F492571

General Info

Members Datasets Scaffolds Average Seq Length
1285 434 1245 332

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10063794|rootL2_100637943
Length 375
Sequence MGPLPGLKLLTGKDIAFTDCFLYYLASYLPCFRYFANLILENMLYTAEDIRQLNNKIQYQAAFIDRLRDEVGRVIVGQHHMLDRLLIGLLSNGHVLLEGVPGLAKTLAIKSLSQAIHAKFSRIQFTPDLLPADVIGTMIYNQQKHEFVVRRGPIFANFILADEINRAPAKVQSALLEAMQERQVTIGDTSYKLEEPFLVLATQNPLEQEGTYPLPEAQQDRFIMKVLVDYPSKQEEQLIIRQNVQGVQAPKVEQVVSMQEIMQAKDLARQVYMDEKVEHYILDIVFATRTPEKYKLEKLKPLIAYGGSPRASINLALAAKANAFLNKRGYVIPEDVRTISKDVLRHRIGLTYEAEAESVNVEQVIDDVLKAIPIP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541278 Niastella sp. CF465 Isolate Unclassified
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
11 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
17 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
18 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
19 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
20 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
21 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
22 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
23 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
24 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
25 2914759650 Rhizosphaericola mali Isolate Rhizosphere
26 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
27 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
28 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
29 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
30 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
31 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
32 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
33 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
34 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
35 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
36 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
43 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
113 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
210 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
218 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
219 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
220 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
221 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
239 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
242 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
247 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
248 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
255 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
271 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
272 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
273 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
274 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
275 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
276 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
277 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
278 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
279 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
280 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
281 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
282 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
283 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
284 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
285 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
286 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
287 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
288 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
292 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
293 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
294 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
303 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
321 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
322 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
344 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
345 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
369 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
370 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
371 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
372 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
373 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
374 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
375 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
376 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
377 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
378 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
379 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
380 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
381 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
382 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
383 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
384 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
385 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
386 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
390 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
391 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
392 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
393 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
394 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
395 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
396 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
409 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
410 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
411 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
412 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
415 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
416 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
417 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
423 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
424 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
425 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
426 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
427 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
431 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
432 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
433 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
434 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0.16
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.11
Nodule 0.39
Rhizoplane 1.17
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 3.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_80314 2162886007 Bacteria 4570
2 JGI24739J22299_10002669 3300001989 Bacteria 6871
3 JGI24737J22298_10012334 3300001990 Bacteria 2786
4 JGI24735J21928_10011812 3300002067 Bacteria 2765
5 rootH1_10040738 3300003316 Bacteria 12353
6 rootL2_10063794 3300003322 Bacteria 4250
7 rootH1_10327397 3300003323 Bacteria 1878
8 JGI25160J50197_1001078 3300003354 Bacteria 13993
9 Ga0065714_10013376 3300005288 Bacteria 1687
10 Ga0065714_10066582 3300005288 Bacteria 6618
11 Ga0065714_10068977 3300005288 Bacteria 4442
12 Ga0065714_10141826 3300005288 Bacteria 1158
13 Ga0065704_10002900 3300005289 Bacteria 5858
14 Ga0065704_10076658 3300005289 Bacteria 5031
15 Ga0065704_10142216 3300005289 Bacteria 1507
16 Ga0065712_10100859 3300005290 Bacteria 2050
17 Ga0065715_10011830 3300005293 Bacteria 2865
18 Ga0065707_10101795 3300005295 Bacteria 2845
19 Ga0070658_10000906 3300005327 Bacteria 25386
20 Ga0070658_10077656 3300005327 Bacteria 2724
21 Ga0070658_10091149 3300005327 Bacteria 2512
22 Ga0070658_10145683 3300005327 Bacteria 1980
23 Ga0070658_10279037 3300005327 Bacteria 1422
24 Ga0070676_10000064 3300005328 Bacteria 35148
25 Ga0070676_10022554 3300005328 Bacteria 3531
26 Ga0070676_10133082 3300005328 Bacteria 1574
27 Ga0070676_10219447 3300005328 Bacteria 1255
28 Ga0070676_10257906 3300005328 Bacteria 1166
29 Ga0070683_100000508 3300005329 Bacteria 27277
30 Ga0070683_100002318 3300005329 Bacteria 15100
31 Ga0070683_100003049 3300005329 Bacteria 13472
32 Ga0070683_100144479 3300005329 Bacteria 2254
33 Ga0070683_100376996 3300005329 Bacteria 1352
34 Ga0070690_100037559 3300005330 Bacteria 3053
35 Ga0070690_100052207 3300005330 Bacteria 2613
36 Ga0070690_100264321 3300005330 Bacteria 1221
37 Ga0070670_100025268 3300005331 Bacteria 5111
38 Ga0070670_100065519 3300005331 Bacteria 3117
39 Ga0070670_100077419 3300005331 Bacteria 2857
40 Ga0070670_100077997 3300005331 Bacteria 2846
41 Ga0070670_100186902 3300005331 Bacteria 1799
42 Ga0070677_10008736 3300005333 Bacteria 3418
43 Ga0068869_100000104 3300005334 Bacteria 39890
44 Ga0068869_100000739 3300005334 Bacteria 18576
45 Ga0068869_100005945 3300005334 Bacteria 7712
46 Ga0068869_100006962 3300005334 Bacteria 7196
47 Ga0068869_100015390 3300005334 Bacteria 5129
48 Ga0068869_100028613 3300005334 Bacteria 3897
49 Ga0068869_100063774 3300005334 Bacteria 2708
50 Ga0068869_100154856 3300005334 Bacteria 1780
51 Ga0070666_10000301 3300005335 Bacteria 31985
52 Ga0070666_10001016 3300005335 Bacteria 17198
53 Ga0070666_10002049 3300005335 Bacteria 12241
54 Ga0070666_10010552 3300005335 Bacteria 5780
55 Ga0070666_10025882 3300005335 Bacteria 3827
56 Ga0070666_10040373 3300005335 Bacteria 3115
57 Ga0070666_10268371 3300005335 Bacteria 1211
58 Ga0070680_100034878 3300005336 Bacteria 4059
59 Ga0070680_100088120 3300005336 Bacteria 2567
60 Ga0070680_100155729 3300005336 Bacteria 1919
61 Ga0070680_100213706 3300005336 Bacteria 1627
62 Ga0070682_100000074 3300005337 Bacteria 91549
63 Ga0070682_100005300 3300005337 Bacteria 7173
64 Ga0070682_100014573 3300005337 Bacteria 4545
65 Ga0070682_100021156 3300005337 Bacteria 3833
66 Ga0070682_100027407 3300005337 Bacteria 3419
67 Ga0070682_100148302 3300005337 Bacteria 1606
68 Ga0068868_100000543 3300005338 Bacteria 25349
69 Ga0068868_100002193 3300005338 Bacteria 13467
70 Ga0068868_100014374 3300005338 Bacteria 5833
71 Ga0068868_100032037 3300005338 Bacteria 4042
72 Ga0068868_100039410 3300005338 Bacteria 3670
73 Ga0068868_100045985 3300005338 Bacteria 3416
74 Ga0068868_100078092 3300005338 Bacteria 2649
75 Ga0068868_100315955 3300005338 Bacteria 1330
76 Ga0070660_100005097 3300005339 Bacteria 9076
77 Ga0070660_100083171 3300005339 Bacteria 2514
78 Ga0070660_100090740 3300005339 Bacteria 2409
79 Ga0070660_100157444 3300005339 Bacteria 1829
80 Ga0070660_100281884 3300005339 Bacteria 1360
81 Ga0070689_100004881 3300005340 Bacteria 9104
82 Ga0070689_100110811 3300005340 Bacteria 2183
83 Ga0070689_100128785 3300005340 Bacteria 2028
84 Ga0070691_10009358 3300005341 Bacteria 4473
85 Ga0070687_100088242 3300005343 Bacteria 1709
86 Ga0070661_100000111 3300005344 Bacteria 68066
87 Ga0070661_100097191 3300005344 Bacteria 2186
88 Ga0070661_100142850 3300005344 Bacteria 1805
89 Ga0070661_100250705 3300005344 Bacteria 1366
90 Ga0070668_100000222 3300005347 Bacteria 36600
91 Ga0070668_100128855 3300005347 Bacteria 2029
92 Ga0070668_100140422 3300005347 Bacteria 1946
93 Ga0070669_100002930 3300005353 Bacteria 12298
94 Ga0070669_100016100 3300005353 Bacteria 5333
95 Ga0070669_100064690 3300005353 Bacteria 2694
96 Ga0070675_100001118 3300005354 Bacteria 19352
97 Ga0070675_100010008 3300005354 Bacteria 7395
98 Ga0070675_100034407 3300005354 Bacteria 4112
99 Ga0070675_100085764 3300005354 Bacteria 2631
100 Ga0070675_100122321 3300005354 Bacteria 2212
101 Ga0070675_100186975 3300005354 Bacteria 1793
102 Ga0070675_100237080 3300005354 Bacteria 1593
103 Ga0070671_100007427 3300005355 Bacteria 8760
104 Ga0070671_100024975 3300005355 Bacteria 4897
105 Ga0070671_100048391 3300005355 Bacteria 3535
106 Ga0070671_100074648 3300005355 Bacteria 2833
107 Ga0070671_100089475 3300005355 Bacteria 2577
108 Ga0070671_100108425 3300005355 Bacteria 2332
109 Ga0070674_100051746 3300005356 Bacteria 2831
110 Ga0070673_100000197 3300005364 Bacteria 29830
111 Ga0070673_100005388 3300005364 Bacteria 8179
112 Ga0070673_100019747 3300005364 Bacteria 4845
113 Ga0070673_100021118 3300005364 Bacteria 4711
114 Ga0070673_100060998 3300005364 Bacteria 2991
115 Ga0070673_100082571 3300005364 Bacteria 2609
116 Ga0070673_100206850 3300005364 Bacteria 1693
117 Ga0070688_100005011 3300005365 Bacteria 6938
118 Ga0070688_100012988 3300005365 Bacteria 4686
119 Ga0070688_100036218 3300005365 Bacteria 3000
120 Ga0070659_100004285 3300005366 Bacteria 10184
121 Ga0070659_100065345 3300005366 Bacteria 2881
122 Ga0070659_100096635 3300005366 Bacteria 2373
123 Ga0070667_100000240 3300005367 Bacteria 62100
124 Ga0070667_100019873 3300005367 Bacteria 5573
125 Ga0070667_100030447 3300005367 Bacteria 4501
126 Ga0070667_100057178 3300005367 Bacteria 3296
127 Ga0070667_100063282 3300005367 Bacteria 3134
128 Ga0070667_100322372 3300005367 Bacteria 1394
129 Ga0070714_100336709 3300005435 Bacteria 1414
130 Ga0070713_100014440 3300005436 Bacteria 5867
131 Ga0070663_100051585 3300005455 Bacteria 2931
132 Ga0070678_100019833 3300005456 Bacteria 4396
133 Ga0070678_100022856 3300005456 Bacteria 4155
134 Ga0070678_100036230 3300005456 Bacteria 3451
135 Ga0070662_100006697 3300005457 Bacteria 7444
136 Ga0070662_100006827 3300005457 Bacteria 7379
137 Ga0070662_100007893 3300005457 Bacteria 6918
138 Ga0070662_100044931 3300005457 Bacteria 3167
139 Ga0070662_100236398 3300005457 Bacteria 1464
140 Ga0070662_100353485 3300005457 Bacteria 1204
141 Ga0070681_10011071 3300005458 Bacteria 8921
142 Ga0070681_10120439 3300005458 Bacteria 2559
143 Ga0070681_10222323 3300005458 Bacteria 1803
144 Ga0070681_10258200 3300005458 Bacteria 1654
145 Ga0068867_100005824 3300005459 Bacteria 8741
146 Ga0068867_100018208 3300005459 Bacteria 4991
147 Ga0068867_100032185 3300005459 Unclassified 3791
148 Ga0068867_100066390 3300005459 Bacteria 2687
149 Ga0068867_100072092 3300005459 Bacteria 2585
150 Ga0070685_10009079 3300005466 Bacteria 5131
151 Ga0070685_10087640 3300005466 Bacteria 1878
152 Ga0070685_10243947 3300005466 Bacteria 1187
153 Ga0070698_100020705 3300005471 Bacteria 6895
154 Ga0070679_100001149 3300005530 Bacteria 23184
155 Ga0070679_100001610 3300005530 Bacteria 20288
156 Ga0070679_100080717 3300005530 Bacteria 3242
157 Ga0070679_100186324 3300005530 Bacteria 2046
158 Ga0070684_100001291 3300005535 Bacteria 17946
159 Ga0070684_100002976 3300005535 Bacteria 12607
160 Ga0070684_100176709 3300005535 Bacteria 1940
161 Ga0068853_100002568 3300005539 Bacteria 13649
162 Ga0068853_100007168 3300005539 Bacteria 8923
163 Ga0068853_100020882 3300005539 Bacteria 5448
164 Ga0068853_100023897 3300005539 Bacteria 5122
165 Ga0068853_100045383 3300005539 Unclassified 3763
166 Ga0068853_100047241 3300005539 Bacteria 3694
167 Ga0068853_100279772 3300005539 Bacteria 1538
168 Ga0068853_100301319 3300005539 Bacteria 1481
169 Ga0068853_100317958 3300005539 Bacteria 1443
170 Ga0070672_100008792 3300005543 Bacteria 6934
171 Ga0070672_100030750 3300005543 Bacteria 4037
172 Ga0070672_100074830 3300005543 Bacteria 2702
173 Ga0070672_100136251 3300005543 Bacteria 2022
174 Ga0070672_100185042 3300005543 Bacteria 1737
175 Ga0070672_100393053 3300005543 Bacteria 1187
176 Ga0070686_100042371 3300005544 Bacteria 2851
177 Ga0070686_100102289 3300005544 Bacteria 1938
178 Ga0070693_100005061 3300005547 Bacteria 6300
179 Ga0070693_100156680 3300005547 Bacteria 1447
180 Ga0070693_100199772 3300005547 Bacteria 1298
181 Ga0070665_100000002 3300005548 Bacteria 849037
182 Ga0070665_100029722 3300005548 Bacteria 5499
183 Ga0070665_100039274 3300005548 Bacteria 4760
184 Ga0068855_100001113 3300005563 Bacteria 33428
185 Ga0068855_100002301 3300005563 Bacteria 23616
186 Ga0068855_100002404 3300005563 Bacteria 23090
187 Ga0068855_100021724 3300005563 Bacteria 7697
188 Ga0068855_100026330 3300005563 Bacteria 6958
189 Ga0068855_100292900 3300005563 Bacteria 1804
190 Ga0070664_100000243 3300005564 Bacteria 39166
191 Ga0070664_100000575 3300005564 Bacteria 27949
192 Ga0070664_100034619 3300005564 Bacteria 4237
193 Ga0070664_100036167 3300005564 Bacteria 4148
194 Ga0070664_100188870 3300005564 Bacteria 1835
195 Ga0068857_100006181 3300005577 Bacteria 10236
196 Ga0068857_100013599 3300005577 Bacteria 7090
197 Ga0068857_100014392 3300005577 Bacteria 6897
198 Ga0068857_100105568 3300005577 Bacteria 2529
199 Ga0068857_100148179 3300005577 Bacteria 2124
200 Ga0068857_100207082 3300005577 Bacteria 1789
201 Ga0068857_100298381 3300005577 Bacteria 1485
202 Ga0068854_100061921 3300005578 Bacteria 2711
203 Ga0068854_100172689 3300005578 Bacteria 1683
204 Ga0068856_100000359 3300005614 Bacteria 49880
205 Ga0068856_100012677 3300005614 Bacteria 8162
206 Ga0068856_100042279 3300005614 Bacteria 4483
207 Ga0068856_100068014 3300005614 Bacteria 3521
208 Ga0068856_100112301 3300005614 Bacteria 2723
209 Ga0068856_100262326 3300005614 Bacteria 1743
210 Ga0068852_100001462 3300005616 Bacteria 15970
211 Ga0068852_100003210 3300005616 Bacteria 11418
212 Ga0068852_100006516 3300005616 Bacteria 8442
213 Ga0068852_100010126 3300005616 Bacteria 7022
214 Ga0068852_100034695 3300005616 Bacteria 4201
215 Ga0068852_100038683 3300005616 Bacteria 4011
216 Ga0068852_100042066 3300005616 Bacteria 3866
217 Ga0068852_100529777 3300005616 Bacteria 1176
218 Ga0068859_100000006 3300005617 Bacteria 421509
219 Ga0068859_100001697 3300005617 Bacteria 22427
220 Ga0068859_100006362 3300005617 Bacteria 11981
221 Ga0068859_100006790 3300005617 Bacteria 11629
222 Ga0068859_100018396 3300005617 Bacteria 7024
223 Ga0068859_100071960 3300005617 Bacteria 3493
224 Ga0068859_100074150 3300005617 Bacteria 3442
225 Ga0068859_100110149 3300005617 Bacteria 2815
226 Ga0068859_100252970 3300005617 Bacteria 1852
227 Ga0068859_100452964 3300005617 Bacteria 1379
228 Ga0068859_100643383 3300005617 Bacteria 1152
229 Ga0068864_100024782 3300005618 Bacteria 5047
230 Ga0068864_100030070 3300005618 Bacteria 4603
231 Ga0068864_100030464 3300005618 Bacteria 4573
232 Ga0068864_100128372 3300005618 Bacteria 2274
233 Ga0068864_100143854 3300005618 Bacteria 2153
234 Ga0068864_100213930 3300005618 Bacteria 1776
235 Ga0068864_100225054 3300005618 Bacteria 1732
236 Ga0068866_10017291 3300005718 Bacteria 3241
237 Ga0068866_10018860 3300005718 Bacteria 3129
238 Ga0068866_10030435 3300005718 Bacteria 2591
239 Ga0068866_10042762 3300005718 Bacteria 2257
240 Ga0068861_100002834 3300005719 Bacteria 11403
241 Ga0068861_100007576 3300005719 Bacteria 7445
242 Ga0068861_100078437 3300005719 Bacteria 2579
243 Ga0068861_100099208 3300005719 Bacteria 2313
244 Ga0068861_100118877 3300005719 Bacteria 2129
245 Ga0068851_10000137 3300005834 Bacteria 39295
246 Ga0068851_10001240 3300005834 Bacteria 11085
247 Ga0068863_100000854 3300005841 Bacteria 30394
248 Ga0068863_100023628 3300005841 Bacteria 5869
249 Ga0068863_100029070 3300005841 Bacteria 5279
250 Ga0068863_100043860 3300005841 Bacteria 4246
251 Ga0068863_100243721 3300005841 Bacteria 1735
252 Ga0068863_100397149 3300005841 Bacteria 1348
253 Ga0068863_100611825 3300005841 Bacteria 1079
254 Ga0068858_100000889 3300005842 Bacteria 31013
255 Ga0068858_100011681 3300005842 Bacteria 8281
256 Ga0068858_100044548 3300005842 Bacteria 4112
257 Ga0068858_100061760 3300005842 Bacteria 3464
258 Ga0068858_100173246 3300005842 Bacteria 2035
259 Ga0068858_100193279 3300005842 Bacteria 1923
260 Ga0068858_100507438 3300005842 Bacteria 1165
261 Ga0068860_100001345 3300005843 Bacteria 26726
262 Ga0068860_100002872 3300005843 Bacteria 17875
263 Ga0068860_100004206 3300005843 Bacteria 14751
264 Ga0068860_100006986 3300005843 Bacteria 11309
265 Ga0068860_100007629 3300005843 Bacteria 10824
266 Ga0068860_100007968 3300005843 Bacteria 10566
267 Ga0068860_100011297 3300005843 Bacteria 8798
268 Ga0068860_100118883 3300005843 Bacteria 2530
269 Ga0068860_100291570 3300005843 Bacteria 1597
270 Ga0068862_100004695 3300005844 Bacteria 11509
271 Ga0068862_100006209 3300005844 Bacteria 9952
272 Ga0075366_10013523 3300006195 Bacteria 4650
273 Ga0075366_10092234 3300006195 Bacteria 1815
274 Ga0097621_100001013 3300006237 Bacteria 19778
275 Ga0097621_100001217 3300006237 Bacteria 17815
276 Ga0097621_100032274 3300006237 Bacteria 4162
277 Ga0097621_100034521 3300006237 Bacteria 4035
278 Ga0097621_100077642 3300006237 Bacteria 2757
279 Ga0097621_100091849 3300006237 Bacteria 2541
280 Ga0097621_100157551 3300006237 Bacteria 1950
281 Ga0068871_100003639 3300006358 Bacteria 10589
282 Ga0068871_100007102 3300006358 Bacteria 7984
283 Ga0068871_100016955 3300006358 Bacteria 5500
284 Ga0068871_100025182 3300006358 Bacteria 4625
285 Ga0068871_100032807 3300006358 Bacteria 4105
286 Ga0068871_100150059 3300006358 Bacteria 1987
287 Ga0068871_100165917 3300006358 Bacteria 1890
288 Ga0068871_100249157 3300006358 Bacteria 1547
289 Ga0068871_100351069 3300006358 Bacteria 1305
290 Ga0075431_100139576 3300006847 Bacteria 2498
291 Ga0075433_10316949 3300006852 Bacteria 1380
292 Ga0068865_100052734 3300006881 Bacteria 2820
293 Ga0068865_100115861 3300006881 Bacteria 1984
294 Ga0097620_100000006 3300006931 Bacteria 421509
295 Ga0097620_100001697 3300006931 Bacteria 22427
296 Ga0097620_100006362 3300006931 Bacteria 11981
297 Ga0097620_100006790 3300006931 Bacteria 11629
298 Ga0097620_100018396 3300006931 Bacteria 7024
299 Ga0097620_100071956 3300006931 Bacteria 3493
300 Ga0097620_100074146 3300006931 Bacteria 3442
301 Ga0097620_100110142 3300006931 Bacteria 2815
302 Ga0097620_100252981 3300006931 Bacteria 1852
303 Ga0097620_100452965 3300006931 Bacteria 1379
304 Ga0097620_100643381 3300006931 Bacteria 1152
305 Ga0099824_1000305 3300006942 Bacteria 52616
306 Ga0079104_1000156 3300006946 Bacteria 97036
307 Ga0099826_10003105 3300006948 Bacteria 11120
308 Ga0105251_10064924 3300009011 Bacteria 1710
309 Ga0105244_10000038 3300009036 Bacteria 158460
310 Ga0105240_10000367 3300009093 Bacteria 84666
311 Ga0105240_10000457 3300009093 Bacteria 75275
312 Ga0105240_10000487 3300009093 Bacteria 73453
313 Ga0105240_10004986 3300009093 Bacteria 19945
314 Ga0105240_10006862 3300009093 Bacteria 16644
315 Ga0105240_10046442 3300009093 Bacteria 5503
316 Ga0105240_10071729 3300009093 Bacteria 4282
317 Ga0105240_10080106 3300009093 Bacteria 4017
318 Ga0105240_10106837 3300009093 Bacteria 3394
319 Ga0105240_10158317 3300009093 Bacteria 2692
320 Ga0111539_10016272 3300009094 Bacteria 9223
321 Ga0111539_10052998 3300009094 Bacteria 4829
322 Ga0111539_10057252 3300009094 Bacteria 4630
323 Ga0111539_10061556 3300009094 Bacteria 4447
324 Ga0105245_10599406 3300009098 Bacteria 1128
325 Ga0105247_10005318 3300009101 Bacteria 8116
326 Ga0105247_10065819 3300009101 Bacteria 2255
327 Ga0114129_10049053 3300009147 Bacteria 5933
328 Ga0114129_10190233 3300009147 Bacteria 2787
329 Ga0105243_10070322 3300009148 Bacteria 2826
330 Ga0105243_10297922 3300009148 Bacteria 1460
331 Ga0105241_10003877 3300009174 Bacteria 11089
332 Ga0105241_10015210 3300009174 Bacteria 5636
333 Ga0105241_10052398 3300009174 Bacteria 3115
334 Ga0105242_10006871 3300009176 Bacteria 8776
335 Ga0105242_10010685 3300009176 Bacteria 7048
336 Ga0105242_10044829 3300009176 Bacteria 3583
337 Ga0105242_10091230 3300009176 Bacteria 2565
338 Ga0105242_10111905 3300009176 Bacteria 2329
339 Ga0105248_10173420 3300009177 Bacteria 2431
340 Ga0105248_10337932 3300009177 Bacteria 1696
341 Ga0105237_10003940 3300009545 Bacteria 17384
342 Ga0105237_10011351 3300009545 Bacteria 9426
343 Ga0105237_10014983 3300009545 Bacteria 8081
344 Ga0105237_10018157 3300009545 Bacteria 7282
345 Ga0105237_10039340 3300009545 Bacteria 4774
346 Ga0105237_10049075 3300009545 Bacteria 4244
347 Ga0105237_10049403 3300009545 Bacteria 4228
348 Ga0105237_10096846 3300009545 Bacteria 2941
349 Ga0105238_10010193 3300009551 Bacteria 9423
350 Ga0105238_10111142 3300009551 Bacteria 2721
351 Ga0105238_10126595 3300009551 Bacteria 2533
352 Ga0105249_10000382 3300009553 Bacteria 44030
353 Ga0105249_10001044 3300009553 Bacteria 24495
354 Ga0105249_10002600 3300009553 Bacteria 15643
355 Ga0105249_10018872 3300009553 Bacteria 6145
356 Ga0105249_10057035 3300009553 Bacteria 3577
357 Ga0105249_10058117 3300009553 Bacteria 3545
358 Ga0105249_10151575 3300009553 Bacteria 2232
359 Ga0105249_10332751 3300009553 Bacteria 1533
360 Ga0105239_10000283 3300010375 Bacteria 74612
361 Ga0105239_10002212 3300010375 Bacteria 24980
362 Ga0105239_10002422 3300010375 Bacteria 23765
363 Ga0105239_10015511 3300010375 Bacteria 8438
364 Ga0105239_10028606 3300010375 Bacteria 6128
365 Ga0105239_10078295 3300010375 Bacteria 3638
366 Ga0105239_10106080 3300010375 Bacteria 3112
367 Ga0105239_10121651 3300010375 Bacteria 2899
368 Ga0105239_10265411 3300010375 Bacteria 1930
369 Ga0105239_10291028 3300010375 Bacteria 1839
370 Ga0105239_10536784 3300010375 Bacteria 1331
371 Ga0105246_10009216 3300011119 Bacteria 6078
372 Ga0105246_10052457 3300011119 Bacteria 2804
373 Ga0157373_10000016 3300013100 Bacteria 181215
374 Ga0157373_10002668 3300013100 Bacteria 13529
375 Ga0157373_10003811 3300013100 Bacteria 11403
376 Ga0157373_10005405 3300013100 Bacteria 9595
377 Ga0157373_10007972 3300013100 Bacteria 7876
378 Ga0157373_10013073 3300013100 Bacteria 6091
379 Ga0157373_10024407 3300013100 Bacteria 4379
380 Ga0157373_10060448 3300013100 Bacteria 2684
381 Ga0157371_10000315 3300013102 Bacteria 62944
382 Ga0157371_10004166 3300013102 Bacteria 12742
383 Ga0157371_10005373 3300013102 Bacteria 10824
384 Ga0157371_10006278 3300013102 Bacteria 9842
385 Ga0157371_10006742 3300013102 Bacteria 9390
386 Ga0157371_10012930 3300013102 Bacteria 6356
387 Ga0157371_10017834 3300013102 Bacteria 5263
388 Ga0157371_10020968 3300013102 Bacteria 4804
389 Ga0157371_10030221 3300013102 Bacteria 3910
390 Ga0157371_10071339 3300013102 Bacteria 2459
391 Ga0157371_10088672 3300013102 Bacteria 2190
392 Ga0157371_10104429 3300013102 Bacteria 2011
393 Ga0157371_10106339 3300013102 Bacteria 1991
394 Ga0157370_10000859 3300013104 Bacteria 38553
395 Ga0157370_10001136 3300013104 Bacteria 33269
396 Ga0157370_10003783 3300013104 Bacteria 17662
397 Ga0157370_10011737 3300013104 Bacteria 9148
398 Ga0157370_10026250 3300013104 Bacteria 5755
399 Ga0157370_10028521 3300013104 Bacteria 5488
400 Ga0157370_10036810 3300013104 Bacteria 4747
401 Ga0157370_10154027 3300013104 Bacteria 2138
402 Ga0157370_10389371 3300013104 Bacteria 1283
403 Ga0157370_10414265 3300013104 Bacteria 1240
404 Ga0157369_10002012 3300013105 Bacteria 24492
405 Ga0157369_10017560 3300013105 Bacteria 8040
406 Ga0157369_10035798 3300013105 Bacteria 5442
407 Ga0157369_10042857 3300013105 Bacteria 4936
408 Ga0157369_10048169 3300013105 Bacteria 4624
409 Ga0157369_10073005 3300013105 Bacteria 3681
410 Ga0157369_10091167 3300013105 Bacteria 3254
411 Ga0157369_10113429 3300013105 Bacteria 2879
412 Ga0157369_10119967 3300013105 Bacteria 2790
413 Ga0157369_10152272 3300013105 Bacteria 2444
414 Ga0157369_10370215 3300013105 Bacteria 1487
415 Ga0157369_10481140 3300013105 Bacteria 1285
416 Ga0157374_10000013 3300013296 Bacteria 461240
417 Ga0157374_10000311 3300013296 Bacteria 45181
418 Ga0157374_10006867 3300013296 Bacteria 9682
419 Ga0157374_10008233 3300013296 Bacteria 8909
420 Ga0157374_10010075 3300013296 Bacteria 8117
421 Ga0157374_10041594 3300013296 Bacteria 4236
422 Ga0157374_10060741 3300013296 Bacteria 3538
423 Ga0157374_10086089 3300013296 Bacteria 2989
424 Ga0157374_10233257 3300013296 Bacteria 1808
425 Ga0157374_10287229 3300013296 Bacteria 1625
426 Ga0157374_10347096 3300013296 Bacteria 1474
427 Ga0157374_10388969 3300013296 Bacteria 1390
428 Ga0157378_10005516 3300013297 Bacteria 11087
429 Ga0157378_10008769 3300013297 Bacteria 8804
430 Ga0157378_10025790 3300013297 Bacteria 5178
431 Ga0157378_10047199 3300013297 Bacteria 3828
432 Ga0157378_10069320 3300013297 Bacteria 3163
433 Ga0157378_10135788 3300013297 Bacteria 2281
434 Ga0157378_10195801 3300013297 Bacteria 1909
435 Ga0157378_10516307 3300013297 Bacteria 1196
436 Ga0163162_10000175 3300013306 Bacteria 59209
437 Ga0163162_10000244 3300013306 Bacteria 49260
438 Ga0163162_10001206 3300013306 Bacteria 24134
439 Ga0163162_10001299 3300013306 Bacteria 23358
440 Ga0163162_10002221 3300013306 Bacteria 18233
441 Ga0163162_10004298 3300013306 Bacteria 13710
442 Ga0163162_10006923 3300013306 Bacteria 10993
443 Ga0163162_10018140 3300013306 Bacteria 6890
444 Ga0163162_10019993 3300013306 Bacteria 6576
445 Ga0163162_10079695 3300013306 Bacteria 3341
446 Ga0163162_10169264 3300013306 Bacteria 2309
447 Ga0163162_10194694 3300013306 Bacteria 2155
448 Ga0163162_10281292 3300013306 Bacteria 1796
449 Ga0157372_10000186 3300013307 Bacteria 68701
450 Ga0157372_10004707 3300013307 Bacteria 14494
451 Ga0157372_10019592 3300013307 Bacteria 7291
452 Ga0157372_10024829 3300013307 Bacteria 6514
453 Ga0157372_10028658 3300013307 Bacteria 6079
454 Ga0157372_10035513 3300013307 Bacteria 5488
455 Ga0157372_10046003 3300013307 Bacteria 4843
456 Ga0157372_10096098 3300013307 Bacteria 3376
457 Ga0157372_10097318 3300013307 Bacteria 3356
458 Ga0157372_10113262 3300013307 Bacteria 3109
459 Ga0157372_10114346 3300013307 Bacteria 3094
460 Ga0157372_10123056 3300013307 Bacteria 2981
461 Ga0157372_10139491 3300013307 Bacteria 2792
462 Ga0157372_10150827 3300013307 Bacteria 2683
463 Ga0157372_10156907 3300013307 Bacteria 2629
464 Ga0157372_10197628 3300013307 Bacteria 2329
465 Ga0157372_10215737 3300013307 Bacteria 2224
466 Ga0157372_10309549 3300013307 Bacteria 1838
467 Ga0157372_10327907 3300013307 Bacteria 1782
468 Ga0157372_10332083 3300013307 Bacteria 1771
469 Ga0157372_10351485 3300013307 Bacteria 1717
470 Ga0157375_10000085 3300013308 Bacteria 93488
471 Ga0157375_10000773 3300013308 Bacteria 28047
472 Ga0157375_10007261 3300013308 Bacteria 9694
473 Ga0157375_10027672 3300013308 Bacteria 5303
474 Ga0157375_10055169 3300013308 Bacteria 3917
475 Ga0157375_10081546 3300013308 Bacteria 3275
476 Ga0157375_10089618 3300013308 Bacteria 3133
477 Ga0157375_10133442 3300013308 Bacteria 2604
478 Ga0157375_10155615 3300013308 Bacteria 2424
479 Ga0157375_10477176 3300013308 Bacteria 1412
480 Ga0163163_10000052 3300014325 Bacteria 127851
481 Ga0163163_10000202 3300014325 Bacteria 61701
482 Ga0163163_10000369 3300014325 Bacteria 43150
483 Ga0163163_10007952 3300014325 Bacteria 9378
484 Ga0163163_10058840 3300014325 Bacteria 3799
485 Ga0163163_10085512 3300014325 Bacteria 3162
486 Ga0163163_10107391 3300014325 Bacteria 2818
487 Ga0163163_10148591 3300014325 Bacteria 2388
488 Ga0163163_10160745 3300014325 Bacteria 2292
489 Ga0163163_10306198 3300014325 Bacteria 1641
490 Ga0157380_10000160 3300014326 Bacteria 38911
491 Ga0157380_10004286 3300014326 Bacteria 9876
492 Ga0157380_10095609 3300014326 Bacteria 2462
493 Ga0157380_10129624 3300014326 Bacteria 2150
494 Ga0157380_10192734 3300014326 Bacteria 1801
495 Ga0157380_10219302 3300014326 Bacteria 1701
496 Ga0157380_10286284 3300014326 Bacteria 1511
497 Ga0157377_10004071 3300014745 Bacteria 6673
498 Ga0157377_10080052 3300014745 Bacteria 1907
499 Ga0157379_10001465 3300014968 Bacteria 19448
500 Ga0157379_10018400 3300014968 Bacteria 6159
501 Ga0157379_10019036 3300014968 Bacteria 6061
502 Ga0157379_10021198 3300014968 Bacteria 5751
503 Ga0157379_10035570 3300014968 Bacteria 4441
504 Ga0157379_10192981 3300014968 Bacteria 1840
505 Ga0157379_10250265 3300014968 Bacteria 1609
506 Ga0157379_10382353 3300014968 Bacteria 1292
507 Ga0157376_10000842 3300014969 Bacteria 20112
508 Ga0157376_10003719 3300014969 Bacteria 10545
509 Ga0157376_10011465 3300014969 Bacteria 6536
510 Ga0157376_10014822 3300014969 Bacteria 5868
511 Ga0157376_10025729 3300014969 Bacteria 4638
512 Ga0157376_10061023 3300014969 Bacteria 3168
513 Ga0157376_10082645 3300014969 Bacteria 2760
514 Ga0157376_10085120 3300014969 Bacteria 2724
515 Ga0157376_10340169 3300014969 Bacteria 1433
516 Ga0182006_1026570 3300015261 Bacteria 2368
517 Ga0163161_10000019 3300017792 Bacteria 216758
518 Ga0163161_10000966 3300017792 Bacteria 22060
519 Ga0163161_10011062 3300017792 Bacteria 6250
520 Ga0163161_10018794 3300017792 Bacteria 4844
521 Ga0163161_10026550 3300017792 Bacteria 4101
522 Ga0163161_10029015 3300017792 Bacteria 3932
523 Ga0163161_10030291 3300017792 Bacteria 3849
524 Ga0163161_10051759 3300017792 Bacteria 2976
525 Ga0163161_10065769 3300017792 Bacteria 2646
526 Ga0163161_10085459 3300017792 Bacteria 2327
527 Ga0163161_10210356 3300017792 Bacteria 1502
528 Ga0209646_1001757 3300025246 Bacteria 5460
529 Ga0209233_1000560 3300025261 Bacteria 19965
530 Ga0207426_1000189 3300025302 Bacteria 153457
531 Ga0207697_10011822 3300025315 Bacteria 3682
532 Ga0207697_10022233 3300025315 Bacteria 2598
533 Ga0207656_10001419 3300025321 Bacteria 7925
534 Ga0207655_1000034 3300025728 Bacteria 364737
535 Ga0207713_1033057 3300025735 Bacteria 2264
536 Ga0207682_10005673 3300025893 Bacteria 5066
537 Ga0207642_10007747 3300025899 Bacteria 3640
538 Ga0207710_10003507 3300025900 Bacteria 6974
539 Ga0207710_10099048 3300025900 Bacteria 1373
540 Ga0207688_10033608 3300025901 Bacteria 2837
541 Ga0207680_10000855 3300025903 Bacteria 14362
542 Ga0207647_10000030 3300025904 Bacteria 106974
543 Ga0207647_10000096 3300025904 Bacteria 67468
544 Ga0207647_10016353 3300025904 Bacteria 5065
545 Ga0207647_10018721 3300025904 Bacteria 4675
546 Ga0207647_10072323 3300025904 Bacteria 2080
547 Ga0207647_10111673 3300025904 Bacteria 1616
548 Ga0207685_10022613 3300025905 Bacteria 2128
549 Ga0207645_10000326 3300025907 Bacteria 39738
550 Ga0207645_10001164 3300025907 Bacteria 21705
551 Ga0207645_10087139 3300025907 Bacteria 2006
552 Ga0207643_10021434 3300025908 Bacteria 3550
553 Ga0207643_10136724 3300025908 Bacteria 1461
554 Ga0207705_10003840 3300025909 Bacteria 11431
555 Ga0207705_10077408 3300025909 Bacteria 2419
556 Ga0207705_10225077 3300025909 Bacteria 1426
557 Ga0207654_10001346 3300025911 Bacteria 13038
558 Ga0207654_10001813 3300025911 Bacteria 11092
559 Ga0207654_10026178 3300025911 Bacteria 3156
560 Ga0207707_10226356 3300025912 Bacteria 1627
561 Ga0207695_10000051 3300025913 Bacteria 399641
562 Ga0207695_10000056 3300025913 Bacteria 382433
563 Ga0207695_10000066 3300025913 Bacteria 334103
564 Ga0207695_10000081 3300025913 Bacteria 284797
565 Ga0207695_10000156 3300025913 Bacteria 204576
566 Ga0207695_10001892 3300025913 Bacteria 32670
567 Ga0207695_10021903 3300025913 Bacteria 7275
568 Ga0207695_10027179 3300025913 Bacteria 6374
569 Ga0207695_10033011 3300025913 Bacteria 5655
570 Ga0207695_10137668 3300025913 Bacteria 2393
571 Ga0207695_10145223 3300025913 Bacteria 2317
572 Ga0207671_10008035 3300025914 Bacteria 9021
573 Ga0207671_10018945 3300025914 Bacteria 5273
574 Ga0207671_10019960 3300025914 Bacteria 5112
575 Ga0207671_10079128 3300025914 Bacteria 2462
576 Ga0207671_10105276 3300025914 Bacteria 2140
577 Ga0207671_10204265 3300025914 Bacteria 1543
578 Ga0207671_10224978 3300025914 Bacteria 1471
579 Ga0207663_10127179 3300025916 Bacteria 1755
580 Ga0207660_10008438 3300025917 Bacteria 6664
581 Ga0207660_10342335 3300025917 Bacteria 1197
582 Ga0207662_10057206 3300025918 Bacteria 2330
583 Ga0207657_10007593 3300025919 Bacteria 11109
584 Ga0207657_10029300 3300025919 Bacteria 5013
585 Ga0207657_10135996 3300025919 Bacteria 2011
586 Ga0207657_10245537 3300025919 Bacteria 1428
587 Ga0207649_10002398 3300025920 Bacteria 10509
588 Ga0207649_10074802 3300025920 Bacteria 2175
589 Ga0207652_10000210 3300025921 Bacteria 61797
590 Ga0207652_10001379 3300025921 Bacteria 21620
591 Ga0207652_10002011 3300025921 Bacteria 17552
592 Ga0207652_10019087 3300025921 Bacteria 5633
593 Ga0207652_10077604 3300025921 Bacteria 2899
594 Ga0207681_10002024 3300025923 Bacteria 13028
595 Ga0207681_10034406 3300025923 Bacteria 3331
596 Ga0207681_10250121 3300025923 Bacteria 1383
597 Ga0207681_10327104 3300025923 Bacteria 1221
598 Ga0207694_10011093 3300025924 Bacteria 6806
599 Ga0207694_10092098 3300025924 Bacteria 2393
600 Ga0207650_10011012 3300025925 Bacteria 6219
601 Ga0207650_10014889 3300025925 Bacteria 5411
602 Ga0207650_10091543 3300025925 Bacteria 2324
603 Ga0207650_10140007 3300025925 Bacteria 1901
604 Ga0207659_10014635 3300025926 Bacteria 5065
605 Ga0207659_10030533 3300025926 Bacteria 3684
606 Ga0207659_10067776 3300025926 Bacteria 2593
607 Ga0207659_10082064 3300025926 Bacteria 2386
608 Ga0207659_10129190 3300025926 Bacteria 1947
609 Ga0207659_10178082 3300025926 Bacteria 1682
610 Ga0207659_10212580 3300025926 Bacteria 1551
611 Ga0207659_10245222 3300025926 Bacteria 1451
612 Ga0207659_10405863 3300025926 Bacteria 1140
613 Ga0207687_10385302 3300025927 Bacteria 1149
614 Ga0207644_10051728 3300025931 Bacteria 2950
615 Ga0207644_10098384 3300025931 Bacteria 2193
616 Ga0207644_10272912 3300025931 Bacteria 1356
617 Ga0207644_10428625 3300025931 Bacteria 1084
618 Ga0207690_10001171 3300025932 Bacteria 16575
619 Ga0207690_10002934 3300025932 Bacteria 10277
620 Ga0207690_10082957 3300025932 Bacteria 2243
621 Ga0207706_10005261 3300025933 Bacteria 12070
622 Ga0207706_10017736 3300025933 Bacteria 6412
623 Ga0207706_10051143 3300025933 Bacteria 3650
624 Ga0207706_10251690 3300025933 Bacteria 1543
625 Ga0207686_10088226 3300025934 Bacteria 2041
626 Ga0207686_10155239 3300025934 Bacteria 1598
627 Ga0207670_10002141 3300025936 Bacteria 10336
628 Ga0207670_10302262 3300025936 Bacteria 1253
629 Ga0207669_10133302 3300025937 Bacteria 1711
630 Ga0207704_10003680 3300025938 Bacteria 6971
631 Ga0207704_10070318 3300025938 Bacteria 2215
632 Ga0207691_10000076 3300025940 Bacteria 83005
633 Ga0207691_10010109 3300025940 Bacteria 9056
634 Ga0207691_10023963 3300025940 Bacteria 5741
635 Ga0207691_10090619 3300025940 Bacteria 2741
636 Ga0207691_10104879 3300025940 Bacteria 2519
637 Ga0207691_10128227 3300025940 Bacteria 2243
638 Ga0207691_10136818 3300025940 Bacteria 2160
639 Ga0207691_10195268 3300025940 Bacteria 1764
640 Ga0207689_10000429 3300025942 Bacteria 39444
641 Ga0207689_10001060 3300025942 Bacteria 26468
642 Ga0207689_10002845 3300025942 Bacteria 15974
643 Ga0207689_10002851 3300025942 Bacteria 15954
644 Ga0207689_10005578 3300025942 Bacteria 11228
645 Ga0207689_10007781 3300025942 Bacteria 9379
646 Ga0207689_10024801 3300025942 Bacteria 5028
647 Ga0207689_10030329 3300025942 Bacteria 4506
648 Ga0207689_10068996 3300025942 Bacteria 2905
649 Ga0207689_10076825 3300025942 Bacteria 2745
650 Ga0207689_10080136 3300025942 Bacteria 2683
651 Ga0207689_10294473 3300025942 Bacteria 1345
652 Ga0207661_10000669 3300025944 Bacteria 22178
653 Ga0207661_10011917 3300025944 Bacteria 6314
654 Ga0207661_10011967 3300025944 Bacteria 6302
655 Ga0207661_10333395 3300025944 Bacteria 1366
656 Ga0207679_10000091 3300025945 Bacteria 78725
657 Ga0207679_10004528 3300025945 Bacteria 8660
658 Ga0207679_10247304 3300025945 Bacteria 1514
659 Ga0207679_10386634 3300025945 Unclassified 1228
660 Ga0207667_10001351 3300025949 Bacteria 30791
661 Ga0207667_10002178 3300025949 Bacteria 24573
662 Ga0207667_10002393 3300025949 Bacteria 23487
663 Ga0207667_10005268 3300025949 Bacteria 15775
664 Ga0207667_10005458 3300025949 Bacteria 15498
665 Ga0207667_10029053 3300025949 Bacteria 6000
666 Ga0207667_10030851 3300025949 Bacteria 5793
667 Ga0207667_10031294 3300025949 Bacteria 5745
668 Ga0207667_10042069 3300025949 Bacteria 4859
669 Ga0207667_10052888 3300025949 Bacteria 4275
670 Ga0207667_10055899 3300025949 Bacteria 4148
671 Ga0207667_10186529 3300025949 Bacteria 2129
672 Ga0207667_10221437 3300025949 Bacteria 1939
673 Ga0207651_10006333 3300025960 Bacteria 6183
674 Ga0207651_10014260 3300025960 Bacteria 4581
675 Ga0207712_10002253 3300025961 Bacteria 12531
676 Ga0207712_10006568 3300025961 Bacteria 7340
677 Ga0207712_10013777 3300025961 Bacteria 5186
678 Ga0207712_10014032 3300025961 Bacteria 5143
679 Ga0207668_10058479 3300025972 Bacteria 2695
680 Ga0207668_10336319 3300025972 Bacteria 1258
681 Ga0207640_10039498 3300025981 Bacteria 2987
682 Ga0207640_10083025 3300025981 Bacteria 2196
683 Ga0207640_10088172 3300025981 Bacteria 2141
684 Ga0207640_10190518 3300025981 Bacteria 1546
685 Ga0207640_10250499 3300025981 Bacteria 1374
686 Ga0207658_10038693 3300025986 Bacteria 3438
687 Ga0207658_10064258 3300025986 Bacteria 2752
688 Ga0207658_10078782 3300025986 Bacteria 2519
689 Ga0207658_10100249 3300025986 Bacteria 2267
690 Ga0207658_10317479 3300025986 Bacteria 1348
691 Ga0207677_10004007 3300026023 Bacteria 7860
692 Ga0207677_10007307 3300026023 Bacteria 6101
693 Ga0207677_10011519 3300026023 Bacteria 5047
694 Ga0207677_10012632 3300026023 Bacteria 4863
695 Ga0207677_10069830 3300026023 Bacteria 2472
696 Ga0207677_10167915 3300026023 Bacteria 1712
697 Ga0207677_10475886 3300026023 Bacteria 1075
698 Ga0207703_10004255 3300026035 Bacteria 11782
699 Ga0207703_10030625 3300026035 Bacteria 4254
700 Ga0207703_10191738 3300026035 Bacteria 1810
701 Ga0207639_10001896 3300026041 Bacteria 14035
702 Ga0207639_10004353 3300026041 Bacteria 9553
703 Ga0207639_10004753 3300026041 Bacteria 9148
704 Ga0207639_10041408 3300026041 Bacteria 3445
705 Ga0207639_10065337 3300026041 Bacteria 2824
706 Ga0207639_10074819 3300026041 Bacteria 2661
707 Ga0207639_10122948 3300026041 Bacteria 2135
708 Ga0207639_10212565 3300026041 Bacteria 1666
709 Ga0207639_10325864 3300026041 Bacteria 1365
710 Ga0207678_10009466 3300026067 Bacteria 8570
711 Ga0207678_10015031 3300026067 Bacteria 6811
712 Ga0207678_10302826 3300026067 Bacteria 1374
713 Ga0207708_10119611 3300026075 Bacteria 2052
714 Ga0207702_10000161 3300026078 Bacteria 79598
715 Ga0207702_10070421 3300026078 Bacteria 3008
716 Ga0207702_10143431 3300026078 Bacteria 2164
717 Ga0207702_10266491 3300026078 Bacteria 1614
718 Ga0207641_10002871 3300026088 Bacteria 15625
719 Ga0207641_10003795 3300026088 Bacteria 13253
720 Ga0207641_10009891 3300026088 Bacteria 7852
721 Ga0207641_10250649 3300026088 Bacteria 1653
722 Ga0207648_10002106 3300026089 Bacteria 21685
723 Ga0207648_10004506 3300026089 Bacteria 14285
724 Ga0207648_10005153 3300026089 Bacteria 13235
725 Ga0207648_10018365 3300026089 Bacteria 6334
726 Ga0207648_10022436 3300026089 Bacteria 5666
727 Ga0207648_10026067 3300026089 Bacteria 5198
728 Ga0207648_10042613 3300026089 Bacteria 3984
729 Ga0207648_10052105 3300026089 Bacteria 3578
730 Ga0207648_10054873 3300026089 Bacteria 3479
731 Ga0207648_10106728 3300026089 Bacteria 2458
732 Ga0207648_10129439 3300026089 Bacteria 2221
733 Ga0207648_10134548 3300026089 Bacteria 2177
734 Ga0207648_10147718 3300026089 Bacteria 2074
735 Ga0207648_10213349 3300026089 Bacteria 1714
736 Ga0207648_10437006 3300026089 Bacteria 1190
737 Ga0207676_10003274 3300026095 Bacteria 11514
738 Ga0207674_10001267 3300026116 Bacteria 33015
739 Ga0207674_10005257 3300026116 Bacteria 15410
740 Ga0207674_10017345 3300026116 Bacteria 7855
741 Ga0207674_10020982 3300026116 Bacteria 7046
742 Ga0207674_10034398 3300026116 Bacteria 5298
743 Ga0207674_10047532 3300026116 Bacteria 4398
744 Ga0207674_10101825 3300026116 Bacteria 2853
745 Ga0207674_10147525 3300026116 Bacteria 2310
746 Ga0207674_10346480 3300026116 Bacteria 1436
747 Ga0207674_10382954 3300026116 Bacteria 1360
748 Ga0207674_10387631 3300026116 Bacteria 1351
749 Ga0207675_100000085 3300026118 Bacteria 73716
750 Ga0207675_100031240 3300026118 Bacteria 4960
751 Ga0207675_100071533 3300026118 Bacteria 3243
752 Ga0207675_100094075 3300026118 Bacteria 2819
753 Ga0207675_100115784 3300026118 Bacteria 2533
754 Ga0207675_100182849 3300026118 Bacteria 2008
755 Ga0207675_100492226 3300026118 Bacteria 1220
756 Ga0207683_10001248 3300026121 Bacteria 23074
757 Ga0207683_10054050 3300026121 Bacteria 3521
758 Ga0207683_10071229 3300026121 Bacteria 3072
759 Ga0207683_10358859 3300026121 Bacteria 1338
760 Ga0207698_10003249 3300026142 Bacteria 9765
761 Ga0207698_10047515 3300026142 Bacteria 3252
762 Ga0207698_10258670 3300026142 Bacteria 1598
763 Ga0209281_1000152 3300027111 Bacteria 167233
764 Ga0209489_118825 3300027361 Bacteria 2545
765 Ga0209974_10064403 3300027876 Bacteria 1244
766 Ga0268266_10000022 3300028379 Bacteria 508060
767 Ga0268266_10033089 3300028379 Bacteria 4396
768 Ga0268266_10066307 3300028379 Bacteria 3122
769 Ga0268265_10004802 3300028380 Bacteria 9318
770 Ga0268265_10011485 3300028380 Bacteria 5987
771 Ga0268265_10221873 3300028380 Bacteria 1655
772 Ga0268264_10000082 3300028381 Bacteria 246913
773 Ga0268264_10004767 3300028381 Bacteria 11512
774 Ga0268264_10005045 3300028381 Bacteria 11175
775 Ga0268264_10005982 3300028381 Bacteria 10303
776 Ga0268264_10011113 3300028381 Bacteria 7438
777 Ga0268264_10073962 3300028381 Bacteria 2893
778 Ga0268264_10105895 3300028381 Bacteria 2454
779 Ga0268264_10137551 3300028381 Bacteria 2174
780 Ga0268264_10283748 3300028381 Bacteria 1552
781 Ga0268264_10365319 3300028381 Bacteria 1378
782 Ga0268264_10474954 3300028381 Bacteria 1215
783 Ga0265337_1007802 3300028556 Bacteria 3967
784 Ga0265337_1008483 3300028556 Bacteria 3735
785 Ga0265326_10024092 3300028558 Bacteria 1738
786 Ga0265319_1010676 3300028563 Bacteria 3818
787 Ga0265319_1028498 3300028563 Bacteria 1968
788 Ga0265319_1032714 3300028563 Bacteria 1800
789 Ga0265334_10006076 3300028573 Bacteria 5236
790 Ga0265334_10034622 3300028573 Bacteria 2004
791 Ga0265318_10002327 3300028577 Bacteria 10200
792 Ga0265318_10006315 3300028577 Bacteria 5471
793 Ga0265318_10008905 3300028577 Bacteria 4444
794 Ga0265318_10013950 3300028577 Bacteria 3381
795 Ga0265323_10008708 3300028653 Bacteria 4172
796 Ga0265322_10001690 3300028654 Bacteria 7016
797 Ga0265322_10034446 3300028654 Bacteria 1443
798 Ga0265336_10003826 3300028666 Bacteria 5802
799 Ga0307517_10090506 3300028786 Bacteria 2510
800 Ga0307515_10000001 3300028794 Bacteria 4259510
801 Ga0307515_10000021 3300028794 Bacteria 406008
802 Ga0307515_10187845 3300028794 Bacteria 1988
803 Ga0265338_10000326 3300028800 Bacteria 86601
804 Ga0265338_10008155 3300028800 Bacteria 12781
805 Ga0265338_10012024 3300028800 Bacteria 9903
806 Ga0265338_10018508 3300028800 Bacteria 7453
807 Ga0265338_10025784 3300028800 Bacteria 5953
808 Ga0265338_10030098 3300028800 Bacteria 5360
809 Ga0265338_10192279 3300028800 Bacteria 1546
810 Ga0265324_10002404 3300029957 Bacteria 9629
811 Ga0265324_10010850 3300029957 Bacteria 3493
812 Ga0307511_10000027 3300030521 Bacteria 109500
813 Ga0265332_10082532 3300031238 Bacteria 1363
814 Ga0265320_10005380 3300031240 Bacteria 8228
815 Ga0265320_10012722 3300031240 Bacteria 4880
816 Ga0265320_10016058 3300031240 Bacteria 4207
817 Ga0265340_10020560 3300031247 Bacteria 3391
818 Ga0265339_10003340 3300031249 Bacteria 11233
819 Ga0265339_10066381 3300031249 Bacteria 1932
820 Ga0265331_10007167 3300031250 Bacteria 6484
821 Ga0265327_10000031 3300031251 Bacteria 325718
822 Ga0265327_10000059 3300031251 Bacteria 236935
823 Ga0265327_10000668 3300031251 Bacteria 55034
824 Ga0265327_10002984 3300031251 Bacteria 16806
825 Ga0265327_10004692 3300031251 Bacteria 11954
826 Ga0265327_10006052 3300031251 Bacteria 9815
827 Ga0265327_10007437 3300031251 Bacteria 8449
828 Ga0265327_10020300 3300031251 Bacteria 4054
829 Ga0265327_10027539 3300031251 Bacteria 3268
830 Ga0265316_10009084 3300031344 Bacteria 9159
831 Ga0265316_10011402 3300031344 Bacteria 8021
832 Ga0265316_10013233 3300031344 Bacteria 7343
833 Ga0265316_10056308 3300031344 Bacteria 3072
834 Ga0265316_10118324 3300031344 Bacteria 2002
835 Ga0307513_10032991 3300031456 Bacteria 5828
836 Ga0307509_10050166 3300031507 Bacteria 4470
837 Ga0307408_100000113 3300031548 Bacteria 89538
838 Ga0307408_100000316 3300031548 Bacteria 46302
839 Ga0307408_100004582 3300031548 Bacteria 9358
840 Ga0265313_10014781 3300031595 Bacteria 4591
841 Ga0265313_10023146 3300031595 Bacteria 3352
842 Ga0307508_10003578 3300031616 Bacteria 15652
843 Ga0265314_10000927 3300031711 Bacteria 34567
844 Ga0265314_10011071 3300031711 Bacteria 7476
845 Ga0265314_10050595 3300031711 Bacteria 2899
846 Ga0265314_10078045 3300031711 Bacteria 2194
847 Ga0265314_10096756 3300031711 Bacteria 1909
848 Ga0265342_10010093 3300031712 Bacteria 6584
849 Ga0265342_10024148 3300031712 Bacteria 3840
850 Ga0265342_10088852 3300031712 Bacteria 1774
851 Ga0316576_10008324 3300031727 Bacteria 6606
852 Ga0316576_10112213 3300031727 Bacteria 2044
853 Ga0307516_10000119 3300031730 Bacteria 92189
854 Ga0307516_10033453 3300031730 Bacteria 5172
855 Ga0307516_10166820 3300031730 Bacteria 1945
856 Ga0307405_10000001 3300031731 Bacteria 1731270
857 Ga0307413_10000561 3300031824 Bacteria 12461
858 Ga0307410_10000010 3300031852 Bacteria 88468
859 Ga0307410_10000031 3300031852 Bacteria 49813
860 Ga0307410_10079569 3300031852 Bacteria 2297
861 Ga0307406_10001444 3300031901 Bacteria 13138
862 Ga0307406_10003447 3300031901 Bacteria 8607
863 Ga0307407_10001090 3300031903 Bacteria 9455
864 Ga0307407_10004004 3300031903 Bacteria 6163
865 Ga0307407_10041385 3300031903 Bacteria 2576
866 Ga0307412_10070587 3300031911 Bacteria 2381
867 Ga0307412_10251624 3300031911 Bacteria 1372
868 Ga0307409_100000003 3300031995 Bacteria 87125
869 Ga0307409_100131596 3300031995 Bacteria 2139
870 Ga0307416_100000022 3300032002 Bacteria 188660
871 Ga0307416_100000207 3300032002 Bacteria 30949
872 Ga0307416_100127235 3300032002 Bacteria 2284
873 Ga0307414_10000064 3300032004 Bacteria 106601
874 Ga0307414_10002124 3300032004 Bacteria 10343
875 Ga0307414_10060590 3300032004 Bacteria 2677
876 Ga0307414_10065563 3300032004 Bacteria 2591
877 Ga0307414_10147156 3300032004 Bacteria 1853
878 Ga0307414_10218872 3300032004 Bacteria 1562
879 Ga0307414_10221519 3300032004 Bacteria 1554
880 Ga0307414_10350709 3300032004 Bacteria 1266
881 Ga0307411_10000009 3300032005 Bacteria 319906
882 Ga0307411_10001493 3300032005 Bacteria 9615
883 Ga0307411_10126858 3300032005 Bacteria 1857
884 Ga0307510_10025153 3300033180 Bacteria 6872
885 Ga0307510_10029575 3300033180 Bacteria 6232
886 Ga0307510_10169732 3300033180 Bacteria 1762
887 Ga0373944_0005008 3300035089 Bacteria 3476
888 Ga0316574_0088972 3300035398 Bacteria 1967
889 Ga0316574_0091118 3300035398 Bacteria 1944
890 Ga0373924_0009514 3300035410 Bacteria 3563
891 Ga0373935_0027853 3300035692 Bacteria 3492
892 Ga0373935_0370730 3300035692 Bacteria 1024
893 Ga0373933_0035984 3300035724 Bacteria 2895
894 Ga0373947_0176925 3300035725 Bacteria 1387
895 Ga0373937_0003368 3300036401 Bacteria 13412
896 Ga0373937_0383647 3300036401 Bacteria 1333
897 Ga0316584_0039146 3300036712 Bacteria 3529
898 Ga0316584_0048099 3300036712 Bacteria 3187
899 Ga0395899_0006956 3300037312 Bacteria 8763
900 Ga0395899_0055275 3300037312 Bacteria 2936
901 Ga0395899_0075737 3300037312 Bacteria 2457
902 Ga0395900_0013108 3300037418 Bacteria 8470
903 Ga0395900_0029924 3300037418 Bacteria 5588
904 Ga0395900_0035803 3300037418 Bacteria 5114
905 Ga0395900_0127665 3300037418 Bacteria 2607
906 Ga0395900_0159490 3300037418 Bacteria 2301
907 Ga0395898_0000730 3300037466 Bacteria 57720
908 Ga0395898_0006355 3300037466 Bacteria 12622
909 Ga0395898_0171115 3300037466 Bacteria 2076
910 Ga0395898_0193706 3300037466 Bacteria 1942
911 Ga0395905_0000003 3300037471 Bacteria 1347396
912 Ga0395905_0000036 3300037471 Bacteria 271733
913 Ga0395905_0003378 3300037471 Bacteria 17099
914 Ga0395905_0005771 3300037471 Bacteria 12581
915 Ga0395905_0053102 3300037471 Bacteria 3794
916 Ga0395905_0154810 3300037471 Bacteria 2156
917 Ga0395901_0000569 3300038443 Bacteria 42892
918 Ga0395901_0001437 3300038443 Bacteria 24852
919 Ga0395901_0001794 3300038443 Bacteria 22140
920 Ga0395901_0035901 3300038443 Bacteria 5122
921 Ga0400489_79071 3300039093 Bacteria 4944
922 Ga0436365_1649030 3300039437 Bacteria 15570
923 Ga0439436_0001482 3300041404 Bacteria 6824
924 Ga0439439_0021835 3300041406 Bacteria 1596
925 Ga0439447_000076 3300041407 Bacteria 34578
926 Ga0439453_0004402 3300041408 Bacteria 2092
927 Ga0439466_0000376 3300041411 Bacteria 17157
928 Ga0451791_1005165 3300041451 Bacteria 1216
929 Ga0451795_0365639 3300041456 Bacteria 1351
930 Ga0451795_0485588 3300041456 Bacteria 2049
931 Ga0451795_1249919 3300041456 Bacteria 1685
932 Ga0451800_0672505 3300041459 Bacteria 1802
933 Ga0451852_12994 3300041508 Bacteria 1410
934 Ga0451855_1934694 3300041511 Bacteria 1247
935 Ga0439433_0032934 3300041999 Bacteria 1190
936 Ga0439441_018202 3300042001 Bacteria 1268
937 Ga0439443_002579 3300042003 Bacteria 2181
938 Ga0439449_0017757 3300042007 Bacteria 2671
939 Ga0439449_0067611 3300042007 Bacteria 1317
940 Ga0439450_011448 3300042008 Bacteria 1739
941 Ga0439457_000013 3300042014 Bacteria 36480
942 Ga0439462_0004681 3300042015 Bacteria 3347
943 Ga0439444_0003596 3300042437 Bacteria 2199
944 Ga0439459_0019160 3300042438 Bacteria 1294
945 Ga0439460_0058277 3300042461 Bacteria 1173
946 Ga0451577_0000034 3300042876 Bacteria 376183
947 Ga0451577_0000140 3300042876 Bacteria 161646
948 Ga0451577_0001044 3300042876 Bacteria 40023
949 Ga0451577_0001305 3300042876 Bacteria 34245
950 Ga0451577_0009882 3300042876 Bacteria 9144
951 Ga0451577_0018956 3300042876 Bacteria 6335
952 Ga0451577_0018999 3300042876 Bacteria 6326
953 Ga0451577_0040420 3300042876 Bacteria 4187
954 Ga0451577_0070537 3300042876 Bacteria 3116
955 Ga0451577_0097332 3300042876 Bacteria 2628
956 Ga0451577_0133524 3300042876 Bacteria 2228
957 Ga0451577_0140156 3300042876 Bacteria 2172
958 Ga0451577_0146029 3300042876 Bacteria 2127
959 Ga0451577_0158740 3300042876 Bacteria 2036
960 Ga0451577_0241033 3300042876 Bacteria 1636
961 Ga0451577_0274717 3300042876 Bacteria 1526
962 Ga0451577_0334674 3300042876 Bacteria 1373
963 Ga0451577_0412692 3300042876 Bacteria 1226
964 Ga0451577_0467264 3300042876 Bacteria 1146
965 Ga0451577_0607562 3300042876 Bacteria 992
966 Ga0466969_0002364 3300044656 Bacteria 10083
967 Ga0466972_0000026 3300044658 Bacteria 184739
968 Ga0466972_0000471 3300044658 Bacteria 20416
969 Ga0466972_0006739 3300044658 Bacteria 5766
970 Ga0453683_0000005 3300044673 Bacteria 741657
971 Ga0453683_0000115 3300044673 Bacteria 118577
972 Ga0453683_0000560 3300044673 Bacteria 41264
973 Ga0453683_0000995 3300044673 Bacteria 26734
974 Ga0453683_0006835 3300044673 Bacteria 7789
975 Ga0453683_0030564 3300044673 Bacteria 3404
976 Ga0453683_0048750 3300044673 Bacteria 2656
977 Ga0453683_0127577 3300044673 Bacteria 1602
978 Ga0453683_0138086 3300044673 Bacteria 1537
979 Ga0453683_0147775 3300044673 Bacteria 1484
980 Ga0453683_0203427 3300044673 Bacteria 1257
981 Ga0466965_0174942 3300044683 Bacteria 1131
982 Ga0453684_0000017 3300044712 Bacteria 925696
983 Ga0453684_0000084 3300044712 Bacteria 398306
984 Ga0453684_0000098 3300044712 Bacteria 376183
985 Ga0453684_0000329 3300044712 Bacteria 198284
986 Ga0453684_0000584 3300044712 Bacteria 135892
987 Ga0453684_0000610 3300044712 Bacteria 131386
988 Ga0453684_0000628 3300044712 Bacteria 128416
989 Ga0453684_0001359 3300044712 Bacteria 71348
990 Ga0453684_0002551 3300044712 Bacteria 43788
991 Ga0453684_0005682 3300044712 Bacteria 24460
992 Ga0453684_0015588 3300044712 Bacteria 11996
993 Ga0453684_0017875 3300044712 Bacteria 10942
994 Ga0453684_0021522 3300044712 Bacteria 9628
995 Ga0453684_0021837 3300044712 Bacteria 9533
996 Ga0453684_0022085 3300044712 Bacteria 9465
997 Ga0453684_0026821 3300044712 Bacteria 8301
998 Ga0453684_0031467 3300044712 Bacteria 7456
999 Ga0453684_0035088 3300044712 Bacteria 6942
1000 Ga0453684_0042093 3300044712 Bacteria 6163
1001 Ga0453684_0048656 3300044712 Bacteria 5600
1002 Ga0453684_0057161 3300044712 Bacteria 5053
1003 Ga0453684_0077947 3300044712 Bacteria 4149
1004 Ga0453684_0078536 3300044712 Bacteria 4130
1005 Ga0453684_0090488 3300044712 Bacteria 3781
1006 Ga0453684_0093855 3300044712 Bacteria 3694
1007 Ga0453684_0123075 3300044712 Bacteria 3128
1008 Ga0453684_0128687 3300044712 Bacteria 3042
1009 Ga0453684_0192531 3300044712 Bacteria 2385
1010 Ga0453684_0284721 3300044712 Bacteria 1884
1011 Ga0453684_0411409 3300044712 Bacteria 1512
1012 Ga0453684_0663332 3300044712 Bacteria 1137
1013 Ga0466971_0008865 3300044719 Bacteria 4393
1014 Ga0466970_0000091 3300044765 Bacteria 38259
1015 Ga0466970_0049786 3300044765 Bacteria 2234
1016 Ga0466970_0094930 3300044765 Bacteria 1621
1017 Ga0466957_0004387 3300044842 Bacteria 7848
1018 Ga0466959_0000004 3300045049 Bacteria 216815
1019 Ga0466959_0006661 3300045049 Bacteria 8028
1020 Ga0466959_0034588 3300045049 Bacteria 3738
1021 Ga0466959_0035958 3300045049 Bacteria 3660
1022 Ga0451576_0000036 3300045051 Bacteria 376183
1023 Ga0451576_0000071 3300045051 Bacteria 258795
1024 Ga0451576_0000176 3300045051 Bacteria 161951
1025 Ga0451576_0000193 3300045051 Bacteria 154108
1026 Ga0451576_0000308 3300045051 Bacteria 118556
1027 Ga0451576_0003790 3300045051 Bacteria 20383
1028 Ga0451576_0004582 3300045051 Bacteria 17858
1029 Ga0451576_0011467 3300045051 Bacteria 10063
1030 Ga0451576_0026264 3300045051 Bacteria 6265
1031 Ga0451576_0091156 3300045051 Bacteria 3170
1032 Ga0451576_0192236 3300045051 Bacteria 2132
1033 Ga0451576_0274564 3300045051 Bacteria 1762
1034 Ga0451576_0333010 3300045051 Bacteria 1589
1035 Ga0466958_0165632 3300045836 Bacteria 1398
1036 Ga0495627_002350 3300046453 Bacteria 9246
1037 Ga0495592_0029031 3300046454 Bacteria 4188
1038 Ga0495638_0115984 3300046460 Bacteria 1587
1039 Ga0495638_0118890 3300046460 Bacteria 1563
1040 Ga0495653_0206268 3300046463 Bacteria 1330
1041 Ga0495650_0006702 3300046471 Bacteria 7132
1042 Ga0495607_0013843 3300046501 Bacteria 5270
1043 Ga0495606_0003717 3300046507 Bacteria 15923
1044 Ga0495606_0004080 3300046507 Bacteria 14847
1045 Ga0495606_0031602 3300046507 Bacteria 3678
1046 Ga0495616_0003146 3300046513 Bacteria 10663
1047 Ga0495618_0029809 3300046514 Bacteria 3405
1048 Ga0495630_0000066 3300046517 Bacteria 85075
1049 Ga0495630_0006610 3300046517 Bacteria 8262
1050 Ga0495643_0001139 3300046522 Bacteria 26102
1051 Ga0495648_0007376 3300046524 Bacteria 8810
1052 Ga0495586_0000003 3300046535 Bacteria 192041
1053 Ga0495598_0060582 3300046537 Bacteria 1166
1054 Ga0495609_0038725 3300046538 Bacteria 2148
1055 Ga0495645_0043567 3300046543 Bacteria 3274
1056 Ga0495645_0308771 3300046543 Bacteria 1031
1057 Ga0495622_0024791 3300046557 Bacteria 2801
1058 Ga0495633_0083646 3300046558 Bacteria 1485
1059 Ga0495668_0000106 3300046616 Bacteria 133476
1060 Ga0495668_0000299 3300046616 Bacteria 68197
1061 Ga0495668_0002015 3300046616 Bacteria 17737
1062 Ga0495634_0013547 3300046642 Bacteria 5889
1063 Ga0495634_0025938 3300046642 Bacteria 4094
1064 Ga0495625_0075767 3300046660 Bacteria 2353
1065 Ga0495657_0134461 3300046675 Bacteria 1546
1066 Ga0495658_0052923 3300046683 Bacteria 2304
1067 Ga0495658_0130743 3300046683 Bacteria 1528
1068 Ga0495671_0057653 3300046692 Bacteria 1922
1069 Ga0495649_0046664 3300046694 Bacteria 2359
1070 Ga0495660_0009088 3300046810 Bacteria 5803
1071 Ga0495604_0125872 3300047317 Bacteria 1848
1072 Ga0495674_0000476 3300047319 Bacteria 36485
1073 Ga0495674_0089702 3300047319 Bacteria 2628
1074 Ga0495672_0017324 3300047320 Bacteria 4822
1075 Ga0495672_0024503 3300047320 Bacteria 3885
1076 Ga0495672_0037705 3300047320 Bacteria 2955
1077 Ga0495676_0001328 3300047321 Bacteria 21204
1078 Ga0495687_000179 3300047443 Bacteria 92387
1079 Ga0495677_0095136 3300047445 Bacteria 1125
1080 Ga0495686_0000010 3300047472 Bacteria 573229
1081 Ga0496101_0055826 3300048904 Bacteria 2854
1082 Ga0496104_0072021 3300048907 Bacteria 3286
1083 Ga0496104_0394401 3300048907 Bacteria 1296
1084 Ga0496105_0061498 3300048908 Bacteria 3099
1085 Ga0496108_0091440 3300048911 Bacteria 2587
1086 Ga0496108_0235127 3300048911 Bacteria 1594
1087 Ga0496109_0056133 3300048912 Bacteria 3594
1088 Ga0496110_0105881 3300048913 Bacteria 2523
1089 Ga0496114_0000603 3300048917 Bacteria 26557
1090 Ga0496115_0010466 3300048918 Bacteria 6931
1091 Ga0496116_0000075 3300048919 Bacteria 231674
1092 Ga0496117_0026473 3300048920 Bacteria 4538
1093 Ga0496118_0051455 3300048921 Bacteria 3151
1094 Ga0496121_0005501 3300048924 Bacteria 16211
1095 Ga0496121_0147110 3300048924 Bacteria 1739
1096 Ga0496124_0004397 3300048927 Bacteria 16453
1097 Ga0496124_0289314 3300048927 Bacteria 1190
1098 Ga0496125_0000024 3300048928 Bacteria 442149
1099 Ga0496125_0000070 3300048928 Bacteria 245793
1100 Ga0501320_000581 3300049536 Bacteria 2229
1101 Ga0501031_0037836 3300049568 Bacteria 3149
1102 Ga0501032_0000795 3300049569 Bacteria 25595
1103 Ga0501032_0010382 3300049569 Bacteria 6715
1104 Ga0501032_0021796 3300049569 Bacteria 4450
1105 Ga0501032_0097646 3300049569 Bacteria 1947
1106 Ga0501033_0000030 3300049570 Bacteria 157953
1107 Ga0501033_0008155 3300049570 Bacteria 8112
1108 Ga0501034_0000002 3300049571 Bacteria 565510
1109 Ga0501034_0000167 3300049571 Bacteria 122702
1110 Ga0501034_0014290 3300049571 Bacteria 8182
1111 Ga0501034_0026580 3300049571 Bacteria 5893
1112 Ga0501034_0106302 3300049571 Bacteria 2799
1113 Ga0501036_0001927 3300049572 Bacteria 16105
1114 Ga0501036_0008362 3300049572 Bacteria 8478
1115 Ga0501036_0030967 3300049572 Bacteria 4520
1116 Ga0501036_0096748 3300049572 Bacteria 2496
1117 Ga0501037_0004005 3300049573 Bacteria 10681
1118 Ga0501037_0012007 3300049573 Bacteria 6381
1119 Ga0501038_0002429 3300049574 Bacteria 17349
1120 Ga0501038_0006084 3300049574 Bacteria 11165
1121 Ga0501038_0128908 3300049574 Bacteria 2079
1122 Ga0501039_0051479 3300049575 Bacteria 3186
1123 Ga0501039_0057772 3300049575 Bacteria 3004
1124 Ga0501040_0135930 3300049576 Bacteria 1731
1125 Ga0501042_0019710 3300049578 Bacteria 4688
1126 Ga0501043_0009779 3300049579 Bacteria 7516
1127 Ga0501043_0019201 3300049579 Bacteria 5366
1128 Ga0501043_0027203 3300049579 Bacteria 4490
1129 Ga0501043_0042137 3300049579 Bacteria 3586
1130 Ga0501043_0124142 3300049579 Bacteria 2024
1131 Ga0501046_0023842 3300049580 Bacteria 5027
1132 Ga0501046_0075934 3300049580 Bacteria 2604
1133 Ga0501046_0093160 3300049580 Bacteria 2316
1134 Ga0501047_0005502 3300049581 Bacteria 11919
1135 Ga0501047_0069130 3300049581 Bacteria 3401
1136 Ga0501047_0114739 3300049581 Bacteria 2576
1137 Ga0501047_0177709 3300049581 Bacteria 1996
1138 Ga0501047_0218223 3300049581 Bacteria 1764
1139 Ga0501047_0218812 3300049581 Bacteria 1761
1140 Ga0501047_0356750 3300049581 Bacteria 1298
1141 Ga0501048_0016832 3300049582 Bacteria 5389
1142 Ga0501048_0121443 3300049582 Bacteria 1846
1143 Ga0501070_0070322 3300049586 Bacteria 2898
1144 Ga0501070_0074086 3300049586 Bacteria 2818
1145 Ga0501073_0034877 3300049589 Bacteria 3578
1146 Ga0501073_0137696 3300049589 Bacteria 1692
1147 Ga0501074_0023422 3300049590 Bacteria 4488
1148 Ga0501077_0037806 3300049593 Bacteria 3074
1149 Ga0501198_000420 3300049649 Bacteria 5231
1150 Ga0501201_000689 3300049651 Bacteria 3176
1151 Ga0501202_010872 3300049652 Bacteria 1696
1152 Ga0501207_000266 3300049654 Bacteria 5438
1153 Ga0501217_000569 3300049661 Bacteria 6207
1154 Ga0501222_002014 3300049662 Bacteria 2814
1155 Ga0501224_000940 3300049664 Bacteria 3755
1156 Ga0501224_009232 3300049664 Bacteria 1441
1157 Ga0501238_000050 3300049671 Bacteria 19623
1158 Ga0501239_005337 3300049672 Bacteria 1293
1159 Ga0501242_000064 3300049674 Bacteria 6749
1160 Ga0501243_018799 3300049675 Bacteria 1129
1161 Ga0501249_000007 3300049679 Bacteria 198318
1162 Ga0501253_000221 3300049683 Bacteria 4352
1163 Ga0501257_007185 3300049686 Bacteria 2485
1164 Ga0501261_001209 3300049690 Bacteria 3172
1165 Ga0501219_000112 3300049703 Bacteria 14228
1166 Ga0501221_000520 3300049704 Bacteria 6098
1167 Ga0501225_0002455 3300049705 Bacteria 5733
1168 Ga0501079_0046308 3300049741 Bacteria 3356
1169 Ga0501079_0069485 3300049741 Bacteria 2719
1170 Ga0501080_0040303 3300049742 Bacteria 4356
1171 Ga0501080_0170296 3300049742 Bacteria 2009
1172 Ga0501083_0002148 3300049744 Bacteria 13525
1173 Ga0501083_0221745 3300049744 Bacteria 1232
1174 Ga0501083_0233582 3300049744 Bacteria 1198
1175 Ga0501241_001813 3300049758 Bacteria 4213
1176 Ga0501263_000743 3300049760 Bacteria 2708
1177 Ga0501266_000018 3300049763 Bacteria 135236
1178 Ga0501266_002260 3300049763 Bacteria 2436
1179 Ga0501268_011598 3300049765 Bacteria 1394
1180 Ga0501269_003981 3300049766 Bacteria 1781
1181 Ga0501269_006101 3300049766 Bacteria 1451
1182 Ga0501270_002434 3300049767 Bacteria 1906
1183 Ga0501279_011631 3300049775 Bacteria 1192
1184 Ga0501280_000720 3300049776 Bacteria 7316
1185 Ga0501035_0003538 3300049822 Bacteria 14921
1186 Ga0501035_0019245 3300049822 Bacteria 6285
1187 Ga0501035_0035021 3300049822 Bacteria 4561
1188 Ga0501035_0048276 3300049822 Bacteria 3818
1189 Ga0501035_0185817 3300049822 Bacteria 1789
1190 Ga0501044_0000920 3300049823 Bacteria 35464
1191 Ga0501044_0002447 3300049823 Bacteria 21166
1192 Ga0501044_0012419 3300049823 Bacteria 9222
1193 Ga0501044_0015185 3300049823 Bacteria 8295
1194 Ga0501044_0025867 3300049823 Bacteria 6221
1195 Ga0501044_0026695 3300049823 Bacteria 6112
1196 Ga0501044_0062056 3300049823 Bacteria 3821
1197 Ga0501044_0110327 3300049823 Bacteria 2760
1198 Ga0501044_0182437 3300049823 Bacteria 2065
1199 Ga0501045_0000007 3300049824 Bacteria 79663
1200 Ga0501284_00086 3300050005 Bacteria 22701
1201 nmdc:mga00v17_273531_c1 3300050491 Bacteria 1096
1202 nmdc:mga0k408_11364_c1 3300050493 Bacteria 4847
1203 nmdc:mga0k408_1154_c1 3300050493 Bacteria 14441
1204 nmdc:mga0k408_68091_c1 3300050493 Bacteria 2076
1205 nmdc:mga0k408_76346_c1 3300050493 Bacteria 1958
1206 nmdc:mga07m45_156447_c1 3300050496 Bacteria 1322
1207 nmdc:mga05p37_148025_c1 3300050507 Bacteria 2874
1208 nmdc:mga05p37_154463_c1 3300050507 Bacteria 2805
1209 nmdc:mga0qj67_169331_c1 3300050509 Bacteria 1774
1210 nmdc:mga06r32_185910_c1 3300050510 Bacteria 2065
1211 nmdc:mga08y16_410147_c1 3300050511 Bacteria 1386
1212 nmdc:mga08y16_5833_c1 3300050511 Bacteria 12904
1213 nmdc:mga0a205_407540_c1 3300050515 Bacteria 1223
1214 Ga0495619_0023650 3300053085 Bacteria 3941
1215 Ga0500578_0000010 3300053086 Bacteria 217642
1216 Ga0500646_0002338 3300053090 Bacteria 4931
1217 Ga0500646_0007928 3300053090 Bacteria 2715
1218 Ga0500646_0049256 3300053090 Bacteria 1211
1219 Ga0500583_0000064 3300053092 Bacteria 66001
1220 Ga0500583_0002019 3300053092 Bacteria 5986
1221 Ga0500641_0000012 3300053096 Bacteria 164908
1222 Ga0500641_0000164 3300053096 Bacteria 24825
1223 Ga0500641_0000290 3300053096 Bacteria 18730
1224 Ga0500641_0020817 3300053096 Bacteria 2493
1225 Ga0500650_0048891 3300053098 Bacteria 1962
1226 Ga0500562_000186 3300053108 Bacteria 16804
1227 Ga0500572_007918 3300053111 Bacteria 2471
1228 Ga0500594_0015182 3300053118 Bacteria 1855
1229 Ga0500642_0002743 3300053130 Bacteria 5215
1230 Ga0500642_0086701 3300053130 Bacteria 1444
1231 Ga0500658_0000005 3300053134 Bacteria 369268
1232 Ga0500568_0002456 3300053139 Bacteria 10896
1233 Ga0500568_0017009 3300053139 Bacteria 3219
1234 Ga0500616_0003610 3300053153 Bacteria 11664
1235 Ga0500616_0006133 3300053153 Bacteria 7954
1236 Ga0500622_0000298 3300053156 Bacteria 50798
1237 Ga0500622_0008909 3300053156 Bacteria 5583
1238 Ga0500622_0009287 3300053156 Bacteria 5451
1239 Ga0500627_0010324 3300053158 Bacteria 3401
1240 Ga0500636_0133910 3300053177 Bacteria 1378
1241 Ga0500637_0014137 3300053178 Bacteria 4202
1242 Ga0500611_000039 3300053727 Bacteria 68825
1243 Ga0500645_004146 3300053730 Bacteria 5648
1244 Ga0501084_0044804 3300054114 Bacteria 3703
1245 Ga0501082_0242325 3300060353 Bacteria 1569

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0027853 Ga0373935_0027853_513_1346 272
2 3300028800 Ga0265338_10192279 Ga0265338_101922792 297
3 3300044712 Ga0453684_0411409 Ga0453684_0411409_42_953 300
4 3300047445 Ga0495677_0095136 Ga0495677_0095136_25_945 304
5 3300026088 Ga0207641_10002871 Ga0207641_1000287113 305
6 3300041411 Ga0439466_0000376 Ga0439466_0000376_16164_17084 306
7 3300041451 Ga0451791_1005165 Ga0451791_1005165_284_1204 306
8 3300042876 Ga0451577_0607562 Ga0451577_0607562_31_951 306
9 3300044673 Ga0453683_0138086 Ga0453683_0138086_580_1500 306
10 3300053090 Ga0500646_0002338 Ga0500646_0002338_11_931 306
11 3300013308 Ga0157375_10155615 Ga0157375_101556152 307
12 3300005842 Ga0068858_100173246 Ga0068858_1001732461 308
13 3300026035 Ga0207703_10191738 Ga0207703_101917382 308
14 3300049581 Ga0501047_0356750 Ga0501047_0356750_346_1275 308
15 3300044712 Ga0453684_0663332 Ga0453684_0663332_196_1125 309
16 3300050491 nmdc:mga00v17_273531_c1 nmdc:mga00v17_273531_c1_34_1026 310
17 3300001990 JGI24737J22298_10012334 JGI24737J22298_100123342 311
18 3300002067 JGI24735J21928_10011812 JGI24735J21928_100118122 311
19 3300005577 Ga0068857_100207082 Ga0068857_1002070822 311
20 3300013100 Ga0157373_10003811 Ga0157373_100038118 311
21 3300013102 Ga0157371_10000315 Ga0157371_1000031526 311
22 3300013104 Ga0157370_10036810 Ga0157370_100368102 311
23 3300013307 Ga0157372_10000186 Ga0157372_1000018624 311
24 3300025261 Ga0209233_1000560 Ga0209233_100056012 311
25 3300025904 Ga0207647_10000030 Ga0207647_1000003056 311
26 3300026116 Ga0207674_10034398 Ga0207674_100343983 311
27 3300044712 Ga0453684_0000017 Ga0453684_0000017_183391_184332 312
28 3300005614 Ga0068856_100000359 Ga0068856_10000035914 313
29 3300026078 Ga0207702_10000161 Ga0207702_1000016114 313
30 3300031249 Ga0265339_10003340 Ga0265339_100033401 313
31 3300031250 Ga0265331_10007167 Ga0265331_100071678 313
32 3300031711 Ga0265314_10000927 Ga0265314_1000092711 313
33 3300031712 Ga0265342_10024148 Ga0265342_100241481 313
34 3300035692 Ga0373935_0370730 Ga0373935_0370730_38_982 313
35 3300032004 Ga0307414_10218872 Ga0307414_102188722 314
36 3300001989 JGI24739J22299_10002669 JGI24739J22299_100026695 315
37 3300003316 rootH1_10040738 rootH1_1004073811 315
38 3300005327 Ga0070658_10279037 Ga0070658_102790371 315
39 3300005334 Ga0068869_100000104 Ga0068869_10000010436 315
40 3300005338 Ga0068868_100014374 Ga0068868_1000143746 315
41 3300005436 Ga0070713_100014440 Ga0070713_1000144402 315
42 3300005459 Ga0068867_100018208 Ga0068867_1000182084 315
43 3300005563 Ga0068855_100021724 Ga0068855_1000217245 315
44 3300005841 Ga0068863_100611825 Ga0068863_1006118251 315
45 3300013102 Ga0157371_10071339 Ga0157371_100713392 315
46 3300013105 Ga0157369_10370215 Ga0157369_103702151 315
47 3300025904 Ga0207647_10016353 Ga0207647_100163534 315
48 3300025909 Ga0207705_10225077 Ga0207705_102250771 315
49 3300025938 Ga0207704_10003680 Ga0207704_100036805 315
50 3300025942 Ga0207689_10000429 Ga0207689_100004295 315
51 3300026023 Ga0207677_10012632 Ga0207677_100126322 315
52 3300026089 Ga0207648_10026067 Ga0207648_100260674 315
53 3300028556 Ga0265337_1007802 Ga0265337_10078022 315
54 3300028556 Ga0265337_1008483 Ga0265337_10084834 315
55 3300028558 Ga0265326_10024092 Ga0265326_100240922 315
56 3300028563 Ga0265319_1010676 Ga0265319_10106764 315
57 3300028563 Ga0265319_1028498 Ga0265319_10284982 315
58 3300028563 Ga0265319_1032714 Ga0265319_10327142 315
59 3300028573 Ga0265334_10006076 Ga0265334_100060763 315
60 3300028573 Ga0265334_10034622 Ga0265334_100346222 315
61 3300028577 Ga0265318_10002327 Ga0265318_100023278 315
62 3300028577 Ga0265318_10006315 Ga0265318_100063154 315
63 3300028577 Ga0265318_10008905 Ga0265318_100089054 315
64 3300028577 Ga0265318_10013950 Ga0265318_100139503 315
65 3300028653 Ga0265323_10008708 Ga0265323_100087083 315
66 3300028654 Ga0265322_10001690 Ga0265322_100016905 315
67 3300028654 Ga0265322_10034446 Ga0265322_100344462 315
68 3300028666 Ga0265336_10003826 Ga0265336_100038265 315
69 3300028800 Ga0265338_10000326 Ga0265338_1000032663 315
70 3300028800 Ga0265338_10008155 Ga0265338_100081554 315
71 3300028800 Ga0265338_10030098 Ga0265338_100300985 315
72 3300029957 Ga0265324_10002404 Ga0265324_100024044 315
73 3300029957 Ga0265324_10010850 Ga0265324_100108503 315
74 3300031238 Ga0265332_10082532 Ga0265332_100825322 315
75 3300031240 Ga0265320_10005380 Ga0265320_100053805 315
76 3300031240 Ga0265320_10012722 Ga0265320_100127224 315
77 3300031240 Ga0265320_10016058 Ga0265320_100160583 315
78 3300031247 Ga0265340_10020560 Ga0265340_100205604 315
79 3300031249 Ga0265339_10066381 Ga0265339_100663812 315
80 3300031251 Ga0265327_10004692 Ga0265327_100046923 315
81 3300031251 Ga0265327_10027539 Ga0265327_100275393 315
82 3300031344 Ga0265316_10009084 Ga0265316_100090843 315
83 3300031344 Ga0265316_10011402 Ga0265316_100114023 315
84 3300031344 Ga0265316_10013233 Ga0265316_100132335 315
85 3300031344 Ga0265316_10056308 Ga0265316_100563082 315
86 3300031548 Ga0307408_100000113 Ga0307408_10000011331 315
87 3300031595 Ga0265313_10023146 Ga0265313_100231462 315
88 3300031711 Ga0265314_10011071 Ga0265314_100110714 315
89 3300031711 Ga0265314_10050595 Ga0265314_100505952 315
90 3300031711 Ga0265314_10078045 Ga0265314_100780452 315
91 3300031711 Ga0265314_10096756 Ga0265314_100967562 315
92 3300031712 Ga0265342_10010093 Ga0265342_100100934 315
93 3300031712 Ga0265342_10088852 Ga0265342_100888522 315
94 3300031852 Ga0307410_10000010 Ga0307410_1000001015 315
95 3300031903 Ga0307407_10001090 Ga0307407_100010907 315
96 3300031903 Ga0307407_10041385 Ga0307407_100413853 315
97 3300031995 Ga0307409_100000003 Ga0307409_10000000349 315
98 3300032002 Ga0307416_100000022 Ga0307416_100000022134 315
99 3300035724 Ga0373933_0035984 Ga0373933_0035984_1246_2208 315
100 3300037471 Ga0395905_0000036 Ga0395905_0000036_230216_231178 315
101 3300042876 Ga0451577_0467264 Ga0451577_0467264_30_995 315
102 3300046507 Ga0495606_0003717 Ga0495606_0003717_14312_15367 315
103 3300046810 Ga0495660_0009088 Ga0495660_0009088_1669_2724 315
104 3300049569 Ga0501032_0000795 Ga0501032_0000795_449_1420 315
105 3300049570 Ga0501033_0008155 Ga0501033_0008155_449_1420 315
106 3300049572 Ga0501036_0001927 Ga0501036_0001927_13576_14547 315
107 3300049574 Ga0501038_0002429 Ga0501038_0002429_2385_3356 315
108 3300049578 Ga0501042_0019710 Ga0501042_0019710_27_998 315
109 3300049580 Ga0501046_0075934 Ga0501046_0075934_1292_2263 315
110 3300049582 Ga0501048_0016832 Ga0501048_0016832_53_1024 315
111 3300049744 Ga0501083_0002148 Ga0501083_0002148_990_1952 315
112 3300049744 Ga0501083_0233582 Ga0501083_0233582_52_1023 315
113 3300049822 Ga0501035_0003538 Ga0501035_0003538_1404_2375 315
114 3300049823 Ga0501044_0002447 Ga0501044_0002447_9999_10961 315
115 3300049823 Ga0501044_0062056 Ga0501044_0062056_1447_2418 315
116 3300050493 nmdc:mga0k408_1154_c1 nmdc:mga0k408_1154_c1_53_1108 315
117 3300050496 nmdc:mga07m45_156447_c1 nmdc:mga07m45_156447_c1_13_1011 315
118 3300005614 Ga0068856_100068014 Ga0068856_1000680143 316
119 3300013105 Ga0157369_10481140 Ga0157369_104811402 316
120 3300014325 Ga0163163_10107391 Ga0163163_101073912 316
121 3300026078 Ga0207702_10266491 Ga0207702_102664912 316
122 3300028800 Ga0265338_10025784 Ga0265338_100257846 316
123 3300049742 Ga0501080_0040303 Ga0501080_0040303_1852_2841 316
124 3300005288 Ga0065714_10013376 Ga0065714_100133762 317
125 3300005293 Ga0065715_10011830 Ga0065715_100118302 317
126 3300005328 Ga0070676_10133082 Ga0070676_101330821 317
127 3300005330 Ga0070690_100052207 Ga0070690_1000522072 317
128 3300005333 Ga0070677_10008736 Ga0070677_100087364 317
129 3300005335 Ga0070666_10268371 Ga0070666_102683711 317
130 3300005338 Ga0068868_100078092 Ga0068868_1000780922 317
131 3300005343 Ga0070687_100088242 Ga0070687_1000882422 317
132 3300005367 Ga0070667_100322372 Ga0070667_1003223722 317
133 3300005457 Ga0070662_100236398 Ga0070662_1002363981 317
134 3300005466 Ga0070685_10087640 Ga0070685_100876402 317
135 3300005471 Ga0070698_100020705 Ga0070698_1000207051 317
136 3300005842 Ga0068858_100061760 Ga0068858_1000617603 317
137 3300006358 Ga0068871_100150059 Ga0068871_1001500592 317
138 3300006847 Ga0075431_100139576 Ga0075431_1001395761 317
139 3300006852 Ga0075433_10316949 Ga0075433_103169491 317
140 3300009101 Ga0105247_10065819 Ga0105247_100658191 317
141 3300009147 Ga0114129_10190233 Ga0114129_101902332 317
142 3300009148 Ga0105243_10297922 Ga0105243_102979221 317
143 3300009177 Ga0105248_10337932 Ga0105248_103379322 317
144 3300013296 Ga0157374_10287229 Ga0157374_102872292 317
145 3300013297 Ga0157378_10135788 Ga0157378_101357882 317
146 3300025315 Ga0207697_10011822 Ga0207697_100118222 317
147 3300025893 Ga0207682_10005673 Ga0207682_100056734 317
148 3300025905 Ga0207685_10022613 Ga0207685_100226132 317
149 3300025908 Ga0207643_10021434 Ga0207643_100214342 317
150 3300025918 Ga0207662_10057206 Ga0207662_100572061 317
151 3300025923 Ga0207681_10250121 Ga0207681_102501212 317
152 3300025925 Ga0207650_10140007 Ga0207650_101400072 317
153 3300025926 Ga0207659_10245222 Ga0207659_102452222 317
154 3300025931 Ga0207644_10098384 Ga0207644_100983842 317
155 3300025933 Ga0207706_10251690 Ga0207706_102516901 317
156 3300025937 Ga0207669_10133302 Ga0207669_101333022 317
157 3300025942 Ga0207689_10068996 Ga0207689_100689963 317
158 3300026041 Ga0207639_10325864 Ga0207639_103258642 317
159 3300026067 Ga0207678_10302826 Ga0207678_103028262 317
160 3300026075 Ga0207708_10119611 Ga0207708_101196112 317
161 3300026088 Ga0207641_10003795 Ga0207641_1000379513 317
162 3300026089 Ga0207648_10054873 Ga0207648_100548732 317
163 3300026116 Ga0207674_10047532 Ga0207674_100475323 317
164 3300026121 Ga0207683_10054050 Ga0207683_100540503 317
165 3300026142 Ga0207698_10047515 Ga0207698_100475153 317
166 3300028380 Ga0268265_10221873 Ga0268265_102218731 317
167 3300035089 Ga0373944_0005008 Ga0373944_0005008_1939_2898 317
168 3300041408 Ga0439453_0004402 Ga0439453_0004402_704_1663 317
169 3300042001 Ga0439441_018202 Ga0439441_018202_189_1148 317
170 3300042003 Ga0439443_002579 Ga0439443_002579_623_1582 317
171 3300042008 Ga0439450_011448 Ga0439450_011448_272_1231 317
172 3300042437 Ga0439444_0003596 Ga0439444_0003596_704_1663 317
173 3300042438 Ga0439459_0019160 Ga0439459_0019160_301_1260 317
174 3300042461 Ga0439460_0058277 Ga0439460_0058277_77_1036 317
175 3300042876 Ga0451577_0001305 Ga0451577_0001305_22087_23115 317
176 3300045051 Ga0451576_0000071 Ga0451576_0000071_222734_223717 317
177 3300045051 Ga0451576_0003790 Ga0451576_0003790_1552_2535 317
178 3300046537 Ga0495598_0060582 Ga0495598_0060582_89_1048 317
179 3300046558 Ga0495633_0083646 Ga0495633_0083646_199_1158 317
180 3300046683 Ga0495658_0130743 Ga0495658_0130743_235_1194 317
181 3300050507 nmdc:mga05p37_148025_c1 nmdc:mga05p37_148025_c1_1800_2759 317
182 3300050509 nmdc:mga0qj67_169331_c1 nmdc:mga0qj67_169331_c1_585_1544 317
183 3300050510 nmdc:mga06r32_185910_c1 nmdc:mga06r32_185910_c1_602_1561 317
184 3300050511 nmdc:mga08y16_410147_c1 nmdc:mga08y16_410147_c1_54_1013 317
185 3300050515 nmdc:mga0a205_407540_c1 nmdc:mga0a205_407540_c1_74_1033 317
186 3300031251 Ga0265327_10002984 Ga0265327_100029844 318
187 3300044712 Ga0453684_0017875 Ga0453684_0017875_1623_2618 318
188 3300046543 Ga0495645_0043567 Ga0495645_0043567_1941_3017 318
189 3300047317 Ga0495604_0125872 Ga0495604_0125872_10_1086 318
190 3300026089 Ga0207648_10129439 Ga0207648_101294392 319
191 3300026089 Ga0207648_10213349 Ga0207648_102133492 320
192 3300049580 Ga0501046_0093160 Ga0501046_0093160_289_1293 320
193 3300053156 Ga0500622_0008909 Ga0500622_0008909_3860_4870 320
194 3300005548 Ga0070665_100029722 Ga0070665_1000297222 321
195 3300026089 Ga0207648_10437006 Ga0207648_104370061 321
196 3300044712 Ga0453684_0021522 Ga0453684_0021522_1152_2147 321
197 3300005329 Ga0070683_100003049 Ga0070683_10000304911 322
198 3300013104 Ga0157370_10154027 Ga0157370_101540274 322
199 3300013307 Ga0157372_10123056 Ga0157372_101230564 322
200 3300014325 Ga0163163_10000052 Ga0163163_1000005265 322
201 3300046543 Ga0495645_0308771 Ga0495645_0308771_50_1021 322
202 3300049766 Ga0501269_006101 Ga0501269_006101_22_993 322
203 3300005329 Ga0070683_100376996 Ga0070683_1003769961 323
204 3300005330 Ga0070690_100037559 Ga0070690_1000375592 323
205 3300005335 Ga0070666_10025882 Ga0070666_100258824 323
206 3300013308 Ga0157375_10000085 Ga0157375_1000008512 323
207 3300044712 Ga0453684_0002551 Ga0453684_0002551_15184_16239 323
208 3300045051 Ga0451576_0333010 Ga0451576_0333010_329_1378 323
209 3300046517 Ga0495630_0000066 Ga0495630_0000066_4880_5938 323
210 3300046535 Ga0495586_0000003 Ga0495586_0000003_79132_80190 323
211 3300046642 Ga0495634_0025938 Ga0495634_0025938_2735_3793 323
212 3300046683 Ga0495658_0052923 Ga0495658_0052923_612_1670 323
213 3300047319 Ga0495674_0000476 Ga0495674_0000476_10590_11648 323
214 3300047320 Ga0495672_0037705 Ga0495672_0037705_1297_2271 323
215 3300047321 Ga0495676_0001328 Ga0495676_0001328_18149_19207 323
216 3300044712 Ga0453684_0026821 Ga0453684_0026821_3625_4653 324
217 3300045051 Ga0451576_0274564 Ga0451576_0274564_133_1161 324
218 3300013306 Ga0163162_10169264 Ga0163162_101692642 326
219 3300026116 Ga0207674_10346480 Ga0207674_103464802 327
220 3300044712 Ga0453684_0035088 Ga0453684_0035088_3788_4780 327
221 3300048907 Ga0496104_0072021 Ga0496104_0072021_287_1279 327
222 3300048908 Ga0496105_0061498 Ga0496105_0061498_613_1605 327
223 iso_pu_bacteria 2914759650 2914760395 327
224 3300005614 Ga0068856_100012677 Ga0068856_1000126775 328
225 3300013307 Ga0157372_10197628 Ga0157372_101976283 328
226 3300031251 Ga0265327_10007437 Ga0265327_100074372 328
227 3300037471 Ga0395905_0000003 Ga0395905_0000003_645175_646161 328
228 3300038443 Ga0395901_0001437 Ga0395901_0001437_6487_7476 328
229 3300042876 Ga0451577_0146029 Ga0451577_0146029_1091_2077 328
230 3300044712 Ga0453684_0021837 Ga0453684_0021837_2292_3278 328
231 iso_pu_bacteria 2738541278 2738724669 328
232 iso_pu_bacteria 2883068021 2883070247 328
233 3300005435 Ga0070714_100336709 Ga0070714_1003367091 329
234 3300014326 Ga0157380_10000160 Ga0157380_1000016017 329
235 3300041456 Ga0451795_0365639 Ga0451795_0365639_161_1153 330
236 3300041508 Ga0451852_12994 Ga0451852_12994_169_1161 330
237 3300042876 Ga0451577_0334674 Ga0451577_0334674_210_1202 330
238 3300044712 Ga0453684_0048656 Ga0453684_0048656_4033_5025 330
239 iso_pu_bacteria 2513020052 2513234033 330
240 iso_pu_bacteria 2519899754 2520880169 330
241 iso_pu_bacteria 2643221600 2644012802 330
242 iso_pu_bacteria 2643221667 2644371864 330
243 iso_pu_bacteria 2643221716 2644641735 330
244 iso_pu_bacteria 2643221725 2644682151 330
245 iso_pu_bacteria 2738541279 2738735583 330
246 iso_pu_bacteria 2738541285 2738768160 330
247 iso_pu_bacteria 2738543007 2739217165 330
248 iso_pu_bacteria 2739367857 2740003665 330
249 iso_pu_bacteria 2739367858 2740008482 330
250 iso_pu_bacteria 2802428842 2802655107 330
251 iso_pu_bacteria 2816332280 2817413830 330
252 iso_pu_bacteria 2833640130 2833641847 330
253 iso_pu_bacteria 2857613821 2857616436 330
254 iso_pu_bacteria 2857618242 2857622335 330
255 iso_pu_bacteria 2881247448 2881250292 330
256 iso_pu_bacteria 2881359912 2881361124 330
257 iso_pu_bacteria 2903895155 2903899127 330
258 iso_pu_bacteria 2904419702 2904421597 330
259 iso_pu_bacteria 2904555929 2904557436 330
260 iso_pu_bacteria 2919191525 2919194659 330
261 iso_pu_bacteria 2919509842 2919512957 330
262 iso_pu_bacteria 2919683626 2919685224 330
263 iso_pu_bacteria 2929150217 2929150964 330
264 iso_pu_bacteria 2958458903 2958460605 330
265 iso_pu_bacteria 2958512119 2958514277 330
266 iso_pu_bacteria 2965320100 2965322391 330
267 iso_pu_bacteria 2977268062 2977272342 330
268 iso_pu_bacteria 8036736890 8036737069 330
269 iso_pu_bacteria 8054307821 8054307897 330
270 iso_pu_bacteria 8055419101 8055420477 330
271 iso_pu_bacteria 8055592153 8055597137 330
272 iso_pu_bacteria 8056440228 8056440800 330
273 3300003354 JGI25160J50197_1001078 JGI25160J50197_10010786 331
274 3300005327 Ga0070658_10000906 Ga0070658_100009063 331
275 3300005328 Ga0070676_10000064 Ga0070676_100000646 331
276 3300005328 Ga0070676_10257906 Ga0070676_102579061 331
277 3300005331 Ga0070670_100077997 Ga0070670_1000779973 331
278 3300005335 Ga0070666_10001016 Ga0070666_100010163 331
279 3300005336 Ga0070680_100213706 Ga0070680_1002137062 331
280 3300005337 Ga0070682_100021156 Ga0070682_1000211563 331
281 3300005337 Ga0070682_100027407 Ga0070682_1000274074 331
282 3300005338 Ga0068868_100002193 Ga0068868_10000219311 331
283 3300005341 Ga0070691_10009358 Ga0070691_100093583 331
284 3300005347 Ga0070668_100000222 Ga0070668_10000022230 331
285 3300005364 Ga0070673_100000197 Ga0070673_10000019721 331
286 3300005367 Ga0070667_100000240 Ga0070667_10000024037 331
287 3300005457 Ga0070662_100006697 Ga0070662_1000066972 331
288 3300005530 Ga0070679_100080717 Ga0070679_1000807173 331
289 3300005543 Ga0070672_100008792 Ga0070672_1000087928 331
290 3300005544 Ga0070686_100042371 Ga0070686_1000423713 331
291 3300005547 Ga0070693_100005061 Ga0070693_1000050614 331
292 3300005618 Ga0068864_100030070 Ga0068864_1000300702 331
293 3300005834 Ga0068851_10000137 Ga0068851_1000013729 331
294 3300005834 Ga0068851_10001240 Ga0068851_100012407 331
295 3300005841 Ga0068863_100000854 Ga0068863_1000008542 331
296 3300005842 Ga0068858_100000889 Ga0068858_10000088924 331
297 3300005843 Ga0068860_100007968 Ga0068860_10000796811 331
298 3300006237 Ga0097621_100032274 Ga0097621_1000322745 331
299 3300006237 Ga0097621_100077642 Ga0097621_1000776422 331
300 3300006358 Ga0068871_100032807 Ga0068871_1000328072 331
301 3300006881 Ga0068865_100115861 Ga0068865_1001158612 331
302 3300009093 Ga0105240_10004986 Ga0105240_100049864 331
303 3300009174 Ga0105241_10052398 Ga0105241_100523982 331
304 3300009176 Ga0105242_10111905 Ga0105242_101119051 331
305 3300009545 Ga0105237_10096846 Ga0105237_100968462 331
306 3300009553 Ga0105249_10018872 Ga0105249_100188725 331
307 3300010375 Ga0105239_10028606 Ga0105239_100286062 331
308 3300013100 Ga0157373_10024407 Ga0157373_100244072 331
309 3300013105 Ga0157369_10048169 Ga0157369_100481692 331
310 3300013105 Ga0157369_10152272 Ga0157369_101522722 331
311 3300013296 Ga0157374_10000311 Ga0157374_100003112 331
312 3300013296 Ga0157374_10060741 Ga0157374_100607414 331
313 3300013296 Ga0157374_10347096 Ga0157374_103470961 331
314 3300013297 Ga0157378_10008769 Ga0157378_100087698 331
315 3300013297 Ga0157378_10047199 Ga0157378_100471994 331
316 3300013297 Ga0157378_10516307 Ga0157378_105163072 331
317 3300013306 Ga0163162_10006923 Ga0163162_100069237 331
318 3300013306 Ga0163162_10018140 Ga0163162_100181404 331
319 3300013307 Ga0157372_10019592 Ga0157372_100195928 331
320 3300013307 Ga0157372_10024829 Ga0157372_100248293 331
321 3300013308 Ga0157375_10027672 Ga0157375_100276725 331
322 3300014325 Ga0163163_10000369 Ga0163163_100003693 331
323 3300014326 Ga0157380_10286284 Ga0157380_102862841 331
324 3300014968 Ga0157379_10001465 Ga0157379_1000146512 331
325 3300014968 Ga0157379_10019036 Ga0157379_100190364 331
326 3300014969 Ga0157376_10003719 Ga0157376_100037195 331
327 3300014969 Ga0157376_10011465 Ga0157376_100114655 331
328 3300014969 Ga0157376_10025729 Ga0157376_100257294 331
329 3300014969 Ga0157376_10061023 Ga0157376_100610233 331
330 3300014969 Ga0157376_10082645 Ga0157376_100826453 331
331 3300017792 Ga0163161_10051759 Ga0163161_100517593 331
332 3300025302 Ga0207426_1000189 Ga0207426_100018995 331
333 3300025321 Ga0207656_10001419 Ga0207656_100014198 331
334 3300025907 Ga0207645_10001164 Ga0207645_100011644 331
335 3300025911 Ga0207654_10026178 Ga0207654_100261783 331
336 3300025923 Ga0207681_10327104 Ga0207681_103271042 331
337 3300025934 Ga0207686_10155239 Ga0207686_101552392 331
338 3300025936 Ga0207670_10302262 Ga0207670_103022621 331
339 3300025938 Ga0207704_10070318 Ga0207704_100703183 331
340 3300025940 Ga0207691_10000076 Ga0207691_1000007666 331
341 3300025940 Ga0207691_10128227 Ga0207691_101282272 331
342 3300025949 Ga0207667_10055899 Ga0207667_100558994 331
343 3300025960 Ga0207651_10014260 Ga0207651_100142604 331
344 3300026035 Ga0207703_10030625 Ga0207703_100306251 331
345 3300026088 Ga0207641_10009891 Ga0207641_100098916 331
346 3300026089 Ga0207648_10002106 Ga0207648_1000210610 331
347 3300028381 Ga0268264_10073962 Ga0268264_100739623 331
348 3300028800 Ga0265338_10012024 Ga0265338_100120249 331
349 3300028800 Ga0265338_10018508 Ga0265338_100185087 331
350 3300031251 Ga0265327_10000031 Ga0265327_1000003176 331
351 3300031251 Ga0265327_10020300 Ga0265327_100203002 331
352 3300031344 Ga0265316_10118324 Ga0265316_101183242 331
353 3300031548 Ga0307408_100000316 Ga0307408_10000031630 331
354 3300031727 Ga0316576_10008324 Ga0316576_100083246 331
355 3300039093 Ga0400489_79071 Ga0400489_79071_2173_3168 331
356 3300039437 Ga0436365_1649030 Ga0436365_1649030_798_1796 331
357 3300041456 Ga0451795_0485588 Ga0451795_0485588_576_1586 331
358 3300041456 Ga0451795_1249919 Ga0451795_1249919_606_1601 331
359 3300041511 Ga0451855_1934694 Ga0451855_1934694_205_1200 331
360 3300042876 Ga0451577_0000034 Ga0451577_0000034_12596_13591 331
361 3300042876 Ga0451577_0000140 Ga0451577_0000140_75240_76235 331
362 3300042876 Ga0451577_0001044 Ga0451577_0001044_12090_13085 331
363 3300042876 Ga0451577_0009882 Ga0451577_0009882_3382_4377 331
364 3300042876 Ga0451577_0018956 Ga0451577_0018956_5061_6056 331
365 3300042876 Ga0451577_0018999 Ga0451577_0018999_4272_5267 331
366 3300042876 Ga0451577_0040420 Ga0451577_0040420_2275_3273 331
367 3300042876 Ga0451577_0070537 Ga0451577_0070537_1631_2626 331
368 3300042876 Ga0451577_0274717 Ga0451577_0274717_188_1183 331
369 3300044658 Ga0466972_0000026 Ga0466972_0000026_22202_23200 331
370 3300044673 Ga0453683_0000005 Ga0453683_0000005_647169_648164 331
371 3300044673 Ga0453683_0000115 Ga0453683_0000115_12932_13927 331
372 3300044673 Ga0453683_0000560 Ga0453683_0000560_9440_10435 331
373 3300044673 Ga0453683_0000995 Ga0453683_0000995_12596_13591 331
374 3300044673 Ga0453683_0006835 Ga0453683_0006835_6694_7689 331
375 3300044673 Ga0453683_0030564 Ga0453683_0030564_1419_2414 331
376 3300044673 Ga0453683_0048750 Ga0453683_0048750_1334_2329 331
377 3300044673 Ga0453683_0127577 Ga0453683_0127577_563_1561 331
378 3300044673 Ga0453683_0147775 Ga0453683_0147775_263_1258 331
379 3300044673 Ga0453683_0203427 Ga0453683_0203427_29_1024 331
380 3300044712 Ga0453684_0000084 Ga0453684_0000084_49369_50364 331
381 3300044712 Ga0453684_0000098 Ga0453684_0000098_12596_13591 331
382 3300044712 Ga0453684_0000329 Ga0453684_0000329_137875_138870 331
383 3300044712 Ga0453684_0000584 Ga0453684_0000584_115984_116979 331
384 3300044712 Ga0453684_0000610 Ga0453684_0000610_97584_98579 331
385 3300044712 Ga0453684_0000628 Ga0453684_0000628_64913_65908 331
386 3300044712 Ga0453684_0031467 Ga0453684_0031467_5169_6164 331
387 3300044712 Ga0453684_0042093 Ga0453684_0042093_2867_3862 331
388 3300044712 Ga0453684_0057161 Ga0453684_0057161_1369_2364 331
389 3300044712 Ga0453684_0090488 Ga0453684_0090488_1410_2405 331
390 3300044712 Ga0453684_0093855 Ga0453684_0093855_2669_3664 331
391 3300044712 Ga0453684_0123075 Ga0453684_0123075_280_1275 331
392 3300044712 Ga0453684_0128687 Ga0453684_0128687_738_1733 331
393 3300044712 Ga0453684_0284721 Ga0453684_0284721_569_1564 331
394 3300044765 Ga0466970_0000091 Ga0466970_0000091_3944_4942 331
395 3300045051 Ga0451576_0000036 Ga0451576_0000036_362593_363588 331
396 3300045051 Ga0451576_0000176 Ga0451576_0000176_48859_49854 331
397 3300045051 Ga0451576_0000193 Ga0451576_0000193_55526_56521 331
398 3300045051 Ga0451576_0000308 Ga0451576_0000308_12932_13927 331
399 3300045051 Ga0451576_0004582 Ga0451576_0004582_11198_12193 331
400 3300045051 Ga0451576_0026264 Ga0451576_0026264_4539_5534 331
401 3300045051 Ga0451576_0091156 Ga0451576_0091156_2093_3088 331
402 3300045051 Ga0451576_0192236 Ga0451576_0192236_818_1813 331
403 3300048911 Ga0496108_0235127 Ga0496108_0235127_502_1500 331
404 3300048912 Ga0496109_0056133 Ga0496109_0056133_812_1810 331
405 3300049581 Ga0501047_0218812 Ga0501047_0218812_208_1206 331
406 3300049742 Ga0501080_0170296 Ga0501080_0170296_617_1615 331
407 3300049823 Ga0501044_0182437 Ga0501044_0182437_61_1059 331
408 3300053108 Ga0500562_000186 Ga0500562_000186_3281_4279 331
409 3300053118 Ga0500594_0015182 Ga0500594_0015182_258_1256 331
410 3300053156 Ga0500622_0000298 Ga0500622_0000298_24757_25755 331
411 3300053730 Ga0500645_004146 Ga0500645_004146_3076_4074 331
412 3300054114 Ga0501084_0044804 Ga0501084_0044804_247_1245 331
413 iso_pu_bacteria 2928078545 2928081974 331
414 iso_pu_bacteria 2928147474 2928151990 331
415 iso_pu_bacteria 2932082852 2932088173 331
416 3300003322 rootL2_10063794 rootL2_100637943 332
417 3300005288 Ga0065714_10068977 Ga0065714_100689775 332
418 3300005288 Ga0065714_10141826 Ga0065714_101418261 332
419 3300005289 Ga0065704_10142216 Ga0065704_101422162 332
420 3300005290 Ga0065712_10100859 Ga0065712_101008593 332
421 3300005295 Ga0065707_10101795 Ga0065707_101017952 332
422 3300005327 Ga0070658_10077656 Ga0070658_100776563 332
423 3300005327 Ga0070658_10091149 Ga0070658_100911493 332
424 3300005327 Ga0070658_10145683 Ga0070658_101456832 332
425 3300005328 Ga0070676_10022554 Ga0070676_100225542 332
426 3300005328 Ga0070676_10219447 Ga0070676_102194472 332
427 3300005329 Ga0070683_100000508 Ga0070683_10000050814 332
428 3300005329 Ga0070683_100002318 Ga0070683_1000023185 332
429 3300005329 Ga0070683_100144479 Ga0070683_1001444791 332
430 3300005330 Ga0070690_100264321 Ga0070690_1002643212 332
431 3300005331 Ga0070670_100025268 Ga0070670_1000252685 332
432 3300005331 Ga0070670_100065519 Ga0070670_1000655193 332
433 3300005331 Ga0070670_100077419 Ga0070670_1000774193 332
434 3300005331 Ga0070670_100186902 Ga0070670_1001869022 332
435 3300005334 Ga0068869_100000739 Ga0068869_10000073916 332
436 3300005334 Ga0068869_100005945 Ga0068869_1000059454 332
437 3300005334 Ga0068869_100006962 Ga0068869_1000069622 332
438 3300005334 Ga0068869_100015390 Ga0068869_1000153905 332
439 3300005334 Ga0068869_100028613 Ga0068869_1000286133 332
440 3300005334 Ga0068869_100063774 Ga0068869_1000637742 332
441 3300005334 Ga0068869_100154856 Ga0068869_1001548561 332
442 3300005335 Ga0070666_10000301 Ga0070666_1000030114 332
443 3300005335 Ga0070666_10002049 Ga0070666_100020499 332
444 3300005335 Ga0070666_10010552 Ga0070666_100105523 332
445 3300005335 Ga0070666_10040373 Ga0070666_100403732 332
446 3300005336 Ga0070680_100034878 Ga0070680_1000348784 332
447 3300005336 Ga0070680_100088120 Ga0070680_1000881202 332
448 3300005336 Ga0070680_100155729 Ga0070680_1001557292 332
449 3300005337 Ga0070682_100000074 Ga0070682_10000007424 332
450 3300005337 Ga0070682_100014573 Ga0070682_1000145734 332
451 3300005337 Ga0070682_100148302 Ga0070682_1001483022 332
452 3300005338 Ga0068868_100000543 Ga0068868_1000005439 332
453 3300005338 Ga0068868_100032037 Ga0068868_1000320374 332
454 3300005338 Ga0068868_100039410 Ga0068868_1000394103 332
455 3300005338 Ga0068868_100045985 Ga0068868_1000459852 332
456 3300005338 Ga0068868_100315955 Ga0068868_1003159551 332
457 3300005339 Ga0070660_100005097 Ga0070660_1000050979 332
458 3300005339 Ga0070660_100083171 Ga0070660_1000831712 332
459 3300005339 Ga0070660_100090740 Ga0070660_1000907402 332
460 3300005339 Ga0070660_100157444 Ga0070660_1001574442 332
461 3300005339 Ga0070660_100281884 Ga0070660_1002818841 332
462 3300005340 Ga0070689_100004881 Ga0070689_10000488111 332
463 3300005340 Ga0070689_100110811 Ga0070689_1001108111 332
464 3300005340 Ga0070689_100128785 Ga0070689_1001287851 332
465 3300005344 Ga0070661_100000111 Ga0070661_10000011114 332
466 3300005344 Ga0070661_100097191 Ga0070661_1000971912 332
467 3300005344 Ga0070661_100142850 Ga0070661_1001428502 332
468 3300005344 Ga0070661_100250705 Ga0070661_1002507052 332
469 3300005347 Ga0070668_100128855 Ga0070668_1001288552 332
470 3300005347 Ga0070668_100140422 Ga0070668_1001404222 332
471 3300005353 Ga0070669_100002930 Ga0070669_10000293015 332
472 3300005353 Ga0070669_100016100 Ga0070669_1000161002 332
473 3300005353 Ga0070669_100064690 Ga0070669_1000646901 332
474 3300005354 Ga0070675_100001118 Ga0070675_10000111814 332
475 3300005354 Ga0070675_100010008 Ga0070675_1000100082 332
476 3300005354 Ga0070675_100034407 Ga0070675_1000344073 332
477 3300005354 Ga0070675_100085764 Ga0070675_1000857642 332
478 3300005354 Ga0070675_100122321 Ga0070675_1001223212 332
479 3300005354 Ga0070675_100186975 Ga0070675_1001869751 332
480 3300005354 Ga0070675_100237080 Ga0070675_1002370802 332
481 3300005355 Ga0070671_100007427 Ga0070671_1000074279 332
482 3300005355 Ga0070671_100024975 Ga0070671_1000249752 332
483 3300005355 Ga0070671_100048391 Ga0070671_1000483912 332
484 3300005355 Ga0070671_100074648 Ga0070671_1000746483 332
485 3300005355 Ga0070671_100089475 Ga0070671_1000894751 332
486 3300005355 Ga0070671_100108425 Ga0070671_1001084252 332
487 3300005356 Ga0070674_100051746 Ga0070674_1000517462 332
488 3300005364 Ga0070673_100005388 Ga0070673_1000053886 332
489 3300005364 Ga0070673_100019747 Ga0070673_1000197472 332
490 3300005364 Ga0070673_100021118 Ga0070673_1000211183 332
491 3300005364 Ga0070673_100060998 Ga0070673_1000609982 332
492 3300005364 Ga0070673_100082571 Ga0070673_1000825711 332
493 3300005364 Ga0070673_100206850 Ga0070673_1002068502 332
494 3300005365 Ga0070688_100005011 Ga0070688_1000050112 332
495 3300005365 Ga0070688_100012988 Ga0070688_1000129881 332
496 3300005365 Ga0070688_100036218 Ga0070688_1000362183 332
497 3300005366 Ga0070659_100004285 Ga0070659_1000042853 332
498 3300005366 Ga0070659_100065345 Ga0070659_1000653453 332
499 3300005366 Ga0070659_100096635 Ga0070659_1000966353 332
500 3300005367 Ga0070667_100019873 Ga0070667_1000198733 332
501 3300005367 Ga0070667_100030447 Ga0070667_1000304472 332
502 3300005367 Ga0070667_100057178 Ga0070667_1000571783 332
503 3300005367 Ga0070667_100063282 Ga0070667_1000632822 332
504 3300005455 Ga0070663_100051585 Ga0070663_1000515851 332
505 3300005456 Ga0070678_100019833 Ga0070678_1000198332 332
506 3300005456 Ga0070678_100022856 Ga0070678_1000228562 332
507 3300005456 Ga0070678_100036230 Ga0070678_1000362303 332
508 3300005457 Ga0070662_100006827 Ga0070662_1000068278 332
509 3300005457 Ga0070662_100007893 Ga0070662_1000078936 332
510 3300005457 Ga0070662_100044931 Ga0070662_1000449313 332
511 3300005457 Ga0070662_100353485 Ga0070662_1003534851 332
512 3300005458 Ga0070681_10011071 Ga0070681_100110712 332
513 3300005458 Ga0070681_10120439 Ga0070681_101204394 332
514 3300005458 Ga0070681_10222323 Ga0070681_102223231 332
515 3300005458 Ga0070681_10258200 Ga0070681_102582001 332
516 3300005459 Ga0068867_100005824 Ga0068867_1000058249 332
517 3300005459 Ga0068867_100032185 Ga0068867_1000321854 332
518 3300005459 Ga0068867_100066390 Ga0068867_1000663902 332
519 3300005459 Ga0068867_100072092 Ga0068867_1000720922 332
520 3300005466 Ga0070685_10009079 Ga0070685_100090793 332
521 3300005466 Ga0070685_10243947 Ga0070685_102439471 332
522 3300005530 Ga0070679_100001149 Ga0070679_10000114917 332
523 3300005530 Ga0070679_100001610 Ga0070679_10000161013 332
524 3300005530 Ga0070679_100186324 Ga0070679_1001863243 332
525 3300005535 Ga0070684_100001291 Ga0070684_1000012916 332
526 3300005535 Ga0070684_100002976 Ga0070684_1000029762 332
527 3300005535 Ga0070684_100176709 Ga0070684_1001767093 332
528 3300005539 Ga0068853_100002568 Ga0068853_10000256814 332
529 3300005539 Ga0068853_100007168 Ga0068853_1000071685 332
530 3300005539 Ga0068853_100020882 Ga0068853_1000208823 332
531 3300005539 Ga0068853_100023897 Ga0068853_1000238972 332
532 3300005539 Ga0068853_100045383 Ga0068853_1000453835 332
533 3300005539 Ga0068853_100047241 Ga0068853_1000472413 332
534 3300005539 Ga0068853_100279772 Ga0068853_1002797721 332
535 3300005539 Ga0068853_100301319 Ga0068853_1003013191 332
536 3300005539 Ga0068853_100317958 Ga0068853_1003179581 332
537 3300005543 Ga0070672_100030750 Ga0070672_1000307503 332
538 3300005543 Ga0070672_100074830 Ga0070672_1000748303 332
539 3300005543 Ga0070672_100185042 Ga0070672_1001850422 332
540 3300005543 Ga0070672_100393053 Ga0070672_1003930532 332
541 3300005544 Ga0070686_100102289 Ga0070686_1001022891 332
542 3300005547 Ga0070693_100199772 Ga0070693_1001997721 332
543 3300005548 Ga0070665_100000002 Ga0070665_100000002381 332
544 3300005548 Ga0070665_100039274 Ga0070665_1000392743 332
545 3300005563 Ga0068855_100001113 Ga0068855_10000111315 332
546 3300005563 Ga0068855_100002301 Ga0068855_1000023011 332
547 3300005563 Ga0068855_100002404 Ga0068855_1000024043 332
548 3300005563 Ga0068855_100026330 Ga0068855_1000263307 332
549 3300005563 Ga0068855_100292900 Ga0068855_1002929002 332
550 3300005564 Ga0070664_100000243 Ga0070664_10000024310 332
551 3300005564 Ga0070664_100000575 Ga0070664_10000057512 332
552 3300005564 Ga0070664_100034619 Ga0070664_1000346195 332
553 3300005564 Ga0070664_100036167 Ga0070664_1000361674 332
554 3300005564 Ga0070664_100188870 Ga0070664_1001888702 332
555 3300005577 Ga0068857_100006181 Ga0068857_1000061817 332
556 3300005577 Ga0068857_100013599 Ga0068857_1000135997 332
557 3300005577 Ga0068857_100014392 Ga0068857_1000143925 332
558 3300005577 Ga0068857_100105568 Ga0068857_1001055683 332
559 3300005577 Ga0068857_100148179 Ga0068857_1001481792 332
560 3300005577 Ga0068857_100298381 Ga0068857_1002983812 332
561 3300005578 Ga0068854_100061921 Ga0068854_1000619213 332
562 3300005578 Ga0068854_100172689 Ga0068854_1001726892 332
563 3300005614 Ga0068856_100042279 Ga0068856_1000422793 332
564 3300005614 Ga0068856_100112301 Ga0068856_1001123011 332
565 3300005616 Ga0068852_100001462 Ga0068852_10000146213 332
566 3300005616 Ga0068852_100003210 Ga0068852_1000032104 332
567 3300005616 Ga0068852_100006516 Ga0068852_1000065163 332
568 3300005616 Ga0068852_100010126 Ga0068852_1000101263 332
569 3300005616 Ga0068852_100034695 Ga0068852_1000346952 332
570 3300005616 Ga0068852_100038683 Ga0068852_1000386831 332
571 3300005616 Ga0068852_100042066 Ga0068852_1000420662 332
572 3300005616 Ga0068852_100529777 Ga0068852_1005297771 332
573 3300005617 Ga0068859_100000006 Ga0068859_100000006397 332
574 3300005617 Ga0068859_100001697 Ga0068859_1000016979 332
575 3300005617 Ga0068859_100006362 Ga0068859_1000063628 332
576 3300005617 Ga0068859_100006790 Ga0068859_1000067909 332
577 3300005617 Ga0068859_100018396 Ga0068859_1000183964 332
578 3300005617 Ga0068859_100071960 Ga0068859_1000719604 332
579 3300005617 Ga0068859_100074150 Ga0068859_1000741503 332
580 3300005617 Ga0068859_100110149 Ga0068859_1001101492 332
581 3300005617 Ga0068859_100252970 Ga0068859_1002529702 332
582 3300005617 Ga0068859_100452964 Ga0068859_1004529642 332
583 3300005617 Ga0068859_100643383 Ga0068859_1006433831 332
584 3300005618 Ga0068864_100024782 Ga0068864_1000247825 332
585 3300005618 Ga0068864_100030464 Ga0068864_1000304644 332
586 3300005618 Ga0068864_100128372 Ga0068864_1001283722 332
587 3300005618 Ga0068864_100143854 Ga0068864_1001438543 332
588 3300005618 Ga0068864_100213930 Ga0068864_1002139302 332
589 3300005618 Ga0068864_100225054 Ga0068864_1002250542 332
590 3300005718 Ga0068866_10017291 Ga0068866_100172912 332
591 3300005718 Ga0068866_10018860 Ga0068866_100188603 332
592 3300005718 Ga0068866_10030435 Ga0068866_100304353 332
593 3300005718 Ga0068866_10042762 Ga0068866_100427622 332
594 3300005719 Ga0068861_100002834 Ga0068861_1000028346 332
595 3300005719 Ga0068861_100007576 Ga0068861_1000075764 332
596 3300005719 Ga0068861_100078437 Ga0068861_1000784373 332
597 3300005719 Ga0068861_100099208 Ga0068861_1000992083 332
598 3300005719 Ga0068861_100118877 Ga0068861_1001188772 332
599 3300005841 Ga0068863_100023628 Ga0068863_1000236282 332
600 3300005841 Ga0068863_100029070 Ga0068863_1000290705 332
601 3300005841 Ga0068863_100043860 Ga0068863_1000438603 332
602 3300005841 Ga0068863_100243721 Ga0068863_1002437212 332
603 3300005841 Ga0068863_100397149 Ga0068863_1003971492 332
604 3300005842 Ga0068858_100011681 Ga0068858_1000116813 332
605 3300005842 Ga0068858_100044548 Ga0068858_1000445483 332
606 3300005842 Ga0068858_100193279 Ga0068858_1001932792 332
607 3300005842 Ga0068858_100507438 Ga0068858_1005074381 332
608 3300005843 Ga0068860_100001345 Ga0068860_10000134521 332
609 3300005843 Ga0068860_100002872 Ga0068860_1000028724 332
610 3300005843 Ga0068860_100004206 Ga0068860_10000420610 332
611 3300005843 Ga0068860_100006986 Ga0068860_1000069868 332
612 3300005843 Ga0068860_100007629 Ga0068860_10000762910 332
613 3300005843 Ga0068860_100011297 Ga0068860_1000112978 332
614 3300005843 Ga0068860_100118883 Ga0068860_1001188832 332
615 3300005843 Ga0068860_100291570 Ga0068860_1002915702 332
616 3300005844 Ga0068862_100004695 Ga0068862_1000046957 332
617 3300005844 Ga0068862_100006209 Ga0068862_1000062099 332
618 3300006195 Ga0075366_10013523 Ga0075366_100135233 332
619 3300006195 Ga0075366_10092234 Ga0075366_100922341 332
620 3300006237 Ga0097621_100001013 Ga0097621_10000101317 332
621 3300006237 Ga0097621_100001217 Ga0097621_1000012177 332
622 3300006237 Ga0097621_100034521 Ga0097621_1000345213 332
623 3300006237 Ga0097621_100091849 Ga0097621_1000918494 332
624 3300006237 Ga0097621_100157551 Ga0097621_1001575512 332
625 3300006358 Ga0068871_100003639 Ga0068871_1000036398 332
626 3300006358 Ga0068871_100007102 Ga0068871_1000071025 332
627 3300006358 Ga0068871_100016955 Ga0068871_1000169556 332
628 3300006358 Ga0068871_100025182 Ga0068871_1000251822 332
629 3300006358 Ga0068871_100165917 Ga0068871_1001659172 332
630 3300006358 Ga0068871_100249157 Ga0068871_1002491572 332
631 3300006358 Ga0068871_100351069 Ga0068871_1003510691 332
632 3300006881 Ga0068865_100052734 Ga0068865_1000527343 332
633 3300006931 Ga0097620_100000006 Ga0097620_100000006397 332
634 3300006931 Ga0097620_100001697 Ga0097620_1000016979 332
635 3300006931 Ga0097620_100006362 Ga0097620_1000063626 332
636 3300006931 Ga0097620_100006790 Ga0097620_1000067909 332
637 3300006931 Ga0097620_100018396 Ga0097620_1000183964 332
638 3300006931 Ga0097620_100071956 Ga0097620_1000719564 332
639 3300006931 Ga0097620_100074146 Ga0097620_1000741462 332
640 3300006931 Ga0097620_100110142 Ga0097620_1001101422 332
641 3300006931 Ga0097620_100252981 Ga0097620_1002529812 332
642 3300006931 Ga0097620_100452965 Ga0097620_1004529652 332
643 3300006931 Ga0097620_100643381 Ga0097620_1006433811 332
644 3300009011 Ga0105251_10064924 Ga0105251_100649241 332
645 3300009093 Ga0105240_10000367 Ga0105240_100003672 332
646 3300009093 Ga0105240_10000457 Ga0105240_1000045723 332
647 3300009093 Ga0105240_10000487 Ga0105240_1000048746 332
648 3300009093 Ga0105240_10006862 Ga0105240_100068624 332
649 3300009093 Ga0105240_10046442 Ga0105240_100464423 332
650 3300009093 Ga0105240_10071729 Ga0105240_100717293 332
651 3300009093 Ga0105240_10080106 Ga0105240_100801064 332
652 3300009093 Ga0105240_10106837 Ga0105240_101068372 332
653 3300009093 Ga0105240_10158317 Ga0105240_101583173 332
654 3300009094 Ga0111539_10016272 Ga0111539_100162723 332
655 3300009094 Ga0111539_10052998 Ga0111539_100529984 332
656 3300009094 Ga0111539_10057252 Ga0111539_100572521 332
657 3300009094 Ga0111539_10061556 Ga0111539_100615564 332
658 3300009098 Ga0105245_10599406 Ga0105245_105994061 332
659 3300009101 Ga0105247_10005318 Ga0105247_100053187 332
660 3300009147 Ga0114129_10049053 Ga0114129_100490536 332
661 3300009148 Ga0105243_10070322 Ga0105243_100703223 332
662 3300009174 Ga0105241_10003877 Ga0105241_100038779 332
663 3300009174 Ga0105241_10015210 Ga0105241_100152102 332
664 3300009176 Ga0105242_10006871 Ga0105242_100068714 332
665 3300009176 Ga0105242_10010685 Ga0105242_100106855 332
666 3300009176 Ga0105242_10044829 Ga0105242_100448293 332
667 3300009176 Ga0105242_10091230 Ga0105242_100912302 332
668 3300009177 Ga0105248_10173420 Ga0105248_101734203 332
669 3300009545 Ga0105237_10003940 Ga0105237_100039404 332
670 3300009545 Ga0105237_10011351 Ga0105237_100113515 332
671 3300009545 Ga0105237_10014983 Ga0105237_100149835 332
672 3300009545 Ga0105237_10018157 Ga0105237_100181573 332
673 3300009545 Ga0105237_10039340 Ga0105237_100393405 332
674 3300009545 Ga0105237_10049075 Ga0105237_100490753 332
675 3300009545 Ga0105237_10049403 Ga0105237_100494035 332
676 3300009551 Ga0105238_10010193 Ga0105238_100101933 332
677 3300009551 Ga0105238_10111142 Ga0105238_101111422 332
678 3300009551 Ga0105238_10126595 Ga0105238_101265952 332
679 3300009553 Ga0105249_10000382 Ga0105249_100003822 332
680 3300009553 Ga0105249_10001044 Ga0105249_1000104414 332
681 3300009553 Ga0105249_10002600 Ga0105249_100026006 332
682 3300009553 Ga0105249_10057035 Ga0105249_100570353 332
683 3300009553 Ga0105249_10058117 Ga0105249_100581171 332
684 3300009553 Ga0105249_10151575 Ga0105249_101515752 332
685 3300009553 Ga0105249_10332751 Ga0105249_103327511 332
686 3300010375 Ga0105239_10000283 Ga0105239_1000028323 332
687 3300010375 Ga0105239_10002212 Ga0105239_1000221216 332
688 3300010375 Ga0105239_10002422 Ga0105239_100024227 332
689 3300010375 Ga0105239_10015511 Ga0105239_100155119 332
690 3300010375 Ga0105239_10078295 Ga0105239_100782953 332
691 3300010375 Ga0105239_10106080 Ga0105239_101060802 332
692 3300010375 Ga0105239_10121651 Ga0105239_101216513 332
693 3300010375 Ga0105239_10265411 Ga0105239_102654111 332
694 3300010375 Ga0105239_10291028 Ga0105239_102910282 332
695 3300010375 Ga0105239_10536784 Ga0105239_105367841 332
696 3300011119 Ga0105246_10009216 Ga0105246_100092166 332
697 3300011119 Ga0105246_10052457 Ga0105246_100524573 332
698 3300013100 Ga0157373_10002668 Ga0157373_1000266813 332
699 3300013100 Ga0157373_10005405 Ga0157373_100054052 332
700 3300013100 Ga0157373_10007972 Ga0157373_100079723 332
701 3300013100 Ga0157373_10013073 Ga0157373_100130733 332
702 3300013100 Ga0157373_10060448 Ga0157373_100604484 332
703 3300013102 Ga0157371_10004166 Ga0157371_1000416610 332
704 3300013102 Ga0157371_10005373 Ga0157371_1000537310 332
705 3300013102 Ga0157371_10006278 Ga0157371_100062787 332
706 3300013102 Ga0157371_10006742 Ga0157371_100067422 332
707 3300013102 Ga0157371_10012930 Ga0157371_100129302 332
708 3300013102 Ga0157371_10017834 Ga0157371_100178344 332
709 3300013102 Ga0157371_10020968 Ga0157371_100209683 332
710 3300013102 Ga0157371_10030221 Ga0157371_100302211 332
711 3300013102 Ga0157371_10088672 Ga0157371_100886722 332
712 3300013102 Ga0157371_10104429 Ga0157371_101044292 332
713 3300013102 Ga0157371_10106339 Ga0157371_101063392 332
714 3300013104 Ga0157370_10001136 Ga0157370_100011365 332
715 3300013104 Ga0157370_10003783 Ga0157370_1000378318 332
716 3300013104 Ga0157370_10026250 Ga0157370_100262505 332
717 3300013104 Ga0157370_10028521 Ga0157370_100285215 332
718 3300013104 Ga0157370_10389371 Ga0157370_103893712 332
719 3300013104 Ga0157370_10414265 Ga0157370_104142651 332
720 3300013105 Ga0157369_10017560 Ga0157369_1001756010 332
721 3300013105 Ga0157369_10035798 Ga0157369_100357983 332
722 3300013105 Ga0157369_10042857 Ga0157369_100428572 332
723 3300013105 Ga0157369_10073005 Ga0157369_100730051 332
724 3300013105 Ga0157369_10091167 Ga0157369_100911672 332
725 3300013105 Ga0157369_10113429 Ga0157369_101134292 332
726 3300013105 Ga0157369_10119967 Ga0157369_101199672 332
727 3300013296 Ga0157374_10000013 Ga0157374_10000013133 332
728 3300013296 Ga0157374_10006867 Ga0157374_100068676 332
729 3300013296 Ga0157374_10008233 Ga0157374_100082335 332
730 3300013296 Ga0157374_10010075 Ga0157374_100100751 332
731 3300013296 Ga0157374_10041594 Ga0157374_100415944 332
732 3300013296 Ga0157374_10086089 Ga0157374_100860892 332
733 3300013296 Ga0157374_10233257 Ga0157374_102332572 332
734 3300013296 Ga0157374_10388969 Ga0157374_103889692 332
735 3300013297 Ga0157378_10005516 Ga0157378_1000551611 332
736 3300013297 Ga0157378_10025790 Ga0157378_100257905 332
737 3300013297 Ga0157378_10069320 Ga0157378_100693204 332
738 3300013297 Ga0157378_10195801 Ga0157378_101958012 332
739 3300013306 Ga0163162_10000175 Ga0163162_1000017514 332
740 3300013306 Ga0163162_10000244 Ga0163162_1000024434 332
741 3300013306 Ga0163162_10001206 Ga0163162_100012069 332
742 3300013306 Ga0163162_10001299 Ga0163162_1000129920 332
743 3300013306 Ga0163162_10002221 Ga0163162_100022215 332
744 3300013306 Ga0163162_10004298 Ga0163162_1000429811 332
745 3300013306 Ga0163162_10079695 Ga0163162_100796953 332
746 3300013306 Ga0163162_10194694 Ga0163162_101946942 332
747 3300013306 Ga0163162_10281292 Ga0163162_102812922 332
748 3300013307 Ga0157372_10004707 Ga0157372_1000470713 332
749 3300013307 Ga0157372_10028658 Ga0157372_100286583 332
750 3300013307 Ga0157372_10035513 Ga0157372_100355135 332
751 3300013307 Ga0157372_10046003 Ga0157372_100460034 332
752 3300013307 Ga0157372_10096098 Ga0157372_100960984 332
753 3300013307 Ga0157372_10097318 Ga0157372_100973183 332
754 3300013307 Ga0157372_10113262 Ga0157372_101132623 332
755 3300013307 Ga0157372_10114346 Ga0157372_101143461 332
756 3300013307 Ga0157372_10139491 Ga0157372_101394912 332
757 3300013307 Ga0157372_10150827 Ga0157372_101508274 332
758 3300013307 Ga0157372_10156907 Ga0157372_101569073 332
759 3300013307 Ga0157372_10215737 Ga0157372_102157372 332
760 3300013307 Ga0157372_10309549 Ga0157372_103095491 332
761 3300013307 Ga0157372_10327907 Ga0157372_103279072 332
762 3300013307 Ga0157372_10332083 Ga0157372_103320832 332
763 3300013307 Ga0157372_10351485 Ga0157372_103514852 332
764 3300013308 Ga0157375_10000773 Ga0157375_100007732 332
765 3300013308 Ga0157375_10007261 Ga0157375_100072611 332
766 3300013308 Ga0157375_10055169 Ga0157375_100551693 332
767 3300013308 Ga0157375_10133442 Ga0157375_101334423 332
768 3300013308 Ga0157375_10477176 Ga0157375_104771761 332
769 3300014325 Ga0163163_10000202 Ga0163163_1000020220 332
770 3300014325 Ga0163163_10007952 Ga0163163_100079523 332
771 3300014325 Ga0163163_10058840 Ga0163163_100588403 332
772 3300014325 Ga0163163_10085512 Ga0163163_100855123 332
773 3300014325 Ga0163163_10148591 Ga0163163_101485912 332
774 3300014325 Ga0163163_10160745 Ga0163163_101607453 332
775 3300014325 Ga0163163_10306198 Ga0163163_103061982 332
776 3300014326 Ga0157380_10004286 Ga0157380_100042866 332
777 3300014326 Ga0157380_10095609 Ga0157380_100956092 332
778 3300014326 Ga0157380_10129624 Ga0157380_101296243 332
779 3300014326 Ga0157380_10192734 Ga0157380_101927342 332
780 3300014326 Ga0157380_10219302 Ga0157380_102193022 332
781 3300014745 Ga0157377_10004071 Ga0157377_100040712 332
782 3300014745 Ga0157377_10080052 Ga0157377_100800521 332
783 3300014968 Ga0157379_10018400 Ga0157379_100184002 332
784 3300014968 Ga0157379_10021198 Ga0157379_100211983 332
785 3300014968 Ga0157379_10035570 Ga0157379_100355702 332
786 3300014968 Ga0157379_10192981 Ga0157379_101929812 332
787 3300014968 Ga0157379_10250265 Ga0157379_102502651 332
788 3300014968 Ga0157379_10382353 Ga0157379_103823532 332
789 3300014969 Ga0157376_10000842 Ga0157376_100008429 332
790 3300014969 Ga0157376_10014822 Ga0157376_100148222 332
791 3300014969 Ga0157376_10085120 Ga0157376_100851203 332
792 3300014969 Ga0157376_10340169 Ga0157376_103401692 332
793 3300017792 Ga0163161_10011062 Ga0163161_100110626 332
794 3300017792 Ga0163161_10018794 Ga0163161_100187944 332
795 3300017792 Ga0163161_10029015 Ga0163161_100290154 332
796 3300017792 Ga0163161_10065769 Ga0163161_100657692 332
797 3300017792 Ga0163161_10085459 Ga0163161_100854591 332
798 3300017792 Ga0163161_10210356 Ga0163161_102103561 332
799 3300025246 Ga0209646_1001757 Ga0209646_10017572 332
800 3300025315 Ga0207697_10022233 Ga0207697_100222333 332
801 3300025899 Ga0207642_10007747 Ga0207642_100077473 332
802 3300025900 Ga0207710_10003507 Ga0207710_100035072 332
803 3300025900 Ga0207710_10099048 Ga0207710_100990481 332
804 3300025901 Ga0207688_10033608 Ga0207688_100336083 332
805 3300025903 Ga0207680_10000855 Ga0207680_100008555 332
806 3300025904 Ga0207647_10000096 Ga0207647_1000009610 332
807 3300025904 Ga0207647_10018721 Ga0207647_100187214 332
808 3300025904 Ga0207647_10072323 Ga0207647_100723232 332
809 3300025904 Ga0207647_10111673 Ga0207647_101116731 332
810 3300025907 Ga0207645_10000326 Ga0207645_1000032624 332
811 3300025907 Ga0207645_10087139 Ga0207645_100871393 332
812 3300025908 Ga0207643_10136724 Ga0207643_101367242 332
813 3300025909 Ga0207705_10003840 Ga0207705_100038403 332
814 3300025909 Ga0207705_10077408 Ga0207705_100774083 332
815 3300025911 Ga0207654_10001346 Ga0207654_100013469 332
816 3300025911 Ga0207654_10001813 Ga0207654_100018138 332
817 3300025912 Ga0207707_10226356 Ga0207707_102263562 332
818 3300025913 Ga0207695_10000051 Ga0207695_10000051112 332
819 3300025913 Ga0207695_10000056 Ga0207695_10000056130 332
820 3300025913 Ga0207695_10000066 Ga0207695_1000006623 332
821 3300025913 Ga0207695_10000081 Ga0207695_10000081112 332
822 3300025913 Ga0207695_10000156 Ga0207695_1000015686 332
823 3300025913 Ga0207695_10001892 Ga0207695_1000189219 332
824 3300025913 Ga0207695_10021903 Ga0207695_100219037 332
825 3300025913 Ga0207695_10027179 Ga0207695_100271793 332
826 3300025913 Ga0207695_10033011 Ga0207695_100330115 332
827 3300025913 Ga0207695_10137668 Ga0207695_101376682 332
828 3300025913 Ga0207695_10145223 Ga0207695_101452232 332
829 3300025914 Ga0207671_10008035 Ga0207671_100080356 332
830 3300025914 Ga0207671_10018945 Ga0207671_100189453 332
831 3300025914 Ga0207671_10019960 Ga0207671_100199605 332
832 3300025914 Ga0207671_10079128 Ga0207671_100791282 332
833 3300025914 Ga0207671_10105276 Ga0207671_101052762 332
834 3300025914 Ga0207671_10204265 Ga0207671_102042652 332
835 3300025914 Ga0207671_10224978 Ga0207671_102249781 332
836 3300025916 Ga0207663_10127179 Ga0207663_101271792 332
837 3300025917 Ga0207660_10008438 Ga0207660_100084386 332
838 3300025917 Ga0207660_10342335 Ga0207660_103423352 332
839 3300025919 Ga0207657_10007593 Ga0207657_100075934 332
840 3300025919 Ga0207657_10029300 Ga0207657_100293004 332
841 3300025919 Ga0207657_10135996 Ga0207657_101359962 332
842 3300025919 Ga0207657_10245537 Ga0207657_102455372 332
843 3300025920 Ga0207649_10002398 Ga0207649_100023986 332
844 3300025920 Ga0207649_10074802 Ga0207649_100748022 332
845 3300025921 Ga0207652_10000210 Ga0207652_1000021010 332
846 3300025921 Ga0207652_10001379 Ga0207652_1000137914 332
847 3300025921 Ga0207652_10002011 Ga0207652_1000201114 332
848 3300025921 Ga0207652_10019087 Ga0207652_100190874 332
849 3300025921 Ga0207652_10077604 Ga0207652_100776043 332
850 3300025923 Ga0207681_10002024 Ga0207681_100020245 332
851 3300025923 Ga0207681_10034406 Ga0207681_100344062 332
852 3300025924 Ga0207694_10011093 Ga0207694_100110936 332
853 3300025924 Ga0207694_10092098 Ga0207694_100920982 332
854 3300025925 Ga0207650_10011012 Ga0207650_100110126 332
855 3300025925 Ga0207650_10014889 Ga0207650_100148896 332
856 3300025925 Ga0207650_10091543 Ga0207650_100915432 332
857 3300025926 Ga0207659_10014635 Ga0207659_100146356 332
858 3300025926 Ga0207659_10030533 Ga0207659_100305334 332
859 3300025926 Ga0207659_10067776 Ga0207659_100677762 332
860 3300025926 Ga0207659_10082064 Ga0207659_100820642 332
861 3300025926 Ga0207659_10129190 Ga0207659_101291902 332
862 3300025926 Ga0207659_10178082 Ga0207659_101780822 332
863 3300025926 Ga0207659_10212580 Ga0207659_102125802 332
864 3300025926 Ga0207659_10405863 Ga0207659_104058631 332
865 3300025927 Ga0207687_10385302 Ga0207687_103853022 332
866 3300025931 Ga0207644_10051728 Ga0207644_100517283 332
867 3300025931 Ga0207644_10272912 Ga0207644_102729122 332
868 3300025931 Ga0207644_10428625 Ga0207644_104286251 332
869 3300025932 Ga0207690_10001171 Ga0207690_1000117113 332
870 3300025932 Ga0207690_10002934 Ga0207690_100029348 332
871 3300025932 Ga0207690_10082957 Ga0207690_100829571 332
872 3300025933 Ga0207706_10005261 Ga0207706_1000526112 332
873 3300025933 Ga0207706_10017736 Ga0207706_100177363 332
874 3300025933 Ga0207706_10051143 Ga0207706_100511433 332
875 3300025934 Ga0207686_10088226 Ga0207686_100882263 332
876 3300025936 Ga0207670_10002141 Ga0207670_100021418 332
877 3300025940 Ga0207691_10010109 Ga0207691_100101092 332
878 3300025940 Ga0207691_10023963 Ga0207691_100239633 332
879 3300025940 Ga0207691_10090619 Ga0207691_100906193 332
880 3300025940 Ga0207691_10104879 Ga0207691_101048793 332
881 3300025940 Ga0207691_10136818 Ga0207691_101368183 332
882 3300025940 Ga0207691_10195268 Ga0207691_101952682 332
883 3300025942 Ga0207689_10001060 Ga0207689_1000106012 332
884 3300025942 Ga0207689_10002845 Ga0207689_1000284510 332
885 3300025942 Ga0207689_10002851 Ga0207689_100028515 332
886 3300025942 Ga0207689_10005578 Ga0207689_100055789 332
887 3300025942 Ga0207689_10007781 Ga0207689_100077814 332
888 3300025942 Ga0207689_10024801 Ga0207689_100248013 332
889 3300025942 Ga0207689_10030329 Ga0207689_100303291 332
890 3300025942 Ga0207689_10076825 Ga0207689_100768252 332
891 3300025942 Ga0207689_10080136 Ga0207689_100801363 332
892 3300025942 Ga0207689_10294473 Ga0207689_102944731 332
893 3300025944 Ga0207661_10000669 Ga0207661_1000066910 332
894 3300025944 Ga0207661_10011917 Ga0207661_100119178 332
895 3300025944 Ga0207661_10011967 Ga0207661_100119674 332
896 3300025944 Ga0207661_10333395 Ga0207661_103333951 332
897 3300025945 Ga0207679_10000091 Ga0207679_1000009170 332
898 3300025945 Ga0207679_10004528 Ga0207679_100045286 332
899 3300025945 Ga0207679_10247304 Ga0207679_102473042 332
900 3300025945 Ga0207679_10386634 Ga0207679_103866341 332
901 3300025949 Ga0207667_10001351 Ga0207667_100013511 332
902 3300025949 Ga0207667_10002178 Ga0207667_1000217810 332
903 3300025949 Ga0207667_10005268 Ga0207667_100052685 332
904 3300025949 Ga0207667_10005458 Ga0207667_1000545813 332
905 3300025949 Ga0207667_10029053 Ga0207667_100290532 332
906 3300025949 Ga0207667_10030851 Ga0207667_100308515 332
907 3300025949 Ga0207667_10031294 Ga0207667_100312943 332
908 3300025949 Ga0207667_10042069 Ga0207667_100420695 332
909 3300025949 Ga0207667_10052888 Ga0207667_100528884 332
910 3300025949 Ga0207667_10186529 Ga0207667_101865292 332
911 3300025949 Ga0207667_10221437 Ga0207667_102214372 332
912 3300025960 Ga0207651_10006333 Ga0207651_100063336 332
913 3300025961 Ga0207712_10002253 Ga0207712_100022534 332
914 3300025961 Ga0207712_10006568 Ga0207712_100065685 332
915 3300025961 Ga0207712_10013777 Ga0207712_100137774 332
916 3300025961 Ga0207712_10014032 Ga0207712_100140324 332
917 3300025972 Ga0207668_10058479 Ga0207668_100584792 332
918 3300025972 Ga0207668_10336319 Ga0207668_103363191 332
919 3300025981 Ga0207640_10039498 Ga0207640_100394982 332
920 3300025981 Ga0207640_10083025 Ga0207640_100830252 332
921 3300025981 Ga0207640_10088172 Ga0207640_100881721 332
922 3300025981 Ga0207640_10190518 Ga0207640_101905181 332
923 3300025981 Ga0207640_10250499 Ga0207640_102504991 332
924 3300025986 Ga0207658_10038693 Ga0207658_100386933 332
925 3300025986 Ga0207658_10064258 Ga0207658_100642583 332
926 3300025986 Ga0207658_10078782 Ga0207658_100787822 332
927 3300025986 Ga0207658_10100249 Ga0207658_101002492 332
928 3300025986 Ga0207658_10317479 Ga0207658_103174791 332
929 3300026023 Ga0207677_10004007 Ga0207677_100040077 332
930 3300026023 Ga0207677_10007307 Ga0207677_100073076 332
931 3300026023 Ga0207677_10011519 Ga0207677_100115195 332
932 3300026023 Ga0207677_10069830 Ga0207677_100698303 332
933 3300026023 Ga0207677_10167915 Ga0207677_101679152 332
934 3300026023 Ga0207677_10475886 Ga0207677_104758861 332
935 3300026035 Ga0207703_10004255 Ga0207703_100042553 332
936 3300026041 Ga0207639_10001896 Ga0207639_1000189610 332
937 3300026041 Ga0207639_10004353 Ga0207639_100043537 332
938 3300026041 Ga0207639_10004753 Ga0207639_100047532 332
939 3300026041 Ga0207639_10041408 Ga0207639_100414085 332
940 3300026041 Ga0207639_10065337 Ga0207639_100653372 332
941 3300026041 Ga0207639_10074819 Ga0207639_100748193 332
942 3300026041 Ga0207639_10122948 Ga0207639_101229483 332
943 3300026041 Ga0207639_10212565 Ga0207639_102125652 332
944 3300026067 Ga0207678_10009466 Ga0207678_100094667 332
945 3300026067 Ga0207678_10015031 Ga0207678_100150314 332
946 3300026078 Ga0207702_10070421 Ga0207702_100704212 332
947 3300026078 Ga0207702_10143431 Ga0207702_101434312 332
948 3300026088 Ga0207641_10250649 Ga0207641_102506491 332
949 3300026089 Ga0207648_10004506 Ga0207648_100045062 332
950 3300026089 Ga0207648_10005153 Ga0207648_100051534 332
951 3300026089 Ga0207648_10018365 Ga0207648_100183654 332
952 3300026089 Ga0207648_10022436 Ga0207648_100224365 332
953 3300026089 Ga0207648_10042613 Ga0207648_100426133 332
954 3300026089 Ga0207648_10052105 Ga0207648_100521052 332
955 3300026089 Ga0207648_10106728 Ga0207648_101067282 332
956 3300026089 Ga0207648_10134548 Ga0207648_101345482 332
957 3300026089 Ga0207648_10147718 Ga0207648_101477182 332
958 3300026095 Ga0207676_10003274 Ga0207676_100032743 332
959 3300026116 Ga0207674_10001267 Ga0207674_1000126725 332
960 3300026116 Ga0207674_10005257 Ga0207674_100052574 332
961 3300026116 Ga0207674_10017345 Ga0207674_100173453 332
962 3300026116 Ga0207674_10020982 Ga0207674_100209822 332
963 3300026116 Ga0207674_10101825 Ga0207674_101018253 332
964 3300026116 Ga0207674_10147525 Ga0207674_101475253 332
965 3300026116 Ga0207674_10382954 Ga0207674_103829541 332
966 3300026116 Ga0207674_10387631 Ga0207674_103876312 332
967 3300026118 Ga0207675_100000085 Ga0207675_10000008547 332
968 3300026118 Ga0207675_100031240 Ga0207675_1000312404 332
969 3300026118 Ga0207675_100071533 Ga0207675_1000715332 332
970 3300026118 Ga0207675_100094075 Ga0207675_1000940752 332
971 3300026118 Ga0207675_100115784 Ga0207675_1001157842 332
972 3300026118 Ga0207675_100182849 Ga0207675_1001828492 332
973 3300026118 Ga0207675_100492226 Ga0207675_1004922261 332
974 3300026121 Ga0207683_10001248 Ga0207683_100012486 332
975 3300026121 Ga0207683_10071229 Ga0207683_100712292 332
976 3300026121 Ga0207683_10358859 Ga0207683_103588592 332
977 3300026142 Ga0207698_10003249 Ga0207698_100032498 332
978 3300026142 Ga0207698_10258670 Ga0207698_102586701 332
979 3300028379 Ga0268266_10000022 Ga0268266_1000002257 332
980 3300028379 Ga0268266_10033089 Ga0268266_100330892 332
981 3300028379 Ga0268266_10066307 Ga0268266_100663073 332
982 3300028380 Ga0268265_10004802 Ga0268265_1000480211 332
983 3300028380 Ga0268265_10011485 Ga0268265_100114855 332
984 3300028381 Ga0268264_10000082 Ga0268264_10000082159 332
985 3300028381 Ga0268264_10004767 Ga0268264_100047676 332
986 3300028381 Ga0268264_10005045 Ga0268264_100050454 332
987 3300028381 Ga0268264_10005982 Ga0268264_100059827 332
988 3300028381 Ga0268264_10011113 Ga0268264_100111134 332
989 3300028381 Ga0268264_10105895 Ga0268264_101058953 332
990 3300028381 Ga0268264_10137551 Ga0268264_101375512 332
991 3300028381 Ga0268264_10283748 Ga0268264_102837482 332
992 3300028381 Ga0268264_10365319 Ga0268264_103653192 332
993 3300028381 Ga0268264_10474954 Ga0268264_104749541 332
994 3300028786 Ga0307517_10090506 Ga0307517_100905061 332
995 3300028794 Ga0307515_10000001 Ga0307515_100000011999 332
996 3300028794 Ga0307515_10000021 Ga0307515_10000021227 332
997 3300030521 Ga0307511_10000027 Ga0307511_100000276 332
998 3300031251 Ga0265327_10000059 Ga0265327_10000059110 332
999 3300031251 Ga0265327_10006052 Ga0265327_100060522 332
1000 3300031456 Ga0307513_10032991 Ga0307513_100329914 332
1001 3300031507 Ga0307509_10050166 Ga0307509_100501664 332
1002 3300031595 Ga0265313_10014781 Ga0265313_100147813 332
1003 3300031616 Ga0307508_10003578 Ga0307508_1000357815 332
1004 3300031730 Ga0307516_10000119 Ga0307516_100001193 332
1005 3300031730 Ga0307516_10033453 Ga0307516_100334532 332
1006 3300031730 Ga0307516_10166820 Ga0307516_101668202 332
1007 3300031852 Ga0307410_10079569 Ga0307410_100795692 332
1008 3300031911 Ga0307412_10251624 Ga0307412_102516242 332
1009 3300031995 Ga0307409_100131596 Ga0307409_1001315962 332
1010 3300032002 Ga0307416_100127235 Ga0307416_1001272352 332
1011 3300032004 Ga0307414_10147156 Ga0307414_101471561 332
1012 3300032004 Ga0307414_10221519 Ga0307414_102215192 332
1013 3300033180 Ga0307510_10029575 Ga0307510_100295754 332
1014 3300033180 Ga0307510_10169732 Ga0307510_101697322 332
1015 3300035410 Ga0373924_0009514 Ga0373924_0009514_1508_2509 332
1016 3300035725 Ga0373947_0176925 Ga0373947_0176925_37_1038 332
1017 3300036401 Ga0373937_0003368 Ga0373937_0003368_4117_5118 332
1018 3300036401 Ga0373937_0383647 Ga0373937_0383647_60_1061 332
1019 3300037312 Ga0395899_0006956 Ga0395899_0006956_287_1288 332
1020 3300037312 Ga0395899_0055275 Ga0395899_0055275_35_1090 332
1021 3300037312 Ga0395899_0075737 Ga0395899_0075737_1405_2406 332
1022 3300037418 Ga0395900_0013108 Ga0395900_0013108_2757_3758 332
1023 3300037418 Ga0395900_0029924 Ga0395900_0029924_583_1584 332
1024 3300037418 Ga0395900_0035803 Ga0395900_0035803_3290_4345 332
1025 3300037418 Ga0395900_0127665 Ga0395900_0127665_1578_2579 332
1026 3300037418 Ga0395900_0159490 Ga0395900_0159490_385_1386 332
1027 3300037466 Ga0395898_0000730 Ga0395898_0000730_11584_12585 332
1028 3300037466 Ga0395898_0006355 Ga0395898_0006355_10907_11908 332
1029 3300037466 Ga0395898_0171115 Ga0395898_0171115_841_1896 332
1030 3300037466 Ga0395898_0193706 Ga0395898_0193706_684_1685 332
1031 3300037471 Ga0395905_0003378 Ga0395905_0003378_2604_3605 332
1032 3300037471 Ga0395905_0005771 Ga0395905_0005771_952_2007 332
1033 3300037471 Ga0395905_0053102 Ga0395905_0053102_874_1875 332
1034 3300037471 Ga0395905_0154810 Ga0395905_0154810_989_1990 332
1035 3300038443 Ga0395901_0000569 Ga0395901_0000569_40962_41963 332
1036 3300038443 Ga0395901_0001794 Ga0395901_0001794_14561_15562 332
1037 3300038443 Ga0395901_0035901 Ga0395901_0035901_2029_3084 332
1038 3300041404 Ga0439436_0001482 Ga0439436_0001482_1523_2524 332
1039 3300041406 Ga0439439_0021835 Ga0439439_0021835_583_1584 332
1040 3300041459 Ga0451800_0672505 Ga0451800_0672505_150_1151 332
1041 3300041999 Ga0439433_0032934 Ga0439433_0032934_148_1149 332
1042 3300042007 Ga0439449_0017757 Ga0439449_0017757_357_1358 332
1043 3300042007 Ga0439449_0067611 Ga0439449_0067611_255_1256 332
1044 3300042014 Ga0439457_000013 Ga0439457_000013_4325_5326 332
1045 3300042015 Ga0439462_0004681 Ga0439462_0004681_410_1411 332
1046 3300042876 Ga0451577_0133524 Ga0451577_0133524_10_1008 332
1047 3300042876 Ga0451577_0140156 Ga0451577_0140156_106_1107 332
1048 3300042876 Ga0451577_0158740 Ga0451577_0158740_445_1512 332
1049 3300042876 Ga0451577_0241033 Ga0451577_0241033_67_1065 332
1050 3300042876 Ga0451577_0412692 Ga0451577_0412692_127_1128 332
1051 3300044656 Ga0466969_0002364 Ga0466969_0002364_133_1134 332
1052 3300044658 Ga0466972_0000471 Ga0466972_0000471_11697_12698 332
1053 3300044658 Ga0466972_0006739 Ga0466972_0006739_3331_4332 332
1054 3300044683 Ga0466965_0174942 Ga0466965_0174942_82_1083 332
1055 3300044712 Ga0453684_0005682 Ga0453684_0005682_7277_8344 332
1056 3300044712 Ga0453684_0015588 Ga0453684_0015588_4591_5589 332
1057 3300044712 Ga0453684_0022085 Ga0453684_0022085_7530_8528 332
1058 3300044712 Ga0453684_0077947 Ga0453684_0077947_109_1107 332
1059 3300044712 Ga0453684_0078536 Ga0453684_0078536_456_1454 332
1060 3300044712 Ga0453684_0192531 Ga0453684_0192531_1278_2276 332
1061 3300044719 Ga0466971_0008865 Ga0466971_0008865_1632_2633 332
1062 3300044765 Ga0466970_0094930 Ga0466970_0094930_245_1246 332
1063 3300044842 Ga0466957_0004387 Ga0466957_0004387_6023_7024 332
1064 3300045049 Ga0466959_0000004 Ga0466959_0000004_25631_26632 332
1065 3300045049 Ga0466959_0006661 Ga0466959_0006661_1560_2561 332
1066 3300045049 Ga0466959_0034588 Ga0466959_0034588_426_1427 332
1067 3300045051 Ga0451576_0011467 Ga0451576_0011467_7406_8473 332
1068 3300045836 Ga0466958_0165632 Ga0466958_0165632_132_1133 332
1069 3300046454 Ga0495592_0029031 Ga0495592_0029031_799_1800 332
1070 3300046460 Ga0495638_0115984 Ga0495638_0115984_216_1217 332
1071 3300046460 Ga0495638_0118890 Ga0495638_0118890_46_1047 332
1072 3300046463 Ga0495653_0206268 Ga0495653_0206268_30_1031 332
1073 3300046471 Ga0495650_0006702 Ga0495650_0006702_4393_5394 332
1074 3300046507 Ga0495606_0004080 Ga0495606_0004080_4487_5488 332
1075 3300046514 Ga0495618_0029809 Ga0495618_0029809_74_1075 332
1076 3300046517 Ga0495630_0006610 Ga0495630_0006610_2802_3803 332
1077 3300046524 Ga0495648_0007376 Ga0495648_0007376_3534_4535 332
1078 3300046538 Ga0495609_0038725 Ga0495609_0038725_538_1551 332
1079 3300046557 Ga0495622_0024791 Ga0495622_0024791_919_1920 332
1080 3300046616 Ga0495668_0000106 Ga0495668_0000106_38057_39058 332
1081 3300046616 Ga0495668_0002015 Ga0495668_0002015_13155_14156 332
1082 3300046642 Ga0495634_0013547 Ga0495634_0013547_1447_2448 332
1083 3300046675 Ga0495657_0134461 Ga0495657_0134461_472_1473 332
1084 3300046694 Ga0495649_0046664 Ga0495649_0046664_907_1908 332
1085 3300047319 Ga0495674_0089702 Ga0495674_0089702_1241_2242 332
1086 3300047320 Ga0495672_0017324 Ga0495672_0017324_3675_4676 332
1087 3300047320 Ga0495672_0024503 Ga0495672_0024503_2400_3401 332
1088 3300047443 Ga0495687_000179 Ga0495687_000179_81280_82281 332
1089 3300047472 Ga0495686_0000010 Ga0495686_0000010_251035_252036 332
1090 3300048904 Ga0496101_0055826 Ga0496101_0055826_1637_2638 332
1091 3300048907 Ga0496104_0394401 Ga0496104_0394401_105_1106 332
1092 3300048911 Ga0496108_0091440 Ga0496108_0091440_970_1971 332
1093 3300048913 Ga0496110_0105881 Ga0496110_0105881_1047_2048 332
1094 3300049568 Ga0501031_0037836 Ga0501031_0037836_1560_2561 332
1095 3300049569 Ga0501032_0021796 Ga0501032_0021796_1750_2751 332
1096 3300049569 Ga0501032_0097646 Ga0501032_0097646_810_1811 332
1097 3300049571 Ga0501034_0000002 Ga0501034_0000002_106865_107866 332
1098 3300049571 Ga0501034_0014290 Ga0501034_0014290_4401_5402 332
1099 3300049571 Ga0501034_0026580 Ga0501034_0026580_821_1822 332
1100 3300049571 Ga0501034_0106302 Ga0501034_0106302_725_1726 332
1101 3300049572 Ga0501036_0030967 Ga0501036_0030967_1473_2474 332
1102 3300049573 Ga0501037_0004005 Ga0501037_0004005_1932_2933 332
1103 3300049573 Ga0501037_0012007 Ga0501037_0012007_3408_4409 332
1104 3300049574 Ga0501038_0128908 Ga0501038_0128908_594_1595 332
1105 3300049575 Ga0501039_0051479 Ga0501039_0051479_1112_2113 332
1106 3300049576 Ga0501040_0135930 Ga0501040_0135930_62_1072 332
1107 3300049579 Ga0501043_0009779 Ga0501043_0009779_6185_7186 332
1108 3300049579 Ga0501043_0019201 Ga0501043_0019201_1158_2159 332
1109 3300049579 Ga0501043_0042137 Ga0501043_0042137_1116_2117 332
1110 3300049579 Ga0501043_0124142 Ga0501043_0124142_405_1406 332
1111 3300049580 Ga0501046_0023842 Ga0501046_0023842_3777_4778 332
1112 3300049581 Ga0501047_0005502 Ga0501047_0005502_2618_3619 332
1113 3300049581 Ga0501047_0069130 Ga0501047_0069130_684_1685 332
1114 3300049581 Ga0501047_0177709 Ga0501047_0177709_32_1033 332
1115 3300049581 Ga0501047_0218223 Ga0501047_0218223_407_1408 332
1116 3300049582 Ga0501048_0121443 Ga0501048_0121443_83_1084 332
1117 3300049586 Ga0501070_0070322 Ga0501070_0070322_841_1842 332
1118 3300049586 Ga0501070_0074086 Ga0501070_0074086_254_1342 332
1119 3300049589 Ga0501073_0034877 Ga0501073_0034877_60_1061 332
1120 3300049589 Ga0501073_0137696 Ga0501073_0137696_112_1113 332
1121 3300049590 Ga0501074_0023422 Ga0501074_0023422_2908_3909 332
1122 3300049593 Ga0501077_0037806 Ga0501077_0037806_558_1568 332
1123 3300049649 Ga0501198_000420 Ga0501198_000420_2462_3463 332
1124 3300049651 Ga0501201_000689 Ga0501201_000689_1195_2196 332
1125 3300049652 Ga0501202_010872 Ga0501202_010872_34_1035 332
1126 3300049654 Ga0501207_000266 Ga0501207_000266_4405_5406 332
1127 3300049661 Ga0501217_000569 Ga0501217_000569_493_1494 332
1128 3300049662 Ga0501222_002014 Ga0501222_002014_1100_2101 332
1129 3300049664 Ga0501224_000940 Ga0501224_000940_2688_3689 332
1130 3300049672 Ga0501239_005337 Ga0501239_005337_87_1088 332
1131 3300049674 Ga0501242_000064 Ga0501242_000064_582_1583 332
1132 3300049675 Ga0501243_018799 Ga0501243_018799_26_1027 332
1133 3300049683 Ga0501253_000221 Ga0501253_000221_1227_2228 332
1134 3300049686 Ga0501257_007185 Ga0501257_007185_578_1579 332
1135 3300049690 Ga0501261_001209 Ga0501261_001209_1742_2743 332
1136 3300049703 Ga0501219_000112 Ga0501219_000112_3928_4929 332
1137 3300049704 Ga0501221_000520 Ga0501221_000520_262_1263 332
1138 3300049705 Ga0501225_0002455 Ga0501225_0002455_4105_5106 332
1139 3300049741 Ga0501079_0046308 Ga0501079_0046308_585_1595 332
1140 3300049741 Ga0501079_0069485 Ga0501079_0069485_1210_2211 332
1141 3300049744 Ga0501083_0221745 Ga0501083_0221745_88_1089 332
1142 3300049758 Ga0501241_001813 Ga0501241_001813_1290_2306 332
1143 3300049760 Ga0501263_000743 Ga0501263_000743_1108_2109 332
1144 3300049763 Ga0501266_002260 Ga0501266_002260_222_1223 332
1145 3300049765 Ga0501268_011598 Ga0501268_011598_41_1042 332
1146 3300049767 Ga0501270_002434 Ga0501270_002434_507_1508 332
1147 3300049775 Ga0501279_011631 Ga0501279_011631_33_1034 332
1148 3300049822 Ga0501035_0035021 Ga0501035_0035021_2134_3135 332
1149 3300049822 Ga0501035_0048276 Ga0501035_0048276_221_1222 332
1150 3300049822 Ga0501035_0185817 Ga0501035_0185817_172_1173 332
1151 3300049823 Ga0501044_0000920 Ga0501044_0000920_9544_10545 332
1152 3300049823 Ga0501044_0012419 Ga0501044_0012419_3509_4510 332
1153 3300049823 Ga0501044_0015185 Ga0501044_0015185_5556_6557 332
1154 3300049823 Ga0501044_0025867 Ga0501044_0025867_1643_2644 332
1155 3300049823 Ga0501044_0110327 Ga0501044_0110327_333_1334 332
1156 3300050005 Ga0501284_00086 Ga0501284_00086_2962_3963 332
1157 3300050493 nmdc:mga0k408_11364_c1 nmdc:mga0k408_11364_c1_1399_2400 332
1158 3300050493 nmdc:mga0k408_68091_c1 nmdc:mga0k408_68091_c1_650_1651 332
1159 3300050493 nmdc:mga0k408_76346_c1 nmdc:mga0k408_76346_c1_764_1765 332
1160 3300050507 nmdc:mga05p37_154463_c1 nmdc:mga05p37_154463_c1_861_1862 332
1161 3300050511 nmdc:mga08y16_5833_c1 nmdc:mga08y16_5833_c1_2768_3769 332
1162 3300053085 Ga0495619_0023650 Ga0495619_0023650_1932_2933 332
1163 3300053086 Ga0500578_0000010 Ga0500578_0000010_159343_160344 332
1164 3300053090 Ga0500646_0007928 Ga0500646_0007928_710_1711 332
1165 3300053090 Ga0500646_0049256 Ga0500646_0049256_148_1149 332
1166 3300053092 Ga0500583_0000064 Ga0500583_0000064_23204_24205 332
1167 3300053092 Ga0500583_0002019 Ga0500583_0002019_4281_5282 332
1168 3300053096 Ga0500641_0020817 Ga0500641_0020817_1397_2398 332
1169 3300053098 Ga0500650_0048891 Ga0500650_0048891_832_1833 332
1170 3300053111 Ga0500572_007918 Ga0500572_007918_1010_2011 332
1171 3300053130 Ga0500642_0002743 Ga0500642_0002743_4178_5179 332
1172 3300053130 Ga0500642_0086701 Ga0500642_0086701_231_1232 332
1173 3300053139 Ga0500568_0002456 Ga0500568_0002456_2757_3761 332
1174 3300053139 Ga0500568_0017009 Ga0500568_0017009_1618_2619 332
1175 3300053153 Ga0500616_0003610 Ga0500616_0003610_2554_3555 332
1176 3300053156 Ga0500622_0009287 Ga0500622_0009287_3356_4357 332
1177 3300053177 Ga0500636_0133910 Ga0500636_0133910_70_1071 332
1178 3300053178 Ga0500637_0014137 Ga0500637_0014137_2186_3187 332
1179 3300053727 Ga0500611_000039 Ga0500611_000039_15936_16937 332
1180 3300060353 Ga0501082_0242325 Ga0501082_0242325_360_1361 332
1181 3300005614 Ga0068856_100262326 Ga0068856_1002623262 333
1182 3300032004 Ga0307414_10002124 Ga0307414_100021242 333
1183 3300035398 Ga0316574_0091118 Ga0316574_0091118_286_1287 333
1184 3300042876 Ga0451577_0097332 Ga0451577_0097332_342_1343 333
1185 3300044712 Ga0453684_0001359 Ga0453684_0001359_8809_9810 333
1186 3300044765 Ga0466970_0049786 Ga0466970_0049786_944_1951 333
1187 3300045049 Ga0466959_0035958 Ga0466959_0035958_1894_2952 333
1188 3300049569 Ga0501032_0010382 Ga0501032_0010382_3954_5030 333
1189 3300049570 Ga0501033_0000030 Ga0501033_0000030_83336_84430 333
1190 3300049571 Ga0501034_0000167 Ga0501034_0000167_66171_67265 333
1191 3300049572 Ga0501036_0008362 Ga0501036_0008362_6206_7300 333
1192 3300049574 Ga0501038_0006084 Ga0501038_0006084_1461_2555 333
1193 3300049575 Ga0501039_0057772 Ga0501039_0057772_1396_2490 333
1194 3300049579 Ga0501043_0027203 Ga0501043_0027203_2902_3996 333
1195 3300049581 Ga0501047_0114739 Ga0501047_0114739_186_1280 333
1196 3300049823 Ga0501044_0026695 Ga0501044_0026695_378_1472 333
1197 3300049824 Ga0501045_0000007 Ga0501045_0000007_75864_76958 333
1198 2162886007 SwRhRL2b_contig_80314 SwRhRL2b_0728.00004290 334
1199 3300003323 rootH1_10327397 rootH1_103273972 334
1200 3300005288 Ga0065714_10066582 Ga0065714_100665824 334
1201 3300005289 Ga0065704_10002900 Ga0065704_100029005 334
1202 3300005289 Ga0065704_10076658 Ga0065704_100766584 334
1203 3300005337 Ga0070682_100005300 Ga0070682_1000053005 334
1204 3300005543 Ga0070672_100136251 Ga0070672_1001362513 334
1205 3300005547 Ga0070693_100156680 Ga0070693_1001566801 334
1206 3300006942 Ga0099824_1000305 Ga0099824_100030510 334
1207 3300006946 Ga0079104_1000156 Ga0079104_100015643 334
1208 3300006948 Ga0099826_10003105 Ga0099826_100031054 334
1209 3300009036 Ga0105244_10000038 Ga0105244_1000003889 334
1210 3300013100 Ga0157373_10000016 Ga0157373_1000001681 334
1211 3300013104 Ga0157370_10000859 Ga0157370_1000085926 334
1212 3300013104 Ga0157370_10011737 Ga0157370_100117378 334
1213 3300013105 Ga0157369_10002012 Ga0157369_1000201212 334
1214 3300013306 Ga0163162_10019993 Ga0163162_100199936 334
1215 3300013308 Ga0157375_10081546 Ga0157375_100815462 334
1216 3300013308 Ga0157375_10089618 Ga0157375_100896183 334
1217 3300015261 Ga0182006_1026570 Ga0182006_10265702 334
1218 3300017792 Ga0163161_10000019 Ga0163161_1000001998 334
1219 3300017792 Ga0163161_10000966 Ga0163161_100009667 334
1220 3300017792 Ga0163161_10026550 Ga0163161_100265502 334
1221 3300017792 Ga0163161_10030291 Ga0163161_100302914 334
1222 3300025728 Ga0207655_1000034 Ga0207655_100003489 334
1223 3300025735 Ga0207713_1033057 Ga0207713_10330571 334
1224 3300025949 Ga0207667_10002393 Ga0207667_100023932 334
1225 3300027111 Ga0209281_1000152 Ga0209281_100015267 334
1226 3300027361 Ga0209489_118825 Ga0209489_1188252 334
1227 3300027876 Ga0209974_10064403 Ga0209974_100644031 334
1228 3300028794 Ga0307515_10187845 Ga0307515_101878452 334
1229 3300031251 Ga0265327_10000668 Ga0265327_1000066812 334
1230 3300031548 Ga0307408_100004582 Ga0307408_1000045823 334
1231 3300031727 Ga0316576_10112213 Ga0316576_101122132 334
1232 3300031731 Ga0307405_10000001 Ga0307405_10000001215 334
1233 3300031824 Ga0307413_10000561 Ga0307413_1000056111 334
1234 3300031852 Ga0307410_10000031 Ga0307410_1000003114 334
1235 3300031901 Ga0307406_10001444 Ga0307406_100014446 334
1236 3300031901 Ga0307406_10003447 Ga0307406_100034477 334
1237 3300031903 Ga0307407_10004004 Ga0307407_100040044 334
1238 3300031911 Ga0307412_10070587 Ga0307412_100705872 334
1239 3300032002 Ga0307416_100000207 Ga0307416_1000002075 334
1240 3300032004 Ga0307414_10000064 Ga0307414_1000006413 334
1241 3300032004 Ga0307414_10060590 Ga0307414_100605903 334
1242 3300032004 Ga0307414_10065563 Ga0307414_100655632 334
1243 3300032004 Ga0307414_10350709 Ga0307414_103507091 334
1244 3300032005 Ga0307411_10000009 Ga0307411_1000000981 334
1245 3300032005 Ga0307411_10001493 Ga0307411_100014935 334
1246 3300032005 Ga0307411_10126858 Ga0307411_101268582 334
1247 3300033180 Ga0307510_10025153 Ga0307510_100251532 334
1248 3300035398 Ga0316574_0088972 Ga0316574_0088972_525_1529 334
1249 3300036712 Ga0316584_0039146 Ga0316584_0039146_2218_3222 334
1250 3300036712 Ga0316584_0048099 Ga0316584_0048099_1618_2622 334
1251 3300041407 Ga0439447_000076 Ga0439447_000076_9502_10506 334
1252 3300046453 Ga0495627_002350 Ga0495627_002350_5590_6594 334
1253 3300046501 Ga0495607_0013843 Ga0495607_0013843_3768_4772 334
1254 3300046507 Ga0495606_0031602 Ga0495606_0031602_829_1833 334
1255 3300046513 Ga0495616_0003146 Ga0495616_0003146_7413_8417 334
1256 3300046522 Ga0495643_0001139 Ga0495643_0001139_13757_14761 334
1257 3300046616 Ga0495668_0000299 Ga0495668_0000299_14650_15672 334
1258 3300046660 Ga0495625_0075767 Ga0495625_0075767_360_1364 334
1259 3300046692 Ga0495671_0057653 Ga0495671_0057653_44_1048 334
1260 3300048917 Ga0496114_0000603 Ga0496114_0000603_6346_7356 334
1261 3300048918 Ga0496115_0010466 Ga0496115_0010466_1559_2563 334
1262 3300048919 Ga0496116_0000075 Ga0496116_0000075_114173_115228 334
1263 3300048920 Ga0496117_0026473 Ga0496117_0026473_1617_2672 334
1264 3300048921 Ga0496118_0051455 Ga0496118_0051455_250_1305 334
1265 3300048924 Ga0496121_0005501 Ga0496121_0005501_14335_15339 334
1266 3300048924 Ga0496121_0147110 Ga0496121_0147110_31_1035 334
1267 3300048927 Ga0496124_0004397 Ga0496124_0004397_6137_7192 334
1268 3300048927 Ga0496124_0289314 Ga0496124_0289314_162_1166 334
1269 3300048928 Ga0496125_0000024 Ga0496125_0000024_25716_26720 334
1270 3300048928 Ga0496125_0000070 Ga0496125_0000070_134214_135269 334
1271 3300049536 Ga0501320_000581 Ga0501320_000581_1204_2208 334
1272 3300049572 Ga0501036_0096748 Ga0501036_0096748_775_1779 334
1273 3300049664 Ga0501224_009232 Ga0501224_009232_366_1370 334
1274 3300049671 Ga0501238_000050 Ga0501238_000050_5797_6801 334
1275 3300049679 Ga0501249_000007 Ga0501249_000007_165088_166092 334
1276 3300049763 Ga0501266_000018 Ga0501266_000018_38116_39120 334
1277 3300049766 Ga0501269_003981 Ga0501269_003981_381_1385 334
1278 3300049776 Ga0501280_000720 Ga0501280_000720_5228_6232 334
1279 3300049822 Ga0501035_0019245 Ga0501035_0019245_1310_2314 334
1280 3300053096 Ga0500641_0000012 Ga0500641_0000012_96342_97346 334
1281 3300053096 Ga0500641_0000164 Ga0500641_0000164_22990_23994 334
1282 3300053096 Ga0500641_0000290 Ga0500641_0000290_1285_2289 334
1283 3300053134 Ga0500658_0000005 Ga0500658_0000005_233787_234791 334
1284 3300053153 Ga0500616_0006133 Ga0500616_0006133_3806_4828 334
1285 3300053158 Ga0500627_0010324 Ga0500627_0010324_1216_2238 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

94

224

1

PF17863

AAA_lid_2

AAA lid domain

298

368

0.96

PF07728

AAA_5

AAA domain (dynein-related subfamily)

94

222

0.86

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

63

267

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.9382 8 334
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.9273 8 334
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.7988 17 329
4upb-assembly1.cif.gz_E electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.782 12 329
4upb-assembly1.cif.gz_C electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.779 12 329
ID Description Score Start End Superfamily
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9859 215 331 1.10.8.80
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9827 218 331 1.10.8.80
2r44A03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9816 215 331 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9776 215 331 1.10.8.80
af_O53314_205_312_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.9741 218 329 1.10.8.80
ID Description Score Start End GO Terms
AF-A0A357XU77-F1-model_v4 ATPase 0.9999 236 334
AF-A0A350NUZ1-F1-model_v4 ATPase 0.9887 9 334 GO:0005524
GO:0016887
AF-A0A519X044-F1-model_v4 MoxR family ATPase 0.9869 23 334 GO:0005524
GO:0016887
AF-C9LDN0-F1-model_v4 ATPase family associated with various cellular activities (AAA) 0.9862 2 334 GO:0005524
GO:0016887
AF-A0A7C2ZI46-F1-model_v4 ATPase 0.9844 80 334 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map