F492353

General Info

Members Datasets Scaffolds Average Seq Length
1266 478 2530 102

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10446216|Ga0105244_104462162
Length 120
Sequence VEFLPESGQDVCRTGETMTKRPRRNHTPAFKAKVALAAVRGDKTLAELAQQFDIHPNQITQWKAQLLDGAAGVFGSETRGDSQGPAVDLTVLHAKIGELTLENDFLAGALGKAGLLSAKR

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
223 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
243 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
246 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
257 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
258 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
261 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
264 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
265 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
270 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
271 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
272 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
273 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
274 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
275 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
276 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
277 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
278 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
279 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
280 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
281 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
284 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
288 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
289 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
292 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
301 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
305 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
306 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
319 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
324 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
325 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
326 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
327 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
328 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
329 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
330 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
338 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
339 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
340 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
341 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
342 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
343 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
344 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
345 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
346 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
347 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
348 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
349 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
352 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
353 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
354 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
367 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
368 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
369 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
375 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
378 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
379 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
383 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
388 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
389 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
390 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
391 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
392 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
404 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
405 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
406 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
407 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
408 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
409 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
410 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
411 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
412 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
413 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
414 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
415 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
416 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
417 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
418 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
419 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
420 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
421 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
422 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
423 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
424 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
425 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
426 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
427 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
428 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
429 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
430 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
431 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
432 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
433 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
434 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
435 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
436 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
437 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
438 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
439 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
440 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
441 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
442 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
443 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
444 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
445 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
446 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
447 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
448 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
449 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
450 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
451 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
452 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
453 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
457 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
458 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
459 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
460 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
461 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
462 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
463 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
464 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
465 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
466 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
467 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
468 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
469 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
470 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
471 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
472 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
473 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
474 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
475 3004167301 Mesorhizobium loti 582 Isolate Unclassified
476 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
477 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
478 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.24
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 1.11
Rhizoplane 6.71
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10446216 3300009036 Bacteria 595
2 JGI24740J21852_10075385 3300001979 Bacteria 894
3 JGI24739J22299_10048622 3300001989 Bacteria 1378
4 JGI24737J22298_10043895 3300001990 Bacteria 1368
5 JGI24743J22301_10016746 3300001991 Bacteria 1370
6 JGI24735J21928_10038814 3300002067 Bacteria 1393
7 JGI24750J21931_1033108 3300002070 Bacteria 765
8 JGI24745J21846_1008427 3300002073 Bacteria 1161
9 JGI24748J21848_1022131 3300002074 Bacteria 769
10 JGI24738J21930_10031770 3300002075 Bacteria 1077
11 JGI24738J21930_10098169 3300002075 Bacteria 624
12 JGI24749J21850_1013788 3300002076 Bacteria 1135
13 JGI24744J21845_10065150 3300002077 Bacteria 665
14 JGI24744J21845_10084576 3300002077 Bacteria 581
15 JGI24742J22300_10011327 3300002244 Bacteria 1480
16 JGI24751J29686_10020433 3300002459 Bacteria 1371
17 rootL2_10147005 3300003322 Bacteria 5012
18 Ga0007410J51695_1069272 3300003574 Bacteria 600
19 Ga0007416J51690_1066597 3300003577 Bacteria 551
20 Ga0070658_10322838 3300005327 Bacteria 1319
21 Ga0070658_10376036 3300005327 Bacteria 1218
22 Ga0070658_10700254 3300005327 Bacteria 879
23 Ga0070676_10206008 3300005328 Bacteria 1292
24 Ga0070676_10398524 3300005328 Bacteria 957
25 Ga0070683_100673647 3300005329 Bacteria 990
26 Ga0070683_100860183 3300005329 Bacteria 870
27 Ga0070683_101342447 3300005329 Bacteria 687
28 Ga0070690_100076274 3300005330 Bacteria 2187
29 Ga0070690_100176442 3300005330 Bacteria 1474
30 Ga0070690_100863778 3300005330 Bacteria 705
31 Ga0070670_100289512 3300005331 Bacteria 1431
32 Ga0070670_100931284 3300005331 Bacteria 788
33 Ga0070670_101040227 3300005331 Bacteria 745
34 Ga0070677_10451856 3300005333 Bacteria 687
35 Ga0068869_100614772 3300005334 Bacteria 919
36 Ga0068869_101891599 3300005334 Bacteria 535
37 Ga0070666_10127659 3300005335 Bacteria 1766
38 Ga0070666_10155880 3300005335 Bacteria 1595
39 Ga0070666_10196442 3300005335 Bacteria 1419
40 Ga0070666_10707744 3300005335 Bacteria 739
41 Ga0070680_100291100 3300005336 Bacteria 1384
42 Ga0070682_100047626 3300005337 Bacteria 2666
43 Ga0070682_100127703 3300005337 Bacteria 1716
44 Ga0070682_100232196 3300005337 Bacteria 1319
45 Ga0070682_100348634 3300005337 Bacteria 1103
46 Ga0068868_100035886 3300005338 Bacteria 3834
47 Ga0068868_100310703 3300005338 Bacteria 1341
48 Ga0068868_100813167 3300005338 Bacteria 844
49 Ga0068868_101006867 3300005338 Bacteria 762
50 Ga0068868_101411374 3300005338 Bacteria 650
51 Ga0068868_101996699 3300005338 Bacteria 550
52 Ga0070660_100133744 3300005339 Bacteria 1986
53 Ga0070660_100217276 3300005339 Bacteria 1553
54 Ga0070660_100586085 3300005339 Bacteria 932
55 Ga0070660_100631401 3300005339 Bacteria 897
56 Ga0070689_100229827 3300005340 Bacteria 1524
57 Ga0070689_100238210 3300005340 Bacteria 1498
58 Ga0070691_10075394 3300005341 Bacteria 1643
59 Ga0070691_10155101 3300005341 Bacteria 1177
60 Ga0070691_10311065 3300005341 Bacteria 864
61 Ga0070687_100081095 3300005343 Bacteria 1770
62 Ga0070687_100121237 3300005343 Bacteria 1496
63 Ga0070661_100237655 3300005344 Bacteria 1402
64 Ga0070661_100342304 3300005344 Bacteria 1172
65 Ga0070692_10090870 3300005345 Bacteria 1659
66 Ga0070692_10101068 3300005345 Bacteria 1581
67 Ga0070668_100261538 3300005347 Bacteria 1439
68 Ga0070669_100079724 3300005353 Bacteria 2435
69 Ga0070669_100132930 3300005353 Bacteria 1911
70 Ga0070669_100266586 3300005353 Bacteria 1368
71 Ga0070669_100577689 3300005353 Bacteria 940
72 Ga0070675_100148798 3300005354 Bacteria 2006
73 Ga0070675_100206088 3300005354 Bacteria 1708
74 Ga0070675_100945754 3300005354 Bacteria 790
75 Ga0070675_102052671 3300005354 Bacteria 527
76 Ga0070671_100080209 3300005355 Bacteria 2728
77 Ga0070671_100556377 3300005355 Bacteria 989
78 Ga0070671_101423457 3300005355 Bacteria 613
79 Ga0070674_100138267 3300005356 Bacteria 1825
80 Ga0070674_100141575 3300005356 Bacteria 1805
81 Ga0070674_100882812 3300005356 Bacteria 778
82 Ga0070673_100206576 3300005364 Bacteria 1694
83 Ga0070673_100263621 3300005364 Bacteria 1506
84 Ga0070673_100306049 3300005364 Bacteria 1400
85 Ga0070673_100592016 3300005364 Bacteria 1011
86 Ga0070673_102219006 3300005364 Bacteria 522
87 Ga0070688_100180293 3300005365 Bacteria 1464
88 Ga0070688_100188306 3300005365 Bacteria 1436
89 Ga0070688_101533574 3300005365 Bacteria 543
90 Ga0070659_100230238 3300005366 Bacteria 1531
91 Ga0070659_100399967 3300005366 Bacteria 1159
92 Ga0070659_101238727 3300005366 Bacteria 660
93 Ga0070667_100234051 3300005367 Bacteria 1638
94 Ga0070667_100254748 3300005367 Bacteria 1570
95 Ga0070667_100417609 3300005367 Bacteria 1223
96 Ga0070667_101152939 3300005367 Bacteria 725
97 Ga0070667_101420702 3300005367 Bacteria 651
98 Ga0070703_10114692 3300005406 Bacteria 969
99 Ga0070703_10165847 3300005406 Bacteria 842
100 Ga0070709_10191833 3300005434 Bacteria 1442
101 Ga0070709_10258746 3300005434 Bacteria 1257
102 Ga0070714_100204469 3300005435 Bacteria 1808
103 Ga0070714_100212290 3300005435 Bacteria 1774
104 Ga0070714_101925590 3300005435 Bacteria 577
105 Ga0070713_100223595 3300005436 Bacteria 1708
106 Ga0070713_100628513 3300005436 Bacteria 1021
107 Ga0070713_101401031 3300005436 Bacteria 678
108 Ga0070710_11338472 3300005437 Bacteria 533
109 Ga0070701_10107413 3300005438 Bacteria 1555
110 Ga0070701_10108264 3300005438 Bacteria 1549
111 Ga0070711_100415920 3300005439 Bacteria 1094
112 Ga0070705_100161616 3300005440 Bacteria 1498
113 Ga0070705_100398297 3300005440 Bacteria 1019
114 Ga0070705_100428057 3300005440 Bacteria 987
115 Ga0070700_100093770 3300005441 Bacteria 1964
116 Ga0070700_100184474 3300005441 Bacteria 1455
117 Ga0070700_101019078 3300005441 Bacteria 682
118 Ga0070694_100058448 3300005444 Bacteria 2624
119 Ga0070694_100116185 3300005444 Bacteria 1913
120 Ga0070694_100472260 3300005444 Bacteria 994
121 Ga0070694_100975822 3300005444 Bacteria 702
122 Ga0070694_101465665 3300005444 Bacteria 577
123 Ga0070708_100073139 3300005445 Bacteria 3089
124 Ga0070708_101256225 3300005445 Bacteria 692
125 Ga0070663_100056086 3300005455 Bacteria 2822
126 Ga0070663_100179196 3300005455 Bacteria 1642
127 Ga0070663_100215612 3300005455 Bacteria 1505
128 Ga0070663_100218255 3300005455 Bacteria 1496
129 Ga0070663_100235485 3300005455 Bacteria 1443
130 Ga0070663_100354031 3300005455 Bacteria 1189
131 Ga0070663_100485483 3300005455 Bacteria 1023
132 Ga0070678_100168375 3300005456 Bacteria 1782
133 Ga0070678_100179777 3300005456 Bacteria 1730
134 Ga0070678_100231064 3300005456 Bacteria 1542
135 Ga0070678_100526465 3300005456 Bacteria 1047
136 Ga0070678_100779996 3300005456 Bacteria 866
137 Ga0070678_101897394 3300005456 Bacteria 563
138 Ga0070678_102400382 3300005456 Bacteria 501
139 Ga0070662_100219086 3300005457 Bacteria 1518
140 Ga0070662_100275160 3300005457 Bacteria 1361
141 Ga0070662_100550755 3300005457 Bacteria 966
142 Ga0070662_100918136 3300005457 Bacteria 747
143 Ga0070681_11440439 3300005458 Bacteria 613
144 Ga0068867_100210797 3300005459 Bacteria 1560
145 Ga0068867_100253286 3300005459 Bacteria 1432
146 Ga0068867_102339022 3300005459 Bacteria 508
147 Ga0070685_10140688 3300005466 Bacteria 1519
148 Ga0070685_10481633 3300005466 Bacteria 875
149 Ga0070685_10706526 3300005466 Bacteria 735
150 Ga0070685_10824106 3300005466 Bacteria 686
151 Ga0070706_100122781 3300005467 Bacteria 2421
152 Ga0070706_100449020 3300005467 Bacteria 1200
153 Ga0070707_100000007 3300005468 Bacteria 181102
154 Ga0070707_101609441 3300005468 Bacteria 616
155 Ga0070698_100049864 3300005471 Bacteria 4272
156 Ga0070698_100157038 3300005471 Bacteria 2220
157 Ga0070699_100018019 3300005518 Bacteria 6066
158 Ga0070699_100084597 3300005518 Bacteria 2768
159 Ga0070699_100140825 3300005518 Bacteria 2130
160 Ga0070679_101221960 3300005530 Bacteria 697
161 Ga0070679_101523359 3300005530 Bacteria 616
162 Ga0070679_101869413 3300005530 Bacteria 549
163 Ga0070684_100270005 3300005535 Bacteria 1557
164 Ga0070684_100282209 3300005535 Bacteria 1522
165 Ga0070684_100410004 3300005535 Bacteria 1250
166 Ga0070697_100029875 3300005536 Bacteria 4375
167 Ga0070697_100033549 3300005536 Bacteria 4134
168 Ga0068853_100207357 3300005539 Bacteria 1785
169 Ga0068853_100309860 3300005539 Bacteria 1461
170 Ga0068853_100674801 3300005539 Bacteria 985
171 Ga0070672_100270996 3300005543 Bacteria 1433
172 Ga0070672_100355467 3300005543 Bacteria 1249
173 Ga0070672_100448078 3300005543 Bacteria 1111
174 Ga0070672_100775940 3300005543 Bacteria 842
175 Ga0070672_101614744 3300005543 Bacteria 582
176 Ga0070686_100013115 3300005544 Bacteria 4733
177 Ga0070686_100113836 3300005544 Bacteria 1848
178 Ga0070686_100133681 3300005544 Bacteria 1718
179 Ga0070686_100514309 3300005544 Bacteria 931
180 Ga0070695_100214298 3300005545 Bacteria 1384
181 Ga0070695_101631310 3300005545 Bacteria 539
182 Ga0070696_100394813 3300005546 Bacteria 1081
183 Ga0070693_100106003 3300005547 Bacteria 1720
184 Ga0070693_100112817 3300005547 Bacteria 1675
185 Ga0070665_100121418 3300005548 Bacteria 2614
186 Ga0070665_100240142 3300005548 Bacteria 1812
187 Ga0070665_100291744 3300005548 Bacteria 1633
188 Ga0070665_101576236 3300005548 Bacteria 665
189 Ga0070704_100226942 3300005549 Bacteria 1521
190 Ga0068855_100288933 3300005563 Bacteria 1818
191 Ga0068855_102080435 3300005563 Bacteria 572
192 Ga0070664_100276476 3300005564 Bacteria 1514
193 Ga0070664_100329572 3300005564 Bacteria 1385
194 Ga0070664_101380973 3300005564 Bacteria 666
195 Ga0068857_100262766 3300005577 Bacteria 1584
196 Ga0068857_100827487 3300005577 Bacteria 885
197 Ga0068854_100143804 3300005578 Bacteria 1833
198 Ga0068854_100445414 3300005578 Bacteria 1080
199 Ga0068854_100513900 3300005578 Bacteria 1010
200 Ga0068854_101020220 3300005578 Bacteria 733
201 Ga0068856_100217350 3300005614 Bacteria 1926
202 Ga0068856_100392445 3300005614 Bacteria 1407
203 Ga0068856_100693589 3300005614 Bacteria 1039
204 Ga0068856_101234487 3300005614 Bacteria 763
205 Ga0070702_100140492 3300005615 Bacteria 1537
206 Ga0070702_100447213 3300005615 Bacteria 936
207 Ga0070702_100467592 3300005615 Bacteria 918
208 Ga0070702_100619891 3300005615 Bacteria 814
209 Ga0068852_100182823 3300005616 Bacteria 1972
210 Ga0068852_100269607 3300005616 Bacteria 1637
211 Ga0068852_100523443 3300005616 Bacteria 1183
212 Ga0068852_100752883 3300005616 Bacteria 986
213 Ga0068852_101527723 3300005616 Bacteria 690
214 Ga0068859_100326179 3300005617 Bacteria 1629
215 Ga0068859_101955481 3300005617 Bacteria 647
216 Ga0068859_102876218 3300005617 Bacteria 528
217 Ga0068864_100255090 3300005618 Bacteria 1630
218 Ga0068864_100289621 3300005618 Bacteria 1531
219 Ga0068864_100298123 3300005618 Bacteria 1508
220 Ga0068864_101500946 3300005618 Bacteria 677
221 Ga0068866_10059176 3300005718 Bacteria 1981
222 Ga0068866_10082102 3300005718 Bacteria 1733
223 Ga0068866_10129037 3300005718 Bacteria 1435
224 Ga0068866_10316049 3300005718 Bacteria 981
225 Ga0068866_10537144 3300005718 Bacteria 780
226 Ga0068861_100163416 3300005719 Bacteria 1839
227 Ga0068861_100164862 3300005719 Bacteria 1831
228 Ga0068861_102453206 3300005719 Bacteria 525
229 Ga0068851_10105009 3300005834 Bacteria 1503
230 Ga0068851_10115648 3300005834 Bacteria 1437
231 Ga0068851_10128625 3300005834 Bacteria 1368
232 Ga0068870_10058705 3300005840 Bacteria 2060
233 Ga0068870_10126529 3300005840 Bacteria 1479
234 Ga0068870_10127391 3300005840 Bacteria 1474
235 Ga0068870_10709567 3300005840 Bacteria 695
236 Ga0068863_100363307 3300005841 Bacteria 1412
237 Ga0068863_100382163 3300005841 Bacteria 1375
238 Ga0068863_101716408 3300005841 Bacteria 637
239 Ga0068863_102507481 3300005841 Bacteria 525
240 Ga0068858_100327399 3300005842 Bacteria 1465
241 Ga0068858_100386408 3300005842 Bacteria 1343
242 Ga0068858_101115700 3300005842 Bacteria 774
243 Ga0068860_100270067 3300005843 Bacteria 1659
244 Ga0068860_100314356 3300005843 Bacteria 1536
245 Ga0068860_100448608 3300005843 Bacteria 1282
246 Ga0068862_100226532 3300005844 Bacteria 1694
247 Ga0068862_100262876 3300005844 Bacteria 1576
248 Ga0070717_10079647 3300006028 Bacteria 2747
249 Ga0070717_10169654 3300006028 Bacteria 1897
250 Ga0070717_10703016 3300006028 Bacteria 918
251 Ga0075363_100947220 3300006048 Bacteria 529
252 Ga0075432_10103406 3300006058 Bacteria 1054
253 Ga0075432_10573666 3300006058 Bacteria 513
254 Ga0070716_100008163 3300006173 Bacteria 5187
255 Ga0070716_100357374 3300006173 Bacteria 1036
256 Ga0070716_100664260 3300006173 Bacteria 792
257 Ga0070712_100391001 3300006175 Bacteria 1147
258 Ga0075366_10248641 3300006195 Bacteria 1084
259 Ga0097621_100246623 3300006237 Bacteria 1563
260 Ga0097621_100444594 3300006237 Bacteria 1167
261 Ga0097621_100973855 3300006237 Bacteria 793
262 Ga0068871_100036623 3300006358 Bacteria 3908
263 Ga0068871_100222844 3300006358 Bacteria 1635
264 Ga0068871_100363941 3300006358 Bacteria 1282
265 Ga0068871_100705600 3300006358 Bacteria 924
266 Ga0075428_101760753 3300006844 Bacteria 645
267 Ga0075430_100117831 3300006846 Bacteria 2213
268 Ga0075430_101263358 3300006846 Bacteria 607
269 Ga0075431_100617805 3300006847 Bacteria 1066
270 Ga0075431_100773162 3300006847 Bacteria 935
271 Ga0075431_101328650 3300006847 Bacteria 679
272 Ga0075429_100312589 3300006880 Bacteria 1375
273 Ga0075429_100446361 3300006880 Bacteria 1133
274 Ga0068865_100205805 3300006881 Bacteria 1530
275 Ga0068865_100220245 3300006881 Bacteria 1483
276 Ga0068865_100227814 3300006881 Bacteria 1460
277 Ga0068865_100457341 3300006881 Bacteria 1057
278 Ga0068865_100716349 3300006881 Bacteria 856
279 Ga0097620_100326231 3300006931 Bacteria 1629
280 Ga0097620_101955544 3300006931 Bacteria 647
281 Ga0097620_102876253 3300006931 Bacteria 528
282 Ga0075435_100576717 3300007076 Bacteria 975
283 Ga0105251_10306132 3300009011 Bacteria 721
284 Ga0105244_10067108 3300009036 Bacteria 1795
285 Ga0105244_10321305 3300009036 Bacteria 715
286 Ga0105250_10114752 3300009092 Bacteria 1105
287 Ga0105240_10258777 3300009093 Bacteria 2009
288 Ga0105240_10448802 3300009093 Bacteria 1444
289 Ga0105240_11048037 3300009093 Bacteria 870
290 Ga0111539_10538945 3300009094 Bacteria 1360
291 Ga0111539_12600487 3300009094 Bacteria 587
292 Ga0105245_10254336 3300009098 Bacteria 1708
293 Ga0105245_10648974 3300009098 Bacteria 1085
294 Ga0105245_10968147 3300009098 Bacteria 894
295 Ga0105245_11733074 3300009098 Bacteria 677
296 Ga0105245_12434956 3300009098 Bacteria 577
297 Ga0105247_10102325 3300009101 Bacteria 1833
298 Ga0105247_10174051 3300009101 Bacteria 1433
299 Ga0105247_10250874 3300009101 Bacteria 1210
300 Ga0105247_10440054 3300009101 Bacteria 937
301 Ga0105243_10123671 3300009148 Bacteria 2185
302 Ga0105243_10161637 3300009148 Bacteria 1931
303 Ga0105243_10245964 3300009148 Bacteria 1594
304 Ga0105243_10391531 3300009148 Bacteria 1288
305 Ga0105243_10541887 3300009148 Bacteria 1110
306 Ga0105243_12007017 3300009148 Bacteria 613
307 Ga0105241_10718732 3300009174 Bacteria 913
308 Ga0105242_10135978 3300009176 Bacteria 2127
309 Ga0105242_10206094 3300009176 Bacteria 1749
310 Ga0105242_10312017 3300009176 Bacteria 1439
311 Ga0105242_10770952 3300009176 Bacteria 949
312 Ga0105242_13111309 3300009176 Bacteria 514
313 Ga0105248_10361670 3300009177 Bacteria 1634
314 Ga0105248_10364424 3300009177 Bacteria 1627
315 Ga0105248_10623182 3300009177 Bacteria 1217
316 Ga0105237_10187553 3300009545 Bacteria 2068
317 Ga0105237_10247040 3300009545 Bacteria 1786
318 Ga0105237_10288859 3300009545 Bacteria 1643
319 Ga0105237_10560816 3300009545 Bacteria 1149
320 Ga0105237_10664183 3300009545 Bacteria 1049
321 Ga0105237_11059527 3300009545 Bacteria 818
322 Ga0105237_11304788 3300009545 Bacteria 732
323 Ga0105237_11620349 3300009545 Bacteria 654
324 Ga0105238_10212369 3300009551 Bacteria 1911
325 Ga0105238_10251586 3300009551 Bacteria 1745
326 Ga0105238_10271229 3300009551 Bacteria 1677
327 Ga0105238_10492074 3300009551 Bacteria 1226
328 Ga0105249_10218416 3300009553 Bacteria 1875
329 Ga0105249_10336293 3300009553 Bacteria 1525
330 Ga0105249_11052789 3300009553 Bacteria 883
331 Ga0105249_11871349 3300009553 Bacteria 673
332 Ga0105239_10285132 3300010375 Bacteria 1860
333 Ga0105239_10371991 3300010375 Bacteria 1615
334 Ga0105239_10387503 3300010375 Bacteria 1581
335 Ga0105239_12133050 3300010375 Bacteria 651
336 Ga0105246_10083590 3300011119 Bacteria 2282
337 Ga0105246_10113072 3300011119 Bacteria 1998
338 Ga0105246_10304329 3300011119 Bacteria 1289
339 Ga0105246_11295462 3300011119 Bacteria 675
340 Ga0105246_11696477 3300011119 Bacteria 600
341 Ga0157341_1013489 3300012494 Bacteria 731
342 Ga0157373_10827986 3300013100 Bacteria 684
343 Ga0157371_10059895 3300013102 Bacteria 2699
344 Ga0157371_10132399 3300013102 Bacteria 1774
345 Ga0157371_10902836 3300013102 Bacteria 670
346 Ga0157370_10254568 3300013104 Bacteria 1624
347 Ga0157370_11769847 3300013104 Bacteria 555
348 Ga0157369_10042214 3300013105 Bacteria 4976
349 Ga0157369_10272875 3300013105 Bacteria 1762
350 Ga0157369_11594000 3300013105 Bacteria 664
351 Ga0157374_10087909 3300013296 Bacteria 2959
352 Ga0157374_10200266 3300013296 Bacteria 1955
353 Ga0157374_10296674 3300013296 Bacteria 1599
354 Ga0157374_10297273 3300013296 Bacteria 1597
355 Ga0157374_10955074 3300013296 Bacteria 876
356 Ga0157374_12726747 3300013296 Bacteria 522
357 Ga0157378_10871081 3300013297 Bacteria 930
358 Ga0157378_11195784 3300013297 Bacteria 799
359 Ga0157378_13097797 3300013297 Bacteria 516
360 Ga0163162_10248003 3300013306 Bacteria 1912
361 Ga0163162_10823584 3300013306 Bacteria 1044
362 Ga0163162_10837849 3300013306 Bacteria 1035
363 Ga0163162_10861900 3300013306 Bacteria 1020
364 Ga0163162_10933409 3300013306 Bacteria 980
365 Ga0163162_11325364 3300013306 Bacteria 818
366 Ga0163162_11582625 3300013306 Bacteria 747
367 Ga0163162_12917569 3300013306 Bacteria 550
368 Ga0157372_10409779 3300013307 Bacteria 1580
369 Ga0157372_11559451 3300013307 Bacteria 760
370 Ga0157372_12616374 3300013307 Bacteria 579
371 Ga0157375_10155470 3300013308 Bacteria 2426
372 Ga0157375_10270996 3300013308 Bacteria 1860
373 Ga0157375_10290764 3300013308 Bacteria 1797
374 Ga0157375_10317125 3300013308 Bacteria 1723
375 Ga0157375_10803846 3300013308 Bacteria 1089
376 Ga0157375_11010822 3300013308 Bacteria 971
377 Ga0157375_11605608 3300013308 Bacteria 769
378 Ga0157375_12973672 3300013308 Bacteria 566
379 Ga0163163_10289466 3300014325 Bacteria 1690
380 Ga0163163_10353639 3300014325 Bacteria 1525
381 Ga0163163_10358006 3300014325 Bacteria 1516
382 Ga0157380_10188246 3300014326 Bacteria 1820
383 Ga0157380_10217327 3300014326 Bacteria 1708
384 Ga0157380_12532236 3300014326 Bacteria 579
385 Ga0182008_10109608 3300014497 Bacteria 1368
386 Ga0182008_10182788 3300014497 Bacteria 1061
387 Ga0182008_10449875 3300014497 Bacteria 700
388 Ga0182008_10467990 3300014497 Bacteria 688
389 Ga0182008_10481325 3300014497 Bacteria 680
390 Ga0182008_10542372 3300014497 Bacteria 645
391 Ga0182008_10779233 3300014497 Bacteria 553
392 Ga0157377_10065212 3300014745 Bacteria 2091
393 Ga0157377_10116083 3300014745 Bacteria 1616
394 Ga0157379_10214339 3300014968 Bacteria 1744
395 Ga0157379_10537179 3300014968 Bacteria 1087
396 Ga0157379_10772597 3300014968 Bacteria 905
397 Ga0157379_11696340 3300014968 Bacteria 619
398 Ga0157376_10339974 3300014969 Bacteria 1433
399 Ga0157376_10485766 3300014969 Bacteria 1211
400 Ga0157376_10989796 3300014969 Bacteria 863
401 Ga0157376_11306218 3300014969 Bacteria 756
402 Ga0182006_1015493 3300015261 Bacteria 3268
403 Ga0182007_10026946 3300015262 Bacteria 1986
404 Ga0182007_10058360 3300015262 Bacteria 1266
405 Ga0182007_10068174 3300015262 Bacteria 1166
406 Ga0182005_1020653 3300015265 Bacteria 1811
407 Ga0182005_1098920 3300015265 Bacteria 816
408 Ga0163161_10139333 3300017792 Bacteria 1836
409 Ga0163161_10559063 3300017792 Bacteria 939
410 Ga0163161_10952873 3300017792 Bacteria 730
411 Ga0163161_11244958 3300017792 Bacteria 645
412 Ga0163161_11781990 3300017792 Bacteria 547
413 Ga0213871_10228380 3300021441 Bacteria 587
414 Ga0224572_1038675 3300024225 Bacteria 901
415 Ga0228598_1037682 3300024227 Bacteria 953
416 Ga0207656_10081982 3300025321 Bacteria 1451
417 Ga0207656_10091229 3300025321 Bacteria 1383
418 Ga0207656_10225329 3300025321 Bacteria 912
419 Ga0207653_10101679 3300025885 Bacteria 1017
420 Ga0207682_10017510 3300025893 Bacteria 2799
421 Ga0207682_10387834 3300025893 Bacteria 660
422 Ga0207692_10356251 3300025898 Bacteria 903
423 Ga0207642_10054106 3300025899 Bacteria 1829
424 Ga0207642_10173014 3300025899 Bacteria 1170
425 Ga0207642_10307922 3300025899 Bacteria 921
426 Ga0207642_10702610 3300025899 Bacteria 637
427 Ga0207710_10064417 3300025900 Bacteria 1669
428 Ga0207710_10082212 3300025900 Bacteria 1496
429 Ga0207710_10432951 3300025900 Bacteria 678
430 Ga0207688_10046979 3300025901 Bacteria 2411
431 Ga0207688_10196745 3300025901 Bacteria 1207
432 Ga0207688_10976130 3300025901 Bacteria 536
433 Ga0207688_11058623 3300025901 Bacteria 512
434 Ga0207680_10111807 3300025903 Bacteria 1773
435 Ga0207680_10355676 3300025903 Bacteria 1029
436 Ga0207680_10397833 3300025903 Bacteria 973
437 Ga0207680_10454225 3300025903 Bacteria 910
438 Ga0207680_10469876 3300025903 Bacteria 894
439 Ga0207647_10107570 3300025904 Bacteria 1650
440 Ga0207647_10168644 3300025904 Bacteria 1275
441 Ga0207647_10241107 3300025904 Bacteria 1038
442 Ga0207699_10146902 3300025906 Bacteria 1555
443 Ga0207699_10157876 3300025906 Bacteria 1507
444 Ga0207699_11223633 3300025906 Bacteria 556
445 Ga0207699_11337724 3300025906 Bacteria 530
446 Ga0207645_10114813 3300025907 Bacteria 1745
447 Ga0207645_10355727 3300025907 Bacteria 980
448 Ga0207643_10042725 3300025908 Bacteria 2556
449 Ga0207643_10049055 3300025908 Bacteria 2392
450 Ga0207643_10390288 3300025908 Bacteria 879
451 Ga0207705_11009052 3300025909 Bacteria 643
452 Ga0207684_10110516 3300025910 Bacteria 2352
453 Ga0207684_11095854 3300025910 Bacteria 663
454 Ga0207654_10297845 3300025911 Bacteria 1096
455 Ga0207654_11020141 3300025911 Bacteria 602
456 Ga0207654_11353230 3300025911 Bacteria 519
457 Ga0207695_10162110 3300025913 Bacteria 2167
458 Ga0207695_10339216 3300025913 Bacteria 1391
459 Ga0207695_10750367 3300025913 Bacteria 856
460 Ga0207671_10232424 3300025914 Bacteria 1447
461 Ga0207671_10244928 3300025914 Bacteria 1409
462 Ga0207671_11080835 3300025914 Bacteria 631
463 Ga0207693_10455965 3300025915 Bacteria 999
464 Ga0207693_10589718 3300025915 Bacteria 865
465 Ga0207663_10101214 3300025916 Bacteria 1936
466 Ga0207660_10371392 3300025917 Bacteria 1149
467 Ga0207662_10100932 3300025918 Bacteria 1788
468 Ga0207657_10178365 3300025919 Bacteria 1718
469 Ga0207657_10509141 3300025919 Bacteria 943
470 Ga0207657_10532591 3300025919 Bacteria 919
471 Ga0207649_10200251 3300025920 Bacteria 1410
472 Ga0207649_11553419 3300025920 Bacteria 524
473 Ga0207652_11074155 3300025921 Bacteria 705
474 Ga0207646_10000010 3300025922 Bacteria 421163
475 Ga0207646_10111221 3300025922 Bacteria 2458
476 Ga0207681_10217254 3300025923 Bacteria 1477
477 Ga0207681_10254438 3300025923 Bacteria 1372
478 Ga0207681_11075510 3300025923 Bacteria 675
479 Ga0207694_10243254 3300025924 Bacteria 1471
480 Ga0207694_10277948 3300025924 Bacteria 1375
481 Ga0207694_10878373 3300025924 Bacteria 758
482 Ga0207650_10213267 3300025925 Bacteria 1551
483 Ga0207650_10240700 3300025925 Bacteria 1462
484 Ga0207650_10379787 3300025925 Bacteria 1167
485 Ga0207650_10945502 3300025925 Bacteria 732
486 Ga0207659_10123813 3300025926 Bacteria 1985
487 Ga0207659_10272209 3300025926 Bacteria 1382
488 Ga0207659_10455781 3300025926 Bacteria 1078
489 Ga0207659_10853706 3300025926 Bacteria 783
490 Ga0207659_11612928 3300025926 Bacteria 554
491 Ga0207687_10213942 3300025927 Bacteria 1514
492 Ga0207687_10234457 3300025927 Bacteria 1451
493 Ga0207687_10237886 3300025927 Bacteria 1442
494 Ga0207700_10295475 3300025928 Bacteria 1397
495 Ga0207700_10955295 3300025928 Bacteria 767
496 Ga0207664_10298280 3300025929 Bacteria 1417
497 Ga0207664_11422812 3300025929 Bacteria 614
498 Ga0207644_10531145 3300025931 Bacteria 972
499 Ga0207644_11061382 3300025931 Bacteria 680
500 Ga0207644_11831820 3300025931 Bacteria 508
501 Ga0207690_10060871 3300025932 Bacteria 2564
502 Ga0207690_10152133 3300025932 Bacteria 1716
503 Ga0207690_10380600 3300025932 Bacteria 1121
504 Ga0207690_10902205 3300025932 Bacteria 733
505 Ga0207706_10053328 3300025933 Bacteria 3570
506 Ga0207706_10098511 3300025933 Bacteria 2572
507 Ga0207706_10127007 3300025933 Bacteria 2243
508 Ga0207686_10133748 3300025934 Bacteria 1704
509 Ga0207686_10525984 3300025934 Bacteria 921
510 Ga0207686_11397339 3300025934 Bacteria 576
511 Ga0207709_10155549 3300025935 Bacteria 1589
512 Ga0207709_10172260 3300025935 Bacteria 1520
513 Ga0207709_10302636 3300025935 Bacteria 1190
514 Ga0207709_11223009 3300025935 Bacteria 619
515 Ga0207670_10219292 3300025936 Bacteria 1455
516 Ga0207670_10220529 3300025936 Bacteria 1451
517 Ga0207669_10147814 3300025937 Bacteria 1641
518 Ga0207669_10177678 3300025937 Bacteria 1522
519 Ga0207669_10181141 3300025937 Bacteria 1510
520 Ga0207669_10224014 3300025937 Bacteria 1382
521 Ga0207669_10455505 3300025937 Bacteria 1015
522 Ga0207704_10181517 3300025938 Bacteria 1521
523 Ga0207704_10200535 3300025938 Bacteria 1460
524 Ga0207704_10203473 3300025938 Bacteria 1451
525 Ga0207665_10891101 3300025939 Bacteria 705
526 Ga0207691_10226247 3300025940 Bacteria 1621
527 Ga0207691_10420151 3300025940 Bacteria 1139
528 Ga0207691_10473945 3300025940 Bacteria 1064
529 Ga0207691_10933339 3300025940 Bacteria 726
530 Ga0207691_11001011 3300025940 Bacteria 697
531 Ga0207711_10139662 3300025941 Bacteria 2179
532 Ga0207711_10203365 3300025941 Bacteria 1808
533 Ga0207711_11720593 3300025941 Bacteria 570
534 Ga0207689_10188350 3300025942 Bacteria 1702
535 Ga0207689_10535867 3300025942 Bacteria 983
536 Ga0207661_10202280 3300025944 Bacteria 1746
537 Ga0207661_10207634 3300025944 Bacteria 1725
538 Ga0207661_10306152 3300025944 Bacteria 1425
539 Ga0207679_10135595 3300025945 Bacteria 1982
540 Ga0207679_10587599 3300025945 Bacteria 1002
541 Ga0207679_10657283 3300025945 Bacteria 948
542 Ga0207679_11568214 3300025945 Bacteria 604
543 Ga0207667_10331701 3300025949 Bacteria 1553
544 Ga0207651_10204576 3300025960 Bacteria 1585
545 Ga0207651_10229638 3300025960 Bacteria 1505
546 Ga0207651_10885256 3300025960 Bacteria 795
547 Ga0207651_11055095 3300025960 Bacteria 727
548 Ga0207651_11425939 3300025960 Bacteria 623
549 Ga0207712_10225239 3300025961 Bacteria 1502
550 Ga0207712_10261959 3300025961 Bacteria 1403
551 Ga0207712_11187219 3300025961 Bacteria 681
552 Ga0207668_10267678 3300025972 Bacteria 1395
553 Ga0207668_10756586 3300025972 Bacteria 857
554 Ga0207640_10199591 3300025981 Bacteria 1515
555 Ga0207640_10244083 3300025981 Bacteria 1390
556 Ga0207640_11271419 3300025981 Bacteria 656
557 Ga0207658_10062311 3300025986 Bacteria 2791
558 Ga0207658_10387065 3300025986 Bacteria 1226
559 Ga0207658_11154024 3300025986 Bacteria 708
560 Ga0207658_12088053 3300025986 Bacteria 515
561 Ga0207677_10226749 3300026023 Bacteria 1502
562 Ga0207677_10256445 3300026023 Bacteria 1423
563 Ga0207677_10495512 3300026023 Bacteria 1055
564 Ga0207677_10520976 3300026023 Bacteria 1031
565 Ga0207677_11286202 3300026023 Bacteria 671
566 Ga0207677_12140303 3300026023 Bacteria 520
567 Ga0207703_10292311 3300026035 Bacteria 1483
568 Ga0207703_10782549 3300026035 Bacteria 910
569 Ga0207703_11186872 3300026035 Bacteria 734
570 Ga0207703_12106901 3300026035 Bacteria 540
571 Ga0207639_10271863 3300026041 Bacteria 1487
572 Ga0207639_10309285 3300026041 Bacteria 1399
573 Ga0207639_10344918 3300026041 Bacteria 1328
574 Ga0207639_10594077 3300026041 Bacteria 1020
575 Ga0207678_10043671 3300026067 Bacteria 3878
576 Ga0207678_10142125 3300026067 Bacteria 2048
577 Ga0207678_10176721 3300026067 Bacteria 1823
578 Ga0207678_10179906 3300026067 Bacteria 1806
579 Ga0207678_10275835 3300026067 Bacteria 1442
580 Ga0207678_10478187 3300026067 Bacteria 1085
581 Ga0207678_10538138 3300026067 Bacteria 1021
582 Ga0207678_11732579 3300026067 Bacteria 548
583 Ga0207708_10199132 3300026075 Bacteria 1597
584 Ga0207708_10219507 3300026075 Bacteria 1523
585 Ga0207708_10919934 3300026075 Bacteria 758
586 Ga0207702_10277123 3300026078 Bacteria 1584
587 Ga0207702_10351197 3300026078 Bacteria 1411
588 Ga0207702_10409422 3300026078 Bacteria 1309
589 Ga0207702_10634515 3300026078 Bacteria 1050
590 Ga0207702_12274285 3300026078 Bacteria 530
591 Ga0207648_10145252 3300026089 Bacteria 2092
592 Ga0207648_10170798 3300026089 Bacteria 1922
593 Ga0207648_10284301 3300026089 Bacteria 1480
594 Ga0207648_10576419 3300026089 Bacteria 1035
595 Ga0207648_10677502 3300026089 Bacteria 954
596 Ga0207648_12270945 3300026089 Bacteria 503
597 Ga0207676_10254430 3300026095 Bacteria 1582
598 Ga0207676_10594191 3300026095 Bacteria 1062
599 Ga0207674_10185122 3300026116 Bacteria 2033
600 Ga0207674_11153920 3300026116 Bacteria 744
601 Ga0207674_11987182 3300026116 Bacteria 547
602 Ga0207675_100184625 3300026118 Bacteria 1998
603 Ga0207675_100295979 3300026118 Bacteria 1575
604 Ga0207675_100297233 3300026118 Bacteria 1572
605 Ga0207683_10053467 3300026121 Bacteria 3541
606 Ga0207683_10187484 3300026121 Bacteria 1877
607 Ga0207683_10203801 3300026121 Bacteria 1799
608 Ga0207683_10249223 3300026121 Bacteria 1621
609 Ga0207683_10269107 3300026121 Bacteria 1556
610 Ga0207683_10678683 3300026121 Bacteria 955
611 Ga0207698_10151177 3300026142 Bacteria 2015
612 Ga0207698_10281204 3300026142 Bacteria 1539
613 Ga0207698_11119658 3300026142 Bacteria 800
614 Ga0207698_11732531 3300026142 Bacteria 640
615 Ga0209973_1055450 3300027252 Bacteria 603
616 Ga0209970_1015752 3300027614 Bacteria 1259
617 Ga0210002_1028915 3300027617 Bacteria 916
618 Ga0209971_1054772 3300027682 Bacteria 964
619 Ga0209966_1034857 3300027695 Bacteria 1031
620 Ga0209998_10029308 3300027717 Bacteria 1213
621 Ga0268266_10141488 3300028379 Bacteria 2159
622 Ga0268266_10311744 3300028379 Bacteria 1470
623 Ga0268265_10268875 3300028380 Bacteria 1519
624 Ga0268265_10950603 3300028380 Bacteria 846
625 Ga0268264_10352046 3300028381 Bacteria 1402
626 Ga0265336_10039272 3300028666 Bacteria 1451
627 Ga0265338_10123350 3300028800 Bacteria 2060
628 Ga0265773_1006783 3300031018 Bacteria 875
629 Ga0265332_10195331 3300031238 Bacteria 842
630 Ga0265328_10043793 3300031239 Bacteria 1646
631 Ga0265328_10155588 3300031239 Bacteria 861
632 Ga0265329_10046286 3300031242 Bacteria 1390
633 Ga0265329_10177809 3300031242 Bacteria 695
634 Ga0265331_10068852 3300031250 Bacteria 1658
635 Ga0265327_10011656 3300031251 Bacteria 6027
636 Ga0265327_10085889 3300031251 Bacteria 1544
637 Ga0265327_10090393 3300031251 Bacteria 1494
638 Ga0265327_10092989 3300031251 Bacteria 1467
639 Ga0265316_10581045 3300031344 Bacteria 796
640 Ga0307509_10203355 3300031507 Bacteria 1814
641 Ga0307408_100242339 3300031548 Bacteria 1482
642 Ga0307408_100256302 3300031548 Bacteria 1445
643 Ga0307408_100320976 3300031548 Bacteria 1304
644 Ga0307408_100458320 3300031548 Bacteria 1107
645 Ga0307408_100898549 3300031548 Bacteria 810
646 Ga0307408_101881296 3300031548 Bacteria 573
647 Ga0307408_101902116 3300031548 Bacteria 570
648 Ga0307408_102036602 3300031548 Bacteria 552
649 Ga0265314_10155969 3300031711 Bacteria 1394
650 Ga0265342_10155701 3300031712 Bacteria 1266
651 Ga0307516_10201716 3300031730 Bacteria 1708
652 Ga0307405_10056128 3300031731 Bacteria 2468
653 Ga0307405_10106019 3300031731 Bacteria 1894
654 Ga0307405_10135819 3300031731 Bacteria 1707
655 Ga0307405_10139368 3300031731 Bacteria 1688
656 Ga0307405_10519874 3300031731 Bacteria 957
657 Ga0307405_10605880 3300031731 Bacteria 894
658 Ga0307405_10923846 3300031731 Bacteria 739
659 Ga0307405_11935707 3300031731 Bacteria 526
660 Ga0307405_11959334 3300031731 Bacteria 523
661 Ga0307413_10034385 3300031824 Bacteria 2896
662 Ga0307413_10162488 3300031824 Bacteria 1570
663 Ga0307413_10170641 3300031824 Bacteria 1539
664 Ga0307413_10176981 3300031824 Bacteria 1516
665 Ga0307413_10482180 3300031824 Bacteria 991
666 Ga0307413_10843731 3300031824 Bacteria 773
667 Ga0307413_11769685 3300031824 Bacteria 552
668 Ga0307410_10164312 3300031852 Bacteria 1666
669 Ga0307410_10170043 3300031852 Bacteria 1641
670 Ga0307410_10186729 3300031852 Bacteria 1573
671 Ga0307410_10244362 3300031852 Bacteria 1392
672 Ga0307410_10276123 3300031852 Bacteria 1316
673 Ga0307410_10284624 3300031852 Bacteria 1298
674 Ga0307410_10285707 3300031852 Bacteria 1296
675 Ga0307410_10357583 3300031852 Bacteria 1168
676 Ga0307410_10559862 3300031852 Bacteria 948
677 Ga0307410_10692253 3300031852 Bacteria 858
678 Ga0307410_10807009 3300031852 Bacteria 798
679 Ga0307410_11805059 3300031852 Bacteria 543
680 Ga0307410_12082808 3300031852 Bacteria 507
681 Ga0326468_10003656 3300031889 Bacteria 1312
682 Ga0307406_10035859 3300031901 Bacteria 3053
683 Ga0307406_10109708 3300031901 Bacteria 1897
684 Ga0307406_10120589 3300031901 Bacteria 1822
685 Ga0307406_10152680 3300031901 Bacteria 1649
686 Ga0307406_10282126 3300031901 Bacteria 1267
687 Ga0307406_10332891 3300031901 Bacteria 1179
688 Ga0307406_10397553 3300031901 Bacteria 1091
689 Ga0307406_10407733 3300031901 Bacteria 1079
690 Ga0307406_10722889 3300031901 Bacteria 833
691 Ga0307406_10732327 3300031901 Bacteria 828
692 Ga0307406_10772625 3300031901 Bacteria 808
693 Ga0307406_11283018 3300031901 Bacteria 638
694 Ga0307407_10050611 3300031903 Bacteria 2377
695 Ga0307407_10057762 3300031903 Bacteria 2252
696 Ga0307407_10160094 3300031903 Bacteria 1472
697 Ga0307407_10164153 3300031903 Bacteria 1456
698 Ga0307407_10173505 3300031903 Bacteria 1422
699 Ga0307407_10188913 3300031903 Bacteria 1371
700 Ga0307407_10217999 3300031903 Bacteria 1288
701 Ga0307407_10275224 3300031903 Bacteria 1163
702 Ga0307407_10341972 3300031903 Bacteria 1057
703 Ga0307407_10447749 3300031903 Bacteria 936
704 Ga0307407_10464182 3300031903 Bacteria 921
705 Ga0307407_10506739 3300031903 Bacteria 886
706 Ga0307407_10553657 3300031903 Bacteria 850
707 Ga0307412_10214107 3300031911 Bacteria 1472
708 Ga0307412_10243070 3300031911 Bacteria 1393
709 Ga0307412_10254872 3300031911 Bacteria 1364
710 Ga0307412_10262841 3300031911 Bacteria 1346
711 Ga0307412_10283139 3300031911 Bacteria 1302
712 Ga0307412_10453393 3300031911 Bacteria 1057
713 Ga0307412_10845564 3300031911 Bacteria 798
714 Ga0307412_10987745 3300031911 Bacteria 743
715 Ga0307412_11446072 3300031911 Bacteria 623
716 Ga0307412_11833857 3300031911 Bacteria 558
717 Ga0307412_11913933 3300031911 Bacteria 547
718 Ga0307409_100016294 3300031995 Bacteria 4912
719 Ga0307409_100177755 3300031995 Bacteria 1880
720 Ga0307409_100326307 3300031995 Bacteria 1438
721 Ga0307409_100332343 3300031995 Bacteria 1426
722 Ga0307409_100363674 3300031995 Bacteria 1369
723 Ga0307409_100670502 3300031995 Bacteria 1033
724 Ga0307409_100911980 3300031995 Bacteria 893
725 Ga0307409_100912902 3300031995 Bacteria 892
726 Ga0307409_101517788 3300031995 Bacteria 697
727 Ga0307409_101707470 3300031995 Bacteria 658
728 Ga0307409_101823167 3300031995 Bacteria 637
729 Ga0307409_102199846 3300031995 Bacteria 581
730 Ga0307409_102204510 3300031995 Bacteria 580
731 Ga0307409_102233918 3300031995 Bacteria 576
732 Ga0307416_100161755 3300032002 Bacteria 2070
733 Ga0307416_100449667 3300032002 Bacteria 1340
734 Ga0307416_100507523 3300032002 Bacteria 1271
735 Ga0307416_100614509 3300032002 Bacteria 1168
736 Ga0307416_101611522 3300032002 Bacteria 754
737 Ga0307416_101746597 3300032002 Bacteria 726
738 Ga0307416_101930726 3300032002 Bacteria 693
739 Ga0307416_101978886 3300032002 Bacteria 685
740 Ga0307416_102362689 3300032002 Bacteria 631
741 Ga0307414_10172061 3300032004 Bacteria 1732
742 Ga0307414_10227577 3300032004 Bacteria 1535
743 Ga0307414_10270764 3300032004 Bacteria 1422
744 Ga0307414_10296609 3300032004 Bacteria 1365
745 Ga0307414_10296641 3300032004 Bacteria 1365
746 Ga0307414_10302509 3300032004 Bacteria 1353
747 Ga0307414_10432597 3300032004 Bacteria 1150
748 Ga0307414_10631763 3300032004 Bacteria 963
749 Ga0307414_10804139 3300032004 Bacteria 857
750 Ga0307414_10985288 3300032004 Bacteria 775
751 Ga0307414_11505262 3300032004 Bacteria 626
752 Ga0307414_11544412 3300032004 Bacteria 618
753 Ga0307411_10173278 3300032005 Bacteria 1629
754 Ga0307411_10219035 3300032005 Bacteria 1475
755 Ga0307411_10240599 3300032005 Bacteria 1416
756 Ga0307411_10242739 3300032005 Bacteria 1411
757 Ga0307411_10282615 3300032005 Bacteria 1321
758 Ga0307411_10297611 3300032005 Bacteria 1292
759 Ga0307411_10325187 3300032005 Bacteria 1243
760 Ga0307411_10518169 3300032005 Bacteria 1011
761 Ga0307411_10586649 3300032005 Bacteria 956
762 Ga0307411_10664660 3300032005 Bacteria 903
763 Ga0307411_10676122 3300032005 Bacteria 896
764 Ga0307411_10827564 3300032005 Bacteria 817
765 Ga0307411_10986595 3300032005 Bacteria 753
766 Ga0307411_11819889 3300032005 Bacteria 565
767 Ga0307415_100033076 3300032126 Bacteria 3353
768 Ga0307415_100252173 3300032126 Bacteria 1434
769 Ga0307415_100287559 3300032126 Bacteria 1355
770 Ga0307415_100709674 3300032126 Bacteria 908
771 Ga0307415_101909892 3300032126 Bacteria 576
772 Ga0307507_10617867 3300033179 Bacteria 556
773 Ga0316212_1008725 3300033547 Bacteria 1456
774 Ga0373959_0120477 3300034820 Bacteria 641
775 Ga0373960_0081620 3300035121 Bacteria 1019
776 Ga0373960_0176132 3300035121 Bacteria 744
777 Ga0373955_0235830 3300035172 Bacteria 1095
778 Ga0373931_0607647 3300035691 Bacteria 715
779 Ga0395905_0004335 3300037471 Bacteria 14779
780 Ga0395905_0215474 3300037471 Bacteria 1798
781 Ga0436360_0827082 3300039438 Bacteria 1812
782 Ga0436362_0885107 3300039453 Bacteria 1685
783 Ga0439439_0074473 3300041406 Bacteria 912
784 Ga0439439_0176265 3300041406 Bacteria 614
785 Ga0439447_050517 3300041407 Bacteria 994
786 Ga0439447_098076 3300041407 Bacteria 673
787 Ga0439447_104153 3300041407 Bacteria 651
788 Ga0439461_0080635 3300041410 Bacteria 768
789 Ga0439465_0089234 3300041413 Bacteria 1053
790 Ga0439465_0208334 3300041413 Bacteria 714
791 Ga0439465_0372319 3300041413 Bacteria 541
792 Ga0451798_0300609 3300041458 Bacteria 649
793 Ga0451807_1611986 3300041486 Bacteria 531
794 Ga0451807_2139995 3300041486 Bacteria 615
795 Ga0451847_0954215 3300041503 Bacteria 537
796 Ga0451849_0997460 3300041505 Bacteria 555
797 Ga0451853_2348868 3300041512 Bacteria 726
798 Ga0439431_0038857 3300041997 Bacteria 1206
799 Ga0439431_0148282 3300041997 Bacteria 666
800 Ga0439433_0025404 3300041999 Bacteria 1338
801 Ga0439433_0129048 3300041999 Bacteria 641
802 Ga0439442_079447 3300042002 Bacteria 701
803 Ga0439442_117565 3300042002 Bacteria 581
804 Ga0439445_0042540 3300042004 Bacteria 1210
805 Ga0439448_0053264 3300042005 Bacteria 1328
806 Ga0439448_0205600 3300042005 Bacteria 691
807 Ga0439449_0250156 3300042007 Bacteria 666
808 Ga0439450_030580 3300042008 Bacteria 1209
809 Ga0439455_0010655 3300042012 Bacteria 2026
810 Ga0439456_128430 3300042013 Bacteria 584
811 Ga0439457_023857 3300042014 Bacteria 1354
812 Ga0439463_113819 3300042016 Bacteria 699
813 Ga0450919_021688 3300042121 Bacteria 726
814 Ga0450888_024445 3300042126 Bacteria 786
815 Ga0450892_031132 3300042130 Bacteria 560
816 Ga0450895_007049 3300042132 Bacteria 927
817 Ga0450898_126898 3300042134 Bacteria 547
818 Ga0450907_069682 3300042146 Bacteria 609
819 Ga0439458_0009994 3300042157 Bacteria 2114
820 Ga0439458_0223147 3300042157 Bacteria 520
821 Ga0450908_069932 3300042184 Bacteria 623
822 Ga0439434_0366723 3300042435 Bacteria 504
823 Ga0439435_0315044 3300042436 Bacteria 538
824 Ga0439459_0114233 3300042438 Bacteria 674
825 Ga0439459_0140276 3300042438 Bacteria 624
826 Ga0439464_0179563 3300042439 Bacteria 670
827 Ga0439460_0122903 3300042461 Bacteria 850
828 Ga0450918_030785 3300042531 Bacteria 948
829 Ga0451577_0245817 3300042876 Bacteria 1619
830 Ga0439440_0162322 3300042993 Bacteria 646
831 Ga0453684_0610709 3300044712 Bacteria 1194
832 Ga0495617_023652 3300046452 Bacteria 2075
833 Ga0495627_047391 3300046453 Bacteria 1303
834 Ga0495592_0338017 3300046454 Bacteria 969
835 Ga0495592_0561832 3300046454 Bacteria 700
836 Ga0495603_0012825 3300046455 Bacteria 5068
837 Ga0495603_0221622 3300046455 Bacteria 1091
838 Ga0495603_0536320 3300046455 Bacteria 670
839 Ga0495590_0028057 3300046457 Bacteria 1974
840 Ga0495590_0036034 3300046457 Bacteria 1726
841 Ga0495590_0060800 3300046457 Bacteria 1323
842 Ga0495591_019147 3300046458 Bacteria 2298
843 Ga0495591_030736 3300046458 Bacteria 1619
844 Ga0495591_034555 3300046458 Bacteria 1486
845 Ga0495629_0000263 3300046459 Bacteria 45659
846 Ga0495629_0288340 3300046459 Bacteria 1125
847 Ga0495629_0625564 3300046459 Bacteria 718
848 Ga0495638_0036148 3300046460 Bacteria 3147
849 Ga0495638_0143296 3300046460 Bacteria 1392
850 Ga0495638_0264427 3300046460 Bacteria 942
851 Ga0495651_0205590 3300046462 Bacteria 1374
852 Ga0495651_0968877 3300046462 Bacteria 517
853 Ga0495653_0192224 3300046463 Bacteria 1391
854 Ga0495653_0220409 3300046463 Bacteria 1275
855 Ga0495653_0496351 3300046463 Bacteria 761
856 Ga0495650_0004350 3300046471 Bacteria 9759
857 Ga0495650_0061568 3300046471 Bacteria 1502
858 Ga0495580_0036349 3300046472 Bacteria 3536
859 Ga0495580_0072797 3300046472 Bacteria 2399
860 Ga0495580_0460160 3300046472 Bacteria 853
861 Ga0495580_0569641 3300046472 Bacteria 750
862 Ga0495580_0954730 3300046472 Bacteria 549
863 Ga0495582_0133140 3300046473 Bacteria 1405
864 Ga0495582_0322670 3300046473 Bacteria 888
865 Ga0495605_0082825 3300046474 Bacteria 1498
866 Ga0495605_0149829 3300046474 Bacteria 1042
867 Ga0495605_0187008 3300046474 Bacteria 908
868 Ga0495605_0218427 3300046474 Bacteria 824
869 Ga0495639_0105210 3300046475 Bacteria 1335
870 Ga0495662_0028384 3300046476 Bacteria 2700
871 Ga0495662_0061616 3300046476 Bacteria 1812
872 Ga0495664_0028943 3300046477 Bacteria 3237
873 Ga0495664_0128024 3300046477 Bacteria 1536
874 Ga0495664_0179338 3300046477 Bacteria 1284
875 Ga0495664_0285338 3300046477 Bacteria 997
876 Ga0495584_0291281 3300046491 Bacteria 829
877 Ga0495585_0027127 3300046492 Bacteria 3270
878 Ga0495594_0051879 3300046499 Bacteria 2257
879 Ga0495596_0047802 3300046500 Bacteria 1678
880 Ga0495596_0074587 3300046500 Bacteria 1317
881 Ga0495596_0182214 3300046500 Bacteria 816
882 Ga0495596_0421129 3300046500 Bacteria 520
883 Ga0495607_0100579 3300046501 Bacteria 1549
884 Ga0495607_0102625 3300046501 Bacteria 1529
885 Ga0495607_0119694 3300046501 Bacteria 1384
886 Ga0495583_0030946 3300046506 Bacteria 2600
887 Ga0495583_0197426 3300046506 Bacteria 818
888 Ga0495583_0323698 3300046506 Bacteria 610
889 Ga0495606_0087627 3300046507 Bacteria 1921
890 Ga0495606_0096472 3300046507 Bacteria 1808
891 Ga0495606_0145798 3300046507 Bacteria 1394
892 Ga0495606_0164978 3300046507 Bacteria 1289
893 Ga0495606_0229280 3300046507 Bacteria 1042
894 Ga0495606_0315715 3300046507 Bacteria 841
895 Ga0495606_0385527 3300046507 Bacteria 734
896 Ga0495608_0168574 3300046511 Bacteria 1389
897 Ga0495608_0398850 3300046511 Bacteria 841
898 Ga0495610_0120335 3300046512 Bacteria 1151
899 Ga0495616_0066018 3300046513 Bacteria 1761
900 Ga0495616_0077831 3300046513 Bacteria 1591
901 Ga0495616_0140212 3300046513 Bacteria 1101
902 Ga0495618_0118889 3300046514 Bacteria 1692
903 Ga0495620_0046725 3300046515 Bacteria 1867
904 Ga0495620_0056267 3300046515 Bacteria 1655
905 Ga0495620_0101675 3300046515 Bacteria 1145
906 Ga0495628_0216553 3300046516 Bacteria 1439
907 Ga0495628_0632330 3300046516 Bacteria 761
908 Ga0495630_0171274 3300046517 Bacteria 1654
909 Ga0495630_0266556 3300046517 Bacteria 1308
910 Ga0495630_0275790 3300046517 Bacteria 1284
911 Ga0495631_0027819 3300046518 Bacteria 2584
912 Ga0495631_0055206 3300046518 Bacteria 1730
913 Ga0495631_0079453 3300046518 Bacteria 1416
914 Ga0495631_0203616 3300046518 Bacteria 846
915 Ga0495632_0057041 3300046519 Bacteria 1907
916 Ga0495632_0157143 3300046519 Bacteria 1049
917 Ga0495632_0361299 3300046519 Bacteria 637
918 Ga0495637_0103780 3300046520 Bacteria 1108
919 Ga0495643_0084364 3300046522 Bacteria 1648
920 Ga0495643_0390634 3300046522 Bacteria 616
921 Ga0495644_0046853 3300046523 Bacteria 1624
922 Ga0495644_0096439 3300046523 Bacteria 1117
923 Ga0495648_0102517 3300046524 Bacteria 1576
924 Ga0495648_0113515 3300046524 Bacteria 1469
925 Ga0495663_0027530 3300046525 Bacteria 1668
926 Ga0495663_0106046 3300046525 Bacteria 930
927 Ga0495666_0111630 3300046526 Bacteria 1283
928 Ga0495642_0000545 3300046528 Bacteria 18971
929 Ga0495642_0076620 3300046528 Bacteria 1404
930 Ga0495652_0013910 3300046529 Bacteria 7234
931 Ga0495652_0206402 3300046529 Bacteria 1487
932 Ga0495652_0600733 3300046529 Bacteria 750
933 Ga0495654_0010396 3300046530 Bacteria 5065
934 Ga0495654_0096790 3300046530 Bacteria 1363
935 Ga0495654_0272030 3300046530 Bacteria 699
936 Ga0495665_0000205 3300046531 Bacteria 30190
937 Ga0495665_0120608 3300046531 Bacteria 1373
938 Ga0495665_0342771 3300046531 Bacteria 761
939 Ga0495640_0444051 3300046533 Bacteria 793
940 Ga0495586_0070011 3300046535 Bacteria 1915
941 Ga0495586_0281372 3300046535 Bacteria 952
942 Ga0495586_0536245 3300046535 Bacteria 675
943 Ga0495587_0006183 3300046536 Bacteria 7814
944 Ga0495587_0508950 3300046536 Bacteria 665
945 Ga0495598_0068166 3300046537 Bacteria 1114
946 Ga0495598_0117404 3300046537 Bacteria 898
947 Ga0495609_0127967 3300046538 Bacteria 1089
948 Ga0495609_0213386 3300046538 Bacteria 803
949 Ga0495621_0116707 3300046539 Bacteria 1028
950 Ga0495597_0052004 3300046542 Bacteria 1804
951 Ga0495597_0083149 3300046542 Bacteria 1367
952 Ga0495597_0096101 3300046542 Bacteria 1253
953 Ga0495645_0000514 3300046543 Bacteria 26695
954 Ga0495645_0006429 3300046543 Bacteria 8153
955 Ga0495645_0068334 3300046543 Bacteria 2565
956 Ga0495645_0213537 3300046543 Bacteria 1301
957 Ga0495645_0586054 3300046543 Bacteria 687
958 Ga0495622_0088243 3300046557 Bacteria 1425
959 Ga0495622_0440620 3300046557 Bacteria 559
960 Ga0495633_0076037 3300046558 Bacteria 1563
961 Ga0495667_0034705 3300046559 Bacteria 3372
962 Ga0495656_0070881 3300046615 Bacteria 1547
963 Ga0495656_0091680 3300046615 Bacteria 1390
964 Ga0495656_0724223 3300046615 Bacteria 536
965 Ga0495668_0058835 3300046616 Bacteria 2120
966 Ga0495668_0088168 3300046616 Bacteria 1701
967 Ga0495668_0096759 3300046616 Bacteria 1615
968 Ga0495668_0339228 3300046616 Bacteria 825
969 Ga0495634_0209492 3300046642 Bacteria 1207
970 Ga0495611_0047987 3300046648 Bacteria 1917
971 Ga0495611_0279908 3300046648 Bacteria 770
972 Ga0495625_0393084 3300046660 Bacteria 868
973 Ga0495625_0461688 3300046660 Bacteria 783
974 Ga0495625_0851205 3300046660 Bacteria 526
975 Ga0495635_0025286 3300046663 Bacteria 4135
976 Ga0495635_0178333 3300046663 Bacteria 1444
977 Ga0495635_0198417 3300046663 Bacteria 1361
978 Ga0495661_0090932 3300046665 Bacteria 1736
979 Ga0495661_0106988 3300046665 Bacteria 1564
980 Ga0495661_0383022 3300046665 Bacteria 686
981 Ga0495588_0105933 3300046674 Bacteria 1479
982 Ga0495588_0251651 3300046674 Bacteria 931
983 Ga0495588_0705053 3300046674 Bacteria 528
984 Ga0495657_0145758 3300046675 Bacteria 1473
985 Ga0495599_0497844 3300046678 Bacteria 717
986 Ga0495599_0639301 3300046678 Bacteria 617
987 Ga0495623_0009456 3300046679 Bacteria 6329
988 Ga0495623_0031770 3300046679 Bacteria 3394
989 Ga0495623_0103985 3300046679 Bacteria 1727
990 Ga0495646_0049912 3300046680 Bacteria 2538
991 Ga0495646_0053550 3300046680 Bacteria 2432
992 Ga0495646_0132744 3300046680 Bacteria 1400
993 Ga0495658_0108468 3300046683 Bacteria 1666
994 Ga0495669_0033933 3300046684 Bacteria 2248
995 Ga0495669_0183232 3300046684 Bacteria 998
996 Ga0495669_0342740 3300046684 Bacteria 722
997 Ga0495613_0205297 3300046689 Bacteria 1387
998 Ga0495613_0445761 3300046689 Bacteria 877
999 Ga0495624_0160099 3300046690 Bacteria 1375
1000 Ga0495624_0350034 3300046690 Bacteria 888
1001 Ga0495670_0093433 3300046691 Bacteria 1541
1002 Ga0495670_0108275 3300046691 Bacteria 1436
1003 Ga0495670_0167384 3300046691 Bacteria 1157
1004 Ga0495671_0077149 3300046692 Bacteria 1633
1005 Ga0495671_0179492 3300046692 Bacteria 1028
1006 Ga0495649_0017123 3300046694 Bacteria 4095
1007 Ga0495649_0091568 3300046694 Bacteria 1620
1008 Ga0495649_0125289 3300046694 Bacteria 1357
1009 Ga0495649_0437015 3300046694 Bacteria 654
1010 Ga0495589_0023413 3300046794 Bacteria 3147
1011 Ga0495589_0065478 3300046794 Bacteria 1781
1012 Ga0495589_0109860 3300046794 Bacteria 1331
1013 Ga0495600_0049909 3300046809 Bacteria 2730
1014 Ga0495660_0146966 3300046810 Bacteria 1167
1015 Ga0495660_0292446 3300046810 Bacteria 741
1016 Ga0495581_0023720 3300047315 Bacteria 3554
1017 Ga0495581_0139362 3300047315 Bacteria 1414
1018 Ga0495581_0244168 3300047315 Bacteria 1050
1019 Ga0495581_0865919 3300047315 Bacteria 517
1020 Ga0495604_0190254 3300047317 Bacteria 1430
1021 Ga0495604_0750047 3300047317 Bacteria 617
1022 Ga0495636_0147336 3300047318 Bacteria 1054
1023 Ga0495636_0235159 3300047318 Bacteria 844
1024 Ga0495636_0270133 3300047318 Bacteria 790
1025 Ga0495674_0034103 3300047319 Bacteria 4605
1026 Ga0495674_0451764 3300047319 Bacteria 1032
1027 Ga0495674_0496515 3300047319 Bacteria 976
1028 Ga0495674_0752002 3300047319 Bacteria 761
1029 Ga0495672_0074202 3300047320 Bacteria 1916
1030 Ga0495672_0145530 3300047320 Bacteria 1233
1031 Ga0495672_0153322 3300047320 Bacteria 1193
1032 Ga0495672_0206298 3300047320 Bacteria 979
1033 Ga0495672_0407090 3300047320 Bacteria 621
1034 Ga0495676_0646415 3300047321 Bacteria 686
1035 Ga0495680_0128592 3300047322 Bacteria 1863
1036 Ga0495680_0267210 3300047322 Bacteria 1208
1037 Ga0495680_0873886 3300047322 Bacteria 582
1038 Ga0495683_0003370 3300047323 Bacteria 9335
1039 Ga0495683_0013555 3300047323 Bacteria 4260
1040 Ga0495683_0063048 3300047323 Bacteria 1832
1041 Ga0495683_0070920 3300047323 Bacteria 1710
1042 Ga0495683_0143651 3300047323 Bacteria 1116
1043 Ga0495683_0265195 3300047323 Bacteria 749
1044 Ga0495687_000170 3300047443 Bacteria 96886
1045 Ga0495687_030716 3300047443 Bacteria 2472
1046 Ga0495675_0059584 3300047444 Bacteria 2420
1047 Ga0495675_0124642 3300047444 Bacteria 1603
1048 Ga0495675_0316623 3300047444 Bacteria 924
1049 Ga0495677_0060175 3300047445 Bacteria 1407
1050 Ga0495677_0121765 3300047445 Bacteria 995
1051 Ga0495679_045178 3300047446 Bacteria 1346
1052 Ga0495679_109404 3300047446 Bacteria 761
1053 Ga0495685_020734 3300047447 Bacteria 2259
1054 Ga0495685_033094 3300047447 Bacteria 1776
1055 Ga0495685_043158 3300047447 Bacteria 1539
1056 Ga0495685_055435 3300047447 Bacteria 1340
1057 Ga0495673_0053034 3300047469 Bacteria 1770
1058 Ga0495673_0116088 3300047469 Bacteria 1064
1059 Ga0495673_0179610 3300047469 Bacteria 802
1060 Ga0495681_0016946 3300047470 Bacteria 4063
1061 Ga0495681_0039069 3300047470 Bacteria 2320
1062 Ga0495681_0071396 3300047470 Bacteria 1572
1063 Ga0495681_0229312 3300047470 Bacteria 742
1064 Ga0495684_0102744 3300047471 Bacteria 2160
1065 Ga0495684_0227413 3300047471 Bacteria 1365
1066 Ga0495686_0430770 3300047472 Bacteria 703
1067 Ga0495593_0015868 3300047673 Bacteria 4256
1068 Ga0495593_0076271 3300047673 Bacteria 1737
1069 Ga0495593_0399219 3300047673 Bacteria 687
1070 Ga0495602_0221394 3300048088 Bacteria 1428
1071 Ga0495602_0261125 3300048088 Bacteria 1284
1072 Ga0495614_0284615 3300048089 Bacteria 761
1073 Ga0495615_0120103 3300048090 Bacteria 759
1074 Ga0495626_0174356 3300048091 Bacteria 895
1075 Ga0495626_0287096 3300048091 Bacteria 652
1076 Ga0496100_0002134 3300048903 Bacteria 9952
1077 Ga0496100_0169411 3300048903 Bacteria 1571
1078 Ga0496100_0310998 3300048903 Bacteria 1181
1079 Ga0496100_0541816 3300048903 Bacteria 900
1080 Ga0496100_0640562 3300048903 Bacteria 827
1081 Ga0496100_0972432 3300048903 Bacteria 668
1082 Ga0496101_0005093 3300048904 Bacteria 8357
1083 Ga0496101_0149019 3300048904 Bacteria 1788
1084 Ga0496101_0538996 3300048904 Bacteria 923
1085 Ga0496101_0910259 3300048904 Bacteria 692
1086 Ga0496102_0127845 3300048905 Bacteria 2376
1087 Ga0496102_0154577 3300048905 Bacteria 2156
1088 Ga0496102_0231774 3300048905 Bacteria 1741
1089 Ga0496102_0333193 3300048905 Bacteria 1429
1090 Ga0496102_1349096 3300048905 Bacteria 632
1091 Ga0496102_1574080 3300048905 Bacteria 576
1092 Ga0496103_0037311 3300048906 Bacteria 2977
1093 Ga0496103_0060967 3300048906 Bacteria 2345
1094 Ga0496103_0172350 3300048906 Bacteria 1389
1095 Ga0496103_0178616 3300048906 Bacteria 1364
1096 Ga0496103_0626407 3300048906 Bacteria 684
1097 Ga0496104_0170608 3300048907 Bacteria 2086
1098 Ga0496104_0206858 3300048907 Bacteria 1874
1099 Ga0496104_0258482 3300048907 Bacteria 1654
1100 Ga0496104_0329188 3300048907 Bacteria 1441
1101 Ga0496104_0346370 3300048907 Bacteria 1398
1102 Ga0496104_1231058 3300048907 Bacteria 652
1103 Ga0496105_0084948 3300048908 Bacteria 2615
1104 Ga0496105_0171028 3300048908 Bacteria 1781
1105 Ga0496105_0263427 3300048908 Bacteria 1393
1106 Ga0496105_0268060 3300048908 Bacteria 1379
1107 Ga0496105_0269192 3300048908 Bacteria 1376
1108 Ga0496105_0277656 3300048908 Bacteria 1352
1109 Ga0496105_0692262 3300048908 Bacteria 783
1110 Ga0496106_0085865 3300048909 Bacteria 2423
1111 Ga0496106_0191748 3300048909 Bacteria 1625
1112 Ga0496106_0380939 3300048909 Bacteria 1133
1113 Ga0496106_0882494 3300048909 Bacteria 707
1114 Ga0496106_1555755 3300048909 Bacteria 507
1115 Ga0496107_0236104 3300048910 Bacteria 1360
1116 Ga0496107_0262240 3300048910 Bacteria 1286
1117 Ga0496107_0303272 3300048910 Bacteria 1189
1118 Ga0496107_0664849 3300048910 Bacteria 767
1119 Ga0496107_0811778 3300048910 Bacteria 685
1120 Ga0496107_0904724 3300048910 Bacteria 643
1121 Ga0496108_0102233 3300048911 Bacteria 2445
1122 Ga0496108_0195500 3300048911 Bacteria 1754
1123 Ga0496108_0216698 3300048911 Bacteria 1662
1124 Ga0496108_0315503 3300048911 Bacteria 1362
1125 Ga0496108_0511718 3300048911 Bacteria 1048
1126 Ga0496108_0902212 3300048911 Bacteria 758
1127 Ga0496108_1124780 3300048911 Bacteria 666
1128 Ga0496109_0103528 3300048912 Bacteria 2642
1129 Ga0496109_0288118 3300048912 Bacteria 1548
1130 Ga0496109_0380318 3300048912 Bacteria 1334
1131 Ga0496109_0419974 3300048912 Bacteria 1263
1132 Ga0496109_0442017 3300048912 Bacteria 1228
1133 Ga0496109_0471412 3300048912 Bacteria 1185
1134 Ga0496109_0755499 3300048912 Bacteria 910
1135 Ga0496109_1548605 3300048912 Bacteria 598
1136 Ga0496110_0251779 3300048913 Bacteria 1607
1137 Ga0496110_0275015 3300048913 Bacteria 1533
1138 Ga0496110_0318118 3300048913 Bacteria 1417
1139 Ga0496110_0947448 3300048913 Bacteria 767
1140 Ga0496110_1159165 3300048913 Bacteria 681
1141 Ga0496110_1532789 3300048913 Bacteria 576
1142 Ga0496111_0209343 3300048914 Bacteria 1448
1143 Ga0496112_0075262 3300048915 Bacteria 3339
1144 Ga0496112_1022967 3300048915 Bacteria 746
1145 Ga0496113_0093666 3300048916 Bacteria 2319
1146 Ga0496113_0110023 3300048916 Bacteria 2143
1147 Ga0496113_0240208 3300048916 Bacteria 1445
1148 Ga0496113_1536318 3300048916 Bacteria 513
1149 Ga0496114_0076167 3300048917 Bacteria 2827
1150 Ga0496114_0125598 3300048917 Bacteria 2211
1151 Ga0496114_0341850 3300048917 Bacteria 1323
1152 Ga0496114_0420956 3300048917 Bacteria 1183
1153 Ga0496114_0689346 3300048917 Bacteria 896
1154 Ga0496114_1109825 3300048917 Bacteria 676
1155 Ga0496114_1337093 3300048917 Bacteria 604
1156 Ga0496115_0167788 3300048918 Bacteria 1815
1157 Ga0496115_1020758 3300048918 Bacteria 631
1158 Ga0496117_0045148 3300048920 Bacteria 3186
1159 Ga0496118_0141973 3300048921 Bacteria 1520
1160 Ga0496119_0110315 3300048922 Bacteria 1528
1161 Ga0496120_0495162 3300048923 Bacteria 526
1162 Ga0496120_0533606 3300048923 Bacteria 500
1163 Ga0496121_0190843 3300048924 Bacteria 1469
1164 Ga0496121_0227811 3300048924 Bacteria 1307
1165 Ga0496124_0491067 3300048927 Bacteria 826
1166 Ga0496125_0088039 3300048928 Bacteria 2342
1167 Ga0496126_0053525 3300048929 Bacteria 3661
1168 Ga0496126_0276733 3300048929 Bacteria 1391
1169 Ga0496126_1165877 3300048929 Bacteria 568
1170 Ga0495678_057059 3300049459 Bacteria 1481
1171 Ga0495678_123896 3300049459 Bacteria 864
1172 Ga0495682_0040152 3300049460 Bacteria 1716
1173 Ga0495682_0045928 3300049460 Bacteria 1595
1174 Ga0495682_0269536 3300049460 Bacteria 601
1175 Ga0501300_002737 3300049523 Bacteria 2634
1176 Ga0501303_066496 3300049526 Bacteria 503
1177 Ga0501198_017318 3300049649 Bacteria 1121
1178 Ga0501199_070109 3300049650 Bacteria 502
1179 Ga0501202_096751 3300049652 Bacteria 713
1180 Ga0501202_206560 3300049652 Bacteria 539
1181 Ga0501206_025272 3300049653 Bacteria 864
1182 Ga0501207_073542 3300049654 Bacteria 646
1183 Ga0501207_132015 3300049654 Bacteria 526
1184 Ga0501208_153166 3300049655 Bacteria 523
1185 Ga0501216_012979 3300049660 Bacteria 1375
1186 Ga0501216_134265 3300049660 Bacteria 576
1187 Ga0501217_173709 3300049661 Bacteria 657
1188 Ga0501223_018734 3300049663 Bacteria 1361
1189 Ga0501224_087071 3300049664 Bacteria 502
1190 Ga0501228_018991 3300049666 Bacteria 762
1191 Ga0501239_003927 3300049672 Bacteria 1437
1192 Ga0501240_006305 3300049673 Bacteria 1455
1193 Ga0501240_103683 3300049673 Bacteria 549
1194 Ga0501242_056705 3300049674 Bacteria 587
1195 Ga0501243_041358 3300049675 Bacteria 811
1196 Ga0501247_022906 3300049677 Bacteria 820
1197 Ga0501248_019538 3300049678 Bacteria 689
1198 Ga0501249_174833 3300049679 Bacteria 552
1199 Ga0501250_036976 3300049680 Bacteria 701
1200 Ga0501251_078707 3300049681 Bacteria 575
1201 Ga0501251_115961 3300049681 Bacteria 503
1202 Ga0501252_034884 3300049682 Bacteria 710
1203 Ga0501253_010244 3300049683 Bacteria 1405
1204 Ga0501255_086591 3300049684 Bacteria 532
1205 Ga0501256_005780 3300049685 Bacteria 1098
1206 Ga0501259_010900 3300049688 Bacteria 1494
1207 Ga0501261_044537 3300049690 Bacteria 709
1208 Ga0501221_058714 3300049704 Bacteria 885
1209 Ga0501225_0073065 3300049705 Bacteria 977
1210 Ga0501225_0263656 3300049705 Bacteria 571
1211 Ga0501241_163082 3300049758 Bacteria 520
1212 Ga0501263_030106 3300049760 Bacteria 764
1213 Ga0501270_006913 3300049767 Bacteria 1383
1214 Ga0501270_134809 3300049767 Bacteria 550
1215 Ga0501272_071852 3300049769 Bacteria 507
1216 Ga0501273_022040 3300049770 Bacteria 868
1217 Ga0501273_060907 3300049770 Bacteria 595
1218 Ga0501275_005373 3300049772 Bacteria 1228
1219 Ga0501279_009351 3300049775 Bacteria 1312
1220 Ga0501279_015333 3300049775 Bacteria 1061
1221 Ga0501283_130070 3300049779 Bacteria 510
1222 Ga0501045_1100666 3300049824 Bacteria 581
1223 Ga0501212_040222 3300049851 Bacteria 771
1224 nmdc:mga07m45_165119_c1 3300050496 Bacteria 1286
1225 nmdc:mga09592_399642_c1 3300050508 Bacteria 1188
1226 nmdc:mga09592_769299_c1 3300050508 Bacteria 816
1227 nmdc:mga0qj67_242353_c1 3300050509 Bacteria 1463
1228 nmdc:mga0qj67_244501_c1 3300050509 Bacteria 1456
1229 nmdc:mga0qj67_296309_c1 3300050509 Bacteria 1311
1230 nmdc:mga0qj67_757627_c1 3300050509 Bacteria 770
1231 nmdc:mga06r32_1032900_c1 3300050510 Bacteria 773
1232 nmdc:mga06r32_1063149_c1 3300050510 Bacteria 760
1233 nmdc:mga06r32_575181_c1 3300050510 Bacteria 1099
1234 nmdc:mga08y16_462029_c1 3300050511 Bacteria 1294
1235 nmdc:mga08y16_825027_c1 3300050511 Bacteria 918
1236 nmdc:mga0rr50_1243187_c1 3300050513 Bacteria 632
1237 Ga0495655_0050320 3300053083 Bacteria 1100
1238 Ga0495655_0246426 3300053083 Bacteria 599
1239 Ga0500608_020766 3300053122 Bacteria 3024
1240 2512347125 2512047030 Bacteria 9031815
1241 2512349955 2512047030 Bacteria 9031815
1242 2514055052 2513237166 Bacteria 10373764
1243 2516024662 2515154189 Bacteria 9629850
1244 2753571618 2751185846 Bacteria 7242164
1245 2753767667 2751185897 Bacteria 5322941
1246 2792838879 2791355137 Bacteria 9654227
1247 2842341345 2842333319 Bacteria 8899485
1248 2842341370 2842333319 Bacteria 8899485
1249 2842341741 2842333319 Bacteria 8899485
1250 2842341776 2842333319 Bacteria 8899485
1251 2869258128 2869256925 Bacteria 6981691
1252 2900643250 2900634093 Bacteria 10263517
1253 2900643356 2900634093 Bacteria 10263517
1254 2902689976 2902682994 Bacteria 8951596
1255 2904616873 2904615490 Bacteria 10047340
1256 2946791336 2946787523 Bacteria 4366789
1257 3004174583 3004167301 Bacteria 8330599
1258 3004174824 3004167301 Bacteria 8330599
1259 3004342122 3004334049 Bacteria 8449246
1260 8004320295 8004312739 Bacteria 7444653
1261 8016605234 8016603502 Bacteria 8731218
1262 8016605290 8016603502 Bacteria 8731218
1263 8016605323 8016603502 Bacteria 8731218
1264 8016613097 8016603502 Bacteria 8731218
1265 8016613116 8016603502 Bacteria 8731218
1266 Ga0105244_10446216
1267 JGI24740J21852_10075385
1268 JGI24739J22299_10048622
1269 JGI24737J22298_10043895
1270 JGI24743J22301_10016746
1271 JGI24735J21928_10038814
1272 JGI24750J21931_1033108
1273 JGI24745J21846_1008427
1274 JGI24748J21848_1022131
1275 JGI24738J21930_10031770
1276 JGI24738J21930_10098169
1277 JGI24749J21850_1013788
1278 JGI24744J21845_10065150
1279 JGI24744J21845_10084576
1280 JGI24742J22300_10011327
1281 JGI24751J29686_10020433
1282 rootL2_10147005
1283 Ga0007410J51695_1069272
1284 Ga0007416J51690_1066597
1285 Ga0070658_10322838
1286 Ga0070658_10376036
1287 Ga0070658_10700254
1288 Ga0070676_10206008
1289 Ga0070676_10398524
1290 Ga0070683_100673647
1291 Ga0070683_100860183
1292 Ga0070683_101342447
1293 Ga0070690_100076274
1294 Ga0070690_100176442
1295 Ga0070690_100863778
1296 Ga0070670_100289512
1297 Ga0070670_100931284
1298 Ga0070670_101040227
1299 Ga0070677_10451856
1300 Ga0068869_100614772
1301 Ga0068869_101891599
1302 Ga0070666_10127659
1303 Ga0070666_10155880
1304 Ga0070666_10196442
1305 Ga0070666_10707744
1306 Ga0070680_100291100
1307 Ga0070682_100047626
1308 Ga0070682_100127703
1309 Ga0070682_100232196
1310 Ga0070682_100348634
1311 Ga0068868_100035886
1312 Ga0068868_100310703
1313 Ga0068868_100813167
1314 Ga0068868_101006867
1315 Ga0068868_101411374
1316 Ga0068868_101996699
1317 Ga0070660_100133744
1318 Ga0070660_100217276
1319 Ga0070660_100586085
1320 Ga0070660_100631401
1321 Ga0070689_100229827
1322 Ga0070689_100238210
1323 Ga0070691_10075394
1324 Ga0070691_10155101
1325 Ga0070691_10311065
1326 Ga0070687_100081095
1327 Ga0070687_100121237
1328 Ga0070661_100237655
1329 Ga0070661_100342304
1330 Ga0070692_10090870
1331 Ga0070692_10101068
1332 Ga0070668_100261538
1333 Ga0070669_100079724
1334 Ga0070669_100132930
1335 Ga0070669_100266586
1336 Ga0070669_100577689
1337 Ga0070675_100148798
1338 Ga0070675_100206088
1339 Ga0070675_100945754
1340 Ga0070675_102052671
1341 Ga0070671_100080209
1342 Ga0070671_100556377
1343 Ga0070671_101423457
1344 Ga0070674_100138267
1345 Ga0070674_100141575
1346 Ga0070674_100882812
1347 Ga0070673_100206576
1348 Ga0070673_100263621
1349 Ga0070673_100306049
1350 Ga0070673_100592016
1351 Ga0070673_102219006
1352 Ga0070688_100180293
1353 Ga0070688_100188306
1354 Ga0070688_101533574
1355 Ga0070659_100230238
1356 Ga0070659_100399967
1357 Ga0070659_101238727
1358 Ga0070667_100234051
1359 Ga0070667_100254748
1360 Ga0070667_100417609
1361 Ga0070667_101152939
1362 Ga0070667_101420702
1363 Ga0070703_10114692
1364 Ga0070703_10165847
1365 Ga0070709_10191833
1366 Ga0070709_10258746
1367 Ga0070714_100204469
1368 Ga0070714_100212290
1369 Ga0070714_101925590
1370 Ga0070713_100223595
1371 Ga0070713_100628513
1372 Ga0070713_101401031
1373 Ga0070710_11338472
1374 Ga0070701_10107413
1375 Ga0070701_10108264
1376 Ga0070711_100415920
1377 Ga0070705_100161616
1378 Ga0070705_100398297
1379 Ga0070705_100428057
1380 Ga0070700_100093770
1381 Ga0070700_100184474
1382 Ga0070700_101019078
1383 Ga0070694_100058448
1384 Ga0070694_100116185
1385 Ga0070694_100472260
1386 Ga0070694_100975822
1387 Ga0070694_101465665
1388 Ga0070708_100073139
1389 Ga0070708_101256225
1390 Ga0070663_100056086
1391 Ga0070663_100179196
1392 Ga0070663_100215612
1393 Ga0070663_100218255
1394 Ga0070663_100235485
1395 Ga0070663_100354031
1396 Ga0070663_100485483
1397 Ga0070678_100168375
1398 Ga0070678_100179777
1399 Ga0070678_100231064
1400 Ga0070678_100526465
1401 Ga0070678_100779996
1402 Ga0070678_101897394
1403 Ga0070678_102400382
1404 Ga0070662_100219086
1405 Ga0070662_100275160
1406 Ga0070662_100550755
1407 Ga0070662_100918136
1408 Ga0070681_11440439
1409 Ga0068867_100210797
1410 Ga0068867_100253286
1411 Ga0068867_102339022
1412 Ga0070685_10140688
1413 Ga0070685_10481633
1414 Ga0070685_10706526
1415 Ga0070685_10824106
1416 Ga0070706_100122781
1417 Ga0070706_100449020
1418 Ga0070707_100000007
1419 Ga0070707_101609441
1420 Ga0070698_100049864
1421 Ga0070698_100157038
1422 Ga0070699_100018019
1423 Ga0070699_100084597
1424 Ga0070699_100140825
1425 Ga0070679_101221960
1426 Ga0070679_101523359
1427 Ga0070679_101869413
1428 Ga0070684_100270005
1429 Ga0070684_100282209
1430 Ga0070684_100410004
1431 Ga0070697_100029875
1432 Ga0070697_100033549
1433 Ga0068853_100207357
1434 Ga0068853_100309860
1435 Ga0068853_100674801
1436 Ga0070672_100270996
1437 Ga0070672_100355467
1438 Ga0070672_100448078
1439 Ga0070672_100775940
1440 Ga0070672_101614744
1441 Ga0070686_100013115
1442 Ga0070686_100113836
1443 Ga0070686_100133681
1444 Ga0070686_100514309
1445 Ga0070695_100214298
1446 Ga0070695_101631310
1447 Ga0070696_100394813
1448 Ga0070693_100106003
1449 Ga0070693_100112817
1450 Ga0070665_100121418
1451 Ga0070665_100240142
1452 Ga0070665_100291744
1453 Ga0070665_101576236
1454 Ga0070704_100226942
1455 Ga0068855_100288933
1456 Ga0068855_102080435
1457 Ga0070664_100276476
1458 Ga0070664_100329572
1459 Ga0070664_101380973
1460 Ga0068857_100262766
1461 Ga0068857_100827487
1462 Ga0068854_100143804
1463 Ga0068854_100445414
1464 Ga0068854_100513900
1465 Ga0068854_101020220
1466 Ga0068856_100217350
1467 Ga0068856_100392445
1468 Ga0068856_100693589
1469 Ga0068856_101234487
1470 Ga0070702_100140492
1471 Ga0070702_100447213
1472 Ga0070702_100467592
1473 Ga0070702_100619891
1474 Ga0068852_100182823
1475 Ga0068852_100269607
1476 Ga0068852_100523443
1477 Ga0068852_100752883
1478 Ga0068852_101527723
1479 Ga0068859_100326179
1480 Ga0068859_101955481
1481 Ga0068859_102876218
1482 Ga0068864_100255090
1483 Ga0068864_100289621
1484 Ga0068864_100298123
1485 Ga0068864_101500946
1486 Ga0068866_10059176
1487 Ga0068866_10082102
1488 Ga0068866_10129037
1489 Ga0068866_10316049
1490 Ga0068866_10537144
1491 Ga0068861_100163416
1492 Ga0068861_100164862
1493 Ga0068861_102453206
1494 Ga0068851_10105009
1495 Ga0068851_10115648
1496 Ga0068851_10128625
1497 Ga0068870_10058705
1498 Ga0068870_10126529
1499 Ga0068870_10127391
1500 Ga0068870_10709567
1501 Ga0068863_100363307
1502 Ga0068863_100382163
1503 Ga0068863_101716408
1504 Ga0068863_102507481
1505 Ga0068858_100327399
1506 Ga0068858_100386408
1507 Ga0068858_101115700
1508 Ga0068860_100270067
1509 Ga0068860_100314356
1510 Ga0068860_100448608
1511 Ga0068862_100226532
1512 Ga0068862_100262876
1513 Ga0070717_10079647
1514 Ga0070717_10169654
1515 Ga0070717_10703016
1516 Ga0075363_100947220
1517 Ga0075432_10103406
1518 Ga0075432_10573666
1519 Ga0070716_100008163
1520 Ga0070716_100357374
1521 Ga0070716_100664260
1522 Ga0070712_100391001
1523 Ga0075366_10248641
1524 Ga0097621_100246623
1525 Ga0097621_100444594
1526 Ga0097621_100973855
1527 Ga0068871_100036623
1528 Ga0068871_100222844
1529 Ga0068871_100363941
1530 Ga0068871_100705600
1531 Ga0075428_101760753
1532 Ga0075430_100117831
1533 Ga0075430_101263358
1534 Ga0075431_100617805
1535 Ga0075431_100773162
1536 Ga0075431_101328650
1537 Ga0075429_100312589
1538 Ga0075429_100446361
1539 Ga0068865_100205805
1540 Ga0068865_100220245
1541 Ga0068865_100227814
1542 Ga0068865_100457341
1543 Ga0068865_100716349
1544 Ga0097620_100326231
1545 Ga0097620_101955544
1546 Ga0097620_102876253
1547 Ga0075435_100576717
1548 Ga0105251_10306132
1549 Ga0105244_10067108
1550 Ga0105244_10321305
1551 Ga0105250_10114752
1552 Ga0105240_10258777
1553 Ga0105240_10448802
1554 Ga0105240_11048037
1555 Ga0111539_10538945
1556 Ga0111539_12600487
1557 Ga0105245_10254336
1558 Ga0105245_10648974
1559 Ga0105245_10968147
1560 Ga0105245_11733074
1561 Ga0105245_12434956
1562 Ga0105247_10102325
1563 Ga0105247_10174051
1564 Ga0105247_10250874
1565 Ga0105247_10440054
1566 Ga0105243_10123671
1567 Ga0105243_10161637
1568 Ga0105243_10245964
1569 Ga0105243_10391531
1570 Ga0105243_10541887
1571 Ga0105243_12007017
1572 Ga0105241_10718732
1573 Ga0105242_10135978
1574 Ga0105242_10206094
1575 Ga0105242_10312017
1576 Ga0105242_10770952
1577 Ga0105242_13111309
1578 Ga0105248_10361670
1579 Ga0105248_10364424
1580 Ga0105248_10623182
1581 Ga0105237_10187553
1582 Ga0105237_10247040
1583 Ga0105237_10288859
1584 Ga0105237_10560816
1585 Ga0105237_10664183
1586 Ga0105237_11059527
1587 Ga0105237_11304788
1588 Ga0105237_11620349
1589 Ga0105238_10212369
1590 Ga0105238_10251586
1591 Ga0105238_10271229
1592 Ga0105238_10492074
1593 Ga0105249_10218416
1594 Ga0105249_10336293
1595 Ga0105249_11052789
1596 Ga0105249_11871349
1597 Ga0105239_10285132
1598 Ga0105239_10371991
1599 Ga0105239_10387503
1600 Ga0105239_12133050
1601 Ga0105246_10083590
1602 Ga0105246_10113072
1603 Ga0105246_10304329
1604 Ga0105246_11295462
1605 Ga0105246_11696477
1606 Ga0157341_1013489
1607 Ga0157373_10827986
1608 Ga0157371_10059895
1609 Ga0157371_10132399
1610 Ga0157371_10902836
1611 Ga0157370_10254568
1612 Ga0157370_11769847
1613 Ga0157369_10042214
1614 Ga0157369_10272875
1615 Ga0157369_11594000
1616 Ga0157374_10087909
1617 Ga0157374_10200266
1618 Ga0157374_10296674
1619 Ga0157374_10297273
1620 Ga0157374_10955074
1621 Ga0157374_12726747
1622 Ga0157378_10871081
1623 Ga0157378_11195784
1624 Ga0157378_13097797
1625 Ga0163162_10248003
1626 Ga0163162_10823584
1627 Ga0163162_10837849
1628 Ga0163162_10861900
1629 Ga0163162_10933409
1630 Ga0163162_11325364
1631 Ga0163162_11582625
1632 Ga0163162_12917569
1633 Ga0157372_10409779
1634 Ga0157372_11559451
1635 Ga0157372_12616374
1636 Ga0157375_10155470
1637 Ga0157375_10270996
1638 Ga0157375_10290764
1639 Ga0157375_10317125
1640 Ga0157375_10803846
1641 Ga0157375_11010822
1642 Ga0157375_11605608
1643 Ga0157375_12973672
1644 Ga0163163_10289466
1645 Ga0163163_10353639
1646 Ga0163163_10358006
1647 Ga0157380_10188246
1648 Ga0157380_10217327
1649 Ga0157380_12532236
1650 Ga0182008_10109608
1651 Ga0182008_10182788
1652 Ga0182008_10449875
1653 Ga0182008_10467990
1654 Ga0182008_10481325
1655 Ga0182008_10542372
1656 Ga0182008_10779233
1657 Ga0157377_10065212
1658 Ga0157377_10116083
1659 Ga0157379_10214339
1660 Ga0157379_10537179
1661 Ga0157379_10772597
1662 Ga0157379_11696340
1663 Ga0157376_10339974
1664 Ga0157376_10485766
1665 Ga0157376_10989796
1666 Ga0157376_11306218
1667 Ga0182006_1015493
1668 Ga0182007_10026946
1669 Ga0182007_10058360
1670 Ga0182007_10068174
1671 Ga0182005_1020653
1672 Ga0182005_1098920
1673 Ga0163161_10139333
1674 Ga0163161_10559063
1675 Ga0163161_10952873
1676 Ga0163161_11244958
1677 Ga0163161_11781990
1678 Ga0213871_10228380
1679 Ga0224572_1038675
1680 Ga0228598_1037682
1681 Ga0207656_10081982
1682 Ga0207656_10091229
1683 Ga0207656_10225329
1684 Ga0207653_10101679
1685 Ga0207682_10017510
1686 Ga0207682_10387834
1687 Ga0207692_10356251
1688 Ga0207642_10054106
1689 Ga0207642_10173014
1690 Ga0207642_10307922
1691 Ga0207642_10702610
1692 Ga0207710_10064417
1693 Ga0207710_10082212
1694 Ga0207710_10432951
1695 Ga0207688_10046979
1696 Ga0207688_10196745
1697 Ga0207688_10976130
1698 Ga0207688_11058623
1699 Ga0207680_10111807
1700 Ga0207680_10355676
1701 Ga0207680_10397833
1702 Ga0207680_10454225
1703 Ga0207680_10469876
1704 Ga0207647_10107570
1705 Ga0207647_10168644
1706 Ga0207647_10241107
1707 Ga0207699_10146902
1708 Ga0207699_10157876
1709 Ga0207699_11223633
1710 Ga0207699_11337724
1711 Ga0207645_10114813
1712 Ga0207645_10355727
1713 Ga0207643_10042725
1714 Ga0207643_10049055
1715 Ga0207643_10390288
1716 Ga0207705_11009052
1717 Ga0207684_10110516
1718 Ga0207684_11095854
1719 Ga0207654_10297845
1720 Ga0207654_11020141
1721 Ga0207654_11353230
1722 Ga0207695_10162110
1723 Ga0207695_10339216
1724 Ga0207695_10750367
1725 Ga0207671_10232424
1726 Ga0207671_10244928
1727 Ga0207671_11080835
1728 Ga0207693_10455965
1729 Ga0207693_10589718
1730 Ga0207663_10101214
1731 Ga0207660_10371392
1732 Ga0207662_10100932
1733 Ga0207657_10178365
1734 Ga0207657_10509141
1735 Ga0207657_10532591
1736 Ga0207649_10200251
1737 Ga0207649_11553419
1738 Ga0207652_11074155
1739 Ga0207646_10000010
1740 Ga0207646_10111221
1741 Ga0207681_10217254
1742 Ga0207681_10254438
1743 Ga0207681_11075510
1744 Ga0207694_10243254
1745 Ga0207694_10277948
1746 Ga0207694_10878373
1747 Ga0207650_10213267
1748 Ga0207650_10240700
1749 Ga0207650_10379787
1750 Ga0207650_10945502
1751 Ga0207659_10123813
1752 Ga0207659_10272209
1753 Ga0207659_10455781
1754 Ga0207659_10853706
1755 Ga0207659_11612928
1756 Ga0207687_10213942
1757 Ga0207687_10234457
1758 Ga0207687_10237886
1759 Ga0207700_10295475
1760 Ga0207700_10955295
1761 Ga0207664_10298280
1762 Ga0207664_11422812
1763 Ga0207644_10531145
1764 Ga0207644_11061382
1765 Ga0207644_11831820
1766 Ga0207690_10060871
1767 Ga0207690_10152133
1768 Ga0207690_10380600
1769 Ga0207690_10902205
1770 Ga0207706_10053328
1771 Ga0207706_10098511
1772 Ga0207706_10127007
1773 Ga0207686_10133748
1774 Ga0207686_10525984
1775 Ga0207686_11397339
1776 Ga0207709_10155549
1777 Ga0207709_10172260
1778 Ga0207709_10302636
1779 Ga0207709_11223009
1780 Ga0207670_10219292
1781 Ga0207670_10220529
1782 Ga0207669_10147814
1783 Ga0207669_10177678
1784 Ga0207669_10181141
1785 Ga0207669_10224014
1786 Ga0207669_10455505
1787 Ga0207704_10181517
1788 Ga0207704_10200535
1789 Ga0207704_10203473
1790 Ga0207665_10891101
1791 Ga0207691_10226247
1792 Ga0207691_10420151
1793 Ga0207691_10473945
1794 Ga0207691_10933339
1795 Ga0207691_11001011
1796 Ga0207711_10139662
1797 Ga0207711_10203365
1798 Ga0207711_11720593
1799 Ga0207689_10188350
1800 Ga0207689_10535867
1801 Ga0207661_10202280
1802 Ga0207661_10207634
1803 Ga0207661_10306152
1804 Ga0207679_10135595
1805 Ga0207679_10587599
1806 Ga0207679_10657283
1807 Ga0207679_11568214
1808 Ga0207667_10331701
1809 Ga0207651_10204576
1810 Ga0207651_10229638
1811 Ga0207651_10885256
1812 Ga0207651_11055095
1813 Ga0207651_11425939
1814 Ga0207712_10225239
1815 Ga0207712_10261959
1816 Ga0207712_11187219
1817 Ga0207668_10267678
1818 Ga0207668_10756586
1819 Ga0207640_10199591
1820 Ga0207640_10244083
1821 Ga0207640_11271419
1822 Ga0207658_10062311
1823 Ga0207658_10387065
1824 Ga0207658_11154024
1825 Ga0207658_12088053
1826 Ga0207677_10226749
1827 Ga0207677_10256445
1828 Ga0207677_10495512
1829 Ga0207677_10520976
1830 Ga0207677_11286202
1831 Ga0207677_12140303
1832 Ga0207703_10292311
1833 Ga0207703_10782549
1834 Ga0207703_11186872
1835 Ga0207703_12106901
1836 Ga0207639_10271863
1837 Ga0207639_10309285
1838 Ga0207639_10344918
1839 Ga0207639_10594077
1840 Ga0207678_10043671
1841 Ga0207678_10142125
1842 Ga0207678_10176721
1843 Ga0207678_10179906
1844 Ga0207678_10275835
1845 Ga0207678_10478187
1846 Ga0207678_10538138
1847 Ga0207678_11732579
1848 Ga0207708_10199132
1849 Ga0207708_10219507
1850 Ga0207708_10919934
1851 Ga0207702_10277123
1852 Ga0207702_10351197
1853 Ga0207702_10409422
1854 Ga0207702_10634515
1855 Ga0207702_12274285
1856 Ga0207648_10145252
1857 Ga0207648_10170798
1858 Ga0207648_10284301
1859 Ga0207648_10576419
1860 Ga0207648_10677502
1861 Ga0207648_12270945
1862 Ga0207676_10254430
1863 Ga0207676_10594191
1864 Ga0207674_10185122
1865 Ga0207674_11153920
1866 Ga0207674_11987182
1867 Ga0207675_100184625
1868 Ga0207675_100295979
1869 Ga0207675_100297233
1870 Ga0207683_10053467
1871 Ga0207683_10187484
1872 Ga0207683_10203801
1873 Ga0207683_10249223
1874 Ga0207683_10269107
1875 Ga0207683_10678683
1876 Ga0207698_10151177
1877 Ga0207698_10281204
1878 Ga0207698_11119658
1879 Ga0207698_11732531
1880 Ga0209973_1055450
1881 Ga0209970_1015752
1882 Ga0210002_1028915
1883 Ga0209971_1054772
1884 Ga0209966_1034857
1885 Ga0209998_10029308
1886 Ga0268266_10141488
1887 Ga0268266_10311744
1888 Ga0268265_10268875
1889 Ga0268265_10950603
1890 Ga0268264_10352046
1891 Ga0265336_10039272
1892 Ga0265338_10123350
1893 Ga0265773_1006783
1894 Ga0265332_10195331
1895 Ga0265328_10043793
1896 Ga0265328_10155588
1897 Ga0265329_10046286
1898 Ga0265329_10177809
1899 Ga0265331_10068852
1900 Ga0265327_10011656
1901 Ga0265327_10085889
1902 Ga0265327_10090393
1903 Ga0265327_10092989
1904 Ga0265316_10581045
1905 Ga0307509_10203355
1906 Ga0307408_100242339
1907 Ga0307408_100256302
1908 Ga0307408_100320976
1909 Ga0307408_100458320
1910 Ga0307408_100898549
1911 Ga0307408_101881296
1912 Ga0307408_101902116
1913 Ga0307408_102036602
1914 Ga0265314_10155969
1915 Ga0265342_10155701
1916 Ga0307516_10201716
1917 Ga0307405_10056128
1918 Ga0307405_10106019
1919 Ga0307405_10135819
1920 Ga0307405_10139368
1921 Ga0307405_10519874
1922 Ga0307405_10605880
1923 Ga0307405_10923846
1924 Ga0307405_11935707
1925 Ga0307405_11959334
1926 Ga0307413_10034385
1927 Ga0307413_10162488
1928 Ga0307413_10170641
1929 Ga0307413_10176981
1930 Ga0307413_10482180
1931 Ga0307413_10843731
1932 Ga0307413_11769685
1933 Ga0307410_10164312
1934 Ga0307410_10170043
1935 Ga0307410_10186729
1936 Ga0307410_10244362
1937 Ga0307410_10276123
1938 Ga0307410_10284624
1939 Ga0307410_10285707
1940 Ga0307410_10357583
1941 Ga0307410_10559862
1942 Ga0307410_10692253
1943 Ga0307410_10807009
1944 Ga0307410_11805059
1945 Ga0307410_12082808
1946 Ga0326468_10003656
1947 Ga0307406_10035859
1948 Ga0307406_10109708
1949 Ga0307406_10120589
1950 Ga0307406_10152680
1951 Ga0307406_10282126
1952 Ga0307406_10332891
1953 Ga0307406_10397553
1954 Ga0307406_10407733
1955 Ga0307406_10722889
1956 Ga0307406_10732327
1957 Ga0307406_10772625
1958 Ga0307406_11283018
1959 Ga0307407_10050611
1960 Ga0307407_10057762
1961 Ga0307407_10160094
1962 Ga0307407_10164153
1963 Ga0307407_10173505
1964 Ga0307407_10188913
1965 Ga0307407_10217999
1966 Ga0307407_10275224
1967 Ga0307407_10341972
1968 Ga0307407_10447749
1969 Ga0307407_10464182
1970 Ga0307407_10506739
1971 Ga0307407_10553657
1972 Ga0307412_10214107
1973 Ga0307412_10243070
1974 Ga0307412_10254872
1975 Ga0307412_10262841
1976 Ga0307412_10283139
1977 Ga0307412_10453393
1978 Ga0307412_10845564
1979 Ga0307412_10987745
1980 Ga0307412_11446072
1981 Ga0307412_11833857
1982 Ga0307412_11913933
1983 Ga0307409_100016294
1984 Ga0307409_100177755
1985 Ga0307409_100326307
1986 Ga0307409_100332343
1987 Ga0307409_100363674
1988 Ga0307409_100670502
1989 Ga0307409_100911980
1990 Ga0307409_100912902
1991 Ga0307409_101517788
1992 Ga0307409_101707470
1993 Ga0307409_101823167
1994 Ga0307409_102199846
1995 Ga0307409_102204510
1996 Ga0307409_102233918
1997 Ga0307416_100161755
1998 Ga0307416_100449667
1999 Ga0307416_100507523
2000 Ga0307416_100614509
2001 Ga0307416_101611522
2002 Ga0307416_101746597
2003 Ga0307416_101930726
2004 Ga0307416_101978886
2005 Ga0307416_102362689
2006 Ga0307414_10172061
2007 Ga0307414_10227577
2008 Ga0307414_10270764
2009 Ga0307414_10296609
2010 Ga0307414_10296641
2011 Ga0307414_10302509
2012 Ga0307414_10432597
2013 Ga0307414_10631763
2014 Ga0307414_10804139
2015 Ga0307414_10985288
2016 Ga0307414_11505262
2017 Ga0307414_11544412
2018 Ga0307411_10173278
2019 Ga0307411_10219035
2020 Ga0307411_10240599
2021 Ga0307411_10242739
2022 Ga0307411_10282615
2023 Ga0307411_10297611
2024 Ga0307411_10325187
2025 Ga0307411_10518169
2026 Ga0307411_10586649
2027 Ga0307411_10664660
2028 Ga0307411_10676122
2029 Ga0307411_10827564
2030 Ga0307411_10986595
2031 Ga0307411_11819889
2032 Ga0307415_100033076
2033 Ga0307415_100252173
2034 Ga0307415_100287559
2035 Ga0307415_100709674
2036 Ga0307415_101909892
2037 Ga0307507_10617867
2038 Ga0316212_1008725
2039 Ga0373959_0120477
2040 Ga0373960_0081620
2041 Ga0373960_0176132
2042 Ga0373955_0235830
2043 Ga0373931_0607647
2044 Ga0395905_0004335
2045 Ga0395905_0215474
2046 Ga0436360_0827082
2047 Ga0436362_0885107
2048 Ga0439439_0074473
2049 Ga0439439_0176265
2050 Ga0439447_050517
2051 Ga0439447_098076
2052 Ga0439447_104153
2053 Ga0439461_0080635
2054 Ga0439465_0089234
2055 Ga0439465_0208334
2056 Ga0439465_0372319
2057 Ga0451798_0300609
2058 Ga0451807_1611986
2059 Ga0451807_2139995
2060 Ga0451847_0954215
2061 Ga0451849_0997460
2062 Ga0451853_2348868
2063 Ga0439431_0038857
2064 Ga0439431_0148282
2065 Ga0439433_0025404
2066 Ga0439433_0129048
2067 Ga0439442_079447
2068 Ga0439442_117565
2069 Ga0439445_0042540
2070 Ga0439448_0053264
2071 Ga0439448_0205600
2072 Ga0439449_0250156
2073 Ga0439450_030580
2074 Ga0439455_0010655
2075 Ga0439456_128430
2076 Ga0439457_023857
2077 Ga0439463_113819
2078 Ga0450919_021688
2079 Ga0450888_024445
2080 Ga0450892_031132
2081 Ga0450895_007049
2082 Ga0450898_126898
2083 Ga0450907_069682
2084 Ga0439458_0009994
2085 Ga0439458_0223147
2086 Ga0450908_069932
2087 Ga0439434_0366723
2088 Ga0439435_0315044
2089 Ga0439459_0114233
2090 Ga0439459_0140276
2091 Ga0439464_0179563
2092 Ga0439460_0122903
2093 Ga0450918_030785
2094 Ga0451577_0245817
2095 Ga0439440_0162322
2096 Ga0453684_0610709
2097 Ga0495617_023652
2098 Ga0495627_047391
2099 Ga0495592_0338017
2100 Ga0495592_0561832
2101 Ga0495603_0012825
2102 Ga0495603_0221622
2103 Ga0495603_0536320
2104 Ga0495590_0028057
2105 Ga0495590_0036034
2106 Ga0495590_0060800
2107 Ga0495591_019147
2108 Ga0495591_030736
2109 Ga0495591_034555
2110 Ga0495629_0000263
2111 Ga0495629_0288340
2112 Ga0495629_0625564
2113 Ga0495638_0036148
2114 Ga0495638_0143296
2115 Ga0495638_0264427
2116 Ga0495651_0205590
2117 Ga0495651_0968877
2118 Ga0495653_0192224
2119 Ga0495653_0220409
2120 Ga0495653_0496351
2121 Ga0495650_0004350
2122 Ga0495650_0061568
2123 Ga0495580_0036349
2124 Ga0495580_0072797
2125 Ga0495580_0460160
2126 Ga0495580_0569641
2127 Ga0495580_0954730
2128 Ga0495582_0133140
2129 Ga0495582_0322670
2130 Ga0495605_0082825
2131 Ga0495605_0149829
2132 Ga0495605_0187008
2133 Ga0495605_0218427
2134 Ga0495639_0105210
2135 Ga0495662_0028384
2136 Ga0495662_0061616
2137 Ga0495664_0028943
2138 Ga0495664_0128024
2139 Ga0495664_0179338
2140 Ga0495664_0285338
2141 Ga0495584_0291281
2142 Ga0495585_0027127
2143 Ga0495594_0051879
2144 Ga0495596_0047802
2145 Ga0495596_0074587
2146 Ga0495596_0182214
2147 Ga0495596_0421129
2148 Ga0495607_0100579
2149 Ga0495607_0102625
2150 Ga0495607_0119694
2151 Ga0495583_0030946
2152 Ga0495583_0197426
2153 Ga0495583_0323698
2154 Ga0495606_0087627
2155 Ga0495606_0096472
2156 Ga0495606_0145798
2157 Ga0495606_0164978
2158 Ga0495606_0229280
2159 Ga0495606_0315715
2160 Ga0495606_0385527
2161 Ga0495608_0168574
2162 Ga0495608_0398850
2163 Ga0495610_0120335
2164 Ga0495616_0066018
2165 Ga0495616_0077831
2166 Ga0495616_0140212
2167 Ga0495618_0118889
2168 Ga0495620_0046725
2169 Ga0495620_0056267
2170 Ga0495620_0101675
2171 Ga0495628_0216553
2172 Ga0495628_0632330
2173 Ga0495630_0171274
2174 Ga0495630_0266556
2175 Ga0495630_0275790
2176 Ga0495631_0027819
2177 Ga0495631_0055206
2178 Ga0495631_0079453
2179 Ga0495631_0203616
2180 Ga0495632_0057041
2181 Ga0495632_0157143
2182 Ga0495632_0361299
2183 Ga0495637_0103780
2184 Ga0495643_0084364
2185 Ga0495643_0390634
2186 Ga0495644_0046853
2187 Ga0495644_0096439
2188 Ga0495648_0102517
2189 Ga0495648_0113515
2190 Ga0495663_0027530
2191 Ga0495663_0106046
2192 Ga0495666_0111630
2193 Ga0495642_0000545
2194 Ga0495642_0076620
2195 Ga0495652_0013910
2196 Ga0495652_0206402
2197 Ga0495652_0600733
2198 Ga0495654_0010396
2199 Ga0495654_0096790
2200 Ga0495654_0272030
2201 Ga0495665_0000205
2202 Ga0495665_0120608
2203 Ga0495665_0342771
2204 Ga0495640_0444051
2205 Ga0495586_0070011
2206 Ga0495586_0281372
2207 Ga0495586_0536245
2208 Ga0495587_0006183
2209 Ga0495587_0508950
2210 Ga0495598_0068166
2211 Ga0495598_0117404
2212 Ga0495609_0127967
2213 Ga0495609_0213386
2214 Ga0495621_0116707
2215 Ga0495597_0052004
2216 Ga0495597_0083149
2217 Ga0495597_0096101
2218 Ga0495645_0000514
2219 Ga0495645_0006429
2220 Ga0495645_0068334
2221 Ga0495645_0213537
2222 Ga0495645_0586054
2223 Ga0495622_0088243
2224 Ga0495622_0440620
2225 Ga0495633_0076037
2226 Ga0495667_0034705
2227 Ga0495656_0070881
2228 Ga0495656_0091680
2229 Ga0495656_0724223
2230 Ga0495668_0058835
2231 Ga0495668_0088168
2232 Ga0495668_0096759
2233 Ga0495668_0339228
2234 Ga0495634_0209492
2235 Ga0495611_0047987
2236 Ga0495611_0279908
2237 Ga0495625_0393084
2238 Ga0495625_0461688
2239 Ga0495625_0851205
2240 Ga0495635_0025286
2241 Ga0495635_0178333
2242 Ga0495635_0198417
2243 Ga0495661_0090932
2244 Ga0495661_0106988
2245 Ga0495661_0383022
2246 Ga0495588_0105933
2247 Ga0495588_0251651
2248 Ga0495588_0705053
2249 Ga0495657_0145758
2250 Ga0495599_0497844
2251 Ga0495599_0639301
2252 Ga0495623_0009456
2253 Ga0495623_0031770
2254 Ga0495623_0103985
2255 Ga0495646_0049912
2256 Ga0495646_0053550
2257 Ga0495646_0132744
2258 Ga0495658_0108468
2259 Ga0495669_0033933
2260 Ga0495669_0183232
2261 Ga0495669_0342740
2262 Ga0495613_0205297
2263 Ga0495613_0445761
2264 Ga0495624_0160099
2265 Ga0495624_0350034
2266 Ga0495670_0093433
2267 Ga0495670_0108275
2268 Ga0495670_0167384
2269 Ga0495671_0077149
2270 Ga0495671_0179492
2271 Ga0495649_0017123
2272 Ga0495649_0091568
2273 Ga0495649_0125289
2274 Ga0495649_0437015
2275 Ga0495589_0023413
2276 Ga0495589_0065478
2277 Ga0495589_0109860
2278 Ga0495600_0049909
2279 Ga0495660_0146966
2280 Ga0495660_0292446
2281 Ga0495581_0023720
2282 Ga0495581_0139362
2283 Ga0495581_0244168
2284 Ga0495581_0865919
2285 Ga0495604_0190254
2286 Ga0495604_0750047
2287 Ga0495636_0147336
2288 Ga0495636_0235159
2289 Ga0495636_0270133
2290 Ga0495674_0034103
2291 Ga0495674_0451764
2292 Ga0495674_0496515
2293 Ga0495674_0752002
2294 Ga0495672_0074202
2295 Ga0495672_0145530
2296 Ga0495672_0153322
2297 Ga0495672_0206298
2298 Ga0495672_0407090
2299 Ga0495676_0646415
2300 Ga0495680_0128592
2301 Ga0495680_0267210
2302 Ga0495680_0873886
2303 Ga0495683_0003370
2304 Ga0495683_0013555
2305 Ga0495683_0063048
2306 Ga0495683_0070920
2307 Ga0495683_0143651
2308 Ga0495683_0265195
2309 Ga0495687_000170
2310 Ga0495687_030716
2311 Ga0495675_0059584
2312 Ga0495675_0124642
2313 Ga0495675_0316623
2314 Ga0495677_0060175
2315 Ga0495677_0121765
2316 Ga0495679_045178
2317 Ga0495679_109404
2318 Ga0495685_020734
2319 Ga0495685_033094
2320 Ga0495685_043158
2321 Ga0495685_055435
2322 Ga0495673_0053034
2323 Ga0495673_0116088
2324 Ga0495673_0179610
2325 Ga0495681_0016946
2326 Ga0495681_0039069
2327 Ga0495681_0071396
2328 Ga0495681_0229312
2329 Ga0495684_0102744
2330 Ga0495684_0227413
2331 Ga0495686_0430770
2332 Ga0495593_0015868
2333 Ga0495593_0076271
2334 Ga0495593_0399219
2335 Ga0495602_0221394
2336 Ga0495602_0261125
2337 Ga0495614_0284615
2338 Ga0495615_0120103
2339 Ga0495626_0174356
2340 Ga0495626_0287096
2341 Ga0496100_0002134
2342 Ga0496100_0169411
2343 Ga0496100_0310998
2344 Ga0496100_0541816
2345 Ga0496100_0640562
2346 Ga0496100_0972432
2347 Ga0496101_0005093
2348 Ga0496101_0149019
2349 Ga0496101_0538996
2350 Ga0496101_0910259
2351 Ga0496102_0127845
2352 Ga0496102_0154577
2353 Ga0496102_0231774
2354 Ga0496102_0333193
2355 Ga0496102_1349096
2356 Ga0496102_1574080
2357 Ga0496103_0037311
2358 Ga0496103_0060967
2359 Ga0496103_0172350
2360 Ga0496103_0178616
2361 Ga0496103_0626407
2362 Ga0496104_0170608
2363 Ga0496104_0206858
2364 Ga0496104_0258482
2365 Ga0496104_0329188
2366 Ga0496104_0346370
2367 Ga0496104_1231058
2368 Ga0496105_0084948
2369 Ga0496105_0171028
2370 Ga0496105_0263427
2371 Ga0496105_0268060
2372 Ga0496105_0269192
2373 Ga0496105_0277656
2374 Ga0496105_0692262
2375 Ga0496106_0085865
2376 Ga0496106_0191748
2377 Ga0496106_0380939
2378 Ga0496106_0882494
2379 Ga0496106_1555755
2380 Ga0496107_0236104
2381 Ga0496107_0262240
2382 Ga0496107_0303272
2383 Ga0496107_0664849
2384 Ga0496107_0811778
2385 Ga0496107_0904724
2386 Ga0496108_0102233
2387 Ga0496108_0195500
2388 Ga0496108_0216698
2389 Ga0496108_0315503
2390 Ga0496108_0511718
2391 Ga0496108_0902212
2392 Ga0496108_1124780
2393 Ga0496109_0103528
2394 Ga0496109_0288118
2395 Ga0496109_0380318
2396 Ga0496109_0419974
2397 Ga0496109_0442017
2398 Ga0496109_0471412
2399 Ga0496109_0755499
2400 Ga0496109_1548605
2401 Ga0496110_0251779
2402 Ga0496110_0275015
2403 Ga0496110_0318118
2404 Ga0496110_0947448
2405 Ga0496110_1159165
2406 Ga0496110_1532789
2407 Ga0496111_0209343
2408 Ga0496112_0075262
2409 Ga0496112_1022967
2410 Ga0496113_0093666
2411 Ga0496113_0110023
2412 Ga0496113_0240208
2413 Ga0496113_1536318
2414 Ga0496114_0076167
2415 Ga0496114_0125598
2416 Ga0496114_0341850
2417 Ga0496114_0420956
2418 Ga0496114_0689346
2419 Ga0496114_1109825
2420 Ga0496114_1337093
2421 Ga0496115_0167788
2422 Ga0496115_1020758
2423 Ga0496117_0045148
2424 Ga0496118_0141973
2425 Ga0496119_0110315
2426 Ga0496120_0495162
2427 Ga0496120_0533606
2428 Ga0496121_0190843
2429 Ga0496121_0227811
2430 Ga0496124_0491067
2431 Ga0496125_0088039
2432 Ga0496126_0053525
2433 Ga0496126_0276733
2434 Ga0496126_1165877
2435 Ga0495678_057059
2436 Ga0495678_123896
2437 Ga0495682_0040152
2438 Ga0495682_0045928
2439 Ga0495682_0269536
2440 Ga0501300_002737
2441 Ga0501303_066496
2442 Ga0501198_017318
2443 Ga0501199_070109
2444 Ga0501202_096751
2445 Ga0501202_206560
2446 Ga0501206_025272
2447 Ga0501207_073542
2448 Ga0501207_132015
2449 Ga0501208_153166
2450 Ga0501216_012979
2451 Ga0501216_134265
2452 Ga0501217_173709
2453 Ga0501223_018734
2454 Ga0501224_087071
2455 Ga0501228_018991
2456 Ga0501239_003927
2457 Ga0501240_006305
2458 Ga0501240_103683
2459 Ga0501242_056705
2460 Ga0501243_041358
2461 Ga0501247_022906
2462 Ga0501248_019538
2463 Ga0501249_174833
2464 Ga0501250_036976
2465 Ga0501251_078707
2466 Ga0501251_115961
2467 Ga0501252_034884
2468 Ga0501253_010244
2469 Ga0501255_086591
2470 Ga0501256_005780
2471 Ga0501259_010900
2472 Ga0501261_044537
2473 Ga0501221_058714
2474 Ga0501225_0073065
2475 Ga0501225_0263656
2476 Ga0501241_163082
2477 Ga0501263_030106
2478 Ga0501270_006913
2479 Ga0501270_134809
2480 Ga0501272_071852
2481 Ga0501273_022040
2482 Ga0501273_060907
2483 Ga0501275_005373
2484 Ga0501279_009351
2485 Ga0501279_015333
2486 Ga0501283_130070
2487 Ga0501045_1100666
2488 Ga0501212_040222
2489 nmdc:mga07m45_165119_c1
2490 nmdc:mga09592_399642_c1
2491 nmdc:mga09592_769299_c1
2492 nmdc:mga0qj67_242353_c1
2493 nmdc:mga0qj67_244501_c1
2494 nmdc:mga0qj67_296309_c1
2495 nmdc:mga0qj67_757627_c1
2496 nmdc:mga06r32_1032900_c1
2497 nmdc:mga06r32_1063149_c1
2498 nmdc:mga06r32_575181_c1
2499 nmdc:mga08y16_462029_c1
2500 nmdc:mga08y16_825027_c1
2501 nmdc:mga0rr50_1243187_c1
2502 Ga0495655_0050320
2503 Ga0495655_0246426
2504 Ga0500608_020766
2505 2512347125
2506 2512349955
2507 2514055052
2508 2516024662
2509 2753571618
2510 2753767667
2511 2792838879
2512 2842341345
2513 2842341370
2514 2842341741
2515 2842341776
2516 2869258128
2517 2900643250
2518 2900643356
2519 2902689976
2520 2904616873
2521 2946791336
2522 3004174583
2523 3004174824
2524 3004342122
2525 8004320295
2526 8016605234
2527 8016605290
2528 8016605323
2529 8016613097
2530 8016613116

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

20

104

0.78

Map