 3300049574 | Ga0501038_0006074 | Ga0501038_0006074_8000_8785 | 261 |
| 395 | 3300049574 | Ga0501038_0060880 | Ga0501038_0060880_2393_3181 | 261 |
| 396 | 3300049574 | Ga0501038_0169787 | Ga0501038_0169787_873_1658 | 261 |
| 397 | 3300049575 | Ga0501039_0003135 | Ga0501039_0003135_605_1432 | 261 |
| 398 | 3300049575 | Ga0501039_0060505 | Ga0501039_0060505_418_1203 | 261 |
| 399 | 3300049575 | Ga0501039_0062906 | Ga0501039_0062906_691_1476 | 261 |
| 400 | 3300049579 | Ga0501043_0001316 | Ga0501043_0001316_8988_9815 | 261 |
| 401 | 3300049579 | Ga0501043_0002528 | Ga0501043_0002528_3272_4060 | 261 |
| 402 | 3300049579 | Ga0501043_0062271 | Ga0501043_0062271_1733_2518 | 261 |
| 403 | 3300049579 | Ga0501043_0129543 | Ga0501043_0129543_1140_1925 | 261 |
| 404 | 3300049579 | Ga0501043_0147381 | Ga0501043_0147381_736_1521 | 261 |
| 405 | 3300049579 | Ga0501043_0357670 | Ga0501043_0357670_74_859 | 261 |
| 406 | 3300049580 | Ga0501046_0000387 | Ga0501046_0000387_25904_26731 | 261 |
| 407 | 3300049580 | Ga0501046_0013980 | Ga0501046_0013980_4249_5034 | 261 |
| 408 | 3300049580 | Ga0501046_0033348 | Ga0501046_0033348_3174_3962 | 261 |
| 409 | 3300049580 | Ga0501046_0043396 | Ga0501046_0043396_821_1606 | 261 |
| 410 | 3300049580 | Ga0501046_0311814 | Ga0501046_0311814_236_1021 | 261 |
| 411 | 3300049581 | Ga0501047_0000124 | Ga0501047_0000124_61270_62058 | 261 |
| 412 | 3300049581 | Ga0501047_0000159 | Ga0501047_0000159_534_1361 | 261 |
| 413 | 3300049581 | Ga0501047_0030311 | Ga0501047_0030311_22_810 | 261 |
| 414 | 3300049581 | Ga0501047_0171580 | Ga0501047_0171580_58_843 | 261 |
| 415 | 3300049581 | Ga0501047_0289294 | Ga0501047_0289294_90_878 | 261 |
| 416 | 3300049581 | Ga0501047_0540566 | Ga0501047_0540566_80_937 | 261 |
| 417 | 3300049582 | Ga0501048_0000375 | Ga0501048_0000375_19523_20311 | 261 |
| 418 | 3300049582 | Ga0501048_0000655 | Ga0501048_0000655_10948_11775 | 261 |
| 419 | 3300049583 | Ga0501067_0002717 | Ga0501067_0002717_6638_7465 | 261 |
| 420 | 3300049583 | Ga0501067_0102809 | Ga0501067_0102809_115_900 | 261 |
| 421 | 3300049584 | Ga0501068_0000168 | Ga0501068_0000168_24449_25276 | 261 |
| 422 | 3300049584 | Ga0501068_0005079 | Ga0501068_0005079_743_1528 | 261 |
| 423 | 3300049584 | Ga0501068_0036229 | Ga0501068_0036229_1070_1855 | 261 |
| 424 | 3300049584 | Ga0501068_0065883 | Ga0501068_0065883_617_1402 | 261 |
| 425 | 3300049584 | Ga0501068_0124115 | Ga0501068_0124115_453_1241 | 261 |
| 426 | 3300049584 | Ga0501068_0206190 | Ga0501068_0206190_116_901 | 261 |
| 427 | 3300049584 | Ga0501068_0319300 | Ga0501068_0319300_74_859 | 261 |
| 428 | 3300049586 | Ga0501070_0002236 | Ga0501070_0002236_12344_13171 | 261 |
| 429 | 3300049586 | Ga0501070_0015967 | Ga0501070_0015967_2299_3087 | 261 |
| 430 | 3300049586 | Ga0501070_0030651 | Ga0501070_0030651_2496_3284 | 261 |
| 431 | 3300049586 | Ga0501070_0097587 | Ga0501070_0097587_1078_1863 | 261 |
| 432 | 3300049586 | Ga0501070_0108875 | Ga0501070_0108875_691_1476 | 261 |
| 433 | 3300049586 | Ga0501070_0174936 | Ga0501070_0174936_858_1643 | 261 |
| 434 | 3300049586 | Ga0501070_0269611 | Ga0501070_0269611_278_1066 | 261 |
| 435 | 3300049587 | Ga0501071_0092696 | Ga0501071_0092696_902_1687 | 261 |
| 436 | 3300049588 | Ga0501072_0007209 | Ga0501072_0007209_1874_2701 | 261 |
| 437 | 3300049588 | Ga0501072_0166330 | Ga0501072_0166330_629_1417 | 261 |
| 438 | 3300049589 | Ga0501073_0000239 | Ga0501073_0000239_636_1463 | 261 |
| 439 | 3300049589 | Ga0501073_0102023 | Ga0501073_0102023_874_1659 | 261 |
| 440 | 3300049589 | Ga0501073_0202250 | Ga0501073_0202250_400_1185 | 261 |
| 441 | 3300049589 | Ga0501073_0466945 | Ga0501073_0466945_31_819 | 261 |
| 442 | 3300049590 | Ga0501074_0000093 | Ga0501074_0000093_38309_39136 | 261 |
| 443 | 3300049590 | Ga0501074_0068594 | Ga0501074_0068594_1699_2487 | 261 |
| 444 | 3300049590 | Ga0501074_0264566 | Ga0501074_0264566_241_1026 | 261 |
| 445 | 3300049741 | Ga0501079_0008383 | Ga0501079_0008383_243_1070 | 261 |
| 446 | 3300049741 | Ga0501079_0066442 | Ga0501079_0066442_26_811 | 261 |
| 447 | 3300049741 | Ga0501079_0078617 | Ga0501079_0078617_945_1730 | 261 |
| 448 | 3300049742 | Ga0501080_0000074 | Ga0501080_0000074_35214_36002 | 261 |
| 449 | 3300049742 | Ga0501080_0002523 | Ga0501080_0002523_7237_8064 | 261 |
| 450 | 3300049742 | Ga0501080_0052826 | Ga0501080_0052826_2188_2973 | 261 |
| 451 | 3300049742 | Ga0501080_0063314 | Ga0501080_0063314_633_1418 | 261 |
| 452 | 3300049742 | Ga0501080_0299553 | Ga0501080_0299553_506_1294 | 261 |
| 453 | 3300049742 | Ga0501080_0659194 | Ga0501080_0659194_87_872 | 261 |
| 454 | 3300049743 | Ga0501081_0260119 | Ga0501081_0260119_215_1042 | 261 |
| 455 | 3300049744 | Ga0501083_0000485 | Ga0501083_0000485_14962_15750 | 261 |
| 456 | 3300049744 | Ga0501083_0062919 | Ga0501083_0062919_1214_1999 | 261 |
| 457 | 3300049744 | Ga0501083_0073861 | Ga0501083_0073861_826_1653 | 261 |
| 458 | 3300049744 | Ga0501083_0116804 | Ga0501083_0116804_611_1396 | 261 |
| 459 | 3300049744 | Ga0501083_0138032 | Ga0501083_0138032_702_1490 | 261 |
| 460 | 3300049744 | Ga0501083_0258354 | Ga0501083_0258354_31_816 | 261 |
| 461 | 3300049822 | Ga0501035_0000172 | Ga0501035_0000172_43779_44606 | 261 |
| 462 | 3300049822 | Ga0501035_0010744 | Ga0501035_0010744_7161_7946 | 261 |
| 463 | 3300049823 | Ga0501044_0001469 | Ga0501044_0001469_5302_6090 | 261 |
| 464 | 3300049823 | Ga0501044_0011690 | Ga0501044_0011690_2161_2988 | 261 |
| 465 | 3300049823 | Ga0501044_0021657 | Ga0501044_0021657_5326_6111 | 261 |
| 466 | 3300049823 | Ga0501044_0025735 | Ga0501044_0025735_556_1344 | 261 |
| 467 | 3300049823 | Ga0501044_0098148 | Ga0501044_0098148_1355_2140 | 261 |
| 468 | 3300049823 | Ga0501044_0177867 | Ga0501044_0177867_157_945 | 261 |
| 469 | 3300049823 | Ga0501044_0183147 | Ga0501044_0183147_1048_1833 | 261 |
| 470 | 3300049823 | Ga0501044_0212800 | Ga0501044_0212800_657_1442 | 261 |
| 471 | 3300049823 | Ga0501044_0258634 | Ga0501044_0258634_460_1248 | 261 |
| 472 | 3300049824 | Ga0501045_0012933 | Ga0501045_0012933_615_1442 | 261 |
| 473 | 3300050494 | nmdc:mga06z11_9341_c1 | nmdc:mga06z11_9341_c1_1258_2043 | 261 |
| 474 | 3300050516 | nmdc:mga0sz30_1915_c1 | nmdc:mga0sz30_1915_c1_4484_5269 | 261 |
| 475 | 3300053077 | Ga0495601_0094122 | Ga0495601_0094122_335_1120 | 261 |
| 476 | 3300053078 | Ga0495612_0011691 | Ga0495612_0011691_2606_3391 | 261 |
| 477 | 3300053078 | Ga0495612_0043035 | Ga0495612_0043035_32_817 | 261 |
| 478 | 3300053083 | Ga0495655_0018998 | Ga0495655_0018998_667_1464 | 261 |
| 479 | 3300053084 | Ga0495595_0000332 | Ga0495595_0000332_15220_16017 | 261 |
| 480 | 3300053084 | Ga0495595_0015233 | Ga0495595_0015233_2157_2942 | 261 |
| 481 | 3300053085 | Ga0495619_0000633 | Ga0495619_0000633_4651_5448 | 261 |
| 482 | 3300053142 | Ga0500577_0077582 | Ga0500577_0077582_433_1239 | 261 |
| 483 | 3300054114 | Ga0501084_0070285 | Ga0501084_0070285_1506_2333 | 261 |
| 484 | 3300060353 | Ga0501082_0018897 | Ga0501082_0018897_4476_5303 | 261 |
| 485 | 3300060353 | Ga0501082_0238783 | Ga0501082_0238783_696_1481 | 261 |
| 486 | 3300060353 | Ga0501082_0322313 | Ga0501082_0322313_505_1290 | 261 |
| 487 | 3300001990 | JGI24737J22298_10002347 | JGI24737J22298_100023471 | 262 |
| 488 | 3300002075 | JGI24738J21930_10034940 | JGI24738J21930_100349402 | 262 |
| 489 | 3300003203 | JGI25406J46586_10007816 | JGI25406J46586_100078161 | 262 |
| 490 | 3300003203 | JGI25406J46586_10087741 | JGI25406J46586_100877411 | 262 |
| 491 | 3300003215 | JGI25153J46596_10002507 | JGI25153J46596_100025075 | 262 |
| 492 | 3300003215 | JGI25153J46596_10002543 | JGI25153J46596_1000254310 | 262 |
| 493 | 3300003215 | JGI25153J46596_10014752 | JGI25153J46596_100147522 | 262 |
| 494 | 3300003215 | JGI25153J46596_10019384 | JGI25153J46596_100193842 | 262 |
| 495 | 3300003215 | JGI25153J46596_10037348 | JGI25153J46596_100373482 | 262 |
| 496 | 3300003354 | JGI25160J50197_1001353 | JGI25160J50197_10013531 | 262 |
| 497 | 3300003354 | JGI25160J50197_1001493 | JGI25160J50197_100149310 | 262 |
| 498 | 3300003354 | JGI25160J50197_1022712 | JGI25160J50197_10227122 | 262 |
| 499 | 3300003659 | JGI25404J52841_10006534 | JGI25404J52841_100065341 | 262 |
| 500 | 3300003659 | JGI25404J52841_10014112 | JGI25404J52841_100141122 | 262 |
| 501 | 3300003659 | JGI25404J52841_10016780 | JGI25404J52841_100167802 | 262 |
| 502 | 3300003771 | Ga0055526_1024692 | Ga0055526_10246922 | 262 |
| 503 | 3300003794 | Ga0055531_10001939 | Ga0055531_100019397 | 262 |
| 504 | 3300004625 | Ga0055543_1004643 | Ga0055543_10046434 | 262 |
| 505 | 3300005262 | Ga0065165_1001641 | Ga0065165_100164116 | 262 |
| 506 | 3300005262 | Ga0065165_1003060 | Ga0065165_10030608 | 262 |
| 507 | 3300005262 | Ga0065165_1006123 | Ga0065165_10061235 | 262 |
| 508 | 3300005262 | Ga0065165_1010912 | Ga0065165_10109122 | 262 |
| 509 | 3300005328 | Ga0070676_10231611 | Ga0070676_102316111 | 262 |
| 510 | 3300005329 | Ga0070683_100002138 | Ga0070683_10000213810 | 262 |
| 511 | 3300005329 | Ga0070683_100060360 | Ga0070683_1000603603 | 262 |
| 512 | 3300005329 | Ga0070683_100103534 | Ga0070683_1001035342 | 262 |
| 513 | 3300005334 | Ga0068869_100018734 | Ga0068869_1000187344 | 262 |
| 514 | 3300005334 | Ga0068869_100242509 | Ga0068869_1002425092 | 262 |
| 515 | 3300005335 | Ga0070666_10237029 | Ga0070666_102370291 | 262 |
| 516 | 3300005336 | Ga0070680_100001388 | Ga0070680_1000013889 | 262 |
| 517 | 3300005336 | Ga0070680_100019162 | Ga0070680_1000191623 | 262 |
| 518 | 3300005337 | Ga0070682_100447038 | Ga0070682_1004470381 | 262 |
| 519 | 3300005338 | Ga0068868_100051877 | Ga0068868_1000518771 | 262 |
| 520 | 3300005341 | Ga0070691_10000536 | Ga0070691_1000053614 | 262 |
| 521 | 3300005341 | Ga0070691_10176035 | Ga0070691_101760351 | 262 |
| 522 | 3300005344 | Ga0070661_100106670 | Ga0070661_1001066702 | 262 |
| 523 | 3300005347 | Ga0070668_100030574 | Ga0070668_1000305746 | 262 |
| 524 | 3300005347 | Ga0070668_100077506 | Ga0070668_1000775062 | 262 |
| 525 | 3300005347 | Ga0070668_100287654 | Ga0070668_1002876542 | 262 |
| 526 | 3300005354 | Ga0070675_100209354 | Ga0070675_1002093542 | 262 |
| 527 | 3300005355 | Ga0070671_100026992 | Ga0070671_1000269926 | 262 |
| 528 | 3300005355 | Ga0070671_100172984 | Ga0070671_1001729843 | 262 |
| 529 | 3300005434 | Ga0070709_10006354 | Ga0070709_1000635410 | 262 |
| 530 | 3300005434 | Ga0070709_10015776 | Ga0070709_100157763 | 262 |
| 531 | 3300005434 | Ga0070709_10135589 | Ga0070709_101355892 | 262 |
| 532 | 3300005435 | Ga0070714_100046252 | Ga0070714_1000462522 | 262 |
| 533 | 3300005436 | Ga0070713_100001186 | Ga0070713_1000011864 | 262 |
| 534 | 3300005436 | Ga0070713_100245356 | Ga0070713_1002453561 | 262 |
| 535 | 3300005437 | Ga0070710_10223903 | Ga0070710_102239032 | 262 |
| 536 | 3300005439 | Ga0070711_100011149 | Ga0070711_1000111491 | 262 |
| 537 | 3300005439 | Ga0070711_100048169 | Ga0070711_1000481693 | 262 |
| 538 | 3300005441 | Ga0070700_100144401 | Ga0070700_1001444012 | 262 |
| 539 | 3300005455 | Ga0070663_100023603 | Ga0070663_1000236032 | 262 |
| 540 | 3300005455 | Ga0070663_100082812 | Ga0070663_1000828122 | 262 |
| 541 | 3300005455 | Ga0070663_100161409 | Ga0070663_1001614091 | 262 |
| 542 | 3300005455 | Ga0070663_100178475 | Ga0070663_1001784753 | 262 |
| 543 | 3300005456 | Ga0070678_100165551 | Ga0070678_1001655512 | 262 |
| 544 | 3300005456 | Ga0070678_100197907 | Ga0070678_1001979072 | 262 |
| 545 | 3300005457 | Ga0070662_100084789 | Ga0070662_1000847891 | 262 |
| 546 | 3300005457 | Ga0070662_100124102 | Ga0070662_1001241023 | 262 |
| 547 | 3300005458 | Ga0070681_10017662 | Ga0070681_100176623 | 262 |
| 548 | 3300005458 | Ga0070681_10024432 | Ga0070681_100244329 | 262 |
| 549 | 3300005458 | Ga0070681_10039710 | Ga0070681_100397106 | 262 |
| 550 | 3300005458 | Ga0070681_10376412 | Ga0070681_103764122 | 262 |
| 551 | 3300005518 | Ga0070699_100199189 | Ga0070699_1001991892 | 262 |
| 552 | 3300005530 | Ga0070679_100003503 | Ga0070679_1000035037 | 262 |
| 553 | 3300005530 | Ga0070679_100027556 | Ga0070679_1000275562 | 262 |
| 554 | 3300005530 | Ga0070679_100147698 | Ga0070679_1001476983 | 262 |
| 555 | 3300005530 | Ga0070679_100150437 | Ga0070679_1001504374 | 262 |
| 556 | 3300005530 | Ga0070679_100174492 | Ga0070679_1001744923 | 262 |
| 557 | 3300005535 | Ga0070684_100001913 | Ga0070684_1000019132 | 262 |
| 558 | 3300005535 | Ga0070684_100599759 | Ga0070684_1005997592 | 262 |
| 559 | 3300005536 | Ga0070697_100060642 | Ga0070697_1000606421 | 262 |
| 560 | 3300005539 | Ga0068853_100067183 | Ga0068853_1000671832 | 262 |
| 561 | 3300005539 | Ga0068853_100097547 | Ga0068853_1000975472 | 262 |
| 562 | 3300005539 | Ga0068853_100109439 | Ga0068853_1001094393 | 262 |
| 563 | 3300005539 | Ga0068853_100528437 | Ga0068853_1005284371 | 262 |
| 564 | 3300005548 | Ga0070665_100104669 | Ga0070665_1001046694 | 262 |
| 565 | 3300005548 | Ga0070665_100277172 | Ga0070665_1002771722 | 262 |
| 566 | 3300005548 | Ga0070665_100307099 | Ga0070665_1003070992 | 262 |
| 567 | 3300005563 | Ga0068855_100060900 | Ga0068855_1000609006 | 262 |
| 568 | 3300005563 | Ga0068855_100181234 | Ga0068855_1001812341 | 262 |
| 569 | 3300005563 | Ga0068855_100195710 | Ga0068855_1001957102 | 262 |
| 570 | 3300005563 | Ga0068855_100220936 | Ga0068855_1002209362 | 262 |
| 571 | 3300005563 | Ga0068855_100238531 | Ga0068855_1002385312 | 262 |
| 572 | 3300005564 | Ga0070664_100113592 | Ga0070664_1001135922 | 262 |
| 573 | 3300005577 | Ga0068857_100010136 | Ga0068857_1000101365 | 262 |
| 574 | 3300005577 | Ga0068857_100103325 | Ga0068857_1001033253 | 262 |
| 575 | 3300005577 | Ga0068857_100481631 | Ga0068857_1004816312 | 262 |
| 576 | 3300005578 | Ga0068854_100393596 | Ga0068854_1003935961 | 262 |
| 577 | 3300005614 | Ga0068856_100000055 | Ga0068856_10000005540 | 262 |
| 578 | 3300005614 | Ga0068856_100124570 | Ga0068856_1001245704 | 262 |
| 579 | 3300005616 | Ga0068852_100008698 | Ga0068852_1000086986 | 262 |
| 580 | 3300005616 | Ga0068852_100016131 | Ga0068852_1000161313 | 262 |
| 581 | 3300005616 | Ga0068852_100264694 | Ga0068852_1002646943 | 262 |
| 582 | 3300005616 | Ga0068852_100357358 | Ga0068852_1003573582 | 262 |
| 583 | 3300005617 | Ga0068859_100051912 | Ga0068859_1000519122 | 262 |
| 584 | 3300005618 | Ga0068864_100096411 | Ga0068864_1000964112 | 262 |
| 585 | 3300005618 | Ga0068864_100164489 | Ga0068864_1001644892 | 262 |
| 586 | 3300005719 | Ga0068861_100048762 | Ga0068861_1000487625 | 262 |
| 587 | 3300005719 | Ga0068861_100108102 | Ga0068861_1001081022 | 262 |
| 588 | 3300005834 | Ga0068851_10003461 | Ga0068851_100034618 | 262 |
| 589 | 3300005834 | Ga0068851_10030046 | Ga0068851_100300461 | 262 |
| 590 | 3300005841 | Ga0068863_100252184 | Ga0068863_1002521842 | 262 |
| 591 | 3300005841 | Ga0068863_100420327 | Ga0068863_1004203272 | 262 |
| 592 | 3300005842 | Ga0068858_100169787 | Ga0068858_1001697872 | 262 |
| 593 | 3300005842 | Ga0068858_100346960 | Ga0068858_1003469602 | 262 |
| 594 | 3300005843 | Ga0068860_100127658 | Ga0068860_1001276582 | 262 |
| 595 | 3300005843 | Ga0068860_100168421 | Ga0068860_1001684211 | 262 |
| 596 | 3300005844 | Ga0068862_100151120 | Ga0068862_1001511202 | 262 |
| 597 | 3300005937 | Ga0081455_10005206 | Ga0081455_100052063 | 262 |
| 598 | 3300005937 | Ga0081455_10026606 | Ga0081455_100266065 | 262 |
| 599 | 3300005937 | Ga0081455_10056015 | Ga0081455_100560153 | 262 |
| 600 | 3300005983 | Ga0081540_1001339 | Ga0081540_100133915 | 262 |
| 601 | 3300005983 | Ga0081540_1002098 | Ga0081540_10020987 | 262 |
| 602 | 3300005983 | Ga0081540_1005216 | Ga0081540_10052165 | 262 |
| 603 | 3300005983 | Ga0081540_1006379 | Ga0081540_100637910 | 262 |
| 604 | 3300005983 | Ga0081540_1007306 | Ga0081540_10073065 | 262 |
| 605 | 3300005983 | Ga0081540_1012638 | Ga0081540_10126383 | 262 |
| 606 | 3300005983 | Ga0081540_1015748 | Ga0081540_10157486 | 262 |
| 607 | 3300005985 | Ga0081539_10000848 | Ga0081539_1000084830 | 262 |
| 608 | 3300006028 | Ga0070717_10000460 | Ga0070717_1000046020 | 262 |
| 609 | 3300006028 | Ga0070717_10637808 | Ga0070717_106378081 | 262 |
| 610 | 3300006038 | Ga0075365_10005251 | Ga0075365_100052511 | 262 |
| 611 | 3300006038 | Ga0075365_10182955 | Ga0075365_101829551 | 262 |
| 612 | 3300006038 | Ga0075365_10438560 | Ga0075365_104385601 | 262 |
| 613 | 3300006042 | Ga0075368_10003948 | Ga0075368_100039485 | 262 |
| 614 | 3300006042 | Ga0075368_10039890 | Ga0075368_100398901 | 262 |
| 615 | 3300006048 | Ga0075363_100005438 | Ga0075363_1000054383 | 262 |
| 616 | 3300006048 | Ga0075363_100021367 | Ga0075363_1000213673 | 262 |
| 617 | 3300006048 | Ga0075363_100042092 | Ga0075363_1000420923 | 262 |
| 618 | 3300006048 | Ga0075363_100043180 | Ga0075363_1000431802 | 262 |
| 619 | 3300006051 | Ga0075364_10020794 | Ga0075364_100207943 | 262 |
| 620 | 3300006051 | Ga0075364_10110313 | Ga0075364_101103132 | 262 |
| 621 | 3300006175 | Ga0070712_100047202 | Ga0070712_1000472024 | 262 |
| 622 | 3300006175 | Ga0070712_100069796 | Ga0070712_1000697964 | 262 |
| 623 | 3300006177 | Ga0075362_10003691 | Ga0075362_100036912 | 262 |
| 624 | 3300006177 | Ga0075362_10062546 | Ga0075362_100625462 | 262 |
| 625 | 3300006177 | Ga0075362_10089718 | Ga0075362_100897182 | 262 |
| 626 | 3300006178 | Ga0075367_10004454 | Ga0075367_100044543 | 262 |
| 627 | 3300006178 | Ga0075367_10140573 | Ga0075367_101405732 | 262 |
| 628 | 3300006178 | Ga0075367_10158117 | Ga0075367_101581171 | 262 |
| 629 | 3300006178 | Ga0075367_10205194 | Ga0075367_102051941 | 262 |
| 630 | 3300006178 | Ga0075367_10244491 | Ga0075367_102444911 | 262 |
| 631 | 3300006186 | Ga0075369_10000317 | Ga0075369_1000031711 | 262 |
| 632 | 3300006186 | Ga0075369_10067389 | Ga0075369_100673892 | 262 |
| 633 | 3300006186 | Ga0075369_10078965 | Ga0075369_100789652 | 262 |
| 634 | 3300006186 | Ga0075369_10183604 | Ga0075369_101836041 | 262 |
| 635 | 3300006195 | Ga0075366_10015532 | Ga0075366_100155322 | 262 |
| 636 | 3300006195 | Ga0075366_10032143 | Ga0075366_100321433 | 262 |
| 637 | 3300006237 | Ga0097621_100160495 | Ga0097621_1001604951 | 262 |
| 638 | 3300006237 | Ga0097621_100382136 | Ga0097621_1003821362 | 262 |
| 639 | 3300006353 | Ga0075370_10024383 | Ga0075370_100243832 | 262 |
| 640 | 3300006353 | Ga0075370_10028738 | Ga0075370_100287383 | 262 |
| 641 | 3300006353 | Ga0075370_10039851 | Ga0075370_100398515 | 262 |
| 642 | 3300006871 | Ga0075434_100006248 | Ga0075434_1000062484 | 262 |
| 643 | 3300006881 | Ga0068865_100427112 | Ga0068865_1004271122 | 262 |
| 644 | 3300006931 | Ga0097620_100051911 | Ga0097620_1000519115 | 262 |
| 645 | 3300006942 | Ga0099824_1012218 | Ga0099824_10122185 | 262 |
| 646 | 3300006943 | Ga0099822_1020991 | Ga0099822_10209917 | 262 |
| 647 | 3300007265 | Ga0099794_10025633 | Ga0099794_100256332 | 262 |
| 648 | 3300009093 | Ga0105240_10004901 | Ga0105240_100049017 | 262 |
| 649 | 3300009093 | Ga0105240_10016877 | Ga0105240_100168779 | 262 |
| 650 | 3300009093 | Ga0105240_10028049 | Ga0105240_100280499 | 262 |
| 651 | 3300009093 | Ga0105240_10047216 | Ga0105240_100472162 | 262 |
| 652 | 3300009093 | Ga0105240_10060225 | Ga0105240_100602254 | 262 |
| 653 | 3300009093 | Ga0105240_10143116 | Ga0105240_101431165 | 262 |
| 654 | 3300009093 | Ga0105240_10275726 | Ga0105240_102757261 | 262 |
| 655 | 3300009094 | Ga0111539_10175434 | Ga0111539_101754342 | 262 |
| 656 | 3300009094 | Ga0111539_10313290 | Ga0111539_103132901 | 262 |
| 657 | 3300009098 | Ga0105245_10010180 | Ga0105245_100101806 | 262 |
| 658 | 3300009098 | Ga0105245_10027248 | Ga0105245_100272485 | 262 |
| 659 | 3300009098 | Ga0105245_10030782 | Ga0105245_100307824 | 262 |
| 660 | 3300009098 | Ga0105245_10149162 | Ga0105245_101491622 | 262 |
| 661 | 3300009098 | Ga0105245_10773911 | Ga0105245_107739111 | 262 |
| 662 | 3300009147 | Ga0114129_11019987 | Ga0114129_110199871 | 262 |
| 663 | 3300009148 | Ga0105243_10189133 | Ga0105243_101891331 | 262 |
| 664 | 3300009174 | Ga0105241_10010434 | Ga0105241_100104343 | 262 |
| 665 | 3300009174 | Ga0105241_10016990 | Ga0105241_100169906 | 262 |
| 666 | 3300009174 | Ga0105241_10027975 | Ga0105241_100279752 | 262 |
| 667 | 3300009174 | Ga0105241_10111787 | Ga0105241_101117872 | 262 |
| 668 | 3300009177 | Ga0105248_10099912 | Ga0105248_100999122 | 262 |
| 669 | 3300009177 | Ga0105248_10907454 | Ga0105248_109074542 | 262 |
| 670 | 3300009545 | Ga0105237_10003690 | Ga0105237_1000369010 | 262 |
| 671 | 3300009545 | Ga0105237_10018023 | Ga0105237_100180237 | 262 |
| 672 | 3300009545 | Ga0105237_10081744 | Ga0105237_100817441 | 262 |
| 673 | 3300009545 | Ga0105237_10111094 | Ga0105237_101110942 | 262 |
| 674 | 3300009551 | Ga0105238_10038154 | Ga0105238_100381542 | 262 |
| 675 | 3300009551 | Ga0105238_10250775 | Ga0105238_102507752 | 262 |
| 676 | 3300009551 | Ga0105238_10269569 | Ga0105238_102695692 | 262 |
| 677 | 3300009553 | Ga0105249_10480820 | Ga0105249_104808202 | 262 |
| 678 | 3300010375 | Ga0105239_10015287 | Ga0105239_100152876 | 262 |
| 679 | 3300010375 | Ga0105239_10018873 | Ga0105239_100188736 | 262 |
| 680 | 3300010375 | Ga0105239_10096921 | Ga0105239_100969213 | 262 |
| 681 | 3300010375 | Ga0105239_10111724 | Ga0105239_101117241 | 262 |
| 682 | 3300010375 | Ga0105239_10188800 | Ga0105239_101888003 | 262 |
| 683 | 3300010375 | Ga0105239_10317477 | Ga0105239_103174773 | 262 |
| 684 | 3300011119 | Ga0105246_10005026 | Ga0105246_1000502612 | 262 |
| 685 | 3300011119 | Ga0105246_10017226 | Ga0105246_100172262 | 262 |
| 686 | 3300011119 | Ga0105246_10562493 | Ga0105246_105624931 | 262 |
| 687 | 3300013104 | Ga0157370_10167354 | Ga0157370_101673542 | 262 |
| 688 | 3300013104 | Ga0157370_10180275 | Ga0157370_101802752 | 262 |
| 689 | 3300013105 | Ga0157369_10016812 | Ga0157369_100168125 | 262 |
| 690 | 3300013105 | Ga0157369_10037771 | Ga0157369_100377711 | 262 |
| 691 | 3300013105 | Ga0157369_10074657 | Ga0157369_100746572 | 262 |
| 692 | 3300013105 | Ga0157369_10086808 | Ga0157369_100868082 | 262 |
| 693 | 3300013296 | Ga0157374_10028177 | Ga0157374_100281773 | 262 |
| 694 | 3300013296 | Ga0157374_10053183 | Ga0157374_100531836 | 262 |
| 695 | 3300013296 | Ga0157374_10169641 | Ga0157374_101696413 | 262 |
| 696 | 3300013306 | Ga0163162_10232701 | Ga0163162_102327012 | 262 |
| 697 | 3300013308 | Ga0157375_10081867 | Ga0157375_100818672 | 262 |
| 698 | 3300014497 | Ga0182008_10179028 | Ga0182008_101790281 | 262 |
| 699 | 3300014745 | Ga0157377_10071003 | Ga0157377_100710032 | 262 |
| 700 | 3300014745 | Ga0157377_10262661 | Ga0157377_102626612 | 262 |
| 701 | 3300014969 | Ga0157376_10023264 | Ga0157376_100232644 | 262 |
| 702 | 3300014969 | Ga0157376_10083788 | Ga0157376_100837882 | 262 |
| 703 | 3300014969 | Ga0157376_10401182 | Ga0157376_104011822 | 262 |
| 704 | 3300020081 | Ga0206354_11243179 | Ga0206354_112431792 | 262 |
| 705 | 3300020082 | Ga0206353_11151056 | Ga0206353_111510562 | 262 |
| 706 | 3300021320 | Ga0214544_1000005 | Ga0214544_100000541 | 262 |
| 707 | 3300021321 | Ga0214542_1000004 | Ga0214542_100000445 | 262 |
| 708 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005352 | 262 |
| 709 | 3300021327 | Ga0214543_1000111 | Ga0214543_100011163 | 262 |
| 710 | 3300021358 | Ga0213873_10023750 | Ga0213873_100237502 | 262 |
| 711 | 3300021361 | Ga0213872_10060892 | Ga0213872_100608923 | 262 |
| 712 | 3300021388 | Ga0213875_10116771 | Ga0213875_101167712 | 262 |
| 713 | 3300025253 | Ga0209677_106835 | Ga0209677_1068352 | 262 |
| 714 | 3300025254 | Ga0209148_1000235 | Ga0209148_100023572 | 262 |
| 715 | 3300025254 | Ga0209148_1013088 | Ga0209148_10130882 | 262 |
| 716 | 3300025261 | Ga0209233_1003872 | Ga0209233_10038724 | 262 |
| 717 | 3300025261 | Ga0209233_1010292 | Ga0209233_10102926 | 262 |
| 718 | 3300025272 | Ga0209455_1000637 | Ga0209455_100063715 | 262 |
| 719 | 3300025291 | Ga0209675_1003389 | Ga0209675_10033897 | 262 |
| 720 | 3300025295 | Ga0209564_1000755 | Ga0209564_100075538 | 262 |
| 721 | 3300025295 | Ga0209564_1005342 | Ga0209564_10053421 | 262 |
| 722 | 3300025295 | Ga0209564_1013065 | Ga0209564_10130653 | 262 |
| 723 | 3300025297 | Ga0209758_1000102 | Ga0209758_1000102174 | 262 |
| 724 | 3300025297 | Ga0209758_1000680 | Ga0209758_100068049 | 262 |
| 725 | 3300025297 | Ga0209758_1002859 | Ga0209758_10028591 | 262 |
| 726 | 3300025297 | Ga0209758_1003592 | Ga0209758_10035929 | 262 |
| 727 | 3300025297 | Ga0209758_1003725 | Ga0209758_10037259 | 262 |
| 728 | 3300025297 | Ga0209758_1008851 | Ga0209758_10088512 | 262 |
| 729 | 3300025297 | Ga0209758_1037504 | Ga0209758_10375042 | 262 |
| 730 | 3300025299 | Ga0209256_1004953 | Ga0209256_10049539 | 262 |
| 731 | 3300025299 | Ga0209256_1035119 | Ga0209256_10351192 | 262 |
| 732 | 3300025302 | Ga0207426_1000532 | Ga0207426_100053244 | 262 |
| 733 | 3300025302 | Ga0207426_1002013 | Ga0207426_100201313 | 262 |
| 734 | 3300025302 | Ga0207426_1009466 | Ga0207426_10094663 | 262 |
| 735 | 3300025303 | Ga0209051_1044393 | Ga0209051_10443931 | 262 |
| 736 | 3300025303 | Ga0209051_1047917 | Ga0209051_10479172 | 262 |
| 737 | 3300025304 | Ga0209257_1003378 | Ga0209257_10033785 | 262 |
| 738 | 3300025304 | Ga0209257_1006352 | Ga0209257_100635210 | 262 |
| 739 | 3300025885 | Ga0207653_10041455 | Ga0207653_100414553 | 262 |
| 740 | 3300025899 | Ga0207642_10043735 | Ga0207642_100437353 | 262 |
| 741 | 3300025901 | Ga0207688_10046651 | Ga0207688_100466512 | 262 |
| 742 | 3300025903 | Ga0207680_10135522 | Ga0207680_101355221 | 262 |
| 743 | 3300025904 | Ga0207647_10001253 | Ga0207647_100012536 | 262 |
| 744 | 3300025906 | Ga0207699_10019382 | Ga0207699_100193824 | 262 |
| 745 | 3300025906 | Ga0207699_10036666 | Ga0207699_100366664 | 262 |
| 746 | 3300025907 | Ga0207645_10104474 | Ga0207645_101044742 | 262 |
| 747 | 3300025909 | Ga0207705_10048614 | Ga0207705_100486141 | 262 |
| 748 | 3300025909 | Ga0207705_10138983 | Ga0207705_101389832 | 262 |
| 749 | 3300025911 | Ga0207654_10004638 | Ga0207654_100046384 | 262 |
| 750 | 3300025911 | Ga0207654_10017841 | Ga0207654_100178413 | 262 |
| 751 | 3300025912 | Ga0207707_10001016 | Ga0207707_1000101613 | 262 |
| 752 | 3300025912 | Ga0207707_10032842 | Ga0207707_100328424 | 262 |
| 753 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006763 | 262 |
| 754 | 3300025913 | Ga0207695_10007711 | Ga0207695_1000771112 | 262 |
| 755 | 3300025913 | Ga0207695_10054420 | Ga0207695_100544202 | 262 |
| 756 | 3300025913 | Ga0207695_10403698 | Ga0207695_104036981 | 262 |
| 757 | 3300025914 | Ga0207671_10014887 | Ga0207671_100148878 | 262 |
| 758 | 3300025914 | Ga0207671_10071058 | Ga0207671_100710582 | 262 |
| 759 | 3300025914 | Ga0207671_10118439 | Ga0207671_101184394 | 262 |
| 760 | 3300025915 | Ga0207693_10009325 | Ga0207693_100093255 | 262 |
| 761 | 3300025915 | Ga0207693_10051019 | Ga0207693_100510193 | 262 |
| 762 | 3300025915 | Ga0207693_10060539 | Ga0207693_100605392 | 262 |
| 763 | 3300025916 | Ga0207663_10206671 | Ga0207663_102066712 | 262 |
| 764 | 3300025917 | Ga0207660_10000924 | Ga0207660_1000092414 | 262 |
| 765 | 3300025917 | Ga0207660_10427726 | Ga0207660_104277261 | 262 |
| 766 | 3300025919 | Ga0207657_10001391 | Ga0207657_1000139125 | 262 |
| 767 | 3300025919 | Ga0207657_10427382 | Ga0207657_104273821 | 262 |
| 768 | 3300025920 | Ga0207649_10050880 | Ga0207649_100508802 | 262 |
| 769 | 3300025920 | Ga0207649_10073277 | Ga0207649_100732774 | 262 |
| 770 | 3300025921 | Ga0207652_10003893 | Ga0207652_1000389314 | 262 |
| 771 | 3300025921 | Ga0207652_10004944 | Ga0207652_100049445 | 262 |
| 772 | 3300025924 | Ga0207694_10195440 | Ga0207694_101954402 | 262 |
| 773 | 3300025924 | Ga0207694_10343030 | Ga0207694_103430302 | 262 |
| 774 | 3300025925 | Ga0207650_10172532 | Ga0207650_101725323 | 262 |
| 775 | 3300025927 | Ga0207687_10008945 | Ga0207687_100089454 | 262 |
| 776 | 3300025927 | Ga0207687_10189937 | Ga0207687_101899371 | 262 |
| 777 | 3300025928 | Ga0207700_10034028 | Ga0207700_100340284 | 262 |
| 778 | 3300025931 | Ga0207644_10098468 | Ga0207644_100984683 | 262 |
| 779 | 3300025931 | Ga0207644_10505516 | Ga0207644_105055162 | 262 |
| 780 | 3300025933 | Ga0207706_10169512 | Ga0207706_101695124 | 262 |
| 781 | 3300025935 | Ga0207709_10134404 | Ga0207709_101344042 | 262 |
| 782 | 3300025939 | Ga0207665_10023296 | Ga0207665_100232961 | 262 |
| 783 | 3300025940 | Ga0207691_10562018 | Ga0207691_105620181 | 262 |
| 784 | 3300025941 | Ga0207711_10058971 | Ga0207711_100589712 | 262 |
| 785 | 3300025941 | Ga0207711_10122248 | Ga0207711_101222483 | 262 |
| 786 | 3300025942 | Ga0207689_10051839 | Ga0207689_100518392 | 262 |
| 787 | 3300025942 | Ga0207689_10202100 | Ga0207689_102021001 | 262 |
| 788 | 3300025944 | Ga0207661_10000421 | Ga0207661_1000042110 | 262 |
| 789 | 3300025944 | Ga0207661_10127181 | Ga0207661_101271813 | 262 |
| 790 | 3300025944 | Ga0207661_10431918 | Ga0207661_104319182 | 262 |
| 791 | 3300025949 | Ga0207667_10015694 | Ga0207667_100156948 | 262 |
| 792 | 3300025949 | Ga0207667_10039623 | Ga0207667_100396232 | 262 |
| 793 | 3300025949 | Ga0207667_10300169 | Ga0207667_103001693 | 262 |
| 794 | 3300025949 | Ga0207667_10528887 | Ga0207667_105288872 | 262 |
| 795 | 3300025972 | Ga0207668_10257093 | Ga0207668_102570932 | 262 |
| 796 | 3300025986 | Ga0207658_10114099 | Ga0207658_101140991 | 262 |
| 797 | 3300026023 | Ga0207677_10056882 | Ga0207677_100568822 | 262 |
| 798 | 3300026041 | Ga0207639_10022760 | Ga0207639_100227603 | 262 |
| 799 | 3300026041 | Ga0207639_10038860 | Ga0207639_100388603 | 262 |
| 800 | 3300026041 | Ga0207639_10226714 | Ga0207639_102267142 | 262 |
| 801 | 3300026067 | Ga0207678_10004216 | Ga0207678_100042169 | 262 |
| 802 | 3300026067 | Ga0207678_10017767 | Ga0207678_100177675 | 262 |
| 803 | 3300026067 | Ga0207678_10025952 | Ga0207678_100259523 | 262 |
| 804 | 3300026067 | Ga0207678_10033530 | Ga0207678_100335308 | 262 |
| 805 | 3300026067 | Ga0207678_10062172 | Ga0207678_100621722 | 262 |
| 806 | 3300026067 | Ga0207678_10083309 | Ga0207678_100833091 | 262 |
| 807 | 3300026067 | Ga0207678_10199184 | Ga0207678_101991843 | 262 |
| 808 | 3300026067 | Ga0207678_10260106 | Ga0207678_102601062 | 262 |
| 809 | 3300026067 | Ga0207678_10538291 | Ga0207678_105382911 | 262 |
| 810 | 3300026075 | Ga0207708_10144256 | Ga0207708_101442562 | 262 |
| 811 | 3300026078 | Ga0207702_10002502 | Ga0207702_100025028 | 262 |
| 812 | 3300026078 | Ga0207702_10151077 | Ga0207702_101510772 | 262 |
| 813 | 3300026088 | Ga0207641_10115607 | Ga0207641_101156073 | 262 |
| 814 | 3300026095 | Ga0207676_10161141 | Ga0207676_101611412 | 262 |
| 815 | 3300026116 | Ga0207674_10016173 | Ga0207674_100161736 | 262 |
| 816 | 3300026116 | Ga0207674_10051452 | Ga0207674_100514524 | 262 |
| 817 | 3300026118 | Ga0207675_100092259 | Ga0207675_1000922593 | 262 |
| 818 | 3300026121 | Ga0207683_10057608 | Ga0207683_100576083 | 262 |
| 819 | 3300026121 | Ga0207683_10242336 | Ga0207683_102423361 | 262 |
| 820 | 3300026142 | Ga0207698_10163292 | Ga0207698_101632922 | 262 |
| 821 | 3300026142 | Ga0207698_10280893 | Ga0207698_102808931 | 262 |
| 822 | 3300027296 | Ga0209389_1000021 | Ga0209389_1000021123 | 262 |
| 823 | 3300027296 | Ga0209389_1000120 | Ga0209389_100012023 | 262 |
| 824 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005294 | 262 |
| 825 | 3300027357 | Ga0209589_1000027 | Ga0209589_1000027106 | 262 |
| 826 | 3300027361 | Ga0209489_100005 | Ga0209489_100005294 | 262 |
| 827 | 3300027361 | Ga0209489_100023 | Ga0209489_10002322 | 262 |
| 828 | 3300027361 | Ga0209489_100742 | Ga0209489_10074240 | 262 |
| 829 | 3300027363 | Ga0209700_100006 | Ga0209700_100006294 | 262 |
| 830 | 3300027363 | Ga0209700_100134 | Ga0209700_10013493 | 262 |
| 831 | 3300027671 | Ga0209588_1003932 | Ga0209588_10039325 | 262 |
| 832 | 3300027866 | Ga0209813_10026424 | Ga0209813_100264242 | 262 |
| 833 | 3300027866 | Ga0209813_10094012 | Ga0209813_100940121 | 262 |
| 834 | 3300027907 | Ga0207428_10325357 | Ga0207428_103253571 | 262 |
| 835 | 3300028379 | Ga0268266_10001136 | Ga0268266_1000113613 | 262 |
| 836 | 3300028379 | Ga0268266_10003686 | Ga0268266_1000368611 | 262 |
| 837 | 3300028379 | Ga0268266_10048100 | Ga0268266_100481002 | 262 |
| 838 | 3300028379 | Ga0268266_10175012 | Ga0268266_101750122 | 262 |
| 839 | 3300028379 | Ga0268266_10538825 | Ga0268266_105388252 | 262 |
| 840 | 3300028379 | Ga0268266_10820899 | Ga0268266_108208991 | 262 |
| 841 | 3300028380 | Ga0268265_10019321 | Ga0268265_100193212 | 262 |
| 842 | 3300028380 | Ga0268265_10140896 | Ga0268265_101408962 | 262 |
| 843 | 3300028786 | Ga0307517_10000098 | Ga0307517_10000098113 | 262 |
| 844 | 3300028794 | Ga0307515_10098751 | Ga0307515_100987513 | 262 |
| 845 | 3300028794 | Ga0307515_10390958 | Ga0307515_103909581 | 262 |
| 846 | 3300030521 | Ga0307511_10232289 | Ga0307511_102322891 | 262 |
| 847 | 3300031241 | Ga0265325_10028710 | Ga0265325_100287102 | 262 |
| 848 | 3300031241 | Ga0265325_10075344 | Ga0265325_100753442 | 262 |
| 849 | 3300031249 | Ga0265339_10120058 | Ga0265339_101200581 | 262 |
| 850 | 3300031250 | Ga0265331_10104634 | Ga0265331_101046341 | 262 |
| 851 | 3300031250 | Ga0265331_10129459 | Ga0265331_101294592 | 262 |
| 852 | 3300031344 | Ga0265316_10171724 | Ga0265316_101717242 | 262 |
| 853 | 3300031344 | Ga0265316_10204536 | Ga0265316_102045361 | 262 |
| 854 | 3300031456 | Ga0307513_10067968 | Ga0307513_100679682 | 262 |
| 855 | 3300031456 | Ga0307513_10203303 | Ga0307513_102033032 | 262 |
| 856 | 3300031595 | Ga0265313_10000710 | Ga0265313_1000071018 | 262 |
| 857 | 3300031595 | Ga0265313_10065446 | Ga0265313_100654462 | 262 |
| 858 | 3300031711 | Ga0265314_10051287 | Ga0265314_100512874 | 262 |
| 859 | 3300031730 | Ga0307516_10046388 | Ga0307516_100463888 | 262 |
| 860 | 3300031731 | Ga0307405_10272364 | Ga0307405_102723642 | 262 |
| 861 | 3300031903 | Ga0307407_10140011 | Ga0307407_101400112 | 262 |
| 862 | 3300031911 | Ga0307412_10125422 | Ga0307412_101254223 | 262 |
| 863 | 3300032002 | Ga0307416_100856021 | Ga0307416_1008560211 | 262 |
| 864 | 3300032005 | Ga0307411_10174325 | Ga0307411_101743252 | 262 |
| 865 | 3300032126 | Ga0307415_100173986 | Ga0307415_1001739862 | 262 |
| 866 | 3300032133 | Ga0316583_10002297 | Ga0316583_100022972 | 262 |
| 867 | 3300033180 | Ga0307510_10007562 | Ga0307510_100075626 | 262 |
| 868 | 3300033180 | Ga0307510_10195621 | Ga0307510_101956211 | 262 |
| 869 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005248 | 262 |
| 870 | 3300034820 | Ga0373959_0021087 | Ga0373959_0021087_59_847 | 262 |
| 871 | 3300035086 | Ga0373934_0044113 | Ga0373934_0044113_11_799 | 262 |
| 872 | 3300035112 | Ga0373932_0069945 | Ga0373932_0069945_259_1047 | 262 |
| 873 | 3300035113 | Ga0373936_0097111 | Ga0373936_0097111_396_1184 | 262 |
| 874 | 3300035113 | Ga0373936_0129041 | Ga0373936_0129041_176_964 | 262 |
| 875 | 3300035116 | Ga0373945_0005116 | Ga0373945_0005116_584_1372 | 262 |
| 876 | 3300035118 | Ga0373954_0008305 | Ga0373954_0008305_216_1004 | 262 |
| 877 | 3300035119 | Ga0373956_0027829 | Ga0373956_0027829_669_1457 | 262 |
| 878 | 3300035120 | Ga0373957_0030699 | Ga0373957_0030699_493_1281 | 262 |
| 879 | 3300035120 | Ga0373957_0034940 | Ga0373957_0034940_863_1651 | 262 |
| 880 | 3300035171 | Ga0373946_0007962 | Ga0373946_0007962_2311_3099 | 262 |
| 881 | 3300035172 | Ga0373955_0018833 | Ga0373955_0018833_724_1512 | 262 |
| 882 | 3300035410 | Ga0373924_0035360 | Ga0373924_0035360_599_1387 | 262 |
| 883 | 3300035692 | Ga0373935_0000520 | Ga0373935_0000520_12355_13143 | 262 |
| 884 | 3300035695 | Ga0373927_0000046 | Ga0373927_0000046_49276_50064 | 262 |
| 885 | 3300035695 | Ga0373927_0005938 | Ga0373927_0005938_6519_7307 | 262 |
| 886 | 3300035695 | Ga0373927_0113941 | Ga0373927_0113941_665_1453 | 262 |
| 887 | 3300035725 | Ga0373947_0001392 | Ga0373947_0001392_7314_8102 | 262 |
| 888 | 3300035725 | Ga0373947_0021349 | Ga0373947_0021349_2935_3723 | 262 |
| 889 | 3300035725 | Ga0373947_0466112 | Ga0373947_0466112_44_832 | 262 |
| 890 | 3300036401 | Ga0373937_0016441 | Ga0373937_0016441_4340_5128 | 262 |
| 891 | 3300036401 | Ga0373937_0075827 | Ga0373937_0075827_1059_1847 | 262 |
| 892 | 3300036401 | Ga0373937_0103455 | Ga0373937_0103455_1432_2220 | 262 |
| 893 | 3300036401 | Ga0373937_0147334 | Ga0373937_0147334_1278_2066 | 262 |
| 894 | 3300037068 | Ga0373925_0009905 | Ga0373925_0009905_4984_5772 | 262 |
| 895 | 3300037068 | Ga0373925_0219496 | Ga0373925_0219496_599_1387 | 262 |
| 896 | 3300037312 | Ga0395899_0116459 | Ga0395899_0116459_275_1063 | 262 |
| 897 | 3300037418 | Ga0395900_0016187 | Ga0395900_0016187_3669_4457 | 262 |
| 898 | 3300037418 | Ga0395900_0032079 | Ga0395900_0032079_1534_2322 | 262 |
| 899 | 3300037418 | Ga0395900_0290498 | Ga0395900_0290498_654_1454 | 262 |
| 900 | 3300037466 | Ga0395898_0030023 | Ga0395898_0030023_4505_5293 | 262 |
| 901 | 3300037466 | Ga0395898_0143916 | Ga0395898_0143916_715_1503 | 262 |
| 902 | 3300037466 | Ga0395898_0146208 | Ga0395898_0146208_871_1659 | 262 |
| 903 | 3300037466 | Ga0395898_0252291 | Ga0395898_0252291_269_1057 | 262 |
| 904 | 3300037471 | Ga0395905_0025920 | Ga0395905_0025920_4600_5388 | 262 |
| 905 | 3300037471 | Ga0395905_0235405 | Ga0395905_0235405_407_1207 | 262 |
| 906 | 3300037853 | Ga0436364_0166778 | Ga0436364_0166778_382_1170 | 262 |
| 907 | 3300038443 | Ga0395901_0044922 | Ga0395901_0044922_3442_4230 | 262 |
| 908 | 3300038443 | Ga0395901_0097370 | Ga0395901_0097370_743_1531 | 262 |
| 909 | 3300038443 | Ga0395901_0113876 | Ga0395901_0113876_18_806 | 262 |
| 910 | 3300038443 | Ga0395901_0254458 | Ga0395901_0254458_533_1321 | 262 |
| 911 | 3300038443 | Ga0395901_0274779 | Ga0395901_0274779_357_1154 | 262 |
| 912 | 3300039437 | Ga0436365_0396839 | Ga0436365_0396839_428_1216 | 262 |
| 913 | 3300039437 | Ga0436365_1044448 | Ga0436365_1044448_715_1503 | 262 |
| 914 | 3300039437 | Ga0436365_1580006 | Ga0436365_1580006_126_914 | 262 |
| 915 | 3300039437 | Ga0436365_1607466 | Ga0436365_1607466_14_802 | 262 |
| 916 | 3300039447 | Ga0436361_0783902 | Ga0436361_0783902_2000_2788 | 262 |
| 917 | 3300039447 | Ga0436361_1109558 | Ga0436361_1109558_131_919 | 262 |
| 918 | 3300039453 | Ga0436362_1140786 | Ga0436362_1140786_190_978 | 262 |
| 919 | 3300041491 | Ga0451833_0606252 | Ga0451833_0606252_206_994 | 262 |
| 920 | 3300044656 | Ga0466969_0015917 | Ga0466969_0015917_3080_3898 | 262 |
| 921 | 3300044658 | Ga0466972_0000126 | Ga0466972_0000126_55438_56226 | 262 |
| 922 | 3300044684 | Ga0466966_0145138 | Ga0466966_0145138_47_835 | 262 |
| 923 | 3300044684 | Ga0466966_0190717 | Ga0466966_0190717_172_960 | 262 |
| 924 | 3300044693 | Ga0466961_0000025 | Ga0466961_0000025_17334_18224 | 262 |
| 925 | 3300044694 | Ga0466963_0011648 | Ga0466963_0011648_2252_3040 | 262 |
| 926 | 3300044694 | Ga0466963_0115616 | Ga0466963_0115616_318_1106 | 262 |
| 927 | 3300044735 | Ga0466968_0053776 | Ga0466968_0053776_535_1323 | 262 |
| 928 | 3300044735 | Ga0466968_0121279 | Ga0466968_0121279_79_867 | 262 |
| 929 | 3300044842 | Ga0466957_0169526 | Ga0466957_0169526_502_1290 | 262 |
| 930 | 3300044842 | Ga0466957_0396019 | Ga0466957_0396019_73_861 | 262 |
| 931 | 3300045049 | Ga0466959_0000873 | Ga0466959_0000873_11123_12013 | 262 |
| 932 | 3300045049 | Ga0466959_0163188 | Ga0466959_0163188_101_889 | 262 |
| 933 | 3300045049 | Ga0466959_0254451 | Ga0466959_0254451_205_993 | 262 |
| 934 | 3300045976 | Ga0466967_0047331 | Ga0466967_0047331_529_1317 | 262 |
| 935 | 3300045976 | Ga0466967_0090497 | Ga0466967_0090497_1486_2274 | 262 |
| 936 | 3300045976 | Ga0466967_0409122 | Ga0466967_0409122_290_1078 | 262 |
| 937 | 3300046454 | Ga0495592_0124840 | Ga0495592_0124840_104_892 | 262 |
| 938 | 3300046454 | Ga0495592_0151994 | Ga0495592_0151994_632_1420 | 262 |
| 939 | 3300046454 | Ga0495592_0156808 | Ga0495592_0156808_86_874 | 262 |
| 940 | 3300046455 | Ga0495603_0000051 | Ga0495603_0000051_12437_13225 | 262 |
| 941 | 3300046455 | Ga0495603_0105023 | Ga0495603_0105023_700_1488 | 262 |
| 942 | 3300046455 | Ga0495603_0155784 | Ga0495603_0155784_29_817 | 262 |
| 943 | 3300046459 | Ga0495629_0000182 | Ga0495629_0000182_40329_41117 | 262 |
| 944 | 3300046459 | Ga0495629_0043713 | Ga0495629_0043713_1656_2444 | 262 |
| 945 | 3300046460 | Ga0495638_0003938 | Ga0495638_0003938_4810_5598 | 262 |
| 946 | 3300046460 | Ga0495638_0013321 | Ga0495638_0013321_3345_4148 | 262 |
| 947 | 3300046460 | Ga0495638_0029466 | Ga0495638_0029466_2304_3107 | 262 |
| 948 | 3300046460 | Ga0495638_0107663 | Ga0495638_0107663_614_1417 | 262 |
| 949 | 3300046460 | Ga0495638_0116709 | Ga0495638_0116709_601_1416 | 262 |
| 950 | 3300046461 | Ga0495641_0006374 | Ga0495641_0006374_5412_6200 | 262 |
| 951 | 3300046462 | Ga0495651_0049059 | Ga0495651_0049059_1249_2037 | 262 |
| 952 | 3300046462 | Ga0495651_0118365 | Ga0495651_0118365_1098_1886 | 262 |
| 953 | 3300046462 | Ga0495651_0141321 | Ga0495651_0141321_234_1022 | 262 |
| 954 | 3300046462 | Ga0495651_0232686 | Ga0495651_0232686_264_1052 | 262 |
| 955 | 3300046462 | Ga0495651_0431907 | Ga0495651_0431907_47_835 | 262 |
| 956 | 3300046463 | Ga0495653_0200069 | Ga0495653_0200069_216_1004 | 262 |
| 957 | 3300046472 | Ga0495580_0004021 | Ga0495580_0004021_4910_5698 | 262 |
| 958 | 3300046473 | Ga0495582_0000137 | Ga0495582_0000137_28989_29777 | 262 |
| 959 | 3300046475 | Ga0495639_0000047 | Ga0495639_0000047_50742_51530 | 262 |
| 960 | 3300046475 | Ga0495639_0016665 | Ga0495639_0016665_309_1103 | 262 |
| 961 | 3300046475 | Ga0495639_0076376 | Ga0495639_0076376_72_860 | 262 |
| 962 | 3300046475 | Ga0495639_0110879 | Ga0495639_0110879_26_814 | 262 |
| 963 | 3300046476 | Ga0495662_0001496 | Ga0495662_0001496_2554_3342 | 262 |
| 964 | 3300046477 | Ga0495664_0001335 | Ga0495664_0001335_971_1759 | 262 |
| 965 | 3300046477 | Ga0495664_0023753 | Ga0495664_0023753_1978_2766 | 262 |
| 966 | 3300046477 | Ga0495664_0034436 | Ga0495664_0034436_1235_2038 | 262 |
| 967 | 3300046477 | Ga0495664_0036584 | Ga0495664_0036584_752_1552 | 262 |
| 968 | 3300046477 | Ga0495664_0061085 | Ga0495664_0061085_1239_2027 | 262 |
| 969 | 3300046477 | Ga0495664_0145246 | Ga0495664_0145246_250_1038 | 262 |
| 970 | 3300046477 | Ga0495664_0352426 | Ga0495664_0352426_21_809 | 262 |
| 971 | 3300046491 | Ga0495584_0044891 | Ga0495584_0044891_533_1321 | 262 |
| 972 | 3300046491 | Ga0495584_0109348 | Ga0495584_0109348_452_1240 | 262 |
| 973 | 3300046499 | Ga0495594_0001833 | Ga0495594_0001833_5241_6029 | 262 |
| 974 | 3300046499 | Ga0495594_0055256 | Ga0495594_0055256_534_1322 | 262 |
| 975 | 3300046499 | Ga0495594_0191194 | Ga0495594_0191194_195_983 | 262 |
| 976 | 3300046501 | Ga0495607_0077143 | Ga0495607_0077143_95_898 | 262 |
| 977 | 3300046507 | Ga0495606_0023313 | Ga0495606_0023313_2003_2791 | 262 |
| 978 | 3300046507 | Ga0495606_0187297 | Ga0495606_0187297_247_1050 | 262 |
| 979 | 3300046511 | Ga0495608_0035676 | Ga0495608_0035676_721_1509 | 262 |
| 980 | 3300046511 | Ga0495608_0041836 | Ga0495608_0041836_338_1126 | 262 |
| 981 | 3300046514 | Ga0495618_0185823 | Ga0495618_0185823_144_932 | 262 |
| 982 | 3300046515 | Ga0495620_0023843 | Ga0495620_0023843_969_1772 | 262 |
| 983 | 3300046515 | Ga0495620_0123525 | Ga0495620_0123525_155_943 | 262 |
| 984 | 3300046516 | Ga0495628_0030327 | Ga0495628_0030327_1129_1917 | 262 |
| 985 | 3300046516 | Ga0495628_0031595 | Ga0495628_0031595_1292_2080 | 262 |
| 986 | 3300046516 | Ga0495628_0065433 | Ga0495628_0065433_602_1390 | 262 |
| 987 | 3300046517 | Ga0495630_0002625 | Ga0495630_0002625_6797_7585 | 262 |
| 988 | 3300046522 | Ga0495643_0155884 | Ga0495643_0155884_325_1113 | 262 |
| 989 | 3300046523 | Ga0495644_0024756 | Ga0495644_0024756_793_1581 | 262 |
| 990 | 3300046524 | Ga0495648_0037184 | Ga0495648_0037184_1792_2595 | 262 |
| 991 | 3300046524 | Ga0495648_0052154 | Ga0495648_0052154_1057_1872 | 262 |
| 992 | 3300046524 | Ga0495648_0145614 | Ga0495648_0145614_56_844 | 262 |
| 993 | 3300046526 | Ga0495666_0072875 | Ga0495666_0072875_662_1450 | 262 |
| 994 | 3300046528 | Ga0495642_0048876 | Ga0495642_0048876_918_1706 | 262 |
| 995 | 3300046529 | Ga0495652_0035614 | Ga0495652_0035614_3154_3942 | 262 |
| 996 | 3300046529 | Ga0495652_0116125 | Ga0495652_0116125_845_1633 | 262 |
| 997 | 3300046530 | Ga0495654_0026918 | Ga0495654_0026918_894_1697 | 262 |
| 998 | 3300046531 | Ga0495665_0001239 | Ga0495665_0001239_5076_5864 | 262 |
| 999 | 3300046533 | Ga0495640_0004375 | Ga0495640_0004375_4286_5074 | 262 |
| 1000 | 3300046533 | Ga0495640_0039432 | Ga0495640_0039432_121_909 | 262 |
| 1001 | 3300046535 | Ga0495586_0056945 | Ga0495586_0056945_132_920 | 262 |
| 1002 | 3300046535 | Ga0495586_0251223 | Ga0495586_0251223_176_964 | 262 |
| 1003 | 3300046536 | Ga0495587_0025522 | Ga0495587_0025522_2313_3101 | 262 |
| 1004 | 3300046536 | Ga0495587_0050017 | Ga0495587_0050017_574_1362 | 262 |
| 1005 | 3300046538 | Ga0495609_0095258 | Ga0495609_0095258_78_866 | 262 |
| 1006 | 3300046542 | Ga0495597_0068617 | Ga0495597_0068617_400_1188 | 262 |
| 1007 | 3300046543 | Ga0495645_0006200 | Ga0495645_0006200_5931_6719 | 262 |
| 1008 | 3300046543 | Ga0495645_0038038 | Ga0495645_0038038_2154_2942 | 262 |
| 1009 | 3300046543 | Ga0495645_0083302 | Ga0495645_0083302_761_1549 | 262 |
| 1010 | 3300046557 | Ga0495622_0006199 | Ga0495622_0006199_586_1374 | 262 |
| 1011 | 3300046557 | Ga0495622_0019937 | Ga0495622_0019937_1798_2586 | 262 |
| 1012 | 3300046557 | Ga0495622_0052256 | Ga0495622_0052256_534_1322 | 262 |
| 1013 | 3300046557 | Ga0495622_0087161 | Ga0495622_0087161_259_1047 | 262 |
| 1014 | 3300046558 | Ga0495633_0067115 | Ga0495633_0067115_265_1053 | 262 |
| 1015 | 3300046559 | Ga0495667_0011170 | Ga0495667_0011170_3250_4038 | 262 |
| 1016 | 3300046559 | Ga0495667_0011352 | Ga0495667_0011352_4532_5320 | 262 |
| 1017 | 3300046559 | Ga0495667_0231259 | Ga0495667_0231259_120_908 | 262 |
| 1018 | 3300046559 | Ga0495667_0346272 | Ga0495667_0346272_59_847 | 262 |
| 1019 | 3300046616 | Ga0495668_0114481 | Ga0495668_0114481_598_1386 | 262 |
| 1020 | 3300046616 | Ga0495668_0281015 | Ga0495668_0281015_76_864 | 262 |
| 1021 | 3300046642 | Ga0495634_0002221 | Ga0495634_0002221_6609_7397 | 262 |
| 1022 | 3300046642 | Ga0495634_0080503 | Ga0495634_0080503_1061_1849 | 262 |
| 1023 | 3300046642 | Ga0495634_0114296 | Ga0495634_0114296_912_1700 | 262 |
| 1024 | 3300046663 | Ga0495635_0001455 | Ga0495635_0001455_6755_7543 | 262 |
| 1025 | 3300046663 | Ga0495635_0043906 | Ga0495635_0043906_1762_2550 | 262 |
| 1026 | 3300046664 | Ga0495659_0017854 | Ga0495659_0017854_105_893 | 262 |
| 1027 | 3300046665 | Ga0495661_0067748 | Ga0495661_0067748_959_1747 | 262 |
| 1028 | 3300046674 | Ga0495588_0009398 | Ga0495588_0009398_668_1456 | 262 |
| 1029 | 3300046674 | Ga0495588_0027119 | Ga0495588_0027119_856_1644 | 262 |
| 1030 | 3300046674 | Ga0495588_0082779 | Ga0495588_0082779_530_1318 | 262 |
| 1031 | 3300046675 | Ga0495657_0006427 | Ga0495657_0006427_1311_2099 | 262 |
| 1032 | 3300046675 | Ga0495657_0007196 | Ga0495657_0007196_1915_2703 | 262 |
| 1033 | 3300046675 | Ga0495657_0263483 | Ga0495657_0263483_12_800 | 262 |
| 1034 | 3300046678 | Ga0495599_0004838 | Ga0495599_0004838_5093_5881 | 262 |
| 1035 | 3300046678 | Ga0495599_0012226 | Ga0495599_0012226_4185_4973 | 262 |
| 1036 | 3300046678 | Ga0495599_0063521 | Ga0495599_0063521_602_1390 | 262 |
| 1037 | 3300046679 | Ga0495623_0043882 | Ga0495623_0043882_1990_2778 | 262 |
| 1038 | 3300046679 | Ga0495623_0047224 | Ga0495623_0047224_1041_1829 | 262 |
| 1039 | 3300046679 | Ga0495623_0105003 | Ga0495623_0105003_777_1565 | 262 |
| 1040 | 3300046680 | Ga0495646_0019779 | Ga0495646_0019779_1225_2013 | 262 |
| 1041 | 3300046680 | Ga0495646_0188503 | Ga0495646_0188503_246_1034 | 262 |
| 1042 | 3300046681 | Ga0495647_0000577 | Ga0495647_0000577_8736_9524 | 262 |
| 1043 | 3300046683 | Ga0495658_0001786 | Ga0495658_0001786_8785_9573 | 262 |
| 1044 | 3300046689 | Ga0495613_0007297 | Ga0495613_0007297_2333_3121 | 262 |
| 1045 | 3300046689 | Ga0495613_0279715 | Ga0495613_0279715_160_948 | 262 |
| 1046 | 3300046690 | Ga0495624_0000898 | Ga0495624_0000898_8762_9550 | 262 |
| 1047 | 3300046691 | Ga0495670_0007688 | Ga0495670_0007688_1249_2052 | 262 |
| 1048 | 3300046694 | Ga0495649_0011437 | Ga0495649_0011437_1843_2631 | 262 |
| 1049 | 3300046809 | Ga0495600_0007660 | Ga0495600_0007660_760_1548 | 262 |
| 1050 | 3300046809 | Ga0495600_0046708 | Ga0495600_0046708_1562_2350 | 262 |
| 1051 | 3300046809 | Ga0495600_0245128 | Ga0495600_0245128_39_827 | 262 |
| 1052 | 3300046809 | Ga0495600_0402645 | Ga0495600_0402645_31_819 | 262 |
| 1053 | 3300047315 | Ga0495581_0197040 | Ga0495581_0197040_29_817 | 262 |
| 1054 | 3300047317 | Ga0495604_0025793 | Ga0495604_0025793_870_1658 | 262 |
| 1055 | 3300047317 | Ga0495604_0032865 | Ga0495604_0032865_952_1740 | 262 |
| 1056 | 3300047319 | Ga0495674_0010092 | Ga0495674_0010092_6500_7288 | 262 |
| 1057 | 3300047319 | Ga0495674_0030208 | Ga0495674_0030208_525_1313 | 262 |
| 1058 | 3300047320 | Ga0495672_0200326 | Ga0495672_0200326_49_837 | 262 |
| 1059 | 3300047321 | Ga0495676_0035661 | Ga0495676_0035661_476_1264 | 262 |
| 1060 | 3300047322 | Ga0495680_0003456 | Ga0495680_0003456_12893_13681 | 262 |
| 1061 | 3300047322 | Ga0495680_0016657 | Ga0495680_0016657_3468_4256 | 262 |
| 1062 | 3300047323 | Ga0495683_0094120 | Ga0495683_0094120_384_1172 | 262 |
| 1063 | 3300047443 | Ga0495687_098245 | Ga0495687_098245_268_1056 | 262 |
| 1064 | 3300047444 | Ga0495675_0025339 | Ga0495675_0025339_2391_3179 | 262 |
| 1065 | 3300047444 | Ga0495675_0097296 | Ga0495675_0097296_804_1592 | 262 |
| 1066 | 3300047469 | Ga0495673_0018535 | Ga0495673_0018535_659_1447 | 262 |
| 1067 | 3300047469 | Ga0495673_0079474 | Ga0495673_0079474_126_914 | 262 |
| 1068 | 3300047471 | Ga0495684_0014553 | Ga0495684_0014553_3119_3907 | 262 |
| 1069 | 3300047471 | Ga0495684_0024347 | Ga0495684_0024347_594_1382 | 262 |
| 1070 | 3300047472 | Ga0495686_0073735 | Ga0495686_0073735_484_1272 | 262 |
| 1071 | 3300047472 | Ga0495686_0152408 | Ga0495686_0152408_73_861 | 262 |
| 1072 | 3300047673 | Ga0495593_0000469 | Ga0495593_0000469_20086_20874 | 262 |
| 1073 | 3300048088 | Ga0495602_0009739 | Ga0495602_0009739_2792_3580 | 262 |
| 1074 | 3300048088 | Ga0495602_0175500 | Ga0495602_0175500_188_976 | 262 |
| 1075 | 3300048089 | Ga0495614_0001926 | Ga0495614_0001926_4208_4996 | 262 |
| 1076 | 3300048903 | Ga0496100_0001098 | Ga0496100_0001098_11640_12428 | 262 |
| 1077 | 3300048903 | Ga0496100_0025314 | Ga0496100_0025314_2202_2990 | 262 |
| 1078 | 3300048903 | Ga0496100_0611768 | Ga0496100_0611768_30_818 | 262 |
| 1079 | 3300048904 | Ga0496101_0007768 | Ga0496101_0007768_4454_5242 | 262 |
| 1080 | 3300048904 | Ga0496101_0204607 | Ga0496101_0204607_235_1023 | 262 |
| 1081 | 3300048904 | Ga0496101_0209813 | Ga0496101_0209813_351_1139 | 262 |
| 1082 | 3300048904 | Ga0496101_0456393 | Ga0496101_0456393_137_925 | 262 |
| 1083 | 3300048905 | Ga0496102_0008520 | Ga0496102_0008520_4540_5328 | 262 |
| 1084 | 3300048905 | Ga0496102_0092857 | Ga0496102_0092857_1616_2404 | 262 |
| 1085 | 3300048906 | Ga0496103_0031194 | Ga0496103_0031194_750_1538 | 262 |
| 1086 | 3300048906 | Ga0496103_0232949 | Ga0496103_0232949_128_916 | 262 |
| 1087 | 3300048907 | Ga0496104_0021810 | Ga0496104_0021810_2118_2906 | 262 |
| 1088 | 3300048907 | Ga0496104_0075775 | Ga0496104_0075775_1466_2254 | 262 |
| 1089 | 3300048907 | Ga0496104_0103613 | Ga0496104_0103613_272_1060 | 262 |
| 1090 | 3300048907 | Ga0496104_0143993 | Ga0496104_0143993_882_1670 | 262 |
| 1091 | 3300048907 | Ga0496104_0453855 | Ga0496104_0453855_157_945 | 262 |
| 1092 | 3300048908 | Ga0496105_0050226 | Ga0496105_0050226_483_1271 | 262 |
| 1093 | 3300048908 | Ga0496105_0088994 | Ga0496105_0088994_186_974 | 262 |
| 1094 | 3300048908 | Ga0496105_0302833 | Ga0496105_0302833_435_1232 | 262 |
| 1095 | 3300048908 | Ga0496105_0318889 | Ga0496105_0318889_343_1131 | 262 |
| 1096 | 3300048908 | Ga0496105_0444744 | Ga0496105_0444744_42_830 | 262 |
| 1097 | 3300048909 | Ga0496106_0021872 | Ga0496106_0021872_2114_2902 | 262 |
| 1098 | 3300048909 | Ga0496106_0031033 | Ga0496106_0031033_803_1591 | 262 |
| 1099 | 3300048909 | Ga0496106_0316315 | Ga0496106_0316315_91_879 | 262 |
| 1100 | 3300048910 | Ga0496107_0006973 | Ga0496107_0006973_5085_5873 | 262 |
| 1101 | 3300048910 | Ga0496107_0011332 | Ga0496107_0011332_1787_2575 | 262 |
| 1102 | 3300048910 | Ga0496107_0033519 | Ga0496107_0033519_410_1210 | 262 |
| 1103 | 3300048910 | Ga0496107_0150128 | Ga0496107_0150128_702_1490 | 262 |
| 1104 | 3300048910 | Ga0496107_0189283 | Ga0496107_0189283_628_1416 | 262 |
| 1105 | 3300048910 | Ga0496107_0429676 | Ga0496107_0429676_91_879 | 262 |
| 1106 | 3300048911 | Ga0496108_0000681 | Ga0496108_0000681_21706_22494 | 262 |
| 1107 | 3300048911 | Ga0496108_0041142 | Ga0496108_0041142_752_1540 | 262 |
| 1108 | 3300048911 | Ga0496108_0104755 | Ga0496108_0104755_1151_1939 | 262 |
| 1109 | 3300048911 | Ga0496108_0235771 | Ga0496108_0235771_54_842 | 262 |
| 1110 | 3300048911 | Ga0496108_0258706 | Ga0496108_0258706_168_956 | 262 |
| 1111 | 3300048912 | Ga0496109_0000450 | Ga0496109_0000450_30651_31439 | 262 |
| 1112 | 3300048912 | Ga0496109_0118426 | Ga0496109_0118426_66_854 | 262 |
| 1113 | 3300048913 | Ga0496110_0009862 | Ga0496110_0009862_3359_4147 | 262 |
| 1114 | 3300048913 | Ga0496110_0015912 | Ga0496110_0015912_80_868 | 262 |
| 1115 | 3300048913 | Ga0496110_0061414 | Ga0496110_0061414_2381_3181 | 262 |
| 1116 | 3300048914 | Ga0496111_0026720 | Ga0496111_0026720_35_835 | 262 |
| 1117 | 3300048914 | Ga0496111_0117031 | Ga0496111_0117031_85_873 | 262 |
| 1118 | 3300048914 | Ga0496111_0143250 | Ga0496111_0143250_720_1508 | 262 |
| 1119 | 3300048914 | Ga0496111_0220909 | Ga0496111_0220909_344_1132 | 262 |
| 1120 | 3300048915 | Ga0496112_0005466 | Ga0496112_0005466_3814_4602 | 262 |
| 1121 | 3300048915 | Ga0496112_0080070 | Ga0496112_0080070_1775_2563 | 262 |
| 1122 | 3300048915 | Ga0496112_0099921 | Ga0496112_0099921_1914_2702 | 262 |
| 1123 | 3300048915 | Ga0496112_0357155 | Ga0496112_0357155_40_828 | 262 |
| 1124 | 3300048916 | Ga0496113_0073139 | Ga0496113_0073139_473_1261 | 262 |
| 1125 | 3300048916 | Ga0496113_0083237 | Ga0496113_0083237_1323_2111 | 262 |
| 1126 | 3300048916 | Ga0496113_0268345 | Ga0496113_0268345_73_861 | 262 |
| 1127 | 3300048917 | Ga0496114_0043733 | Ga0496114_0043733_1688_2476 | 262 |
| 1128 | 3300048917 | Ga0496114_0073639 | Ga0496114_0073639_1427_2227 | 262 |
| 1129 | 3300048917 | Ga0496114_0378150 | Ga0496114_0378150_147_935 | 262 |
| 1130 | 3300048918 | Ga0496115_0025021 | Ga0496115_0025021_1197_1985 | 262 |
| 1131 | 3300048918 | Ga0496115_0078214 | Ga0496115_0078214_1389_2189 | 262 |
| 1132 | 3300048918 | Ga0496115_0125033 | Ga0496115_0125033_201_989 | 262 |
| 1133 | 3300048918 | Ga0496115_0138205 | Ga0496115_0138205_130_918 | 262 |
| 1134 | 3300048918 | Ga0496115_0473303 | Ga0496115_0473303_169_957 | 262 |
| 1135 | 3300048919 | Ga0496116_0013006 | Ga0496116_0013006_2448_3251 | 262 |
| 1136 | 3300048919 | Ga0496116_0134361 | Ga0496116_0134361_454_1242 | 262 |
| 1137 | 3300048920 | Ga0496117_0042127 | Ga0496117_0042127_1365_2153 | 262 |
| 1138 | 3300048921 | Ga0496118_0105601 | Ga0496118_0105601_43_846 | 262 |
| 1139 | 3300048921 | Ga0496118_0221411 | Ga0496118_0221411_55_843 | 262 |
| 1140 | 3300048921 | Ga0496118_0232281 | Ga0496118_0232281_138_926 | 262 |
| 1141 | 3300048922 | Ga0496119_0096910 | Ga0496119_0096910_733_1521 | 262 |
| 1142 | 3300048922 | Ga0496119_0125484 | Ga0496119_0125484_540_1328 | 262 |
| 1143 | 3300048922 | Ga0496119_0159858 | Ga0496119_0159858_358_1161 | 262 |
| 1144 | 3300048923 | Ga0496120_0017558 | Ga0496120_0017558_3630_4418 | 262 |
| 1145 | 3300048923 | Ga0496120_0047496 | Ga0496120_0047496_362_1165 | 262 |
| 1146 | 3300048924 | Ga0496121_0004144 | Ga0496121_0004144_18935_19750 | 262 |
| 1147 | 3300048924 | Ga0496121_0004646 | Ga0496121_0004646_12024_12851 | 262 |
| 1148 | 3300048924 | Ga0496121_0011273 | Ga0496121_0011273_2190_2978 | 262 |
| 1149 | 3300048924 | Ga0496121_0020673 | Ga0496121_0020673_5279_6067 | 262 |
| 1150 | 3300048924 | Ga0496121_0054482 | Ga0496121_0054482_1515_2303 | 262 |
| 1151 | 3300048924 | Ga0496121_0079161 | Ga0496121_0079161_1266_2054 | 262 |
| 1152 | 3300048924 | Ga0496121_0387127 | Ga0496121_0387127_92_880 | 262 |
| 1153 | 3300048925 | Ga0496122_0027804 | Ga0496122_0027804_1689_2492 | 262 |
| 1154 | 3300048926 | Ga0496123_0041988 | Ga0496123_0041988_2145_2948 | 262 |
| 1155 | 3300048927 | Ga0496124_0117186 | Ga0496124_0117186_391_1179 | 262 |
| 1156 | 3300048927 | Ga0496124_0157120 | Ga0496124_0157120_390_1178 | 262 |
| 1157 | 3300048927 | Ga0496124_0175044 | Ga0496124_0175044_354_1157 | 262 |
| 1158 | 3300048927 | Ga0496124_0311890 | Ga0496124_0311890_296_1084 | 262 |
| 1159 | 3300048928 | Ga0496125_0014087 | Ga0496125_0014087_6158_6961 | 262 |
| 1160 | 3300048928 | Ga0496125_0034884 | Ga0496125_0034884_54_842 | 262 |
| 1161 | 3300048928 | Ga0496125_0239573 | Ga0496125_0239573_87_875 | 262 |
| 1162 | 3300048928 | Ga0496125_0240716 | Ga0496125_0240716_146_934 | 262 |
| 1163 | 3300048929 | Ga0496126_0007855 | Ga0496126_0007855_8348_9136 | 262 |
| 1164 | 3300048929 | Ga0496126_0020062 | Ga0496126_0020062_1214_2002 | 262 |
| 1165 | 3300048929 | Ga0496126_0021191 | Ga0496126_0021191_5108_5896 | 262 |
| 1166 | 3300048929 | Ga0496126_0050628 | Ga0496126_0050628_2814_3602 | 262 |
| 1167 | 3300048929 | Ga0496126_0057447 | Ga0496126_0057447_2241_3029 | 262 |
| 1168 | 3300048929 | Ga0496126_0123865 | Ga0496126_0123865_58_846 | 262 |
| 1169 | 3300048929 | Ga0496126_0131840 | Ga0496126_0131840_489_1277 | 262 |
| 1170 | 3300048929 | Ga0496126_0180569 | Ga0496126_0180569_565_1353 | 262 |
| 1171 | 3300048929 | Ga0496126_0239287 | Ga0496126_0239287_32_820 | 262 |
| 1172 | 3300048929 | Ga0496126_0351035 | Ga0496126_0351035_231_1019 | 262 |
| 1173 | 3300049460 | Ga0495682_0045355 | Ga0495682_0045355_694_1482 | 262 |
| 1174 | 3300049570 | Ga0501033_0137433 | Ga0501033_0137433_541_1329 | 262 |
| 1175 | 3300049571 | Ga0501034_0271556 | Ga0501034_0271556_607_1398 | 262 |
| 1176 | 3300049572 | Ga0501036_0153801 | Ga0501036_0153801_930_1718 | 262 |
| 1177 | 3300049572 | Ga0501036_0255863 | Ga0501036_0255863_11_802 | 262 |
| 1178 | 3300049580 | Ga0501046_0032260 | Ga0501046_0032260_3158_3946 | 262 |
| 1179 | 3300049581 | Ga0501047_0183419 | Ga0501047_0183419_1085_1873 | 262 |
| 1180 | 3300049586 | Ga0501070_0004540 | Ga0501070_0004540_9884_10672 | 262 |
| 1181 | 3300049586 | Ga0501070_0172352 | Ga0501070_0172352_588_1376 | 262 |
| 1182 | 3300049586 | Ga0501070_0216585 | Ga0501070_0216585_48_839 | 262 |
| 1183 | 3300049587 | Ga0501071_0070112 | Ga0501071_0070112_442_1230 | 262 |
| 1184 | 3300049587 | Ga0501071_0210478 | Ga0501071_0210478_65_859 | 262 |
| 1185 | 3300049590 | Ga0501074_0035328 | Ga0501074_0035328_739_1527 | 262 |
| 1186 | 3300049592 | Ga0501076_0391201 | Ga0501076_0391201_243_1031 | 262 |
| 1187 | 3300049742 | Ga0501080_0005538 | Ga0501080_0005538_4358_5146 | 262 |
| 1188 | 3300049742 | Ga0501080_0079849 | Ga0501080_0079849_1367_2158 | 262 |
| 1189 | 3300049743 | Ga0501081_0225355 | Ga0501081_0225355_272_1060 | 262 |
| 1190 | 3300049744 | Ga0501083_0009923 | Ga0501083_0009923_323_1114 | 262 |
| 1191 | 3300049823 | Ga0501044_0046842 | Ga0501044_0046842_185_973 | 262 |
| 1192 | 3300049823 | Ga0501044_0092432 | Ga0501044_0092432_1441_2229 | 262 |
| 1193 | 3300049823 | Ga0501044_0120000 | Ga0501044_0120000_1324_2112 | 262 |
| 1194 | 3300049823 | Ga0501044_0164958 | Ga0501044_0164958_423_1235 | 262 |
| 1195 | 3300050489 | nmdc:mga03683_11799_c1 | nmdc:mga03683_11799_c1_2082_2870 | 262 |
| 1196 | 3300050489 | nmdc:mga03683_1474_c1 | nmdc:mga03683_1474_c1_4983_5771 | 262 |
| 1197 | 3300050489 | nmdc:mga03683_3122_c1 | nmdc:mga03683_3122_c1_2558_3346 | 262 |
| 1198 | 3300050490 | nmdc:mga03n38_110804_c1 | nmdc:mga03n38_110804_c1_446_1234 | 262 |
| 1199 | 3300050490 | nmdc:mga03n38_55032_c1 | nmdc:mga03n38_55032_c1_735_1523 | 262 |
| 1200 | 3300050491 | nmdc:mga00v17_222206_c1 | nmdc:mga00v17_222206_c1_51_839 | 262 |
| 1201 | 3300050492 | nmdc:mga0yw44_3010_c1 | nmdc:mga0yw44_3010_c1_4363_5151 | 262 |
| 1202 | 3300050493 | nmdc:mga0k408_332236_c1 | nmdc:mga0k408_332236_c1_73_861 | 262 |
| 1203 | 3300050493 | nmdc:mga0k408_43647_c1 | nmdc:mga0k408_43647_c1_1404_2192 | 262 |
| 1204 | 3300050494 | nmdc:mga06z11_111400_c1 | nmdc:mga06z11_111400_c1_593_1381 | 262 |
| 1205 | 3300050494 | nmdc:mga06z11_233064_c1 | nmdc:mga06z11_233064_c1_135_923 | 262 |
| 1206 | 3300050494 | nmdc:mga06z11_29164_c1 | nmdc:mga06z11_29164_c1_1285_2073 | 262 |
| 1207 | 3300050494 | nmdc:mga06z11_59566_c1 | nmdc:mga06z11_59566_c1_142_930 | 262 |
| 1208 | 3300050495 | nmdc:mga04h51_111410_c1 | nmdc:mga04h51_111410_c1_29_817 | 262 |
| 1209 | 3300050496 | nmdc:mga07m45_104987_c1 | nmdc:mga07m45_104987_c1_225_1013 | 262 |
| 1210 | 3300050496 | nmdc:mga07m45_117657_c1 | nmdc:mga07m45_117657_c1_525_1313 | 262 |
| 1211 | 3300050496 | nmdc:mga07m45_125034_c1 | nmdc:mga07m45_125034_c1_77_865 | 262 |
| 1212 | 3300050511 | nmdc:mga08y16_484020_c1 | nmdc:mga08y16_484020_c1_443_1231 | 262 |
| 1213 | 3300050512 | nmdc:mga0n895_105724_c1 | nmdc:mga0n895_105724_c1_1392_2180 | 262 |
| 1214 | 3300050512 | nmdc:mga0n895_19893_c1 | nmdc:mga0n895_19893_c1_2055_2843 | 262 |
| 1215 | 3300050512 | nmdc:mga0n895_456373_c1 | nmdc:mga0n895_456373_c1_167_955 | 262 |
| 1216 | 3300050516 | nmdc:mga0sz30_83144_c1 | nmdc:mga0sz30_83144_c1_267_1055 | 262 |
| 1217 | 3300050516 | nmdc:mga0sz30_98535_c1 | nmdc:mga0sz30_98535_c1_161_964 | 262 |
| 1218 | 3300053077 | Ga0495601_0049011 | Ga0495601_0049011_773_1561 | 262 |
| 1219 | 3300053077 | Ga0495601_0071093 | Ga0495601_0071093_996_1784 | 262 |
| 1220 | 3300053077 | Ga0495601_0090397 | Ga0495601_0090397_802_1590 | 262 |
| 1221 | 3300053078 | Ga0495612_0012298 | Ga0495612_0012298_1126_1914 | 262 |
| 1222 | 3300053080 | Ga0500635_0015817 | Ga0500635_0015817_1141_1929 | 262 |
| 1223 | 3300053083 | Ga0495655_0081910 | Ga0495655_0081910_56_844 | 262 |
| 1224 | 3300053085 | Ga0495619_0181288 | Ga0495619_0181288_212_1021 | 262 |
| 1225 | 3300053086 | Ga0500578_0242366 | Ga0500578_0242366_156_944 | 262 |
| 1226 | 3300053087 | Ga0500643_000016 | Ga0500643_000016_48069_48857 | 262 |
| 1227 | 3300053088 | Ga0500644_0120262 | Ga0500644_0120262_101_889 | 262 |
| 1228 | 3300053091 | Ga0500647_0060458 | Ga0500647_0060458_154_942 | 262 |
| 1229 | 3300053092 | Ga0500583_0011788 | Ga0500583_0011788_2435_3223 | 262 |
| 1230 | 3300053093 | Ga0500651_0007818 | Ga0500651_0007818_1990_2958 | 262 |
| 1231 | 3300053094 | Ga0500566_0000078 | Ga0500566_0000078_35960_36748 | 262 |
| 1232 | 3300053094 | Ga0500566_0000290 | Ga0500566_0000290_20171_20959 | 262 |
| 1233 | 3300053094 | Ga0500566_0003107 | Ga0500566_0003107_4200_5003 | 262 |
| 1234 | 3300053095 | Ga0500640_000121 | Ga0500640_000121_13550_14338 | 262 |
| 1235 | 3300053096 | Ga0500641_0000385 | Ga0500641_0000385_10345_11133 | 262 |
| 1236 | 3300053096 | Ga0500641_0004079 | Ga0500641_0004079_172_960 | 262 |
| 1237 | 3300053096 | Ga0500641_0043383 | Ga0500641_0043383_1008_1811 | 262 |
| 1238 | 3300053096 | Ga0500641_0066567 | Ga0500641_0066567_282_1070 | 262 |
| 1239 | 3300053096 | Ga0500641_0072315 | Ga0500641_0072315_548_1336 | 262 |
| 1240 | 3300053098 | Ga0500650_0003982 | Ga0500650_0003982_54_857 | 262 |
| 1241 | 3300053103 | Ga0500555_006193 | Ga0500555_006193_2325_3113 | 262 |
| 1242 | 3300053104 | Ga0500556_0000195 | Ga0500556_0000195_5469_6272 | 262 |
| 1243 | 3300053105 | Ga0500557_000011 | Ga0500557_000011_45581_46369 | 262 |
| 1244 | 3300053108 | Ga0500562_001257 | Ga0500562_001257_368_1171 | 262 |
| 1245 | 3300053109 | Ga0500569_047274 | Ga0500569_047274_486_1274 | 262 |
| 1246 | 3300053109 | Ga0500569_068215 | Ga0500569_068215_121_909 | 262 |
| 1247 | 3300053111 | Ga0500572_000170 | Ga0500572_000170_5531_6319 | 262 |
| 1248 | 3300053117 | Ga0500593_136427 | Ga0500593_136427_36_839 | 262 |
| 1249 | 3300053119 | Ga0500595_001017 | Ga0500595_001017_4041_4829 | 262 |
| 1250 | 3300053119 | Ga0500595_001686 | Ga0500595_001686_4318_5106 | 262 |
| 1251 | 3300053119 | Ga0500595_009585 | Ga0500595_009585_95_883 | 262 |
| 1252 | 3300053119 | Ga0500595_050090 | Ga0500595_050090_372_1160 | 262 |
| 1253 | 3300053120 | Ga0500597_177569 | Ga0500597_177569_40_828 | 262 |
| 1254 | 3300053121 | Ga0500607_087138 | Ga0500607_087138_375_1163 | 262 |
| 1255 | 3300053122 | Ga0500608_046544 | Ga0500608_046544_119_907 | 262 |
| 1256 | 3300053125 | Ga0500618_015074 | Ga0500618_015074_922_1725 | 262 |
| 1257 | 3300053130 | Ga0500642_0000012 | Ga0500642_0000012_5385_6212 | 262 |
| 1258 | 3300053130 | Ga0500642_0000090 | Ga0500642_0000090_5814_6602 | 262 |
| 1259 | 3300053130 | Ga0500642_0008061 | Ga0500642_0008061_2777_3565 | 262 |
| 1260 | 3300053130 | Ga0500642_0053707 | Ga0500642_0053707_519_1307 | 262 |
| 1261 | 3300053130 | Ga0500642_0091731 | Ga0500642_0091731_477_1265 | 262 |
| 1262 | 3300053131 | Ga0500652_000327 | Ga0500652_000327_5347_6150 | 262 |
| 1263 | 3300053136 | Ga0500559_0000421 | Ga0500559_0000421_11387_12190 | 262 |
| 1264 | 3300053136 | Ga0500559_0004643 | Ga0500559_0004643_160_948 | 262 |
| 1265 | 3300053136 | Ga0500559_0010249 | Ga0500559_0010249_428_1216 | 262 |
| 1266 | 3300053139 | Ga0500568_0000614 | Ga0500568_0000614_7659_8462 | 262 |
| 1267 | 3300053145 | Ga0500586_000877 | Ga0500586_000877_365_1162 | 262 |
| 1268 | 3300053146 | Ga0500588_0027314 | Ga0500588_0027314_326_1114 | 262 |
| 1269 | 3300053150 | Ga0500603_000081 | Ga0500603_000081_5531_6319 | 262 |
| 1270 | 3300053150 | Ga0500603_001666 | Ga0500603_001666_3893_4681 | 262 |
| 1271 | 3300053151 | Ga0500604_0002038 | Ga0500604_0002038_4422_5225 | 262 |
| 1272 | 3300053153 | Ga0500616_0000408 | Ga0500616_0000408_37284_38072 | 262 |
| 1273 | 3300053153 | Ga0500616_0004061 | Ga0500616_0004061_5470_6297 | 262 |
| 1274 | 3300053153 | Ga0500616_0093103 | Ga0500616_0093103_455_1243 | 262 |
| 1275 | 3300053155 | Ga0500620_000984 | Ga0500620_000984_1347_2186 | 262 |
| 1276 | 3300053156 | Ga0500622_0001313 | Ga0500622_0001313_15182_15985 | 262 |
| 1277 | 3300053156 | Ga0500622_0154692 | Ga0500622_0154692_264_1052 | 262 |
| 1278 | 3300053158 | Ga0500627_0051787 | Ga0500627_0051787_127_930 | 262 |
| 1279 | 3300053159 | Ga0500630_004509 | Ga0500630_004509_433_1221 | 262 |
| 1280 | 3300053160 | Ga0500633_0076507 | Ga0500633_0076507_95_922 | 262 |
| 1281 | 3300053162 | Ga0500638_062165 | Ga0500638_062165_845_1633 | 262 |
| 1282 | 3300053163 | Ga0500639_000028 | Ga0500639_000028_65238_66026 | 262 |
| 1283 | 3300053177 | Ga0500636_0001766 | Ga0500636_0001766_2835_3623 | 262 |
| 1284 | 3300053177 | Ga0500636_0004562 | Ga0500636_0004562_3469_4272 | 262 |
| 1285 | 3300053177 | Ga0500636_0021694 | Ga0500636_0021694_44_832 | 262 |
| 1286 | 3300053177 | Ga0500636_0090488 | Ga0500636_0090488_673_1461 | 262 |
| 1287 | 3300053178 | Ga0500637_0112382 | Ga0500637_0112382_358_1146 | 262 |
| 1288 | 3300053178 | Ga0500637_0174378 | Ga0500637_0174378_405_1193 | 262 |
| 1289 | 3300053723 | Ga0500567_079370 | Ga0500567_079370_493_1290 | 262 |
| 1290 | 3300053729 | Ga0500625_040499 | Ga0500625_040499_340_1128 | 262 |
| 1291 | 3300053735 | Ga0500596_002436 | Ga0500596_002436_638_1426 | 262 |
| 1292 | 3300053736 | Ga0500599_000324 | Ga0500599_000324_1519_2307 | 262 |
| 1293 | 3300053737 | Ga0500601_000049 | Ga0500601_000049_20198_20986 | 262 |
| 1294 | 3300053737 | Ga0500601_007957 | Ga0500601_007957_337_1125 | 262 |
| 1295 | 3300054114 | Ga0501084_0665997 | Ga0501084_0665997_74_862 | 262 |
| 1296 | 3300061719 | Ga0466962_0173859 | Ga0466962_0173859_119_907 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cdy-assembly1.cif.gz_A | the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution | 0.9437 | 7 | 245 |
| 4i5d-assembly1.cif.gz_A | crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form | 0.943 | 6 | 244 |
| 4bmn-assembly1.cif.gz_C | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9409 | 6 | 244 |
| 4nbu-assembly1.cif.gz_D | crystal structure of fabg from bacillus sp | 0.9405 | 6 | 244 |
| 4bmn-assembly1.cif.gz_B | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9399 | 6 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9494 | 6 | 243 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9491 | 7 | 81 | 3.40.50.720 |
| af_P9WGR9_1_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9409 | 7 | 244 | 3.40.50.720 |
| 4bmnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9379 | 6 | 244 | 3.40.50.720 |
| 2ehdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9321 | 7 | 241 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833GAE2-F1-model_v4 | SDR family oxidoreductase | 0.9596 | 6 | 188 |
GO:0016491
|
| AF-A0A1Q6KX94-F1-model_v4 | deleted | 0.9523 | 7 | 178 |
|
| AF-A0A833GAE2-F1-model_v4 | SDR family oxidoreductase | 0.9444 | 6 | 188 |
GO:0016491
|
| AF-A0A4R2KVD1-F1-model_v4 | 2-deoxy-D-gluconate 3-dehydrogenase | 0.9438 | 7 | 245 |
GO:0016616
|
| AF-A0A5D0SRJ3-F1-model_v4 | SDR family oxidoreductase | 0.9437 | 5 | 244 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar