F492411

General Info

Members Datasets Scaffolds Average Seq Length
1271 530 2542 273

Family's Representative Sequence

Representative Sequence 3300012476|Ga0157344_1000282|Ga0157344_10002822
Length 281
Sequence MKRSRNRADATPRGSKAKIALAVLGVAVLIYGLTAYVLLPRAWTHYEHQKGLAGLTMVTHTSQGIPGDPINVGLVGTRKDVLCVMHAAGWYPADPITFRSSVEIVGSVVLRRPYDDAPVSDLYYDGRRDLAFEKPVGESADRRHHVRFWEVLKQGDENRPVWLGSATFDRDVGLSRYTGQVTHHIGPNVDAERDGLTNDLKNSKVVEAVYEVSGVGPTFMGRNGEGDRYFTDGEVKISRLVPGCDRKVETAIELKNPPLVDLKNETWKALAALLGKGAAAN

Samples

Sample ID Description Type Environment
1 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
122 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
123 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
141 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
142 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
158 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
159 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
229 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
230 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
231 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
244 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
245 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
246 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
261 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
262 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
263 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
264 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
265 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
266 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
267 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
268 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
271 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
276 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
313 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
314 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
315 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
316 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
317 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
318 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
319 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
320 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
321 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
322 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
330 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
331 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
332 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
333 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
344 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
349 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
350 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
366 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
367 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
368 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
369 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
370 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
371 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
375 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
390 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
391 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
392 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
393 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
394 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
395 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
396 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
397 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
398 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
399 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
400 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
406 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
407 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
424 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
425 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
429 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
430 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
431 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
440 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
441 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
459 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
460 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
461 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
462 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
463 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
464 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
465 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
466 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
467 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
468 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
469 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
470 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
471 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
472 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
473 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
474 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
475 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
476 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
477 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
478 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
481 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
482 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
483 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
484 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
485 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
486 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
487 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
488 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
489 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
490 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
491 2643221733 Bosea sp. Root381 Isolate Unclassified
492 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
493 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
494 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
495 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
496 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
497 2791355199
498 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
499 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
500 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
501 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
502 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
503 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
504 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
505 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
506 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
507 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
508 2904699407
509 2906610324
510 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
511 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
512 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
513 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
514 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
515 2922425934
516 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
517 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
518 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
519 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
520 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
521 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
522 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
523 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
524 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
525 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
526 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
527 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
528 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
529 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
530 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 0.08
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.25
Nodule 3.07
Rhizoplane 6.85
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157344_1000282 3300012476 Bacteria 1850
2 SwRhRL2b_contig_1310266 2162886007 Bacteria 1712
3 2214800754 2209111006 Bacteria 11091
4 ARSoilYngRDRAFT_c00299 3300000042 Bacteria 7188
5 ARcpr5yngRDRAFT_c000016 3300000043 Bacteria 29226
6 ARSoilOldRDRAFT_c000011 3300000044 Bacteria 42914
7 ARSoilOldRDRAFT_c000296 3300000044 Bacteria 6967
8 ARCol0oldRDRAFT_c00058 3300000045 Bacteria 8766
9 ARCol0yngRDRAFT_1000018 3300000652 Bacteria 30924
10 JGI24746J21847_1001996 3300001977 Bacteria 3252
11 JGI24747J21853_1000082 3300001978 Bacteria 4068
12 JGI24740J21852_10016896 3300001979 Bacteria 2624
13 JGI24739J22299_10003664 3300001989 Bacteria 5862
14 JGI24737J22298_10002982 3300001990 Bacteria 5997
15 JGI24750J21931_1000658 3300002070 Bacteria 5137
16 JGI24748J21848_1002791 3300002074 Bacteria 1987
17 JGI24738J21930_10001701 3300002075 Bacteria 6018
18 JGI24749J21850_1001295 3300002076 Bacteria 3546
19 JGI24744J21845_10004447 3300002077 Bacteria 2898
20 JGI24035J26624_1000095 3300002126 Bacteria 7456
21 JGI24034J26672_10000699 3300002239 Bacteria 4307
22 JGI24751J29686_10022618 3300002459 Bacteria 1304
23 JGI25406J46586_10006379 3300003203 Bacteria 5439
24 JGI25153J46596_10003598 3300003215 Bacteria 8605
25 JGI25153J46596_10004203 3300003215 Bacteria 7809
26 JGI25153J46596_10004900 3300003215 Bacteria 7115
27 JGI25404J52841_10012877 3300003659 Bacteria 1814
28 JGI25404J52841_10019217 3300003659 Bacteria 1480
29 Ga0065704_10075339 3300005289 Bacteria 5650
30 Ga0065712_10004981 3300005290 Bacteria 4244
31 Ga0065712_10069431 3300005290 Bacteria 7310
32 Ga0065715_10094058 3300005293 Bacteria 4457
33 Ga0065707_10123422 3300005295 Bacteria 2066
34 Ga0070676_10005715 3300005328 Bacteria 6629
35 Ga0070676_10082633 3300005328 Unclassified 1952
36 Ga0070676_10262670 3300005328 Bacteria 1157
37 Ga0070683_100001578 3300005329 Bacteria 17633
38 Ga0070683_100069464 3300005329 Bacteria 3284
39 Ga0070690_100000317 3300005330 Bacteria 24874
40 Ga0070690_100012441 3300005330 Bacteria 5006
41 Ga0070690_100055191 3300005330 Bacteria 2544
42 Ga0070670_100021689 3300005331 Bacteria 5523
43 Ga0070670_100149474 3300005331 Bacteria 2021
44 Ga0070670_100251625 3300005331 Unclassified 1539
45 Ga0070677_10001615 3300005333 Bacteria 7123
46 Ga0068869_100009045 3300005334 Bacteria 6456
47 Ga0068869_100104468 3300005334 Bacteria 2147
48 Ga0068869_100175075 3300005334 Bacteria 1679
49 Ga0068869_100180563 3300005334 Bacteria 1654
50 Ga0070666_10028616 3300005335 Bacteria 3658
51 Ga0070666_10091866 3300005335 Bacteria 2086
52 Ga0070680_100018000 3300005336 Bacteria 5579
53 Ga0070680_100069931 3300005336 Bacteria 2883
54 Ga0070680_100080931 3300005336 Bacteria 2679
55 Ga0070682_100006267 3300005337 Bacteria 6672
56 Ga0070682_100094705 3300005337 Bacteria 1960
57 Ga0070682_100108820 3300005337 Unclassified 1843
58 Ga0070682_100183135 3300005337 Bacteria 1465
59 Ga0068868_100033097 3300005338 Bacteria 3983
60 Ga0068868_100042420 3300005338 Bacteria 3551
61 Ga0068868_100103360 3300005338 Unclassified 2308
62 Ga0068868_100107551 3300005338 Bacteria 2263
63 Ga0070660_100004871 3300005339 Bacteria 9275
64 Ga0070660_100049909 3300005339 Bacteria 3218
65 Ga0070660_100142997 3300005339 Bacteria 1920
66 Ga0070660_100359286 3300005339 Bacteria 1200
67 Ga0070689_100002987 3300005340 Bacteria 11119
68 Ga0070689_100019991 3300005340 Bacteria 4962
69 Ga0070689_100095383 3300005340 Unclassified 2349
70 Ga0070689_100127987 3300005340 Bacteria 2034
71 Ga0070689_100227586 3300005340 Bacteria 1532
72 Ga0070691_10005410 3300005341 Bacteria 5807
73 Ga0070691_10082214 3300005341 Bacteria 1579
74 Ga0070691_10207682 3300005341 Bacteria 1032
75 Ga0070687_100002357 3300005343 Bacteria 7043
76 Ga0070661_100004564 3300005344 Bacteria 9524
77 Ga0070661_100056606 3300005344 Bacteria 2873
78 Ga0070661_100212076 3300005344 Unclassified 1483
79 Ga0070692_10005247 3300005345 Bacteria 5498
80 Ga0070692_10009078 3300005345 Bacteria 4467
81 Ga0070668_100011260 3300005347 Bacteria 6662
82 Ga0070668_100071444 3300005347 Bacteria 2704
83 Ga0070668_100545576 3300005347 Bacteria 1008
84 Ga0070669_100012130 3300005353 Bacteria 6116
85 Ga0070669_100014076 3300005353 Bacteria 5689
86 Ga0070669_100121994 3300005353 Bacteria 1989
87 Ga0070675_100027426 3300005354 Bacteria 4575
88 Ga0070675_100211378 3300005354 Bacteria 1686
89 Ga0070671_100013351 3300005355 Bacteria 6621
90 Ga0070671_100106860 3300005355 Bacteria 2350
91 Ga0070671_100180218 3300005355 Unclassified 1788
92 Ga0070671_100211734 3300005355 Bacteria 1644
93 Ga0070674_100004148 3300005356 Bacteria 8229
94 Ga0070674_100037906 3300005356 Bacteria 3245
95 Ga0070674_100131500 3300005356 Unclassified 1866
96 Ga0070674_100182904 3300005356 Bacteria 1607
97 Ga0070673_100006382 3300005364 Bacteria 7663
98 Ga0070673_100041153 3300005364 Bacteria 3550
99 Ga0070673_100667495 3300005364 Bacteria 953
100 Ga0070688_100007113 3300005365 Bacteria 6023
101 Ga0070688_100008074 3300005365 Bacteria 5699
102 Ga0070688_100392394 3300005365 Bacteria 1025
103 Ga0070659_100021218 3300005366 Bacteria 4942
104 Ga0070659_100021801 3300005366 Bacteria 4884
105 Ga0070659_100034194 3300005366 Bacteria 3952
106 Ga0070659_100040056 3300005366 Bacteria 3661
107 Ga0070659_100085539 3300005366 Bacteria 2522
108 Ga0070659_100174891 3300005366 Bacteria 1760
109 Ga0070659_100181295 3300005366 Bacteria 1728
110 Ga0070667_100014112 3300005367 Bacteria 6601
111 Ga0070667_100179805 3300005367 Bacteria 1870
112 Ga0070667_100297624 3300005367 Bacteria 1452
113 Ga0070703_10018408 3300005406 Bacteria 2019
114 Ga0070709_10006522 3300005434 Bacteria 6362
115 Ga0070709_10332602 3300005434 Bacteria 1118
116 Ga0070714_100032388 3300005435 Bacteria 4362
117 Ga0070714_100240730 3300005435 Bacteria 1670
118 Ga0070714_100363721 3300005435 Bacteria 1361
119 Ga0070713_100003148 3300005436 Bacteria 10865
120 Ga0070713_100009774 3300005436 Bacteria 6893
121 Ga0070713_100086450 3300005436 Bacteria 2688
122 Ga0070713_100087509 3300005436 Unclassified 2672
123 Ga0070713_100109217 3300005436 Bacteria 2410
124 Ga0070713_100175757 3300005436 Bacteria 1921
125 Ga0070713_100438649 3300005436 Bacteria 1225
126 Ga0070710_10002456 3300005437 Bacteria 8781
127 Ga0070710_10116452 3300005437 Unclassified 1612
128 Ga0070701_10000656 3300005438 Bacteria 12133
129 Ga0070711_100014604 3300005439 Unclassified 4949
130 Ga0070711_100312455 3300005439 Bacteria 1253
131 Ga0070705_100008451 3300005440 Bacteria 5101
132 Ga0070705_100056841 3300005440 Bacteria 2305
133 Ga0070700_100013984 3300005441 Bacteria 4523
134 Ga0070700_100079109 3300005441 Bacteria 2118
135 Ga0070694_100005726 3300005444 Bacteria 7538
136 Ga0070708_100071378 3300005445 Bacteria 3126
137 Ga0070708_100131472 3300005445 Bacteria 2317
138 Ga0070708_100193628 3300005445 Bacteria 1902
139 Ga0070708_100339863 3300005445 Bacteria 1415
140 Ga0070663_100003512 3300005455 Bacteria 9052
141 Ga0070663_100010818 3300005455 Bacteria 5699
142 Ga0070663_100291030 3300005455 Bacteria 1304
143 Ga0070678_100010317 3300005456 Bacteria 5699
144 Ga0070678_100019792 3300005456 Bacteria 4399
145 Ga0070678_100022922 3300005456 Bacteria 4150
146 Ga0070678_100023098 3300005456 Bacteria 4137
147 Ga0070662_100041448 3300005457 Bacteria 3284
148 Ga0070662_100047743 3300005457 Bacteria 3081
149 Ga0070662_100054329 3300005457 Bacteria 2902
150 Ga0070662_100093467 3300005457 Bacteria 2262
151 Ga0070662_100557245 3300005457 Bacteria 961
152 Ga0070681_10002401 3300005458 Bacteria 17118
153 Ga0070681_10032469 3300005458 Bacteria 5239
154 Ga0070681_10117011 3300005458 Bacteria 2602
155 Ga0070681_10273722 3300005458 Bacteria 1600
156 Ga0068867_100007228 3300005459 Bacteria 7851
157 Ga0068867_100070408 3300005459 Bacteria 2615
158 Ga0068867_100198629 3300005459 Unclassified 1604
159 Ga0068867_100281689 3300005459 Bacteria 1363
160 Ga0070685_10001672 3300005466 Bacteria 11650
161 Ga0070685_10007202 3300005466 Bacteria 5685
162 Ga0070706_100247178 3300005467 Bacteria 1666
163 Ga0070698_100158372 3300005471 Bacteria 2209
164 Ga0070679_100026366 3300005530 Bacteria 5709
165 Ga0070679_100329404 3300005530 Bacteria 1476
166 Ga0070679_100503901 3300005530 Bacteria 1155
167 Ga0070684_100006426 3300005535 Bacteria 9095
168 Ga0070684_100018816 3300005535 Bacteria 5699
169 Ga0070684_100039628 3300005535 Bacteria 4054
170 Ga0070697_100139097 3300005536 Bacteria 2041
171 Ga0068853_100031431 3300005539 Bacteria 4491
172 Ga0068853_100059399 3300005539 Bacteria 3303
173 Ga0068853_100068079 3300005539 Bacteria 3094
174 Ga0068853_100112877 3300005539 Bacteria 2415
175 Ga0068853_100295667 3300005539 Bacteria 1495
176 Ga0068853_100403400 3300005539 Bacteria 1280
177 Ga0070672_100012277 3300005543 Bacteria 6005
178 Ga0070672_100516363 3300005543 Bacteria 1035
179 Ga0070686_100008469 3300005544 Bacteria 5759
180 Ga0070686_100068694 3300005544 Unclassified 2312
181 Ga0070695_100005342 3300005545 Bacteria 7564
182 Ga0070695_100019542 3300005545 Bacteria 4125
183 Ga0070693_100018128 3300005547 Bacteria 3672
184 Ga0070693_100024747 3300005547 Bacteria 3223
185 Ga0070665_100011785 3300005548 Bacteria 8830
186 Ga0070665_100023550 3300005548 Bacteria 6200
187 Ga0070665_100024295 3300005548 Bacteria 6102
188 Ga0070665_100125021 3300005548 Plasmid 2574
189 Ga0070665_100212052 3300005548 Bacteria 1937
190 Ga0070665_100218691 3300005548 Bacteria 1905
191 Ga0070704_100010246 3300005549 Bacteria 5699
192 Ga0070704_100015863 3300005549 Bacteria 4744
193 Ga0070704_100178960 3300005549 Bacteria 1694
194 Ga0068855_100105152 3300005563 Bacteria 3246
195 Ga0068855_100115627 3300005563 Bacteria 3075
196 Ga0068855_100199102 3300005563 Bacteria 2256
197 Ga0068855_100404275 3300005563 Unclassified 1496
198 Ga0068855_100533612 3300005563 Bacteria 1272
199 Ga0068855_100706459 3300005563 Bacteria 1078
200 Ga0070664_100008431 3300005564 Bacteria 8334
201 Ga0070664_100081828 3300005564 Unclassified 2783
202 Ga0068857_100000358 3300005577 Bacteria 31869
203 Ga0068857_100395263 3300005577 Bacteria 1286
204 Ga0068854_100005944 3300005578 Bacteria 7732
205 Ga0068854_100220291 3300005578 Bacteria 1501
206 Ga0068854_100275776 3300005578 Bacteria 1352
207 Ga0068854_100312437 3300005578 Bacteria 1275
208 Ga0068854_100578881 3300005578 Bacteria 956
209 Ga0068856_100007430 3300005614 Bacteria 10692
210 Ga0068856_100028358 3300005614 Bacteria 5467
211 Ga0068856_100118304 3300005614 Bacteria 2651
212 Ga0068856_100593350 3300005614 Bacteria 1129
213 Ga0070702_100002143 3300005615 Bacteria 8385
214 Ga0070702_100047599 3300005615 Bacteria 2436
215 Ga0070702_100111499 3300005615 Bacteria 1696
216 Ga0070702_100259671 3300005615 Bacteria 1182
217 Ga0068852_100006913 3300005616 Bacteria 8251
218 Ga0068852_100065156 3300005616 Bacteria 3178
219 Ga0068852_100190291 3300005616 Bacteria 1936
220 Ga0068852_100402518 3300005616 Bacteria 1347
221 Ga0068859_100009657 3300005617 Bacteria 9741
222 Ga0068859_100009678 3300005617 Bacteria 9729
223 Ga0068859_100102862 3300005617 Bacteria 2914
224 Ga0068859_100186919 3300005617 Unclassified 2156
225 Ga0068859_100218697 3300005617 Bacteria 1992
226 Ga0068864_100002272 3300005618 Bacteria 15889
227 Ga0068864_100198827 3300005618 Bacteria 1840
228 Ga0068866_10000358 3300005718 Bacteria 21438
229 Ga0068861_100010301 3300005719 Bacteria 6487
230 Ga0068861_100108017 3300005719 Bacteria 2225
231 Ga0068870_10000025 3300005840 Bacteria 46848
232 Ga0068863_100018070 3300005841 Bacteria 6753
233 Ga0068863_100214954 3300005841 Bacteria 1852
234 Ga0068858_100007959 3300005842 Bacteria 10215
235 Ga0068858_100066757 3300005842 Bacteria 3331
236 Ga0068858_100239483 3300005842 Bacteria 1721
237 Ga0068858_100351150 3300005842 Bacteria 1412
238 Ga0068858_100400654 3300005842 Bacteria 1318
239 Ga0068860_100008914 3300005843 Bacteria 9996
240 Ga0068860_100043626 3300005843 Bacteria 4277
241 Ga0068860_100077524 3300005843 Bacteria 3160
242 Ga0068862_100019145 3300005844 Bacteria 5708
243 Ga0068862_100019155 3300005844 Bacteria 5706
244 Ga0068862_100036577 3300005844 Bacteria 4161
245 Ga0068862_100354770 3300005844 Bacteria 1361
246 Ga0081455_10011459 3300005937 Bacteria 8907
247 Ga0081455_10023546 3300005937 Bacteria 5729
248 Ga0081455_10028858 3300005937 Bacteria 5064
249 Ga0081455_10104063 3300005937 Bacteria 2272
250 Ga0081538_10087030 3300005981 Bacteria 1633
251 Ga0081540_1000094 3300005983 Bacteria 93201
252 Ga0081540_1001430 3300005983 Bacteria 20638
253 Ga0081540_1001921 3300005983 Bacteria 17417
254 Ga0081540_1003396 3300005983 Bacteria 12619
255 Ga0081540_1003410 3300005983 Bacteria 12579
256 Ga0081540_1003755 3300005983 Bacteria 11903
257 Ga0081540_1008562 3300005983 Bacteria 7138
258 Ga0081540_1009897 3300005983 Bacteria 6508
259 Ga0081540_1014017 3300005983 Bacteria 5170
260 Ga0081540_1014781 3300005983 Bacteria 4976
261 Ga0081539_10000576 3300005985 Bacteria 75490
262 Ga0070717_10000634 3300006028 Bacteria 22593
263 Ga0070717_10010988 3300006028 Bacteria 6856
264 Ga0070717_10017729 3300006028 Bacteria 5545
265 Ga0075368_10059626 3300006042 Bacteria 1527
266 Ga0075363_100004592 3300006048 Bacteria 6060
267 Ga0075364_10034926 3300006051 Bacteria 3247
268 Ga0070715_10073674 3300006163 Bacteria 1532
269 Ga0070716_100001804 3300006173 Bacteria 9699
270 Ga0070716_100299080 3300006173 Bacteria 1118
271 Ga0075367_10046222 3300006178 Bacteria 2557
272 Ga0075367_10096250 3300006178 Bacteria 1805
273 Ga0075367_10119768 3300006178 Bacteria 1621
274 Ga0075367_10242943 3300006178 Bacteria 1128
275 Ga0075369_10006714 3300006186 Bacteria 4363
276 Ga0075366_10071490 3300006195 Bacteria 2067
277 Ga0097621_100016388 3300006237 Bacteria 5602
278 Ga0097621_100051635 3300006237 Bacteria 3346
279 Ga0097621_100250537 3300006237 Unclassified 1551
280 Ga0075370_10015849 3300006353 Bacteria 4044
281 Ga0068871_100002009 3300006358 Bacteria 13770
282 Ga0068871_100025271 3300006358 Bacteria 4618
283 Ga0068871_100057023 3300006358 Bacteria 3176
284 Ga0068871_100196823 3300006358 Bacteria 1738
285 Ga0075428_100051601 3300006844 Bacteria 4510
286 Ga0075428_100213858 3300006844 Bacteria 2083
287 Ga0075433_10002066 3300006852 Bacteria 15176
288 Ga0075433_10022602 3300006852 Bacteria 5281
289 Ga0075434_100015564 3300006871 Bacteria 7300
290 Ga0075434_100022929 3300006871 Bacteria 6076
291 Ga0068865_100006423 3300006881 Bacteria 7170
292 Ga0068865_100020100 3300006881 Bacteria 4330
293 Ga0068865_100023595 3300006881 Bacteria 4029
294 Ga0068865_100143772 3300006881 Bacteria 1801
295 Ga0068865_100160164 3300006881 Bacteria 1716
296 Ga0075436_100043792 3300006914 Unclassified 3086
297 Ga0097620_100009656 3300006931 Bacteria 9741
298 Ga0097620_100009681 3300006931 Bacteria 9729
299 Ga0097620_100102866 3300006931 Bacteria 2914
300 Ga0097620_100186919 3300006931 Unclassified 2156
301 Ga0097620_100218700 3300006931 Bacteria 1992
302 Ga0099825_1039685 3300006941 Bacteria 1434
303 Ga0099824_1012080 3300006942 Bacteria 9538
304 Ga0099822_1022705 3300006943 Bacteria 5882
305 Ga0075435_100033865 3300007076 Bacteria 4043
306 Ga0075435_100060859 3300007076 Plasmid 3062
307 Ga0075435_100330562 3300007076 Bacteria 1305
308 Ga0105250_10028063 3300009092 Bacteria 2267
309 Ga0105250_10060546 3300009092 Bacteria 1521
310 Ga0105240_10035173 3300009093 Bacteria 6458
311 Ga0105240_10040699 3300009093 Bacteria 5941
312 Ga0111539_10015594 3300009094 Bacteria 9449
313 Ga0111539_10028243 3300009094 Bacteria 6847
314 Ga0111539_10063264 3300009094 Bacteria 4379
315 Ga0111539_10095372 3300009094 Unclassified 3494
316 Ga0111539_10114723 3300009094 Plasmid 3160
317 Ga0105245_10005724 3300009098 Bacteria 10914
318 Ga0105245_10628499 3300009098 Bacteria 1102
319 Ga0105247_10010313 3300009101 Bacteria 5651
320 Ga0114129_10028721 3300009147 Bacteria 7881
321 Ga0114129_10190378 3300009147 Bacteria 2786
322 Ga0114129_10303165 3300009147 Bacteria 2128
323 Ga0105243_10015784 3300009148 Bacteria 5711
324 Ga0105243_10042388 3300009148 Bacteria 3563
325 Ga0105243_10078808 3300009148 Bacteria 2683
326 Ga0105243_10412601 3300009148 Bacteria 1257
327 Ga0105241_10021878 3300009174 Bacteria 4733
328 Ga0105241_10060326 3300009174 Bacteria 2918
329 Ga0105241_10315378 3300009174 Unclassified 1346
330 Ga0105242_10019259 3300009176 Bacteria 5346
331 Ga0105242_10028442 3300009176 Bacteria 4451
332 Ga0105242_10036531 3300009176 Bacteria 3942
333 Ga0105242_10153849 3300009176 Bacteria 2007
334 Ga0105242_10302393 3300009176 Bacteria 1461
335 Ga0105248_10002041 3300009177 Bacteria 22378
336 Ga0105248_10005510 3300009177 Bacteria 13903
337 Ga0105248_10037197 3300009177 Bacteria 5445
338 Ga0105248_10177382 3300009177 Bacteria 2401
339 Ga0105248_10228964 3300009177 Unclassified 2092
340 Ga0105237_10016489 3300009545 Bacteria 7674
341 Ga0105237_10051821 3300009545 Bacteria 4122
342 Ga0105237_10090529 3300009545 Unclassified 3048
343 Ga0105237_10118870 3300009545 Bacteria 2637
344 Ga0105238_10108221 3300009551 Bacteria 2761
345 Ga0105238_10120133 3300009551 Bacteria 2608
346 Ga0105238_10178701 3300009551 Bacteria 2099
347 Ga0105249_10022058 3300009553 Bacteria 5702
348 Ga0105249_10076537 3300009553 Bacteria 3102
349 Ga0105249_10156770 3300009553 Bacteria 2196
350 Ga0105239_10201726 3300010375 Bacteria 2228
351 Ga0105239_10359180 3300010375 Bacteria 1645
352 Ga0105239_10632725 3300010375 Bacteria 1221
353 Ga0105246_10019451 3300011119 Bacteria 4339
354 Ga0105246_10070598 3300011119 Bacteria 2457
355 Ga0105246_10097388 3300011119 Bacteria 2134
356 Ga0105246_10263671 3300011119 Bacteria 1374
357 Ga0157347_1004878 3300012502 Unclassified 1263
358 Ga0157342_1000220 3300012507 Bacteria 3108
359 Ga0157326_1001234 3300012513 Bacteria 2847
360 Ga0157373_10125608 3300013100 Bacteria 1804
361 Ga0157373_10216555 3300013100 Bacteria 1351
362 Ga0157371_10011449 3300013102 Bacteria 6829
363 Ga0157371_10077316 3300013102 Bacteria 2357
364 Ga0157369_10052265 3300013105 Bacteria 4422
365 Ga0157369_10068416 3300013105 Bacteria 3815
366 Ga0157369_10164220 3300013105 Bacteria 2342
367 Ga0157374_10020164 3300013296 Bacteria 5911
368 Ga0157374_10042005 3300013296 Bacteria 4216
369 Ga0157374_10228870 3300013296 Bacteria 1826
370 Ga0157374_10295784 3300013296 Bacteria 1601
371 Ga0157378_10002347 3300013297 Bacteria 16816
372 Ga0157378_10011414 3300013297 Bacteria 7778
373 Ga0157378_10022614 3300013297 Bacteria 5532
374 Ga0163162_10048931 3300013306 Bacteria 4236
375 Ga0163162_10055539 3300013306 Plasmid 3987
376 Ga0163162_10101466 3300013306 Bacteria 2969
377 Ga0163162_10371269 3300013306 Bacteria 1564
378 Ga0163162_10566053 3300013306 Bacteria 1264
379 Ga0157372_10030789 3300013307 Bacteria 5871
380 Ga0157372_10052452 3300013307 Bacteria 4541
381 Ga0157375_10014931 3300013308 Bacteria 6944
382 Ga0157375_10023326 3300013308 Bacteria 5709
383 Ga0157375_10054066 3300013308 Bacteria 3953
384 Ga0157375_10532737 3300013308 Unclassified 1337
385 Ga0163163_10009112 3300014325 Bacteria 8844
386 Ga0163163_10024529 3300014325 Bacteria 5740
387 Ga0163163_10027579 3300014325 Bacteria 5442
388 Ga0157380_10013011 3300014326 Bacteria 6051
389 Ga0157377_10013159 3300014745 Bacteria 4181
390 Ga0157377_10036710 3300014745 Bacteria 2697
391 Ga0157379_10017138 3300014968 Bacteria 6379
392 Ga0157379_10045825 3300014968 Bacteria 3903
393 Ga0157379_10105871 3300014968 Bacteria 2525
394 Ga0157379_10593394 3300014968 Bacteria 1033
395 Ga0157379_10610834 3300014968 Bacteria 1018
396 Ga0157376_10014690 3300014969 Bacteria 5887
397 Ga0157376_10104478 3300014969 Unclassified 2482
398 Ga0157376_10200906 3300014969 Bacteria 1834
399 Ga0157376_10318070 3300014969 Bacteria 1479
400 Ga0163161_10014960 3300017792 Bacteria 5405
401 Ga0163161_10015751 3300017792 Bacteria 5273
402 Ga0163161_10021341 3300017792 Bacteria 4552
403 Ga0163161_10565574 3300017792 Bacteria 933
404 Ga0213873_10004209 3300021358 Unclassified 2664
405 Ga0213876_10001149 3300021384 Bacteria 16763
406 Ga0213875_10013263 3300021388 Bacteria 4052
407 Ga0207666_1000252 3300025271 Bacteria 7908
408 Ga0207673_1000312 3300025290 Bacteria 4922
409 Ga0209564_1000383 3300025295 Bacteria 81061
410 Ga0209758_1001636 3300025297 Bacteria 25462
411 Ga0209758_1002075 3300025297 Bacteria 21325
412 Ga0209758_1008580 3300025297 Bacteria 6576
413 Ga0209758_1018169 3300025297 Bacteria 3462
414 Ga0207697_10005344 3300025315 Bacteria 5985
415 Ga0207697_10009401 3300025315 Bacteria 4225
416 Ga0207697_10037382 3300025315 Bacteria 1989
417 Ga0207696_1025900 3300025711 Bacteria 1822
418 Ga0207682_10000607 3300025893 Bacteria 16670
419 Ga0207692_10027781 3300025898 Bacteria 2669
420 Ga0207692_10038252 3300025898 Bacteria 2352
421 Ga0207692_10175613 3300025898 Bacteria 1244
422 Ga0207642_10232852 3300025899 Bacteria 1036
423 Ga0207710_10005316 3300025900 Bacteria 5557
424 Ga0207710_10005663 3300025900 Bacteria 5376
425 Ga0207710_10030021 3300025900 Unclassified 2369
426 Ga0207688_10007436 3300025901 Bacteria 5957
427 Ga0207688_10050955 3300025901 Unclassified 2318
428 Ga0207680_10010462 3300025903 Bacteria 4641
429 Ga0207680_10012061 3300025903 Bacteria 4392
430 Ga0207680_10228431 3300025903 Bacteria 1278
431 Ga0207647_10017211 3300025904 Bacteria 4917
432 Ga0207699_10057881 3300025906 Bacteria 2316
433 Ga0207699_10113722 3300025906 Bacteria 1739
434 Ga0207699_10277636 3300025906 Bacteria 1163
435 Ga0207699_10348287 3300025906 Bacteria 1045
436 Ga0207645_10011758 3300025907 Bacteria 5964
437 Ga0207645_10018911 3300025907 Bacteria 4525
438 Ga0207645_10117274 3300025907 Bacteria 1727
439 Ga0207643_10000397 3300025908 Bacteria 29056
440 Ga0207705_10243621 3300025909 Bacteria 1370
441 Ga0207684_10179289 3300025910 Bacteria 1826
442 Ga0207684_10287907 3300025910 Bacteria 1417
443 Ga0207654_10012414 3300025911 Bacteria 4366
444 Ga0207654_10040574 3300025911 Bacteria 2624
445 Ga0207707_10088697 3300025912 Bacteria 2702
446 Ga0207707_10153772 3300025912 Bacteria 2011
447 Ga0207707_10168694 3300025912 Bacteria 1913
448 Ga0207707_10188795 3300025912 Bacteria 1798
449 Ga0207671_10012726 3300025914 Bacteria 6748
450 Ga0207671_10052945 3300025914 Bacteria 3008
451 Ga0207693_10003052 3300025915 Bacteria 14462
452 Ga0207693_10012826 3300025915 Bacteria 6760
453 Ga0207663_10006864 3300025916 Bacteria 5862
454 Ga0207663_10050794 3300025916 Bacteria 2579
455 Ga0207660_10000850 3300025917 Bacteria 20128
456 Ga0207660_10016424 3300025917 Bacteria 4900
457 Ga0207660_10029194 3300025917 Bacteria 3779
458 Ga0207660_10169783 3300025917 Bacteria 1688
459 Ga0207662_10004603 3300025918 Bacteria 7271
460 Ga0207662_10009872 3300025918 Bacteria 5267
461 Ga0207657_10001022 3300025919 Bacteria 29697
462 Ga0207657_10017741 3300025919 Bacteria 6815
463 Ga0207657_10021802 3300025919 Bacteria 6018
464 Ga0207657_10073397 3300025919 Bacteria 2891
465 Ga0207657_10368253 3300025919 Bacteria 1132
466 Ga0207657_10398939 3300025919 Bacteria 1082
467 Ga0207649_10001199 3300025920 Bacteria 15630
468 Ga0207649_10066945 3300025920 Bacteria 2279
469 Ga0207649_10278713 3300025920 Bacteria 1215
470 Ga0207652_10001750 3300025921 Bacteria 18954
471 Ga0207652_10144210 3300025921 Bacteria 2130
472 Ga0207652_10326970 3300025921 Bacteria 1384
473 Ga0207652_10397696 3300025921 Bacteria 1243
474 Ga0207681_10002492 3300025923 Bacteria 11695
475 Ga0207681_10079752 3300025923 Bacteria 2307
476 Ga0207681_10324445 3300025923 Bacteria 1225
477 Ga0207694_10511339 3300025924 Bacteria 1006
478 Ga0207650_10005388 3300025925 Bacteria 8726
479 Ga0207650_10007437 3300025925 Bacteria 7466
480 Ga0207650_10085363 3300025925 Bacteria 2401
481 Ga0207650_10230552 3300025925 Bacteria 1493
482 Ga0207659_10000923 3300025926 Bacteria 17507
483 Ga0207659_10272673 3300025926 Bacteria 1380
484 Ga0207659_10317891 3300025926 Bacteria 1283
485 Ga0207687_10005521 3300025927 Bacteria 8365
486 Ga0207687_10269276 3300025927 Bacteria 1361
487 Ga0207700_10003926 3300025928 Bacteria 8689
488 Ga0207700_10005821 3300025928 Bacteria 7405
489 Ga0207700_10070039 3300025928 Bacteria 2695
490 Ga0207700_10231802 3300025928 Unclassified 1570
491 Ga0207664_10034648 3300025929 Bacteria 3889
492 Ga0207664_10069970 3300025929 Plasmid 2823
493 Ga0207664_10160917 3300025929 Bacteria 1915
494 Ga0207664_10185373 3300025929 Bacteria 1789
495 Ga0207664_10196765 3300025929 Bacteria 1738
496 Ga0207644_10015795 3300025931 Bacteria 5076
497 Ga0207644_10277569 3300025931 Bacteria 1345
498 Ga0207644_10383933 3300025931 Bacteria 1146
499 Ga0207690_10003249 3300025932 Bacteria 9751
500 Ga0207690_10018277 3300025932 Bacteria 4298
501 Ga0207690_10115082 3300025932 Bacteria 1943
502 Ga0207706_10007463 3300025933 Bacteria 10112
503 Ga0207706_10021728 3300025933 Bacteria 5760
504 Ga0207706_10027879 3300025933 Bacteria 5048
505 Ga0207706_10041497 3300025933 Bacteria 4079
506 Ga0207706_10067767 3300025933 Bacteria 3141
507 Ga0207706_10103381 3300025933 Bacteria 2506
508 Ga0207686_10017959 3300025934 Bacteria 3997
509 Ga0207686_10083437 3300025934 Bacteria 2091
510 Ga0207686_10097215 3300025934 Bacteria 1958
511 Ga0207686_10140705 3300025934 Bacteria 1667
512 Ga0207709_10001261 3300025935 Bacteria 18148
513 Ga0207709_10055539 3300025935 Bacteria 2447
514 Ga0207670_10000898 3300025936 Bacteria 15693
515 Ga0207670_10028808 3300025936 Bacteria 3530
516 Ga0207669_10000616 3300025937 Bacteria 15473
517 Ga0207669_10092155 3300025937 Unclassified 1976
518 Ga0207704_10003913 3300025938 Bacteria 6771
519 Ga0207704_10036500 3300025938 Bacteria 2828
520 Ga0207704_10149527 3300025938 Bacteria 1646
521 Ga0207665_10001758 3300025939 Bacteria 14547
522 Ga0207665_10023515 3300025939 Bacteria 4059
523 Ga0207665_10099804 3300025939 Bacteria 2025
524 Ga0207691_10030394 3300025940 Bacteria 5048
525 Ga0207691_10041614 3300025940 Bacteria 4241
526 Ga0207711_10010610 3300025941 Bacteria 7661
527 Ga0207711_10019726 3300025941 Bacteria 5616
528 Ga0207711_10141437 3300025941 Unclassified 2165
529 Ga0207711_10294669 3300025941 Bacteria 1495
530 Ga0207711_10415462 3300025941 Bacteria 1251
531 Ga0207689_10039266 3300025942 Bacteria 3919
532 Ga0207661_10008182 3300025944 Bacteria 7464
533 Ga0207661_10028175 3300025944 Bacteria 4299
534 Ga0207661_10161762 3300025944 Bacteria 1943
535 Ga0207679_10000624 3300025945 Bacteria 23633
536 Ga0207679_10002602 3300025945 Bacteria 11113
537 Ga0207679_10130207 3300025945 Bacteria 2017
538 Ga0207679_10150096 3300025945 Unclassified 1895
539 Ga0207667_10125229 3300025949 Bacteria 2646
540 Ga0207667_10138551 3300025949 Bacteria 2505
541 Ga0207667_10170681 3300025949 Bacteria 2236
542 Ga0207667_10184967 3300025949 Bacteria 2139
543 Ga0207667_10258372 3300025949 Bacteria 1781
544 Ga0207667_10278104 3300025949 Bacteria 1711
545 Ga0207667_10344216 3300025949 Unclassified 1521
546 Ga0207651_10002018 3300025960 Bacteria 9542
547 Ga0207651_10065021 3300025960 Bacteria 2556
548 Ga0207712_10008156 3300025961 Bacteria 6621
549 Ga0207712_10019512 3300025961 Bacteria 4429
550 Ga0207712_10073619 3300025961 Bacteria 2465
551 Ga0207712_10117680 3300025961 Bacteria 2005
552 Ga0207668_10007113 3300025972 Bacteria 6639
553 Ga0207668_10030141 3300025972 Bacteria 3562
554 Ga0207668_10067147 3300025972 Bacteria 2545
555 Ga0207668_10068097 3300025972 Bacteria 2529
556 Ga0207668_10350369 3300025972 Bacteria 1234
557 Ga0207640_10004625 3300025981 Bacteria 7471
558 Ga0207658_10020018 3300025986 Bacteria 4631
559 Ga0207658_10029919 3300025986 Bacteria 3851
560 Ga0207658_10234157 3300025986 Bacteria 1552
561 Ga0207658_10319369 3300025986 Bacteria 1344
562 Ga0207677_10001740 3300026023 Bacteria 11549
563 Ga0207677_10026098 3300026023 Bacteria 3658
564 Ga0207677_10138709 3300026023 Bacteria 1858
565 Ga0207703_10004099 3300026035 Bacteria 12027
566 Ga0207703_10152353 3300026035 Bacteria 2017
567 Ga0207703_10177381 3300026035 Bacteria 1878
568 Ga0207703_10200158 3300026035 Bacteria 1774
569 Ga0207703_10334493 3300026035 Bacteria 1390
570 Ga0207639_10009424 3300026041 Bacteria 6736
571 Ga0207639_10027093 3300026041 Bacteria 4171
572 Ga0207639_10081032 3300026041 Bacteria 2570
573 Ga0207639_10103956 3300026041 Bacteria 2302
574 Ga0207639_10255366 3300026041 Bacteria 1530
575 Ga0207639_10503441 3300026041 Bacteria 1107
576 Ga0207678_10004907 3300026067 Bacteria 12015
577 Ga0207678_10007002 3300026067 Bacteria 10009
578 Ga0207678_10018352 3300026067 Bacteria 6145
579 Ga0207678_10025184 3300026067 Bacteria 5194
580 Ga0207678_10056387 3300026067 Bacteria 3382
581 Ga0207678_10056627 3300026067 Bacteria 3374
582 Ga0207678_10076349 3300026067 Bacteria 2870
583 Ga0207678_10219292 3300026067 Bacteria 1628
584 Ga0207708_10005694 3300026075 Bacteria 9210
585 Ga0207708_10019999 3300026075 Bacteria 5048
586 Ga0207708_10034687 3300026075 Bacteria 3838
587 Ga0207702_10034909 3300026078 Bacteria 4206
588 Ga0207702_10271426 3300026078 Bacteria 1600
589 Ga0207702_10307890 3300026078 Unclassified 1505
590 Ga0207702_10663611 3300026078 Bacteria 1026
591 Ga0207641_10008255 3300026088 Bacteria 8606
592 Ga0207641_10318850 3300026088 Unclassified 1473
593 Ga0207641_10459240 3300026088 Bacteria 1232
594 Ga0207648_10013388 3300026089 Bacteria 7633
595 Ga0207648_10023823 3300026089 Bacteria 5475
596 Ga0207648_10031421 3300026089 Bacteria 4695
597 Ga0207648_10135801 3300026089 Unclassified 2166
598 Ga0207676_10003096 3300026095 Bacteria 11864
599 Ga0207676_10272869 3300026095 Bacteria 1532
600 Ga0207676_10425778 3300026095 Bacteria 1246
601 Ga0207674_10001342 3300026116 Bacteria 31848
602 Ga0207674_10127532 3300026116 Bacteria 2509
603 Ga0207674_10217927 3300026116 Bacteria 1857
604 Ga0207675_100014616 3300026118 Bacteria 7318
605 Ga0207675_100445694 3300026118 Bacteria 1282
606 Ga0207683_10001099 3300026121 Bacteria 24626
607 Ga0207683_10022874 3300026121 Bacteria 5370
608 Ga0207683_10029169 3300026121 Bacteria 4776
609 Ga0207683_10058867 3300026121 Bacteria 3374
610 Ga0207683_10068702 3300026121 Bacteria 3129
611 Ga0207683_10121648 3300026121 Bacteria 2344
612 Ga0207683_10124201 3300026121 Bacteria 2319
613 Ga0207683_10292531 3300026121 Bacteria 1489
614 Ga0207698_10016568 3300026142 Bacteria 4973
615 Ga0207698_10019792 3300026142 Bacteria 4617
616 Ga0207698_10232164 3300026142 Bacteria 1675
617 Ga0207698_10608786 3300026142 Bacteria 1078
618 Ga0209589_1001113 3300027357 Bacteria 42801
619 Ga0209489_101913 3300027361 Bacteria 42801
620 Ga0209700_101949 3300027363 Bacteria 42801
621 Ga0210002_1003782 3300027617 Bacteria 2244
622 Ga0209983_1004092 3300027665 Bacteria 3078
623 Ga0209971_1008596 3300027682 Bacteria 2423
624 Ga0209966_1013854 3300027695 Bacteria 1498
625 Ga0209998_10000489 3300027717 Bacteria 10900
626 Ga0209974_10004052 3300027876 Bacteria 5238
627 Ga0207428_10004210 3300027907 Bacteria 13779
628 Ga0207428_10005539 3300027907 Bacteria 11762
629 Ga0207428_10066297 3300027907 Unclassified 2845
630 Ga0268266_10004422 3300028379 Bacteria 13462
631 Ga0268266_10020036 3300028379 Bacteria 5701
632 Ga0268266_10042438 3300028379 Bacteria 3885
633 Ga0268266_10146966 3300028379 Bacteria 2120
634 Ga0268266_10245374 3300028379 Bacteria 1654
635 Ga0268265_10026427 3300028380 Bacteria 4130
636 Ga0268265_10038216 3300028380 Bacteria 3529
637 Ga0268265_10154000 3300028380 Bacteria 1942
638 Ga0268265_10161201 3300028380 Bacteria 1905
639 Ga0268265_10493244 3300028380 Unclassified 1153
640 Ga0268264_10013558 3300028381 Bacteria 6711
641 Ga0268264_10063753 3300028381 Bacteria 3099
642 Ga0268264_10489918 3300028381 Bacteria 1197
643 Ga0307517_10001121 3300028786 Bacteria 45217
644 Ga0307515_10352234 3300028794 Bacteria 1118
645 Ga0265330_10007827 3300031235 Bacteria 5184
646 Ga0265330_10015690 3300031235 Bacteria 3503
647 Ga0265332_10010541 3300031238 Bacteria 4116
648 Ga0265325_10000048 3300031241 Bacteria 82899
649 Ga0265340_10001917 3300031247 Bacteria 11880
650 Ga0265339_10000343 3300031249 Bacteria 37462
651 Ga0265339_10006887 3300031249 Bacteria 7407
652 Ga0265331_10028663 3300031250 Bacteria 2783
653 Ga0265331_10029976 3300031250 Bacteria 2711
654 Ga0265313_10031601 3300031595 Bacteria 2712
655 Ga0307508_10116942 3300031616 Bacteria 2268
656 Ga0265314_10028896 3300031711 Bacteria 4126
657 Ga0265342_10007591 3300031712 Bacteria 7917
658 Ga0265342_10032352 3300031712 Bacteria 3226
659 Ga0265342_10172094 3300031712 Bacteria 1190
660 Ga0307516_10030519 3300031730 Bacteria 5438
661 Ga0307405_10285897 3300031731 Bacteria 1244
662 Ga0307410_10272776 3300031852 Bacteria 1324
663 Ga0307406_10182996 3300031901 Bacteria 1527
664 Ga0307407_10089675 3300031903 Bacteria 1882
665 Ga0307412_10355866 3300031911 Bacteria 1177
666 Ga0307409_100174858 3300031995 Bacteria 1894
667 Ga0307409_100464427 3300031995 Bacteria 1224
668 Ga0307415_100034970 3300032126 Bacteria 3277
669 Ga0307510_10058140 3300033180 Bacteria 4007
670 Ga0307510_10115363 3300033180 Bacteria 2411
671 Ga0315911_1000008 3300033442 Bacteria 381285
672 Ga0373930_0000428 3300034816 Bacteria 5622
673 Ga0373948_0004805 3300034817 Bacteria 2158
674 Ga0373948_0026651 3300034817 Bacteria 1140
675 Ga0373950_0001947 3300034818 Bacteria 2787
676 Ga0373950_0004504 3300034818 Bacteria 2043
677 Ga0373958_0002750 3300034819 Bacteria 2492
678 Ga0373958_0003399 3300034819 Bacteria 2291
679 Ga0373959_0001525 3300034820 Bacteria 3689
680 Ga0373938_0000057 3300034957 Bacteria 14266
681 Ga0373938_0000077 3300034957 Bacteria 12968
682 Ga0373938_0001090 3300034957 Bacteria 4373
683 Ga0373926_0007991 3300035083 Bacteria 3525
684 Ga0373926_0039181 3300035083 Unclassified 1688
685 Ga0373928_0000660 3300035084 Bacteria 6780
686 Ga0373929_0000710 3300035085 Bacteria 6457
687 Ga0373940_0000045 3300035088 Bacteria 13700
688 Ga0373940_0014537 3300035088 Bacteria 1922
689 Ga0373944_0002996 3300035089 Bacteria 4341
690 Ga0373944_0005170 3300035089 Bacteria 3429
691 Ga0373949_0000989 3300035090 Bacteria 8802
692 Ga0373949_0009139 3300035090 Bacteria 2171
693 Ga0373951_0002076 3300035091 Bacteria 5134
694 Ga0373951_0072243 3300035091 Unclassified 881
695 Ga0373952_0000796 3300035092 Bacteria 5662
696 Ga0373952_0002234 3300035092 Bacteria 3490
697 Ga0373952_0014123 3300035092 Unclassified 1594
698 Ga0373923_0002121 3300035111 Bacteria 6008
699 Ga0373923_0046437 3300035111 Bacteria 1806
700 Ga0373923_0120667 3300035111 Bacteria 1171
701 Ga0373932_0003655 3300035112 Bacteria 3678
702 Ga0373932_0004543 3300035112 Bacteria 3276
703 Ga0373932_0005543 3300035112 Bacteria 2968
704 Ga0373936_0001371 3300035113 Bacteria 8836
705 Ga0373936_0027377 3300035113 Unclassified 2236
706 Ga0373936_0092880 3300035113 Bacteria 1267
707 Ga0373939_0000176 3300035114 Bacteria 17716
708 Ga0373939_0001854 3300035114 Bacteria 5069
709 Ga0373939_0072825 3300035114 Unclassified 1123
710 Ga0373941_0000035 3300035115 Bacteria 20398
711 Ga0373941_0005231 3300035115 Bacteria 3042
712 Ga0373941_0012047 3300035115 Unclassified 2251
713 Ga0373945_0010000 3300035116 Plasmid 3117
714 Ga0373945_0150320 3300035116 Bacteria 944
715 Ga0373953_0001650 3300035117 Bacteria 6554
716 Ga0373953_0021791 3300035117 Bacteria 2409
717 Ga0373953_0035342 3300035117 Bacteria 1963
718 Ga0373953_0202766 3300035117 Bacteria 858
719 Ga0373954_0002418 3300035118 Bacteria 7824
720 Ga0373954_0022022 3300035118 Bacteria 2889
721 Ga0373954_0038357 3300035118 Bacteria 2228
722 Ga0373954_0077705 3300035118 Bacteria 1583
723 Ga0373956_0007029 3300035119 Bacteria 4526
724 Ga0373956_0010778 3300035119 Bacteria 3753
725 Ga0373957_0021582 3300035120 Bacteria 2287
726 Ga0373957_0030695 3300035120 Bacteria 1970
727 Ga0373960_0000830 3300035121 Bacteria 6506
728 Ga0373960_0002844 3300035121 Bacteria 3918
729 Ga0373960_0052165 3300035121 Unclassified 1217
730 Ga0373943_0003652 3300035170 Bacteria 6994
731 Ga0373943_0008570 3300035170 Bacteria 4583
732 Ga0373943_0017611 3300035170 Bacteria 3269
733 Ga0373943_0031830 3300035170 Bacteria 2504
734 Ga0373943_0051710 3300035170 Bacteria 2024
735 Ga0373946_0014419 3300035171 Bacteria 2981
736 Ga0373946_0045496 3300035171 Bacteria 1816
737 Ga0373946_0140717 3300035171 Bacteria 1118
738 Ga0373955_0009884 3300035172 Bacteria 4488
739 Ga0373955_0164135 3300035172 Bacteria 1312
740 Ga0373955_0174481 3300035172 Bacteria 1273
741 Ga0373955_0259407 3300035172 Bacteria 1043
742 Ga0373942_0001115 3300035207 Bacteria 7135
743 Ga0373961_0001224 3300035241 Bacteria 7888
744 Ga0373961_0036081 3300035241 Unclassified 1406
745 Ga0373961_0078889 3300035241 Bacteria 1032
746 Ga0373962_0003498 3300035242 Bacteria 3774
747 Ga0373962_0005660 3300035242 Bacteria 3016
748 Ga0373924_0009983 3300035410 Bacteria 3494
749 Ga0373924_0045700 3300035410 Bacteria 1801
750 Ga0373931_0000125 3300035691 Bacteria 34699
751 Ga0373931_0002698 3300035691 Bacteria 7901
752 Ga0373931_0021799 3300035691 Unclassified 3217
753 Ga0373931_0023754 3300035691 Bacteria 3097
754 Ga0373931_0088786 3300035691 Bacteria 1719
755 Ga0373935_0012719 3300035692 Bacteria 5066
756 Ga0373935_0019294 3300035692 Bacteria 4158
757 Ga0373935_0064522 3300035692 Bacteria 2349
758 Ga0373935_0100388 3300035692 Bacteria 1907
759 Ga0373927_0023068 3300035695 Bacteria 4075
760 Ga0373927_0034410 3300035695 Bacteria 3295
761 Ga0373927_0089063 3300035695 Bacteria 2004
762 Ga0373927_0263184 3300035695 Bacteria 1134
763 Ga0373933_0005734 3300035724 Bacteria 6756
764 Ga0373933_0014957 3300035724 Bacteria 4321
765 Ga0373933_0095344 3300035724 Bacteria 1841
766 Ga0373933_0375435 3300035724 Bacteria 926
767 Ga0373947_0004759 3300035725 Bacteria 7954
768 Ga0373947_0013409 3300035725 Bacteria 4696
769 Ga0373947_0039166 3300035725 Bacteria 2819
770 Ga0373947_0364757 3300035725 Bacteria 971
771 Ga0373937_0022226 3300036401 Bacteria 5700
772 Ga0373937_0031472 3300036401 Bacteria 4808
773 Ga0373937_0049533 3300036401 Bacteria 3846
774 Ga0373937_0078218 3300036401 Bacteria 3057
775 Ga0373937_0128068 3300036401 Bacteria 2369
776 Ga0372808_004425 3300036459 Bacteria 1793
777 Ga0373925_0096741 3300037068 Unclassified 2263
778 Ga0373925_0176148 3300037068 Bacteria 1690
779 Ga0395900_0020298 3300037418 Bacteria 6782
780 Ga0395898_0020845 3300037466 Bacteria 6653
781 Ga0395898_0114453 3300037466 Bacteria 2585
782 Ga0395905_0096484 3300037471 Bacteria 2776
783 Ga0395905_0153620 3300037471 Bacteria 2165
784 Ga0436364_0238250 3300037853 Bacteria 3804
785 Ga0436364_0714615 3300037853 Bacteria 13367
786 Ga0395901_0153846 3300038443 Bacteria 2416
787 Ga0395901_0180498 3300038443 Bacteria 2214
788 Ga0395901_0509298 3300038443 Bacteria 1224
789 Ga0436365_0178109 3300039437 Bacteria 13648
790 Ga0436365_0599176 3300039437 Bacteria 1863
791 Ga0436365_1339516 3300039437 Bacteria 21592
792 Ga0436360_1270532 3300039438 Bacteria 1337
793 Ga0436361_0463950 3300039447 Bacteria 8376
794 Ga0436361_1094789 3300039447 Bacteria 3058
795 Ga0436363_0174491 3300039450 Bacteria 1612
796 Ga0436363_0289284 3300039450 Bacteria 9957
797 Ga0436363_0518314 3300039450 Bacteria 2640
798 Ga0436363_1000992 3300039450 Bacteria 1933
799 Ga0436363_1585272 3300039450 Bacteria 1133
800 Ga0436362_0401285 3300039453 Bacteria 3155
801 Ga0436362_0763668 3300039453 Bacteria 13939
802 Ga0451802_0697902 3300041460 Bacteria 1470
803 Ga0451837_0272069 3300041494 Bacteria 1041
804 Ga0451853_0925930 3300041512 Bacteria 1566
805 Ga0439460_0113562 3300042461 Bacteria 881
806 Ga0451577_0071382 3300042876 Bacteria 3097
807 Ga0466965_0109786 3300044683 Bacteria 1417
808 Ga0466966_0085266 3300044684 Bacteria 1964
809 Ga0466966_0114765 3300044684 Bacteria 1659
810 Ga0466961_0336231 3300044693 Bacteria 920
811 Ga0466964_0144862 3300044706 Bacteria 1096
812 Ga0466971_0052084 3300044719 Bacteria 1843
813 Ga0466970_0049709 3300044765 Bacteria 2236
814 Ga0466959_0021885 3300045049 Bacteria 4721
815 Ga0466959_0106443 3300045049 Bacteria 2005
816 Ga0451576_0022944 3300045051 Bacteria 6763
817 Ga0466958_0108719 3300045836 Bacteria 1730
818 Ga0495592_0001601 3300046454 Bacteria 15847
819 Ga0495592_0035987 3300046454 Bacteria 3729
820 Ga0495592_0094444 3300046454 Bacteria 2140
821 Ga0495592_0129755 3300046454 Unclassified 1764
822 Ga0495603_0012595 3300046455 Bacteria 5117
823 Ga0495603_0020559 3300046455 Bacteria 3999
824 Ga0495603_0034436 3300046455 Bacteria 3044
825 Ga0495603_0075646 3300046455 Bacteria 1976
826 Ga0495603_0101644 3300046455 Bacteria 1678
827 Ga0495603_0210051 3300046455 Bacteria 1124
828 Ga0495590_0050010 3300046457 Bacteria 1458
829 Ga0495590_0103337 3300046457 Bacteria 1013
830 Ga0495591_031860 3300046458 Bacteria 1577
831 Ga0495629_0000529 3300046459 Bacteria 31881
832 Ga0495629_0004229 3300046459 Bacteria 10768
833 Ga0495629_0033905 3300046459 Bacteria 3610
834 Ga0495629_0091494 3300046459 Bacteria 2123
835 Ga0495629_0133490 3300046459 Bacteria 1729
836 Ga0495629_0141090 3300046459 Bacteria 1676
837 Ga0495638_0004302 3300046460 Bacteria 10809
838 Ga0495638_0078088 3300046460 Bacteria 2015
839 Ga0495638_0225393 3300046460 Bacteria 1045
840 Ga0495641_0010753 3300046461 Bacteria 5270
841 Ga0495651_0020601 3300046462 Bacteria 5120
842 Ga0495651_0021894 3300046462 Bacteria 4970
843 Ga0495651_0051985 3300046462 Bacteria 3157
844 Ga0495651_0114942 3300046462 Bacteria 1985
845 Ga0495653_0012516 3300046463 Bacteria 6927
846 Ga0495653_0058175 3300046463 Bacteria 2939
847 Ga0495650_0084148 3300046471 Bacteria 1221
848 Ga0495650_0089442 3300046471 Bacteria 1174
849 Ga0495580_0007673 3300046472 Bacteria 8653
850 Ga0495580_0022152 3300046472 Unclassified 4680
851 Ga0495580_0131024 3300046472 Bacteria 1739
852 Ga0495582_0006695 3300046473 Bacteria 6401
853 Ga0495582_0029819 3300046473 Bacteria 2995
854 Ga0495582_0052239 3300046473 Bacteria 2254
855 Ga0495605_0083664 3300046474 Bacteria 1489
856 Ga0495605_0108578 3300046474 Bacteria 1268
857 Ga0495639_0001865 3300046475 Bacteria 9333
858 Ga0495662_0003981 3300046476 Bacteria 7447
859 Ga0495662_0062934 3300046476 Bacteria 1792
860 Ga0495664_0012337 3300046477 Bacteria 4839
861 Ga0495664_0105191 3300046477 Unclassified 1701
862 Ga0495664_0130092 3300046477 Bacteria 1524
863 Ga0495664_0156969 3300046477 Bacteria 1380
864 Ga0495664_0165089 3300046477 Bacteria 1343
865 Ga0495585_0005277 3300046492 Bacteria 8169
866 Ga0495594_0021679 3300046499 Bacteria 3431
867 Ga0495596_0031987 3300046500 Bacteria 2099
868 Ga0495606_0085827 3300046507 Bacteria 1946
869 Ga0495608_0001932 3300046511 Bacteria 14875
870 Ga0495608_0009207 3300046511 Bacteria 6906
871 Ga0495608_0017225 3300046511 Bacteria 5000
872 Ga0495608_0048650 3300046511 Bacteria 2816
873 Ga0495610_0031350 3300046512 Bacteria 2774
874 Ga0495616_0025644 3300046513 Bacteria 3147
875 Ga0495616_0025755 3300046513 Bacteria 3138
876 Ga0495618_0022040 3300046514 Bacteria 3931
877 Ga0495618_0032778 3300046514 Bacteria 3254
878 Ga0495618_0047500 3300046514 Bacteria 2709
879 Ga0495620_0010678 3300046515 Bacteria 4834
880 Ga0495628_0044955 3300046516 Bacteria 3511
881 Ga0495628_0058598 3300046516 Bacteria 3025
882 Ga0495628_0064729 3300046516 Bacteria 2862
883 Ga0495628_0093348 3300046516 Bacteria 2327
884 Ga0495630_0031036 3300046517 Unclassified 3977
885 Ga0495630_0151426 3300046517 Bacteria 1765
886 Ga0495631_0082678 3300046518 Bacteria 1384
887 Ga0495637_0023063 3300046520 Bacteria 2833
888 Ga0495644_0001817 3300046523 Bacteria 8599
889 Ga0495644_0010365 3300046523 Bacteria 3592
890 Ga0495644_0032867 3300046523 Bacteria 1961
891 Ga0495648_0003042 3300046524 Bacteria 15007
892 Ga0495648_0039904 3300046524 Bacteria 2982
893 Ga0495648_0171071 3300046524 Bacteria 1113
894 Ga0495663_0010015 3300046525 Bacteria 2631
895 Ga0495666_0033731 3300046526 Bacteria 2499
896 Ga0495652_0002586 3300046529 Bacteria 18522
897 Ga0495652_0048277 3300046529 Bacteria 3648
898 Ga0495652_0078232 3300046529 Bacteria 2738
899 Ga0495652_0126606 3300046529 Unclassified 2028
900 Ga0495665_0008876 3300046531 Bacteria 5453
901 Ga0495665_0033115 3300046531 Bacteria 2764
902 Ga0495640_0029890 3300046533 Bacteria 3905
903 Ga0495640_0030405 3300046533 Bacteria 3866
904 Ga0495640_0139635 3300046533 Bacteria 1562
905 Ga0495586_0008373 3300046535 Bacteria 5505
906 Ga0495587_0005424 3300046536 Bacteria 8324
907 Ga0495587_0010263 3300046536 Bacteria 5969
908 Ga0495587_0022397 3300046536 Bacteria 3890
909 Ga0495587_0045339 3300046536 Bacteria 2614
910 Ga0495598_0016808 3300046537 Bacteria 1874
911 Ga0495609_0045250 3300046538 Bacteria 1972
912 Ga0495621_0011202 3300046539 Bacteria 2767
913 Ga0495597_0018503 3300046542 Bacteria 3270
914 Ga0495645_0016154 3300046543 Bacteria 5322
915 Ga0495645_0022781 3300046543 Bacteria 4531
916 Ga0495622_0013428 3300046557 Bacteria 3799
917 Ga0495622_0087699 3300046557 Unclassified 1430
918 Ga0495633_0004580 3300046558 Bacteria 8719
919 Ga0495633_0082926 3300046558 Bacteria 1492
920 Ga0495667_0001575 3300046559 Bacteria 15141
921 Ga0495667_0003563 3300046559 Bacteria 10468
922 Ga0495667_0005690 3300046559 Bacteria 8437
923 Ga0495667_0033262 3300046559 Bacteria 3451
924 Ga0495656_0000925 3300046615 Bacteria 9484
925 Ga0495656_0036469 3300046615 Bacteria 2025
926 Ga0495634_0004321 3300046642 Bacteria 11195
927 Ga0495634_0009241 3300046642 Bacteria 7275
928 Ga0495634_0021643 3300046642 Bacteria 4541
929 Ga0495634_0086846 3300046642 Bacteria 2036
930 Ga0495611_0001608 3300046648 Bacteria 11004
931 Ga0495611_0100399 3300046648 Bacteria 1343
932 Ga0495635_0009683 3300046663 Bacteria 6736
933 Ga0495635_0010344 3300046663 Bacteria 6524
934 Ga0495635_0094299 3300046663 Bacteria 2046
935 Ga0495635_0133127 3300046663 Unclassified 1695
936 Ga0495635_0143965 3300046663 Bacteria 1623
937 Ga0495635_0220554 3300046663 Bacteria 1283
938 Ga0495659_0014935 3300046664 Bacteria 2548
939 Ga0495659_0022443 3300046664 Unclassified 2136
940 Ga0495661_0057558 3300046665 Bacteria 2320
941 Ga0495588_0004803 3300046674 Bacteria 5979
942 Ga0495657_0009411 3300046675 Bacteria 7404
943 Ga0495599_0014495 3300046678 Bacteria 4881
944 Ga0495599_0263962 3300046678 Bacteria 1045
945 Ga0495623_0017378 3300046679 Bacteria 4647
946 Ga0495623_0082140 3300046679 Bacteria 1991
947 Ga0495623_0110247 3300046679 Bacteria 1668
948 Ga0495646_0001304 3300046680 Bacteria 14717
949 Ga0495646_0002965 3300046680 Bacteria 10516
950 Ga0495646_0014971 3300046680 Bacteria 4927
951 Ga0495647_0022947 3300046681 Unclassified 2258
952 Ga0495647_0029089 3300046681 Bacteria 2041
953 Ga0495658_0009196 3300046683 Bacteria 4913
954 Ga0495658_0046658 3300046683 Unclassified 2436
955 Ga0495669_0034687 3300046684 Bacteria 2224
956 Ga0495669_0082845 3300046684 Bacteria 1474
957 Ga0495669_0103281 3300046684 Bacteria 1325
958 Ga0495669_0163962 3300046684 Bacteria 1055
959 Ga0495669_0167493 3300046684 Bacteria 1044
960 Ga0495613_0102826 3300046689 Bacteria 2063
961 Ga0495613_0111228 3300046689 Bacteria 1973
962 Ga0495613_0126389 3300046689 Bacteria 1833
963 Ga0495624_0012055 3300046690 Bacteria 5923
964 Ga0495624_0058420 3300046690 Bacteria 2422
965 Ga0495670_0002070 3300046691 Bacteria 9893
966 Ga0495670_0083899 3300046691 Unclassified 1625
967 Ga0495670_0227710 3300046691 Bacteria 991
968 Ga0495589_0081596 3300046794 Bacteria 1573
969 Ga0495600_0005087 3300046809 Bacteria 7903
970 Ga0495600_0012078 3300046809 Bacteria 5393
971 Ga0495600_0016709 3300046809 Bacteria 4663
972 Ga0495600_0019397 3300046809 Bacteria 4342
973 Ga0495581_0052260 3300047315 Bacteria 2360
974 Ga0495581_0103234 3300047315 Bacteria 1657
975 Ga0495581_0143636 3300047315 Bacteria 1393
976 Ga0495604_0009361 3300047317 Bacteria 7752
977 Ga0495604_0010978 3300047317 Bacteria 7190
978 Ga0495604_0043354 3300047317 Bacteria 3522
979 Ga0495604_0046121 3300047317 Unclassified 3398
980 Ga0495604_0098369 3300047317 Bacteria 2156
981 Ga0495636_0221991 3300047318 Bacteria 868
982 Ga0495674_0004206 3300047319 Bacteria 13863
983 Ga0495674_0014922 3300047319 Bacteria 7270
984 Ga0495674_0046723 3300047319 Bacteria 3842
985 Ga0495674_0117609 3300047319 Bacteria 2248
986 Ga0495672_0003454 3300047320 Bacteria 13522
987 Ga0495676_0054363 3300047321 Bacteria 3184
988 Ga0495676_0075874 3300047321 Bacteria 2569
989 Ga0495676_0106029 3300047321 Bacteria 2071
990 Ga0495676_0386687 3300047321 Bacteria 930
991 Ga0495680_0004370 3300047322 Bacteria 13540
992 Ga0495680_0006545 3300047322 Bacteria 10814
993 Ga0495680_0016602 3300047322 Bacteria 6318
994 Ga0495680_0021067 3300047322 Bacteria 5463
995 Ga0495680_0021703 3300047322 Bacteria 5370
996 Ga0495675_0003788 3300047444 Bacteria 9147
997 Ga0495675_0039774 3300047444 Bacteria 2995
998 Ga0495675_0043811 3300047444 Bacteria 2850
999 Ga0495675_0061383 3300047444 Unclassified 2381
1000 Ga0495673_0054926 3300047469 Bacteria 1730
1001 Ga0495684_0000497 3300047471 Bacteria 32091
1002 Ga0495684_0000994 3300047471 Bacteria 23076
1003 Ga0495684_0057775 3300047471 Bacteria 2956
1004 Ga0495684_0134293 3300047471 Unclassified 1857
1005 Ga0495593_0012729 3300047673 Plasmid 4802
1006 Ga0495593_0017540 3300047673 Bacteria 4029
1007 Ga0495593_0035904 3300047673 Bacteria 2689
1008 Ga0495602_0012526 3300048088 Bacteria 8709
1009 Ga0495602_0022872 3300048088 Bacteria 6105
1010 Ga0495602_0023974 3300048088 Bacteria 5930
1011 Ga0495602_0088368 3300048088 Bacteria 2580
1012 Ga0495614_0032076 3300048089 Unclassified 2261
1013 Ga0495614_0075003 3300048089 Bacteria 1461
1014 Ga0495615_0071377 3300048090 Bacteria 936
1015 Ga0495626_0047391 3300048091 Bacteria 1998
1016 Ga0496100_0006789 3300048903 Bacteria 6270
1017 Ga0496100_0087153 3300048903 Unclassified 2122
1018 Ga0496100_0380950 3300048903 Bacteria 1071
1019 Ga0496100_0492733 3300048903 Unclassified 943
1020 Ga0496101_0004666 3300048904 Bacteria 8672
1021 Ga0496101_0019111 3300048904 Bacteria 4671
1022 Ga0496101_0122915 3300048904 Unclassified 1964
1023 Ga0496102_0036631 3300048905 Bacteria 4421
1024 Ga0496102_0093896 3300048905 Bacteria 2779
1025 Ga0496102_0094468 3300048905 Bacteria 2771
1026 Ga0496102_0128173 3300048905 Bacteria 2373
1027 Ga0496102_0146573 3300048905 Bacteria 2216
1028 Ga0496102_0181071 3300048905 Bacteria 1986
1029 Ga0496102_0348483 3300048905 Bacteria 1394
1030 Ga0496103_0005617 3300048906 Bacteria 7495
1031 Ga0496103_0047733 3300048906 Bacteria 2646
1032 Ga0496103_0053865 3300048906 Bacteria 2493
1033 Ga0496103_0377923 3300048906 Bacteria 910
1034 Ga0496104_0001904 3300048907 Bacteria 18078
1035 Ga0496104_0002719 3300048907 Bacteria 15219
1036 Ga0496104_0181095 3300048907 Bacteria 2017
1037 Ga0496104_0287216 3300048907 Unclassified 1557
1038 Ga0496104_0415759 3300048907 Bacteria 1257
1039 Ga0496104_0593675 3300048907 Bacteria 1018
1040 Ga0496105_0002098 3300048908 Bacteria 14421
1041 Ga0496105_0006427 3300048908 Bacteria 9034
1042 Ga0496105_0030853 3300048908 Bacteria 4394
1043 Ga0496105_0263380 3300048908 Bacteria 1394
1044 Ga0496105_0277704 3300048908 Unclassified 1351
1045 Ga0496106_0004911 3300048909 Bacteria 9894
1046 Ga0496106_0010763 3300048909 Bacteria 6759
1047 Ga0496106_0041542 3300048909 Bacteria 3446
1048 Ga0496106_0095754 3300048909 Unclassified 2296
1049 Ga0496106_0102688 3300048909 Bacteria 2218
1050 Ga0496106_0174187 3300048909 Bacteria 1706
1051 Ga0496106_0188309 3300048909 Bacteria 1640
1052 Ga0496107_0008851 3300048910 Bacteria 6975
1053 Ga0496107_0050019 3300048910 Bacteria 3013
1054 Ga0496107_0055962 3300048910 Plasmid 2849
1055 Ga0496107_0284836 3300048910 Bacteria 1230
1056 Ga0496107_0288508 3300048910 Bacteria 1221
1057 Ga0496108_0000805 3300048911 Bacteria 24339
1058 Ga0496108_0011014 3300048911 Bacteria 7344
1059 Ga0496108_0038659 3300048911 Bacteria 3975
1060 Ga0496108_0076277 3300048911 Bacteria 2833
1061 Ga0496108_0206639 3300048911 Bacteria 1704
1062 Ga0496108_0274436 3300048911 Unclassified 1468
1063 Ga0496109_0003834 3300048912 Bacteria 12561
1064 Ga0496109_0006148 3300048912 Bacteria 10090
1065 Ga0496109_0010849 3300048912 Bacteria 7799
1066 Ga0496109_0034697 3300048912 Bacteria 4546
1067 Ga0496109_0107735 3300048912 Bacteria 2589
1068 Ga0496109_0113227 3300048912 Bacteria 2523
1069 Ga0496109_0135910 3300048912 Unclassified 2297
1070 Ga0496109_0356770 3300048912 Bacteria 1381
1071 Ga0496110_0041290 3300048913 Bacteria 4024
1072 Ga0496110_0122868 3300048913 Bacteria 2341
1073 Ga0496110_0134229 3300048913 Bacteria 2236
1074 Ga0496111_0025643 3300048914 Bacteria 4160
1075 Ga0496111_0096616 3300048914 Bacteria 2168
1076 Ga0496111_0449428 3300048914 Unclassified 951
1077 Ga0496112_0008679 3300048915 Bacteria 9112
1078 Ga0496112_0035815 3300048915 Bacteria 4837
1079 Ga0496112_0076186 3300048915 Bacteria 3317
1080 Ga0496112_0121145 3300048915 Bacteria 2585
1081 Ga0496112_0154555 3300048915 Bacteria 2261
1082 Ga0496112_0158389 3300048915 Bacteria 2231
1083 Ga0496112_0284932 3300048915 Unclassified 1598
1084 Ga0496113_0000438 3300048916 Bacteria 20214
1085 Ga0496113_0019532 3300048916 Bacteria 4743
1086 Ga0496113_0050922 3300048916 Bacteria 3089
1087 Ga0496113_0207308 3300048916 Bacteria 1559
1088 Ga0496113_0302188 3300048916 Bacteria 1281
1089 Ga0496114_0049245 3300048917 Bacteria 3505
1090 Ga0496114_0107697 3300048917 Unclassified 2385
1091 Ga0496114_0184579 3300048917 Bacteria 1823
1092 Ga0496114_0215479 3300048917 Bacteria 1685
1093 Ga0496115_0018670 3300048918 Bacteria 5330
1094 Ga0496115_0025924 3300048918 Bacteria 4569
1095 Ga0496115_0029352 3300048918 Bacteria 4319
1096 Ga0496115_0031429 3300048918 Bacteria 4185
1097 Ga0496115_0074217 3300048918 Bacteria 2762
1098 Ga0496115_0100578 3300048918 Bacteria 2370
1099 Ga0496115_0274505 3300048918 Unclassified 1384
1100 Ga0496116_0000958 3300048919 Bacteria 35612
1101 Ga0496118_0048321 3300048921 Bacteria 3288
1102 Ga0496119_0035034 3300048922 Bacteria 3295
1103 Ga0496119_0144533 3300048922 Bacteria 1281
1104 Ga0496121_0002920 3300048924 Bacteria 25047
1105 Ga0496121_0013931 3300048924 Bacteria 8592
1106 Ga0496121_0023674 3300048924 Bacteria 5903
1107 Ga0496121_0075192 3300048924 Bacteria 2699
1108 Ga0496121_0077157 3300048924 Bacteria 2654
1109 Ga0496121_0083048 3300048924 Bacteria 2530
1110 Ga0496121_0187666 3300048924 Bacteria 1485
1111 Ga0496121_0208958 3300048924 Bacteria 1384
1112 Ga0496122_0017864 3300048925 Bacteria 6592
1113 Ga0496122_0089044 3300048925 Bacteria 2112
1114 Ga0496124_0071501 3300048927 Bacteria 2876
1115 Ga0496125_0003632 3300048928 Bacteria 18501
1116 Ga0496125_0021736 3300048928 Bacteria 5972
1117 Ga0496126_0018354 3300048929 Bacteria 6933
1118 Ga0496126_0041783 3300048929 Bacteria 4240
1119 Ga0496126_0103310 3300048929 Bacteria 2490
1120 Ga0496126_0107710 3300048929 Bacteria 2430
1121 Ga0496126_0140704 3300048929 Bacteria 2077
1122 Ga0496126_0198508 3300048929 Bacteria 1695
1123 Ga0501031_0177938 3300049568 Bacteria 1390
1124 Ga0501033_0226561 3300049570 Bacteria 1329
1125 Ga0501034_0222205 3300049571 Bacteria 1841
1126 Ga0501036_0125433 3300049572 Bacteria 2168
1127 Ga0501036_0142458 3300049572 Bacteria 2022
1128 Ga0501037_0335079 3300049573 Bacteria 1046
1129 Ga0501043_0017220 3300049579 Bacteria 5668
1130 Ga0501046_0029243 3300049580 Bacteria 4481
1131 Ga0501047_0123187 3300049581 Bacteria 2473
1132 Ga0501047_0174160 3300049581 Bacteria 2020
1133 Ga0501047_0301337 3300049581 Bacteria 1445
1134 Ga0501068_0078539 3300049584 Bacteria 2023
1135 Ga0501070_0209719 3300049586 Bacteria 1599
1136 Ga0501070_0214529 3300049586 Bacteria 1579
1137 Ga0501070_0226043 3300049586 Bacteria 1534
1138 Ga0501035_0029235 3300049822 Bacteria 5025
1139 Ga0501035_0116942 3300049822 Bacteria 2333
1140 Ga0501044_0070676 3300049823 Bacteria 3550
1141 Ga0501044_0093539 3300049823 Bacteria 3031
1142 Ga0501044_0147160 3300049823 Bacteria 2340
1143 Ga0501044_0171863 3300049823 Bacteria 2138
1144 nmdc:mga03n38_2004_c1 3300050490 Bacteria 6128
1145 nmdc:mga03n38_3012_c1 3300050490 Bacteria 5334
1146 nmdc:mga00v17_21355_c1 3300050491 Bacteria 3721
1147 nmdc:mga00v17_95124_c1 3300050491 Bacteria 1875
1148 nmdc:mga0yw44_164923_c1 3300050492 Bacteria 1452
1149 nmdc:mga0yw44_2357_c1 3300050492 Bacteria 8013
1150 nmdc:mga0k408_49753_c1 3300050493 Bacteria 2426
1151 nmdc:mga06z11_105477_c1 3300050494 Bacteria 1553
1152 nmdc:mga07m45_202490_c1 3300050496 Bacteria 1155
1153 nmdc:mga05p37_18057_c1 3300050507 Bacteria 8520
1154 nmdc:mga05p37_58782_c1 3300050507 Bacteria 4735
1155 nmdc:mga08y16_12539_c1 3300050511 Bacteria 8919
1156 nmdc:mga08y16_140521_c1 3300050511 Bacteria 2511
1157 nmdc:mga08y16_4539_c1 3300050511 Bacteria 14468
1158 nmdc:mga0n895_1836_c1 3300050512 Bacteria 16193
1159 nmdc:mga0n895_196663_c1 3300050512 Bacteria 2047
1160 nmdc:mga0n895_66040_c1 3300050512 Bacteria 3582
1161 nmdc:mga0n895_7304_c1 3300050512 Bacteria 9470
1162 nmdc:mga0rr50_20965_c1 3300050513 Bacteria 4452
1163 nmdc:mga0rr50_25982_c1 3300050513 Bacteria 4078
1164 nmdc:mga0rr50_391933_c1 3300050513 Bacteria 1172
1165 nmdc:mga0rr50_53181_c1 3300050513 Plasmid 3012
1166 nmdc:mga08x19_27217_c1 3300050514 Unclassified 3575
1167 nmdc:mga0a205_2579_c1 3300050515 Bacteria 15986
1168 nmdc:mga0a205_26018_c1 3300050515 Bacteria 5575
1169 nmdc:mga0sz30_31685_c1 3300050516 Bacteria 2189
1170 Ga0495601_0002613 3300053077 Bacteria 10214
1171 Ga0495601_0006170 3300053077 Bacteria 6994
1172 Ga0495601_0024647 3300053077 Bacteria 3705
1173 Ga0495601_0030648 3300053077 Bacteria 3340
1174 Ga0495601_0040018 3300053077 Bacteria 2936
1175 Ga0495601_0082043 3300053077 Unclassified 2069
1176 Ga0495612_0000281 3300053078 Bacteria 20935
1177 Ga0495612_0008253 3300053078 Unclassified 4229
1178 Ga0495612_0009000 3300053078 Bacteria 4048
1179 Ga0495612_0014065 3300053078 Bacteria 3222
1180 Ga0495612_0014717 3300053078 Bacteria 3141
1181 Ga0495612_0084269 3300053078 Bacteria 1339
1182 Ga0495595_0000337 3300053084 Bacteria 18087
1183 Ga0495595_0008607 3300053084 Bacteria 4196
1184 Ga0495595_0015798 3300053084 Plasmid 3223
1185 Ga0495619_0000333 3300053085 Bacteria 33042
1186 Ga0495619_0000546 3300053085 Bacteria 24865
1187 Ga0495619_0005259 3300053085 Bacteria 8203
1188 Ga0495619_0022573 3300053085 Plasmid 4029
1189 Ga0495619_0024161 3300053085 Unclassified 3897
1190 Ga0495619_0067842 3300053085 Unclassified 2382
1191 Ga0495619_0094294 3300053085 Bacteria 2030
1192 Ga0495619_0128776 3300053085 Bacteria 1739
1193 Ga0495619_0188066 3300053085 Unclassified 1429
1194 Ga0500643_015965 3300053087 Bacteria 2560
1195 Ga0500646_0013953 3300053090 Bacteria 2083
1196 Ga0500651_0010394 3300053093 Bacteria 5577
1197 Ga0500651_0111123 3300053093 Bacteria 1672
1198 Ga0500566_0000403 3300053094 Bacteria 24071
1199 Ga0500641_0165883 3300053096 Bacteria 951
1200 Ga0500650_0005095 3300053098 Bacteria 4848
1201 Ga0500650_0127179 3300053098 Bacteria 1186
1202 Ga0500556_0000016 3300053104 Bacteria 194958
1203 Ga0500592_001811 3300053116 Bacteria 3453
1204 Ga0500595_003699 3300053119 Bacteria 7057
1205 Ga0500595_017201 3300053119 Bacteria 2674
1206 Ga0500642_0000017 3300053130 Bacteria 167670
1207 Ga0500652_000751 3300053131 Bacteria 10946
1208 Ga0500559_0000209 3300053136 Bacteria 46899
1209 Ga0500568_0000626 3300053139 Bacteria 25411
1210 Ga0500616_0000565 3300053153 Bacteria 45296
1211 Ga0500622_0002251 3300053156 Bacteria 14193
1212 Ga0500627_0025957 3300053158 Bacteria 2413
1213 Ga0500627_0065382 3300053158 Bacteria 1605
1214 Ga0500627_0215114 3300053158 Unclassified 859
1215 Ga0500636_0005654 3300053177 Bacteria 7144
1216 Ga0500636_0151742 3300053177 Bacteria 1272
1217 Ga0500637_0014160 3300053178 Bacteria 4199
1218 Ga0500645_007874 3300053730 Bacteria 3678
1219 Ga0500645_017152 3300053730 Bacteria 2272
1220 Ga0501082_0291901 3300060353 Bacteria 1420
1221 Ga0466962_0039220 3300061719 Bacteria 2269
1222 Ga0530510_0408047 3300061734 Bacteria 1025
1223 2509152560 2508501128 Bacteria 8613869
1224 2513661637 2513237096 Bacteria 8722461
1225 2513671795 2513237098 Bacteria 9902361
1226 2513698861 2513237101 Bacteria 7952346
1227 2513863110 2513237137 Bacteria 9558895
1228 2513923308 2513237145 Bacteria 8979722
1229 2517889129 2517572143 Bacteria 9484767
1230 2524541226 2524023228 Bacteria 10118060
1231 2603858174 2602042107 Bacteria 6226103
1232 2644732367 2643221733 Bacteria 5690728
1233 2671121585 2667528175 Bacteria 7532676
1234 2723841895 2721755755 Bacteria 8322773
1235 2728753702 2728368998 Bacteria 8720350
1236 2776259776 2775506901 Bacteria 9631051
1237 2793072623 2791355197 Bacteria 8420563
1238 2793079170
1239 2874610505 2874604998 Bacteria 7834745
1240 2876818199 2876808645 Bacteria 8824342
1241 2879115147 2879110137 Bacteria 8907982
1242 2885382867 2885374607 Bacteria 8927485
1243 2885388435 2885383462 Bacteria 9473874
1244 2889035186 2889033259 Bacteria 9099371
1245 2893067055 2893066018 Bacteria 6158120
1246 2903753638 2903748898 Bacteria 9972761
1247 2903774871 2903768456 Bacteria 9749579
1248 2904690927 2904690495 Bacteria 9412302
1249 2904708244
1250 2906613480
1251 2906668204 2906660503 Bacteria 8595048
1252 2908747742 2908739725 Bacteria 8628932
1253 2908756983 2908756301 Bacteria 8864324
1254 2922363286 2922361189 Bacteria 7436256
1255 2922388789 2922386360 Bacteria 7017218
1256 2922433917
1257 2935634939 2935630451 Bacteria 8169952
1258 2941514273 2941507105 Bacteria 8166816
1259 2941522234 2941515067 Bacteria 8166720
1260 2941530105 2941523033 Bacteria 8169134
1261 3005475365 3005474847 Bacteria 9259049
1262 8006935919 8006933436 Bacteria 10410654
1263 8006969406 8006964411 Bacteria 8966052
1264 8006975965 8006973647 Bacteria 10679141
1265 8006988454 8006984368 Bacteria 9651211
1266 8007000701 8006994254 Bacteria 8309700
1267 8019562754 8019555841 Bacteria 9642137
1268 8019572833 8019565922 Bacteria 9639779
1269 8056678588 8056673599 Bacteria 7871253
1270 8056687331 8056681323 Bacteria 8472857
1271 8056691890 8056689827 Bacteria 6712655
1272 Ga0157344_1000282
1273 SwRhRL2b_contig_1310266
1274 2214800754
1275 ARSoilYngRDRAFT_c00299
1276 ARcpr5yngRDRAFT_c000016
1277 ARSoilOldRDRAFT_c000011
1278 ARSoilOldRDRAFT_c000296
1279 ARCol0oldRDRAFT_c00058
1280 ARCol0yngRDRAFT_1000018
1281 JGI24746J21847_1001996
1282 JGI24747J21853_1000082
1283 JGI24740J21852_10016896
1284 JGI24739J22299_10003664
1285 JGI24737J22298_10002982
1286 JGI24750J21931_1000658
1287 JGI24748J21848_1002791
1288 JGI24738J21930_10001701
1289 JGI24749J21850_1001295
1290 JGI24744J21845_10004447
1291 JGI24035J26624_1000095
1292 JGI24034J26672_10000699
1293 JGI24751J29686_10022618
1294 JGI25406J46586_10006379
1295 JGI25153J46596_10003598
1296 JGI25153J46596_10004203
1297 JGI25153J46596_10004900
1298 JGI25404J52841_10012877
1299 JGI25404J52841_10019217
1300 Ga0065704_10075339
1301 Ga0065712_10004981
1302 Ga0065712_10069431
1303 Ga0065715_10094058
1304 Ga0065707_10123422
1305 Ga0070676_10005715
1306 Ga0070676_10082633
1307 Ga0070676_10262670
1308 Ga0070683_100001578
1309 Ga0070683_100069464
1310 Ga0070690_100000317
1311 Ga0070690_100012441
1312 Ga0070690_100055191
1313 Ga0070670_100021689
1314 Ga0070670_100149474
1315 Ga0070670_100251625
1316 Ga0070677_10001615
1317 Ga0068869_100009045
1318 Ga0068869_100104468
1319 Ga0068869_100175075
1320 Ga0068869_100180563
1321 Ga0070666_10028616
1322 Ga0070666_10091866
1323 Ga0070680_100018000
1324 Ga0070680_100069931
1325 Ga0070680_100080931
1326 Ga0070682_100006267
1327 Ga0070682_100094705
1328 Ga0070682_100108820
1329 Ga0070682_100183135
1330 Ga0068868_100033097
1331 Ga0068868_100042420
1332 Ga0068868_100103360
1333 Ga0068868_100107551
1334 Ga0070660_100004871
1335 Ga0070660_100049909
1336 Ga0070660_100142997
1337 Ga0070660_100359286
1338 Ga0070689_100002987
1339 Ga0070689_100019991
1340 Ga0070689_100095383
1341 Ga0070689_100127987
1342 Ga0070689_100227586
1343 Ga0070691_10005410
1344 Ga0070691_10082214
1345 Ga0070691_10207682
1346 Ga0070687_100002357
1347 Ga0070661_100004564
1348 Ga0070661_100056606
1349 Ga0070661_100212076
1350 Ga0070692_10005247
1351 Ga0070692_10009078
1352 Ga0070668_100011260
1353 Ga0070668_100071444
1354 Ga0070668_100545576
1355 Ga0070669_100012130
1356 Ga0070669_100014076
1357 Ga0070669_100121994
1358 Ga0070675_100027426
1359 Ga0070675_100211378
1360 Ga0070671_100013351
1361 Ga0070671_100106860
1362 Ga0070671_100180218
1363 Ga0070671_100211734
1364 Ga0070674_100004148
1365 Ga0070674_100037906
1366 Ga0070674_100131500
1367 Ga0070674_100182904
1368 Ga0070673_100006382
1369 Ga0070673_100041153
1370 Ga0070673_100667495
1371 Ga0070688_100007113
1372 Ga0070688_100008074
1373 Ga0070688_100392394
1374 Ga0070659_100021218
1375 Ga0070659_100021801
1376 Ga0070659_100034194
1377 Ga0070659_100040056
1378 Ga0070659_100085539
1379 Ga0070659_100174891
1380 Ga0070659_100181295
1381 Ga0070667_100014112
1382 Ga0070667_100179805
1383 Ga0070667_100297624
1384 Ga0070703_10018408
1385 Ga0070709_10006522
1386 Ga0070709_10332602
1387 Ga0070714_100032388
1388 Ga0070714_100240730
1389 Ga0070714_100363721
1390 Ga0070713_100003148
1391 Ga0070713_100009774
1392 Ga0070713_100086450
1393 Ga0070713_100087509
1394 Ga0070713_100109217
1395 Ga0070713_100175757
1396 Ga0070713_100438649
1397 Ga0070710_10002456
1398 Ga0070710_10116452
1399 Ga0070701_10000656
1400 Ga0070711_100014604
1401 Ga0070711_100312455
1402 Ga0070705_100008451
1403 Ga0070705_100056841
1404 Ga0070700_100013984
1405 Ga0070700_100079109
1406 Ga0070694_100005726
1407 Ga0070708_100071378
1408 Ga0070708_100131472
1409 Ga0070708_100193628
1410 Ga0070708_100339863
1411 Ga0070663_100003512
1412 Ga0070663_100010818
1413 Ga0070663_100291030
1414 Ga0070678_100010317
1415 Ga0070678_100019792
1416 Ga0070678_100022922
1417 Ga0070678_100023098
1418 Ga0070662_100041448
1419 Ga0070662_100047743
1420 Ga0070662_100054329
1421 Ga0070662_100093467
1422 Ga0070662_100557245
1423 Ga0070681_10002401
1424 Ga0070681_10032469
1425 Ga0070681_10117011
1426 Ga0070681_10273722
1427 Ga0068867_100007228
1428 Ga0068867_100070408
1429 Ga0068867_100198629
1430 Ga0068867_100281689
1431 Ga0070685_10001672
1432 Ga0070685_10007202
1433 Ga0070706_100247178
1434 Ga0070698_100158372
1435 Ga0070679_100026366
1436 Ga0070679_100329404
1437 Ga0070679_100503901
1438 Ga0070684_100006426
1439 Ga0070684_100018816
1440 Ga0070684_100039628
1441 Ga0070697_100139097
1442 Ga0068853_100031431
1443 Ga0068853_100059399
1444 Ga0068853_100068079
1445 Ga0068853_100112877
1446 Ga0068853_100295667
1447 Ga0068853_100403400
1448 Ga0070672_100012277
1449 Ga0070672_100516363
1450 Ga0070686_100008469
1451 Ga0070686_100068694
1452 Ga0070695_100005342
1453 Ga0070695_100019542
1454 Ga0070693_100018128
1455 Ga0070693_100024747
1456 Ga0070665_100011785
1457 Ga0070665_100023550
1458 Ga0070665_100024295
1459 Ga0070665_100125021
1460 Ga0070665_100212052
1461 Ga0070665_100218691
1462 Ga0070704_100010246
1463 Ga0070704_100015863
1464 Ga0070704_100178960
1465 Ga0068855_100105152
1466 Ga0068855_100115627
1467 Ga0068855_100199102
1468 Ga0068855_100404275
1469 Ga0068855_100533612
1470 Ga0068855_100706459
1471 Ga0070664_100008431
1472 Ga0070664_100081828
1473 Ga0068857_100000358
1474 Ga0068857_100395263
1475 Ga0068854_100005944
1476 Ga0068854_100220291
1477 Ga0068854_100275776
1478 Ga0068854_100312437
1479 Ga0068854_100578881
1480 Ga0068856_100007430
1481 Ga0068856_100028358
1482 Ga0068856_100118304
1483 Ga0068856_100593350
1484 Ga0070702_100002143
1485 Ga0070702_100047599
1486 Ga0070702_100111499
1487 Ga0070702_100259671
1488 Ga0068852_100006913
1489 Ga0068852_100065156
1490 Ga0068852_100190291
1491 Ga0068852_100402518
1492 Ga0068859_100009657
1493 Ga0068859_100009678
1494 Ga0068859_100102862
1495 Ga0068859_100186919
1496 Ga0068859_100218697
1497 Ga0068864_100002272
1498 Ga0068864_100198827
1499 Ga0068866_10000358
1500 Ga0068861_100010301
1501 Ga0068861_100108017
1502 Ga0068870_10000025
1503 Ga0068863_100018070
1504 Ga0068863_100214954
1505 Ga0068858_100007959
1506 Ga0068858_100066757
1507 Ga0068858_100239483
1508 Ga0068858_100351150
1509 Ga0068858_100400654
1510 Ga0068860_100008914
1511 Ga0068860_100043626
1512 Ga0068860_100077524
1513 Ga0068862_100019145
1514 Ga0068862_100019155
1515 Ga0068862_100036577
1516 Ga0068862_100354770
1517 Ga0081455_10011459
1518 Ga0081455_10023546
1519 Ga0081455_10028858
1520 Ga0081455_10104063
1521 Ga0081538_10087030
1522 Ga0081540_1000094
1523 Ga0081540_1001430
1524 Ga0081540_1001921
1525 Ga0081540_1003396
1526 Ga0081540_1003410
1527 Ga0081540_1003755
1528 Ga0081540_1008562
1529 Ga0081540_1009897
1530 Ga0081540_1014017
1531 Ga0081540_1014781
1532 Ga0081539_10000576
1533 Ga0070717_10000634
1534 Ga0070717_10010988
1535 Ga0070717_10017729
1536 Ga0075368_10059626
1537 Ga0075363_100004592
1538 Ga0075364_10034926
1539 Ga0070715_10073674
1540 Ga0070716_100001804
1541 Ga0070716_100299080
1542 Ga0075367_10046222
1543 Ga0075367_10096250
1544 Ga0075367_10119768
1545 Ga0075367_10242943
1546 Ga0075369_10006714
1547 Ga0075366_10071490
1548 Ga0097621_100016388
1549 Ga0097621_100051635
1550 Ga0097621_100250537
1551 Ga0075370_10015849
1552 Ga0068871_100002009
1553 Ga0068871_100025271
1554 Ga0068871_100057023
1555 Ga0068871_100196823
1556 Ga0075428_100051601
1557 Ga0075428_100213858
1558 Ga0075433_10002066
1559 Ga0075433_10022602
1560 Ga0075434_100015564
1561 Ga0075434_100022929
1562 Ga0068865_100006423
1563 Ga0068865_100020100
1564 Ga0068865_100023595
1565 Ga0068865_100143772
1566 Ga0068865_100160164
1567 Ga0075436_100043792
1568 Ga0097620_100009656
1569 Ga0097620_100009681
1570 Ga0097620_100102866
1571 Ga0097620_100186919
1572 Ga0097620_100218700
1573 Ga0099825_1039685
1574 Ga0099824_1012080
1575 Ga0099822_1022705
1576 Ga0075435_100033865
1577 Ga0075435_100060859
1578 Ga0075435_100330562
1579 Ga0105250_10028063
1580 Ga0105250_10060546
1581 Ga0105240_10035173
1582 Ga0105240_10040699
1583 Ga0111539_10015594
1584 Ga0111539_10028243
1585 Ga0111539_10063264
1586 Ga0111539_10095372
1587 Ga0111539_10114723
1588 Ga0105245_10005724
1589 Ga0105245_10628499
1590 Ga0105247_10010313
1591 Ga0114129_10028721
1592 Ga0114129_10190378
1593 Ga0114129_10303165
1594 Ga0105243_10015784
1595 Ga0105243_10042388
1596 Ga0105243_10078808
1597 Ga0105243_10412601
1598 Ga0105241_10021878
1599 Ga0105241_10060326
1600 Ga0105241_10315378
1601 Ga0105242_10019259
1602 Ga0105242_10028442
1603 Ga0105242_10036531
1604 Ga0105242_10153849
1605 Ga0105242_10302393
1606 Ga0105248_10002041
1607 Ga0105248_10005510
1608 Ga0105248_10037197
1609 Ga0105248_10177382
1610 Ga0105248_10228964
1611 Ga0105237_10016489
1612 Ga0105237_10051821
1613 Ga0105237_10090529
1614 Ga0105237_10118870
1615 Ga0105238_10108221
1616 Ga0105238_10120133
1617 Ga0105238_10178701
1618 Ga0105249_10022058
1619 Ga0105249_10076537
1620 Ga0105249_10156770
1621 Ga0105239_10201726
1622 Ga0105239_10359180
1623 Ga0105239_10632725
1624 Ga0105246_10019451
1625 Ga0105246_10070598
1626 Ga0105246_10097388
1627 Ga0105246_10263671
1628 Ga0157347_1004878
1629 Ga0157342_1000220
1630 Ga0157326_1001234
1631 Ga0157373_10125608
1632 Ga0157373_10216555
1633 Ga0157371_10011449
1634 Ga0157371_10077316
1635 Ga0157369_10052265
1636 Ga0157369_10068416
1637 Ga0157369_10164220
1638 Ga0157374_10020164
1639 Ga0157374_10042005
1640 Ga0157374_10228870
1641 Ga0157374_10295784
1642 Ga0157378_10002347
1643 Ga0157378_10011414
1644 Ga0157378_10022614
1645 Ga0163162_10048931
1646 Ga0163162_10055539
1647 Ga0163162_10101466
1648 Ga0163162_10371269
1649 Ga0163162_10566053
1650 Ga0157372_10030789
1651 Ga0157372_10052452
1652 Ga0157375_10014931
1653 Ga0157375_10023326
1654 Ga0157375_10054066
1655 Ga0157375_10532737
1656 Ga0163163_10009112
1657 Ga0163163_10024529
1658 Ga0163163_10027579
1659 Ga0157380_10013011
1660 Ga0157377_10013159
1661 Ga0157377_10036710
1662 Ga0157379_10017138
1663 Ga0157379_10045825
1664 Ga0157379_10105871
1665 Ga0157379_10593394
1666 Ga0157379_10610834
1667 Ga0157376_10014690
1668 Ga0157376_10104478
1669 Ga0157376_10200906
1670 Ga0157376_10318070
1671 Ga0163161_10014960
1672 Ga0163161_10015751
1673 Ga0163161_10021341
1674 Ga0163161_10565574
1675 Ga0213873_10004209
1676 Ga0213876_10001149
1677 Ga0213875_10013263
1678 Ga0207666_1000252
1679 Ga0207673_1000312
1680 Ga0209564_1000383
1681 Ga0209758_1001636
1682 Ga0209758_1002075
1683 Ga0209758_1008580
1684 Ga0209758_1018169
1685 Ga0207697_10005344
1686 Ga0207697_10009401
1687 Ga0207697_10037382
1688 Ga0207696_1025900
1689 Ga0207682_10000607
1690 Ga0207692_10027781
1691 Ga0207692_10038252
1692 Ga0207692_10175613
1693 Ga0207642_10232852
1694 Ga0207710_10005316
1695 Ga0207710_10005663
1696 Ga0207710_10030021
1697 Ga0207688_10007436
1698 Ga0207688_10050955
1699 Ga0207680_10010462
1700 Ga0207680_10012061
1701 Ga0207680_10228431
1702 Ga0207647_10017211
1703 Ga0207699_10057881
1704 Ga0207699_10113722
1705 Ga0207699_10277636
1706 Ga0207699_10348287
1707 Ga0207645_10011758
1708 Ga0207645_10018911
1709 Ga0207645_10117274
1710 Ga0207643_10000397
1711 Ga0207705_10243621
1712 Ga0207684_10179289
1713 Ga0207684_10287907
1714 Ga0207654_10012414
1715 Ga0207654_10040574
1716 Ga0207707_10088697
1717 Ga0207707_10153772
1718 Ga0207707_10168694
1719 Ga0207707_10188795
1720 Ga0207671_10012726
1721 Ga0207671_10052945
1722 Ga0207693_10003052
1723 Ga0207693_10012826
1724 Ga0207663_10006864
1725 Ga0207663_10050794
1726 Ga0207660_10000850
1727 Ga0207660_10016424
1728 Ga0207660_10029194
1729 Ga0207660_10169783
1730 Ga0207662_10004603
1731 Ga0207662_10009872
1732 Ga0207657_10001022
1733 Ga0207657_10017741
1734 Ga0207657_10021802
1735 Ga0207657_10073397
1736 Ga0207657_10368253
1737 Ga0207657_10398939
1738 Ga0207649_10001199
1739 Ga0207649_10066945
1740 Ga0207649_10278713
1741 Ga0207652_10001750
1742 Ga0207652_10144210
1743 Ga0207652_10326970
1744 Ga0207652_10397696
1745 Ga0207681_10002492
1746 Ga0207681_10079752
1747 Ga0207681_10324445
1748 Ga0207694_10511339
1749 Ga0207650_10005388
1750 Ga0207650_10007437
1751 Ga0207650_10085363
1752 Ga0207650_10230552
1753 Ga0207659_10000923
1754 Ga0207659_10272673
1755 Ga0207659_10317891
1756 Ga0207687_10005521
1757 Ga0207687_10269276
1758 Ga0207700_10003926
1759 Ga0207700_10005821
1760 Ga0207700_10070039
1761 Ga0207700_10231802
1762 Ga0207664_10034648
1763 Ga0207664_10069970
1764 Ga0207664_10160917
1765 Ga0207664_10185373
1766 Ga0207664_10196765
1767 Ga0207644_10015795
1768 Ga0207644_10277569
1769 Ga0207644_10383933
1770 Ga0207690_10003249
1771 Ga0207690_10018277
1772 Ga0207690_10115082
1773 Ga0207706_10007463
1774 Ga0207706_10021728
1775 Ga0207706_10027879
1776 Ga0207706_10041497
1777 Ga0207706_10067767
1778 Ga0207706_10103381
1779 Ga0207686_10017959
1780 Ga0207686_10083437
1781 Ga0207686_10097215
1782 Ga0207686_10140705
1783 Ga0207709_10001261
1784 Ga0207709_10055539
1785 Ga0207670_10000898
1786 Ga0207670_10028808
1787 Ga0207669_10000616
1788 Ga0207669_10092155
1789 Ga0207704_10003913
1790 Ga0207704_10036500
1791 Ga0207704_10149527
1792 Ga0207665_10001758
1793 Ga0207665_10023515
1794 Ga0207665_10099804
1795 Ga0207691_10030394
1796 Ga0207691_10041614
1797 Ga0207711_10010610
1798 Ga0207711_10019726
1799 Ga0207711_10141437
1800 Ga0207711_10294669
1801 Ga0207711_10415462
1802 Ga0207689_10039266
1803 Ga0207661_10008182
1804 Ga0207661_10028175
1805 Ga0207661_10161762
1806 Ga0207679_10000624
1807 Ga0207679_10002602
1808 Ga0207679_10130207
1809 Ga0207679_10150096
1810 Ga0207667_10125229
1811 Ga0207667_10138551
1812 Ga0207667_10170681
1813 Ga0207667_10184967
1814 Ga0207667_10258372
1815 Ga0207667_10278104
1816 Ga0207667_10344216
1817 Ga0207651_10002018
1818 Ga0207651_10065021
1819 Ga0207712_10008156
1820 Ga0207712_10019512
1821 Ga0207712_10073619
1822 Ga0207712_10117680
1823 Ga0207668_10007113
1824 Ga0207668_10030141
1825 Ga0207668_10067147
1826 Ga0207668_10068097
1827 Ga0207668_10350369
1828 Ga0207640_10004625
1829 Ga0207658_10020018
1830 Ga0207658_10029919
1831 Ga0207658_10234157
1832 Ga0207658_10319369
1833 Ga0207677_10001740
1834 Ga0207677_10026098
1835 Ga0207677_10138709
1836 Ga0207703_10004099
1837 Ga0207703_10152353
1838 Ga0207703_10177381
1839 Ga0207703_10200158
1840 Ga0207703_10334493
1841 Ga0207639_10009424
1842 Ga0207639_10027093
1843 Ga0207639_10081032
1844 Ga0207639_10103956
1845 Ga0207639_10255366
1846 Ga0207639_10503441
1847 Ga0207678_10004907
1848 Ga0207678_10007002
1849 Ga0207678_10018352
1850 Ga0207678_10025184
1851 Ga0207678_10056387
1852 Ga0207678_10056627
1853 Ga0207678_10076349
1854 Ga0207678_10219292
1855 Ga0207708_10005694
1856 Ga0207708_10019999
1857 Ga0207708_10034687
1858 Ga0207702_10034909
1859 Ga0207702_10271426
1860 Ga0207702_10307890
1861 Ga0207702_10663611
1862 Ga0207641_10008255
1863 Ga0207641_10318850
1864 Ga0207641_10459240
1865 Ga0207648_10013388
1866 Ga0207648_10023823
1867 Ga0207648_10031421
1868 Ga0207648_10135801
1869 Ga0207676_10003096
1870 Ga0207676_10272869
1871 Ga0207676_10425778
1872 Ga0207674_10001342
1873 Ga0207674_10127532
1874 Ga0207674_10217927
1875 Ga0207675_100014616
1876 Ga0207675_100445694
1877 Ga0207683_10001099
1878 Ga0207683_10022874
1879 Ga0207683_10029169
1880 Ga0207683_10058867
1881 Ga0207683_10068702
1882 Ga0207683_10121648
1883 Ga0207683_10124201
1884 Ga0207683_10292531
1885 Ga0207698_10016568
1886 Ga0207698_10019792
1887 Ga0207698_10232164
1888 Ga0207698_10608786
1889 Ga0209589_1001113
1890 Ga0209489_101913
1891 Ga0209700_101949
1892 Ga0210002_1003782
1893 Ga0209983_1004092
1894 Ga0209971_1008596
1895 Ga0209966_1013854
1896 Ga0209998_10000489
1897 Ga0209974_10004052
1898 Ga0207428_10004210
1899 Ga0207428_10005539
1900 Ga0207428_10066297
1901 Ga0268266_10004422
1902 Ga0268266_10020036
1903 Ga0268266_10042438
1904 Ga0268266_10146966
1905 Ga0268266_10245374
1906 Ga0268265_10026427
1907 Ga0268265_10038216
1908 Ga0268265_10154000
1909 Ga0268265_10161201
1910 Ga0268265_10493244
1911 Ga0268264_10013558
1912 Ga0268264_10063753
1913 Ga0268264_10489918
1914 Ga0307517_10001121
1915 Ga0307515_10352234
1916 Ga0265330_10007827
1917 Ga0265330_10015690
1918 Ga0265332_10010541
1919 Ga0265325_10000048
1920 Ga0265340_10001917
1921 Ga0265339_10000343
1922 Ga0265339_10006887
1923 Ga0265331_10028663
1924 Ga0265331_10029976
1925 Ga0265313_10031601
1926 Ga0307508_10116942
1927 Ga0265314_10028896
1928 Ga0265342_10007591
1929 Ga0265342_10032352
1930 Ga0265342_10172094
1931 Ga0307516_10030519
1932 Ga0307405_10285897
1933 Ga0307410_10272776
1934 Ga0307406_10182996
1935 Ga0307407_10089675
1936 Ga0307412_10355866
1937 Ga0307409_100174858
1938 Ga0307409_100464427
1939 Ga0307415_100034970
1940 Ga0307510_10058140
1941 Ga0307510_10115363
1942 Ga0315911_1000008
1943 Ga0373930_0000428
1944 Ga0373948_0004805
1945 Ga0373948_0026651
1946 Ga0373950_0001947
1947 Ga0373950_0004504
1948 Ga0373958_0002750
1949 Ga0373958_0003399
1950 Ga0373959_0001525
1951 Ga0373938_0000057
1952 Ga0373938_0000077
1953 Ga0373938_0001090
1954 Ga0373926_0007991
1955 Ga0373926_0039181
1956 Ga0373928_0000660
1957 Ga0373929_0000710
1958 Ga0373940_0000045
1959 Ga0373940_0014537
1960 Ga0373944_0002996
1961 Ga0373944_0005170
1962 Ga0373949_0000989
1963 Ga0373949_0009139
1964 Ga0373951_0002076
1965 Ga0373951_0072243
1966 Ga0373952_0000796
1967 Ga0373952_0002234
1968 Ga0373952_0014123
1969 Ga0373923_0002121
1970 Ga0373923_0046437
1971 Ga0373923_0120667
1972 Ga0373932_0003655
1973 Ga0373932_0004543
1974 Ga0373932_0005543
1975 Ga0373936_0001371
1976 Ga0373936_0027377
1977 Ga0373936_0092880
1978 Ga0373939_0000176
1979 Ga0373939_0001854
1980 Ga0373939_0072825
1981 Ga0373941_0000035
1982 Ga0373941_0005231
1983 Ga0373941_0012047
1984 Ga0373945_0010000
1985 Ga0373945_0150320
1986 Ga0373953_0001650
1987 Ga0373953_0021791
1988 Ga0373953_0035342
1989 Ga0373953_0202766
1990 Ga0373954_0002418
1991 Ga0373954_0022022
1992 Ga0373954_0038357
1993 Ga0373954_0077705
1994 Ga0373956_0007029
1995 Ga0373956_0010778
1996 Ga0373957_0021582
1997 Ga0373957_0030695
1998 Ga0373960_0000830
1999 Ga0373960_0002844
2000 Ga0373960_0052165
2001 Ga0373943_0003652
2002 Ga0373943_0008570
2003 Ga0373943_0017611
2004 Ga0373943_0031830
2005 Ga0373943_0051710
2006 Ga0373946_0014419
2007 Ga0373946_0045496
2008 Ga0373946_0140717
2009 Ga0373955_0009884
2010 Ga0373955_0164135
2011 Ga0373955_0174481
2012 Ga0373955_0259407
2013 Ga0373942_0001115
2014 Ga0373961_0001224
2015 Ga0373961_0036081
2016 Ga0373961_0078889
2017 Ga0373962_0003498
2018 Ga0373962_0005660
2019 Ga0373924_0009983
2020 Ga0373924_0045700
2021 Ga0373931_0000125
2022 Ga0373931_0002698
2023 Ga0373931_0021799
2024 Ga0373931_0023754
2025 Ga0373931_0088786
2026 Ga0373935_0012719
2027 Ga0373935_0019294
2028 Ga0373935_0064522
2029 Ga0373935_0100388
2030 Ga0373927_0023068
2031 Ga0373927_0034410
2032 Ga0373927_0089063
2033 Ga0373927_0263184
2034 Ga0373933_0005734
2035 Ga0373933_0014957
2036 Ga0373933_0095344
2037 Ga0373933_0375435
2038 Ga0373947_0004759
2039 Ga0373947_0013409
2040 Ga0373947_0039166
2041 Ga0373947_0364757
2042 Ga0373937_0022226
2043 Ga0373937_0031472
2044 Ga0373937_0049533
2045 Ga0373937_0078218
2046 Ga0373937_0128068
2047 Ga0372808_004425
2048 Ga0373925_0096741
2049 Ga0373925_0176148
2050 Ga0395900_0020298
2051 Ga0395898_0020845
2052 Ga0395898_0114453
2053 Ga0395905_0096484
2054 Ga0395905_0153620
2055 Ga0436364_0238250
2056 Ga0436364_0714615
2057 Ga0395901_0153846
2058 Ga0395901_0180498
2059 Ga0395901_0509298
2060 Ga0436365_0178109
2061 Ga0436365_0599176
2062 Ga0436365_1339516
2063 Ga0436360_1270532
2064 Ga0436361_0463950
2065 Ga0436361_1094789
2066 Ga0436363_0174491
2067 Ga0436363_0289284
2068 Ga0436363_0518314
2069 Ga0436363_1000992
2070 Ga0436363_1585272
2071 Ga0436362_0401285
2072 Ga0436362_0763668
2073 Ga0451802_0697902
2074 Ga0451837_0272069
2075 Ga0451853_0925930
2076 Ga0439460_0113562
2077 Ga0451577_0071382
2078 Ga0466965_0109786
2079 Ga0466966_0085266
2080 Ga0466966_0114765
2081 Ga0466961_0336231
2082 Ga0466964_0144862
2083 Ga0466971_0052084
2084 Ga0466970_0049709
2085 Ga0466959_0021885
2086 Ga0466959_0106443
2087 Ga0451576_0022944
2088 Ga0466958_0108719
2089 Ga0495592_0001601
2090 Ga0495592_0035987
2091 Ga0495592_0094444
2092 Ga0495592_0129755
2093 Ga0495603_0012595
2094 Ga0495603_0020559
2095 Ga0495603_0034436
2096 Ga0495603_0075646
2097 Ga0495603_0101644
2098 Ga0495603_0210051
2099 Ga0495590_0050010
2100 Ga0495590_0103337
2101 Ga0495591_031860
2102 Ga0495629_0000529
2103 Ga0495629_0004229
2104 Ga0495629_0033905
2105 Ga0495629_0091494
2106 Ga0495629_0133490
2107 Ga0495629_0141090
2108 Ga0495638_0004302
2109 Ga0495638_0078088
2110 Ga0495638_0225393
2111 Ga0495641_0010753
2112 Ga0495651_0020601
2113 Ga0495651_0021894
2114 Ga0495651_0051985
2115 Ga0495651_0114942
2116 Ga0495653_0012516
2117 Ga0495653_0058175
2118 Ga0495650_0084148
2119 Ga0495650_0089442
2120 Ga0495580_0007673
2121 Ga0495580_0022152
2122 Ga0495580_0131024
2123 Ga0495582_0006695
2124 Ga0495582_0029819
2125 Ga0495582_0052239
2126 Ga0495605_0083664
2127 Ga0495605_0108578
2128 Ga0495639_0001865
2129 Ga0495662_0003981
2130 Ga0495662_0062934
2131 Ga0495664_0012337
2132 Ga0495664_0105191
2133 Ga0495664_0130092
2134 Ga0495664_0156969
2135 Ga0495664_0165089
2136 Ga0495585_0005277
2137 Ga0495594_0021679
2138 Ga0495596_0031987
2139 Ga0495606_0085827
2140 Ga0495608_0001932
2141 Ga0495608_0009207
2142 Ga0495608_0017225
2143 Ga0495608_0048650
2144 Ga0495610_0031350
2145 Ga0495616_0025644
2146 Ga0495616_0025755
2147 Ga0495618_0022040
2148 Ga0495618_0032778
2149 Ga0495618_0047500
2150 Ga0495620_0010678
2151 Ga0495628_0044955
2152 Ga0495628_0058598
2153 Ga0495628_0064729
2154 Ga0495628_0093348
2155 Ga0495630_0031036
2156 Ga0495630_0151426
2157 Ga0495631_0082678
2158 Ga0495637_0023063
2159 Ga0495644_0001817
2160 Ga0495644_0010365
2161 Ga0495644_0032867
2162 Ga0495648_0003042
2163 Ga0495648_0039904
2164 Ga0495648_0171071
2165 Ga0495663_0010015
2166 Ga0495666_0033731
2167 Ga0495652_0002586
2168 Ga0495652_0048277
2169 Ga0495652_0078232
2170 Ga0495652_0126606
2171 Ga0495665_0008876
2172 Ga0495665_0033115
2173 Ga0495640_0029890
2174 Ga0495640_0030405
2175 Ga0495640_0139635
2176 Ga0495586_0008373
2177 Ga0495587_0005424
2178 Ga0495587_0010263
2179 Ga0495587_0022397
2180 Ga0495587_0045339
2181 Ga0495598_0016808
2182 Ga0495609_0045250
2183 Ga0495621_0011202
2184 Ga0495597_0018503
2185 Ga0495645_0016154
2186 Ga0495645_0022781
2187 Ga0495622_0013428
2188 Ga0495622_0087699
2189 Ga0495633_0004580
2190 Ga0495633_0082926
2191 Ga0495667_0001575
2192 Ga0495667_0003563
2193 Ga0495667_0005690
2194 Ga0495667_0033262
2195 Ga0495656_0000925
2196 Ga0495656_0036469
2197 Ga0495634_0004321
2198 Ga0495634_0009241
2199 Ga0495634_0021643
2200 Ga0495634_0086846
2201 Ga0495611_0001608
2202 Ga0495611_0100399
2203 Ga0495635_0009683
2204 Ga0495635_0010344
2205 Ga0495635_0094299
2206 Ga0495635_0133127
2207 Ga0495635_0143965
2208 Ga0495635_0220554
2209 Ga0495659_0014935
2210 Ga0495659_0022443
2211 Ga0495661_0057558
2212 Ga0495588_0004803
2213 Ga0495657_0009411
2214 Ga0495599_0014495
2215 Ga0495599_0263962
2216 Ga0495623_0017378
2217 Ga0495623_0082140
2218 Ga0495623_0110247
2219 Ga0495646_0001304
2220 Ga0495646_0002965
2221 Ga0495646_0014971
2222 Ga0495647_0022947
2223 Ga0495647_0029089
2224 Ga0495658_0009196
2225 Ga0495658_0046658
2226 Ga0495669_0034687
2227 Ga0495669_0082845
2228 Ga0495669_0103281
2229 Ga0495669_0163962
2230 Ga0495669_0167493
2231 Ga0495613_0102826
2232 Ga0495613_0111228
2233 Ga0495613_0126389
2234 Ga0495624_0012055
2235 Ga0495624_0058420
2236 Ga0495670_0002070
2237 Ga0495670_0083899
2238 Ga0495670_0227710
2239 Ga0495589_0081596
2240 Ga0495600_0005087
2241 Ga0495600_0012078
2242 Ga0495600_0016709
2243 Ga0495600_0019397
2244 Ga0495581_0052260
2245 Ga0495581_0103234
2246 Ga0495581_0143636
2247 Ga0495604_0009361
2248 Ga0495604_0010978
2249 Ga0495604_0043354
2250 Ga0495604_0046121
2251 Ga0495604_0098369
2252 Ga0495636_0221991
2253 Ga0495674_0004206
2254 Ga0495674_0014922
2255 Ga0495674_0046723
2256 Ga0495674_0117609
2257 Ga0495672_0003454
2258 Ga0495676_0054363
2259 Ga0495676_0075874
2260 Ga0495676_0106029
2261 Ga0495676_0386687
2262 Ga0495680_0004370
2263 Ga0495680_0006545
2264 Ga0495680_0016602
2265 Ga0495680_0021067
2266 Ga0495680_0021703
2267 Ga0495675_0003788
2268 Ga0495675_0039774
2269 Ga0495675_0043811
2270 Ga0495675_0061383
2271 Ga0495673_0054926
2272 Ga0495684_0000497
2273 Ga0495684_0000994
2274 Ga0495684_0057775
2275 Ga0495684_0134293
2276 Ga0495593_0012729
2277 Ga0495593_0017540
2278 Ga0495593_0035904
2279 Ga0495602_0012526
2280 Ga0495602_0022872
2281 Ga0495602_0023974
2282 Ga0495602_0088368
2283 Ga0495614_0032076
2284 Ga0495614_0075003
2285 Ga0495615_0071377
2286 Ga0495626_0047391
2287 Ga0496100_0006789
2288 Ga0496100_0087153
2289 Ga0496100_0380950
2290 Ga0496100_0492733
2291 Ga0496101_0004666
2292 Ga0496101_0019111
2293 Ga0496101_0122915
2294 Ga0496102_0036631
2295 Ga0496102_0093896
2296 Ga0496102_0094468
2297 Ga0496102_0128173
2298 Ga0496102_0146573
2299 Ga0496102_0181071
2300 Ga0496102_0348483
2301 Ga0496103_0005617
2302 Ga0496103_0047733
2303 Ga0496103_0053865
2304 Ga0496103_0377923
2305 Ga0496104_0001904
2306 Ga0496104_0002719
2307 Ga0496104_0181095
2308 Ga0496104_0287216
2309 Ga0496104_0415759
2310 Ga0496104_0593675
2311 Ga0496105_0002098
2312 Ga0496105_0006427
2313 Ga0496105_0030853
2314 Ga0496105_0263380
2315 Ga0496105_0277704
2316 Ga0496106_0004911
2317 Ga0496106_0010763
2318 Ga0496106_0041542
2319 Ga0496106_0095754
2320 Ga0496106_0102688
2321 Ga0496106_0174187
2322 Ga0496106_0188309
2323 Ga0496107_0008851
2324 Ga0496107_0050019
2325 Ga0496107_0055962
2326 Ga0496107_0284836
2327 Ga0496107_0288508
2328 Ga0496108_0000805
2329 Ga0496108_0011014
2330 Ga0496108_0038659
2331 Ga0496108_0076277
2332 Ga0496108_0206639
2333 Ga0496108_0274436
2334 Ga0496109_0003834
2335 Ga0496109_0006148
2336 Ga0496109_0010849
2337 Ga0496109_0034697
2338 Ga0496109_0107735
2339 Ga0496109_0113227
2340 Ga0496109_0135910
2341 Ga0496109_0356770
2342 Ga0496110_0041290
2343 Ga0496110_0122868
2344 Ga0496110_0134229
2345 Ga0496111_0025643
2346 Ga0496111_0096616
2347 Ga0496111_0449428
2348 Ga0496112_0008679
2349 Ga0496112_0035815
2350 Ga0496112_0076186
2351 Ga0496112_0121145
2352 Ga0496112_0154555
2353 Ga0496112_0158389
2354 Ga0496112_0284932
2355 Ga0496113_0000438
2356 Ga0496113_0019532
2357 Ga0496113_0050922
2358 Ga0496113_0207308
2359 Ga0496113_0302188
2360 Ga0496114_0049245
2361 Ga0496114_0107697
2362 Ga0496114_0184579
2363 Ga0496114_0215479
2364 Ga0496115_0018670
2365 Ga0496115_0025924
2366 Ga0496115_0029352
2367 Ga0496115_0031429
2368 Ga0496115_0074217
2369 Ga0496115_0100578
2370 Ga0496115_0274505
2371 Ga0496116_0000958
2372 Ga0496118_0048321
2373 Ga0496119_0035034
2374 Ga0496119_0144533
2375 Ga0496121_0002920
2376 Ga0496121_0013931
2377 Ga0496121_0023674
2378 Ga0496121_0075192
2379 Ga0496121_0077157
2380 Ga0496121_0083048
2381 Ga0496121_0187666
2382 Ga0496121_0208958
2383 Ga0496122_0017864
2384 Ga0496122_0089044
2385 Ga0496124_0071501
2386 Ga0496125_0003632
2387 Ga0496125_0021736
2388 Ga0496126_0018354
2389 Ga0496126_0041783
2390 Ga0496126_0103310
2391 Ga0496126_0107710
2392 Ga0496126_0140704
2393 Ga0496126_0198508
2394 Ga0501031_0177938
2395 Ga0501033_0226561
2396 Ga0501034_0222205
2397 Ga0501036_0125433
2398 Ga0501036_0142458
2399 Ga0501037_0335079
2400 Ga0501043_0017220
2401 Ga0501046_0029243
2402 Ga0501047_0123187
2403 Ga0501047_0174160
2404 Ga0501047_0301337
2405 Ga0501068_0078539
2406 Ga0501070_0209719
2407 Ga0501070_0214529
2408 Ga0501070_0226043
2409 Ga0501035_0029235
2410 Ga0501035_0116942
2411 Ga0501044_0070676
2412 Ga0501044_0093539
2413 Ga0501044_0147160
2414 Ga0501044_0171863
2415 nmdc:mga03n38_2004_c1
2416 nmdc:mga03n38_3012_c1
2417 nmdc:mga00v17_21355_c1
2418 nmdc:mga00v17_95124_c1
2419 nmdc:mga0yw44_164923_c1
2420 nmdc:mga0yw44_2357_c1
2421 nmdc:mga0k408_49753_c1
2422 nmdc:mga06z11_105477_c1
2423 nmdc:mga07m45_202490_c1
2424 nmdc:mga05p37_18057_c1
2425 nmdc:mga05p37_58782_c1
2426 nmdc:mga08y16_12539_c1
2427 nmdc:mga08y16_140521_c1
2428 nmdc:mga08y16_4539_c1
2429 nmdc:mga0n895_1836_c1
2430 nmdc:mga0n895_196663_c1
2431 nmdc:mga0n895_66040_c1
2432 nmdc:mga0n895_7304_c1
2433 nmdc:mga0rr50_20965_c1
2434 nmdc:mga0rr50_25982_c1
2435 nmdc:mga0rr50_391933_c1
2436 nmdc:mga0rr50_53181_c1
2437 nmdc:mga08x19_27217_c1
2438 nmdc:mga0a205_2579_c1
2439 nmdc:mga0a205_26018_c1
2440 nmdc:mga0sz30_31685_c1
2441 Ga0495601_0002613
2442 Ga0495601_0006170
2443 Ga0495601_0024647
2444 Ga0495601_0030648
2445 Ga0495601_0040018
2446 Ga0495601_0082043
2447 Ga0495612_0000281
2448 Ga0495612_0008253
2449 Ga0495612_0009000
2450 Ga0495612_0014065
2451 Ga0495612_0014717
2452 Ga0495612_0084269
2453 Ga0495595_0000337
2454 Ga0495595_0008607
2455 Ga0495595_0015798
2456 Ga0495619_0000333
2457 Ga0495619_0000546
2458 Ga0495619_0005259
2459 Ga0495619_0022573
2460 Ga0495619_0024161
2461 Ga0495619_0067842
2462 Ga0495619_0094294
2463 Ga0495619_0128776
2464 Ga0495619_0188066
2465 Ga0500643_015965
2466 Ga0500646_0013953
2467 Ga0500651_0010394
2468 Ga0500651_0111123
2469 Ga0500566_0000403
2470 Ga0500641_0165883
2471 Ga0500650_0005095
2472 Ga0500650_0127179
2473 Ga0500556_0000016
2474 Ga0500592_001811
2475 Ga0500595_003699
2476 Ga0500595_017201
2477 Ga0500642_0000017
2478 Ga0500652_000751
2479 Ga0500559_0000209
2480 Ga0500568_0000626
2481 Ga0500616_0000565
2482 Ga0500622_0002251
2483 Ga0500627_0025957
2484 Ga0500627_0065382
2485 Ga0500627_0215114
2486 Ga0500636_0005654
2487 Ga0500636_0151742
2488 Ga0500637_0014160
2489 Ga0500645_007874
2490 Ga0500645_017152
2491 Ga0501082_0291901
2492 Ga0466962_0039220
2493 Ga0530510_0408047
2494 2509152560
2495 2513661637
2496 2513671795
2497 2513698861
2498 2513863110
2499 2513923308
2500 2517889129
2501 2524541226
2502 2603858174
2503 2644732367
2504 2671121585
2505 2723841895
2506 2728753702
2507 2776259776
2508 2793072623
2509 2793079170
2510 2874610505
2511 2876818199
2512 2879115147
2513 2885382867
2514 2885388435
2515 2889035186
2516 2893067055
2517 2903753638
2518 2903774871
2519 2904690927
2520 2904708244
2521 2906613480
2522 2906668204
2523 2908747742
2524 2908756983
2525 2922363286
2526 2922388789
2527 2922433917
2528 2935634939
2529 2941514273
2530 2941522234
2531 2941530105
2532 3005475365
2533 8006935919
2534 8006969406
2535 8006975965
2536 8006988454
2537 8007000701
2538 8019562754
2539 8019572833
2540 8056678588
2541 8056687331
2542 8056691890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14067

LssY_C

LssY C-terminus

51

235

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wva-assembly1.cif.gz_A takifugu rubripes vkor-like with vitamin k1 epoxide at non-catalytic state 0.5594 135 170
7nru-assembly1.cif.gz_A structure of a natural chimera of meningococcal factor h binding protein belonging to nl096 strain 0.5339 121 167
4z3t-assembly1.cif.gz_A meningococcal factor h binding protein mutant l130r/g133d 0.517 121 165
8bk2-assembly3.cif.gz_C x-ray structure of meningococcal factor h binding protein variant 2 in complex with a specific and bactericidal human monoclonal antibody 1b1 0.4977 121 165
7lcv-assembly1.cif.gz_C factor h enhancing human antibody fragment (fab) to meningococcal factor h binding protein 0.4889 121 165
ID Description Score Start End Superfamily
af_B6SUS2_106_186_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.6265 131 167 2.20.25.80
af_F1LIL9_48_280_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5732 127 169 3.80.10.10
af_Q5AA47_148_344_3.30.1460.20 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.5545 131 155 3.30.1460.20
af_Q6Z0Y0_75_342_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5286 112 187 2.120.10.80
2w80D02 Mainly Beta;Beta Barrel;Porin; 0.4888 121 167 2.40.160.90
ID Description Score Start End GO Terms
AF-A0A529SQC3-F1-model_v4 LssY-like C-terminal domain-containing protein 0.9701 168 241
AF-A0A529N5T7-F1-model_v4 LssY-like C-terminal domain-containing protein 0.9638 183 241
AF-A0A5R2N9D1-F1-model_v4 LssY-like C-terminal domain-containing protein 0.9226 153 241
AF-A0A534R7M5-F1-model_v4 LssY-like C-terminal domain-containing protein 0.9115 133 276
AF-A0A534A2G4-F1-model_v4 LssY-like C-terminal domain-containing protein 0.9102 50 204

Map