F492353
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1266 | 478 | 2530 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10446216|Ga0105244_104462162 |
| Length | 120 |
| Sequence | VEFLPESGQDVCRTGETMTKRPRRNHTPAFKAKVALAAVRGDKTLAELAQQFDIHPNQITQWKAQLLDGAAGVFGSETRGDSQGPAVDLTVLHAKIGELTLENDFLAGALGKAGLLSAKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 144 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 145 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 235 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 236 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 243 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 257 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 258 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 261 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 264 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 265 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 266 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 267 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 270 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 271 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 272 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 273 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 274 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 275 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 276 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 277 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 278 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 279 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 280 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 281 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 282 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 283 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 284 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 288 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 289 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 392 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 393 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 394 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 395 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 396 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 397 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 403 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 404 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 405 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 406 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 407 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 408 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 409 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 410 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 411 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 412 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 413 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 416 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 417 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 418 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 419 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 420 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 421 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 422 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 423 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 424 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 425 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 427 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 428 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 429 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 430 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 431 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 432 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 433 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 434 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 435 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 436 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 437 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 438 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 439 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 440 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 441 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 442 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 443 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 444 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 446 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 447 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 448 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 449 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 450 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 451 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 452 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 453 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 455 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 456 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 463 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 464 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 465 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 466 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 467 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 468 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 469 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 470 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 471 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 472 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 473 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 474 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 475 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 476 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 477 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 478 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0.24 |
| Isolates | 2.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 1.11 |
| Rhizoplane | 6.71 |
| Rhizosphere | 89.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105244_10446216 | 3300009036 | Bacteria | 595 |
| 2 | JGI24740J21852_10075385 | 3300001979 | Bacteria | 894 |
| 3 | JGI24739J22299_10048622 | 3300001989 | Bacteria | 1378 |
| 4 | JGI24737J22298_10043895 | 3300001990 | Bacteria | 1368 |
| 5 | JGI24743J22301_10016746 | 3300001991 | Bacteria | 1370 |
| 6 | JGI24735J21928_10038814 | 3300002067 | Bacteria | 1393 |
| 7 | JGI24750J21931_1033108 | 3300002070 | Bacteria | 765 |
| 8 | JGI24745J21846_1008427 | 3300002073 | Bacteria | 1161 |
| 9 | JGI24748J21848_1022131 | 3300002074 | Bacteria | 769 |
| 10 | JGI24738J21930_10031770 | 3300002075 | Bacteria | 1077 |
| 11 | JGI24738J21930_10098169 | 3300002075 | Bacteria | 624 |
| 12 | JGI24749J21850_1013788 | 3300002076 | Bacteria | 1135 |
| 13 | JGI24744J21845_10065150 | 3300002077 | Bacteria | 665 |
| 14 | JGI24744J21845_10084576 | 3300002077 | Bacteria | 581 |
| 15 | JGI24742J22300_10011327 | 3300002244 | Bacteria | 1480 |
| 16 | JGI24751J29686_10020433 | 3300002459 | Bacteria | 1371 |
| 17 | rootL2_10147005 | 3300003322 | Bacteria | 5012 |
| 18 | Ga0007410J51695_1069272 | 3300003574 | Bacteria | 600 |
| 19 | Ga0007416J51690_1066597 | 3300003577 | Bacteria | 551 |
| 20 | Ga0070658_10322838 | 3300005327 | Bacteria | 1319 |
| 21 | Ga0070658_10376036 | 3300005327 | Bacteria | 1218 |
| 22 | Ga0070658_10700254 | 3300005327 | Bacteria | 879 |
| 23 | Ga0070676_10206008 | 3300005328 | Bacteria | 1292 |
| 24 | Ga0070676_10398524 | 3300005328 | Bacteria | 957 |
| 25 | Ga0070683_100673647 | 3300005329 | Bacteria | 990 |
| 26 | Ga0070683_100860183 | 3300005329 | Bacteria | 870 |
| 27 | Ga0070683_101342447 | 3300005329 | Bacteria | 687 |
| 28 | Ga0070690_100076274 | 3300005330 | Bacteria | 2187 |
| 29 | Ga0070690_100176442 | 3300005330 | Bacteria | 1474 |
| 30 | Ga0070690_100863778 | 3300005330 | Bacteria | 705 |
| 31 | Ga0070670_100289512 | 3300005331 | Bacteria | 1431 |
| 32 | Ga0070670_100931284 | 3300005331 | Bacteria | 788 |
| 33 | Ga0070670_101040227 | 3300005331 | Bacteria | 745 |
| 34 | Ga0070677_10451856 | 3300005333 | Bacteria | 687 |
| 35 | Ga0068869_100614772 | 3300005334 | Bacteria | 919 |
| 36 | Ga0068869_101891599 | 3300005334 | Bacteria | 535 |
| 37 | Ga0070666_10127659 | 3300005335 | Bacteria | 1766 |
| 38 | Ga0070666_10155880 | 3300005335 | Bacteria | 1595 |
| 39 | Ga0070666_10196442 | 3300005335 | Bacteria | 1419 |
| 40 | Ga0070666_10707744 | 3300005335 | Bacteria | 739 |
| 41 | Ga0070680_100291100 | 3300005336 | Bacteria | 1384 |
| 42 | Ga0070682_100047626 | 3300005337 | Bacteria | 2666 |
| 43 | Ga0070682_100127703 | 3300005337 | Bacteria | 1716 |
| 44 | Ga0070682_100232196 | 3300005337 | Bacteria | 1319 |
| 45 | Ga0070682_100348634 | 3300005337 | Bacteria | 1103 |
| 46 | Ga0068868_100035886 | 3300005338 | Bacteria | 3834 |
| 47 | Ga0068868_100310703 | 3300005338 | Bacteria | 1341 |
| 48 | Ga0068868_100813167 | 3300005338 | Bacteria | 844 |
| 49 | Ga0068868_101006867 | 3300005338 | Bacteria | 762 |
| 50 | Ga0068868_101411374 | 3300005338 | Bacteria | 650 |
| 51 | Ga0068868_101996699 | 3300005338 | Bacteria | 550 |
| 52 | Ga0070660_100133744 | 3300005339 | Bacteria | 1986 |
| 53 | Ga0070660_100217276 | 3300005339 | Bacteria | 1553 |
| 54 | Ga0070660_100586085 | 3300005339 | Bacteria | 932 |
| 55 | Ga0070660_100631401 | 3300005339 | Bacteria | 897 |
| 56 | Ga0070689_100229827 | 3300005340 | Bacteria | 1524 |
| 57 | Ga0070689_100238210 | 3300005340 | Bacteria | 1498 |
| 58 | Ga0070691_10075394 | 3300005341 | Bacteria | 1643 |
| 59 | Ga0070691_10155101 | 3300005341 | Bacteria | 1177 |
| 60 | Ga0070691_10311065 | 3300005341 | Bacteria | 864 |
| 61 | Ga0070687_100081095 | 3300005343 | Bacteria | 1770 |
| 62 | Ga0070687_100121237 | 3300005343 | Bacteria | 1496 |
| 63 | Ga0070661_100237655 | 3300005344 | Bacteria | 1402 |
| 64 | Ga0070661_100342304 | 3300005344 | Bacteria | 1172 |
| 65 | Ga0070692_10090870 | 3300005345 | Bacteria | 1659 |
| 66 | Ga0070692_10101068 | 3300005345 | Bacteria | 1581 |
| 67 | Ga0070668_100261538 | 3300005347 | Bacteria | 1439 |
| 68 | Ga0070669_100079724 | 3300005353 | Bacteria | 2435 |
| 69 | Ga0070669_100132930 | 3300005353 | Bacteria | 1911 |
| 70 | Ga0070669_100266586 | 3300005353 | Bacteria | 1368 |
| 71 | Ga0070669_100577689 | 3300005353 | Bacteria | 940 |
| 72 | Ga0070675_100148798 | 3300005354 | Bacteria | 2006 |
| 73 | Ga0070675_100206088 | 3300005354 | Bacteria | 1708 |
| 74 | Ga0070675_100945754 | 3300005354 | Bacteria | 790 |
| 75 | Ga0070675_102052671 | 3300005354 | Bacteria | 527 |
| 76 | Ga0070671_100080209 | 3300005355 | Bacteria | 2728 |
| 77 | Ga0070671_100556377 | 3300005355 | Bacteria | 989 |
| 78 | Ga0070671_101423457 | 3300005355 | Bacteria | 613 |
| 79 | Ga0070674_100138267 | 3300005356 | Bacteria | 1825 |
| 80 | Ga0070674_100141575 | 3300005356 | Bacteria | 1805 |
| 81 | Ga0070674_100882812 | 3300005356 | Bacteria | 778 |
| 82 | Ga0070673_100206576 | 3300005364 | Bacteria | 1694 |
| 83 | Ga0070673_100263621 | 3300005364 | Bacteria | 1506 |
| 84 | Ga0070673_100306049 | 3300005364 | Bacteria | 1400 |
| 85 | Ga0070673_100592016 | 3300005364 | Bacteria | 1011 |
| 86 | Ga0070673_102219006 | 3300005364 | Bacteria | 522 |
| 87 | Ga0070688_100180293 | 3300005365 | Bacteria | 1464 |
| 88 | Ga0070688_100188306 | 3300005365 | Bacteria | 1436 |
| 89 | Ga0070688_101533574 | 3300005365 | Bacteria | 543 |
| 90 | Ga0070659_100230238 | 3300005366 | Bacteria | 1531 |
| 91 | Ga0070659_100399967 | 3300005366 | Bacteria | 1159 |
| 92 | Ga0070659_101238727 | 3300005366 | Bacteria | 660 |
| 93 | Ga0070667_100234051 | 3300005367 | Bacteria | 1638 |
| 94 | Ga0070667_100254748 | 3300005367 | Bacteria | 1570 |
| 95 | Ga0070667_100417609 | 3300005367 | Bacteria | 1223 |
| 96 | Ga0070667_101152939 | 3300005367 | Bacteria | 725 |
| 97 | Ga0070667_101420702 | 3300005367 | Bacteria | 651 |
| 98 | Ga0070703_10114692 | 3300005406 | Bacteria | 969 |
| 99 | Ga0070703_10165847 | 3300005406 | Bacteria | 842 |
| 100 | Ga0070709_10191833 | 3300005434 | Bacteria | 1442 |
| 101 | Ga0070709_10258746 | 3300005434 | Bacteria | 1257 |
| 102 | Ga0070714_100204469 | 3300005435 | Bacteria | 1808 |
| 103 | Ga0070714_100212290 | 3300005435 | Bacteria | 1774 |
| 104 | Ga0070714_101925590 | 3300005435 | Bacteria | 577 |
| 105 | Ga0070713_100223595 | 3300005436 | Bacteria | 1708 |
| 106 | Ga0070713_100628513 | 3300005436 | Bacteria | 1021 |
| 107 | Ga0070713_101401031 | 3300005436 | Bacteria | 678 |
| 108 | Ga0070710_11338472 | 3300005437 | Bacteria | 533 |
| 109 | Ga0070701_10107413 | 3300005438 | Bacteria | 1555 |
| 110 | Ga0070701_10108264 | 3300005438 | Bacteria | 1549 |
| 111 | Ga0070711_100415920 | 3300005439 | Bacteria | 1094 |
| 112 | Ga0070705_100161616 | 3300005440 | Bacteria | 1498 |
| 113 | Ga0070705_100398297 | 3300005440 | Bacteria | 1019 |
| 114 | Ga0070705_100428057 | 3300005440 | Bacteria | 987 |
| 115 | Ga0070700_100093770 | 3300005441 | Bacteria | 1964 |
| 116 | Ga0070700_100184474 | 3300005441 | Bacteria | 1455 |
| 117 | Ga0070700_101019078 | 3300005441 | Bacteria | 682 |
| 118 | Ga0070694_100058448 | 3300005444 | Bacteria | 2624 |
| 119 | Ga0070694_100116185 | 3300005444 | Bacteria | 1913 |
| 120 | Ga0070694_100472260 | 3300005444 | Bacteria | 994 |
| 121 | Ga0070694_100975822 | 3300005444 | Bacteria | 702 |
| 122 | Ga0070694_101465665 | 3300005444 | Bacteria | 577 |
| 123 | Ga0070708_100073139 | 3300005445 | Bacteria | 3089 |
| 124 | Ga0070708_101256225 | 3300005445 | Bacteria | 692 |
| 125 | Ga0070663_100056086 | 3300005455 | Bacteria | 2822 |
| 126 | Ga0070663_100179196 | 3300005455 | Bacteria | 1642 |
| 127 | Ga0070663_100215612 | 3300005455 | Bacteria | 1505 |
| 128 | Ga0070663_100218255 | 3300005455 | Bacteria | 1496 |
| 129 | Ga0070663_100235485 | 3300005455 | Bacteria | 1443 |
| 130 | Ga0070663_100354031 | 3300005455 | Bacteria | 1189 |
| 131 | Ga0070663_100485483 | 3300005455 | Bacteria | 1023 |
| 132 | Ga0070678_100168375 | 3300005456 | Bacteria | 1782 |
| 133 | Ga0070678_100179777 | 3300005456 | Bacteria | 1730 |
| 134 | Ga0070678_100231064 | 3300005456 | Bacteria | 1542 |
| 135 | Ga0070678_100526465 | 3300005456 | Bacteria | 1047 |
| 136 | Ga0070678_100779996 | 3300005456 | Bacteria | 866 |
| 137 | Ga0070678_101897394 | 3300005456 | Bacteria | 563 |
| 138 | Ga0070678_102400382 | 3300005456 | Bacteria | 501 |
| 139 | Ga0070662_100219086 | 3300005457 | Bacteria | 1518 |
| 140 | Ga0070662_100275160 | 3300005457 | Bacteria | 1361 |
| 141 | Ga0070662_100550755 | 3300005457 | Bacteria | 966 |
| 142 | Ga0070662_100918136 | 3300005457 | Bacteria | 747 |
| 143 | Ga0070681_11440439 | 3300005458 | Bacteria | 613 |
| 144 | Ga0068867_100210797 | 3300005459 | Bacteria | 1560 |
| 145 | Ga0068867_100253286 | 3300005459 | Bacteria | 1432 |
| 146 | Ga0068867_102339022 | 3300005459 | Bacteria | 508 |
| 147 | Ga0070685_10140688 | 3300005466 | Bacteria | 1519 |
| 148 | Ga0070685_10481633 | 3300005466 | Bacteria | 875 |
| 149 | Ga0070685_10706526 | 3300005466 | Bacteria | 735 |
| 150 | Ga0070685_10824106 | 3300005466 | Bacteria | 686 |
| 151 | Ga0070706_100122781 | 3300005467 | Bacteria | 2421 |
| 152 | Ga0070706_100449020 | 3300005467 | Bacteria | 1200 |
| 153 | Ga0070707_100000007 | 3300005468 | Bacteria | 181102 |
| 154 | Ga0070707_101609441 | 3300005468 | Bacteria | 616 |
| 155 | Ga0070698_100049864 | 3300005471 | Bacteria | 4272 |
| 156 | Ga0070698_100157038 | 3300005471 | Bacteria | 2220 |
| 157 | Ga0070699_100018019 | 3300005518 | Bacteria | 6066 |
| 158 | Ga0070699_100084597 | 3300005518 | Bacteria | 2768 |
| 159 | Ga0070699_100140825 | 3300005518 | Bacteria | 2130 |
| 160 | Ga0070679_101221960 | 3300005530 | Bacteria | 697 |
| 161 | Ga0070679_101523359 | 3300005530 | Bacteria | 616 |
| 162 | Ga0070679_101869413 | 3300005530 | Bacteria | 549 |
| 163 | Ga0070684_100270005 | 3300005535 | Bacteria | 1557 |
| 164 | Ga0070684_100282209 | 3300005535 | Bacteria | 1522 |
| 165 | Ga0070684_100410004 | 3300005535 | Bacteria | 1250 |
| 166 | Ga0070697_100029875 | 3300005536 | Bacteria | 4375 |
| 167 | Ga0070697_100033549 | 3300005536 | Bacteria | 4134 |
| 168 | Ga0068853_100207357 | 3300005539 | Bacteria | 1785 |
| 169 | Ga0068853_100309860 | 3300005539 | Bacteria | 1461 |
| 170 | Ga0068853_100674801 | 3300005539 | Bacteria | 985 |
| 171 | Ga0070672_100270996 | 3300005543 | Bacteria | 1433 |
| 172 | Ga0070672_100355467 | 3300005543 | Bacteria | 1249 |
| 173 | Ga0070672_100448078 | 3300005543 | Bacteria | 1111 |
| 174 | Ga0070672_100775940 | 3300005543 | Bacteria | 842 |
| 175 | Ga0070672_101614744 | 3300005543 | Bacteria | 582 |
| 176 | Ga0070686_100013115 | 3300005544 | Bacteria | 4733 |
| 177 | Ga0070686_100113836 | 3300005544 | Bacteria | 1848 |
| 178 | Ga0070686_100133681 | 3300005544 | Bacteria | 1718 |
| 179 | Ga0070686_100514309 | 3300005544 | Bacteria | 931 |
| 180 | Ga0070695_100214298 | 3300005545 | Bacteria | 1384 |
| 181 | Ga0070695_101631310 | 3300005545 | Bacteria | 539 |
| 182 | Ga0070696_100394813 | 3300005546 | Bacteria | 1081 |
| 183 | Ga0070693_100106003 | 3300005547 | Bacteria | 1720 |
| 184 | Ga0070693_100112817 | 3300005547 | Bacteria | 1675 |
| 185 | Ga0070665_100121418 | 3300005548 | Bacteria | 2614 |
| 186 | Ga0070665_100240142 | 3300005548 | Bacteria | 1812 |
| 187 | Ga0070665_100291744 | 3300005548 | Bacteria | 1633 |
| 188 | Ga0070665_101576236 | 3300005548 | Bacteria | 665 |
| 189 | Ga0070704_100226942 | 3300005549 | Bacteria | 1521 |
| 190 | Ga0068855_100288933 | 3300005563 | Bacteria | 1818 |
| 191 | Ga0068855_102080435 | 3300005563 | Bacteria | 572 |
| 192 | Ga0070664_100276476 | 3300005564 | Bacteria | 1514 |
| 193 | Ga0070664_100329572 | 3300005564 | Bacteria | 1385 |
| 194 | Ga0070664_101380973 | 3300005564 | Bacteria | 666 |
| 195 | Ga0068857_100262766 | 3300005577 | Bacteria | 1584 |
| 196 | Ga0068857_100827487 | 3300005577 | Bacteria | 885 |
| 197 | Ga0068854_100143804 | 3300005578 | Bacteria | 1833 |
| 198 | Ga0068854_100445414 | 3300005578 | Bacteria | 1080 |
| 199 | Ga0068854_100513900 | 3300005578 | Bacteria | 1010 |
| 200 | Ga0068854_101020220 | 3300005578 | Bacteria | 733 |
| 201 | Ga0068856_100217350 | 3300005614 | Bacteria | 1926 |
| 202 | Ga0068856_100392445 | 3300005614 | Bacteria | 1407 |
| 203 | Ga0068856_100693589 | 3300005614 | Bacteria | 1039 |
| 204 | Ga0068856_101234487 | 3300005614 | Bacteria | 763 |
| 205 | Ga0070702_100140492 | 3300005615 | Bacteria | 1537 |
| 206 | Ga0070702_100447213 | 3300005615 | Bacteria | 936 |
| 207 | Ga0070702_100467592 | 3300005615 | Bacteria | 918 |
| 208 | Ga0070702_100619891 | 3300005615 | Bacteria | 814 |
| 209 | Ga0068852_100182823 | 3300005616 | Bacteria | 1972 |
| 210 | Ga0068852_100269607 | 3300005616 | Bacteria | 1637 |
| 211 | Ga0068852_100523443 | 3300005616 | Bacteria | 1183 |
| 212 | Ga0068852_100752883 | 3300005616 | Bacteria | 986 |
| 213 | Ga0068852_101527723 | 3300005616 | Bacteria | 690 |
| 214 | Ga0068859_100326179 | 3300005617 | Bacteria | 1629 |
| 215 | Ga0068859_101955481 | 3300005617 | Bacteria | 647 |
| 216 | Ga0068859_102876218 | 3300005617 | Bacteria | 528 |
| 217 | Ga0068864_100255090 | 3300005618 | Bacteria | 1630 |
| 218 | Ga0068864_100289621 | 3300005618 | Bacteria | 1531 |
| 219 | Ga0068864_100298123 | 3300005618 | Bacteria | 1508 |
| 220 | Ga0068864_101500946 | 3300005618 | Bacteria | 677 |
| 221 | Ga0068866_10059176 | 3300005718 | Bacteria | 1981 |
| 222 | Ga0068866_10082102 | 3300005718 | Bacteria | 1733 |
| 223 | Ga0068866_10129037 | 3300005718 | Bacteria | 1435 |
| 224 | Ga0068866_10316049 | 3300005718 | Bacteria | 981 |
| 225 | Ga0068866_10537144 | 3300005718 | Bacteria | 780 |
| 226 | Ga0068861_100163416 | 3300005719 | Bacteria | 1839 |
| 227 | Ga0068861_100164862 | 3300005719 | Bacteria | 1831 |
| 228 | Ga0068861_102453206 | 3300005719 | Bacteria | 525 |
| 229 | Ga0068851_10105009 | 3300005834 | Bacteria | 1503 |
| 230 | Ga0068851_10115648 | 3300005834 | Bacteria | 1437 |
| 231 | Ga0068851_10128625 | 3300005834 | Bacteria | 1368 |
| 232 | Ga0068870_10058705 | 3300005840 | Bacteria | 2060 |
| 233 | Ga0068870_10126529 | 3300005840 | Bacteria | 1479 |
| 234 | Ga0068870_10127391 | 3300005840 | Bacteria | 1474 |
| 235 | Ga0068870_10709567 | 3300005840 | Bacteria | 695 |
| 236 | Ga0068863_100363307 | 3300005841 | Bacteria | 1412 |
| 237 | Ga0068863_100382163 | 3300005841 | Bacteria | 1375 |
| 238 | Ga0068863_101716408 | 3300005841 | Bacteria | 637 |
| 239 | Ga0068863_102507481 | 3300005841 | Bacteria | 525 |
| 240 | Ga0068858_100327399 | 3300005842 | Bacteria | 1465 |
| 241 | Ga0068858_100386408 | 3300005842 | Bacteria | 1343 |
| 242 | Ga0068858_101115700 | 3300005842 | Bacteria | 774 |
| 243 | Ga0068860_100270067 | 3300005843 | Bacteria | 1659 |
| 244 | Ga0068860_100314356 | 3300005843 | Bacteria | 1536 |
| 245 | Ga0068860_100448608 | 3300005843 | Bacteria | 1282 |
| 246 | Ga0068862_100226532 | 3300005844 | Bacteria | 1694 |
| 247 | Ga0068862_100262876 | 3300005844 | Bacteria | 1576 |
| 248 | Ga0070717_10079647 | 3300006028 | Bacteria | 2747 |
| 249 | Ga0070717_10169654 | 3300006028 | Bacteria | 1897 |
| 250 | Ga0070717_10703016 | 3300006028 | Bacteria | 918 |
| 251 | Ga0075363_100947220 | 3300006048 | Bacteria | 529 |
| 252 | Ga0075432_10103406 | 3300006058 | Bacteria | 1054 |
| 253 | Ga0075432_10573666 | 3300006058 | Bacteria | 513 |
| 254 | Ga0070716_100008163 | 3300006173 | Bacteria | 5187 |
| 255 | Ga0070716_100357374 | 3300006173 | Bacteria | 1036 |
| 256 | Ga0070716_100664260 | 3300006173 | Bacteria | 792 |
| 257 | Ga0070712_100391001 | 3300006175 | Bacteria | 1147 |
| 258 | Ga0075366_10248641 | 3300006195 | Bacteria | 1084 |
| 259 | Ga0097621_100246623 | 3300006237 | Bacteria | 1563 |
| 260 | Ga0097621_100444594 | 3300006237 | Bacteria | 1167 |
| 261 | Ga0097621_100973855 | 3300006237 | Bacteria | 793 |
| 262 | Ga0068871_100036623 | 3300006358 | Bacteria | 3908 |
| 263 | Ga0068871_100222844 | 3300006358 | Bacteria | 1635 |
| 264 | Ga0068871_100363941 | 3300006358 | Bacteria | 1282 |
| 265 | Ga0068871_100705600 | 3300006358 | Bacteria | 924 |
| 266 | Ga0075428_101760753 | 3300006844 | Bacteria | 645 |
| 267 | Ga0075430_100117831 | 3300006846 | Bacteria | 2213 |
| 268 | Ga0075430_101263358 | 3300006846 | Bacteria | 607 |
| 269 | Ga0075431_100617805 | 3300006847 | Bacteria | 1066 |
| 270 | Ga0075431_100773162 | 3300006847 | Bacteria | 935 |
| 271 | Ga0075431_101328650 | 3300006847 | Bacteria | 679 |
| 272 | Ga0075429_100312589 | 3300006880 | Bacteria | 1375 |
| 273 | Ga0075429_100446361 | 3300006880 | Bacteria | 1133 |
| 274 | Ga0068865_100205805 | 3300006881 | Bacteria | 1530 |
| 275 | Ga0068865_100220245 | 3300006881 | Bacteria | 1483 |
| 276 | Ga0068865_100227814 | 3300006881 | Bacteria | 1460 |
| 277 | Ga0068865_100457341 | 3300006881 | Bacteria | 1057 |
| 278 | Ga0068865_100716349 | 3300006881 | Bacteria | 856 |
| 279 | Ga0097620_100326231 | 3300006931 | Bacteria | 1629 |
| 280 | Ga0097620_101955544 | 3300006931 | Bacteria | 647 |
| 281 | Ga0097620_102876253 | 3300006931 | Bacteria | 528 |
| 282 | Ga0075435_100576717 | 3300007076 | Bacteria | 975 |
| 283 | Ga0105251_10306132 | 3300009011 | Bacteria | 721 |
| 284 | Ga0105244_10067108 | 3300009036 | Bacteria | 1795 |
| 285 | Ga0105244_10321305 | 3300009036 | Bacteria | 715 |
| 286 | Ga0105250_10114752 | 3300009092 | Bacteria | 1105 |
| 287 | Ga0105240_10258777 | 3300009093 | Bacteria | 2009 |
| 288 | Ga0105240_10448802 | 3300009093 | Bacteria | 1444 |
| 289 | Ga0105240_11048037 | 3300009093 | Bacteria | 870 |
| 290 | Ga0111539_10538945 | 3300009094 | Bacteria | 1360 |
| 291 | Ga0111539_12600487 | 3300009094 | Bacteria | 587 |
| 292 | Ga0105245_10254336 | 3300009098 | Bacteria | 1708 |
| 293 | Ga0105245_10648974 | 3300009098 | Bacteria | 1085 |
| 294 | Ga0105245_10968147 | 3300009098 | Bacteria | 894 |
| 295 | Ga0105245_11733074 | 3300009098 | Bacteria | 677 |
| 296 | Ga0105245_12434956 | 3300009098 | Bacteria | 577 |
| 297 | Ga0105247_10102325 | 3300009101 | Bacteria | 1833 |
| 298 | Ga0105247_10174051 | 3300009101 | Bacteria | 1433 |
| 299 | Ga0105247_10250874 | 3300009101 | Bacteria | 1210 |
| 300 | Ga0105247_10440054 | 3300009101 | Bacteria | 937 |
| 301 | Ga0105243_10123671 | 3300009148 | Bacteria | 2185 |
| 302 | Ga0105243_10161637 | 3300009148 | Bacteria | 1931 |
| 303 | Ga0105243_10245964 | 3300009148 | Bacteria | 1594 |
| 304 | Ga0105243_10391531 | 3300009148 | Bacteria | 1288 |
| 305 | Ga0105243_10541887 | 3300009148 | Bacteria | 1110 |
| 306 | Ga0105243_12007017 | 3300009148 | Bacteria | 613 |
| 307 | Ga0105241_10718732 | 3300009174 | Bacteria | 913 |
| 308 | Ga0105242_10135978 | 3300009176 | Bacteria | 2127 |
| 309 | Ga0105242_10206094 | 3300009176 | Bacteria | 1749 |
| 310 | Ga0105242_10312017 | 3300009176 | Bacteria | 1439 |
| 311 | Ga0105242_10770952 | 3300009176 | Bacteria | 949 |
| 312 | Ga0105242_13111309 | 3300009176 | Bacteria | 514 |
| 313 | Ga0105248_10361670 | 3300009177 | Bacteria | 1634 |
| 314 | Ga0105248_10364424 | 3300009177 | Bacteria | 1627 |
| 315 | Ga0105248_10623182 | 3300009177 | Bacteria | 1217 |
| 316 | Ga0105237_10187553 | 3300009545 | Bacteria | 2068 |
| 317 | Ga0105237_10247040 | 3300009545 | Bacteria | 1786 |
| 318 | Ga0105237_10288859 | 3300009545 | Bacteria | 1643 |
| 319 | Ga0105237_10560816 | 3300009545 | Bacteria | 1149 |
| 320 | Ga0105237_10664183 | 3300009545 | Bacteria | 1049 |
| 321 | Ga0105237_11059527 | 3300009545 | Bacteria | 818 |
| 322 | Ga0105237_11304788 | 3300009545 | Bacteria | 732 |
| 323 | Ga0105237_11620349 | 3300009545 | Bacteria | 654 |
| 324 | Ga0105238_10212369 | 3300009551 | Bacteria | 1911 |
| 325 | Ga0105238_10251586 | 3300009551 | Bacteria | 1745 |
| 326 | Ga0105238_10271229 | 3300009551 | Bacteria | 1677 |
| 327 | Ga0105238_10492074 | 3300009551 | Bacteria | 1226 |
| 328 | Ga0105249_10218416 | 3300009553 | Bacteria | 1875 |
| 329 | Ga0105249_10336293 | 3300009553 | Bacteria | 1525 |
| 330 | Ga0105249_11052789 | 3300009553 | Bacteria | 883 |
| 331 | Ga0105249_11871349 | 3300009553 | Bacteria | 673 |
| 332 | Ga0105239_10285132 | 3300010375 | Bacteria | 1860 |
| 333 | Ga0105239_10371991 | 3300010375 | Bacteria | 1615 |
| 334 | Ga0105239_10387503 | 3300010375 | Bacteria | 1581 |
| 335 | Ga0105239_12133050 | 3300010375 | Bacteria | 651 |
| 336 | Ga0105246_10083590 | 3300011119 | Bacteria | 2282 |
| 337 | Ga0105246_10113072 | 3300011119 | Bacteria | 1998 |
| 338 | Ga0105246_10304329 | 3300011119 | Bacteria | 1289 |
| 339 | Ga0105246_11295462 | 3300011119 | Bacteria | 675 |
| 340 | Ga0105246_11696477 | 3300011119 | Bacteria | 600 |
| 341 | Ga0157341_1013489 | 3300012494 | Bacteria | 731 |
| 342 | Ga0157373_10827986 | 3300013100 | Bacteria | 684 |
| 343 | Ga0157371_10059895 | 3300013102 | Bacteria | 2699 |
| 344 | Ga0157371_10132399 | 3300013102 | Bacteria | 1774 |
| 345 | Ga0157371_10902836 | 3300013102 | Bacteria | 670 |
| 346 | Ga0157370_10254568 | 3300013104 | Bacteria | 1624 |
| 347 | Ga0157370_11769847 | 3300013104 | Bacteria | 555 |
| 348 | Ga0157369_10042214 | 3300013105 | Bacteria | 4976 |
| 349 | Ga0157369_10272875 | 3300013105 | Bacteria | 1762 |
| 350 | Ga0157369_11594000 | 3300013105 | Bacteria | 664 |
| 351 | Ga0157374_10087909 | 3300013296 | Bacteria | 2959 |
| 352 | Ga0157374_10200266 | 3300013296 | Bacteria | 1955 |
| 353 | Ga0157374_10296674 | 3300013296 | Bacteria | 1599 |
| 354 | Ga0157374_10297273 | 3300013296 | Bacteria | 1597 |
| 355 | Ga0157374_10955074 | 3300013296 | Bacteria | 876 |
| 356 | Ga0157374_12726747 | 3300013296 | Bacteria | 522 |
| 357 | Ga0157378_10871081 | 3300013297 | Bacteria | 930 |
| 358 | Ga0157378_11195784 | 3300013297 | Bacteria | 799 |
| 359 | Ga0157378_13097797 | 3300013297 | Bacteria | 516 |
| 360 | Ga0163162_10248003 | 3300013306 | Bacteria | 1912 |
| 361 | Ga0163162_10823584 | 3300013306 | Bacteria | 1044 |
| 362 | Ga0163162_10837849 | 3300013306 | Bacteria | 1035 |
| 363 | Ga0163162_10861900 | 3300013306 | Bacteria | 1020 |
| 364 | Ga0163162_10933409 | 3300013306 | Bacteria | 980 |
| 365 | Ga0163162_11325364 | 3300013306 | Bacteria | 818 |
| 366 | Ga0163162_11582625 | 3300013306 | Bacteria | 747 |
| 367 | Ga0163162_12917569 | 3300013306 | Bacteria | 550 |
| 368 | Ga0157372_10409779 | 3300013307 | Bacteria | 1580 |
| 369 | Ga0157372_11559451 | 3300013307 | Bacteria | 760 |
| 370 | Ga0157372_12616374 | 3300013307 | Bacteria | 579 |
| 371 | Ga0157375_10155470 | 3300013308 | Bacteria | 2426 |
| 372 | Ga0157375_10270996 | 3300013308 | Bacteria | 1860 |
| 373 | Ga0157375_10290764 | 3300013308 | Bacteria | 1797 |
| 374 | Ga0157375_10317125 | 3300013308 | Bacteria | 1723 |
| 375 | Ga0157375_10803846 | 3300013308 | Bacteria | 1089 |
| 376 | Ga0157375_11010822 | 3300013308 | Bacteria | 971 |
| 377 | Ga0157375_11605608 | 3300013308 | Bacteria | 769 |
| 378 | Ga0157375_12973672 | 3300013308 | Bacteria | 566 |
| 379 | Ga0163163_10289466 | 3300014325 | Bacteria | 1690 |
| 380 | Ga0163163_10353639 | 3300014325 | Bacteria | 1525 |
| 381 | Ga0163163_10358006 | 3300014325 | Bacteria | 1516 |
| 382 | Ga0157380_10188246 | 3300014326 | Bacteria | 1820 |
| 383 | Ga0157380_10217327 | 3300014326 | Bacteria | 1708 |
| 384 | Ga0157380_12532236 | 3300014326 | Bacteria | 579 |
| 385 | Ga0182008_10109608 | 3300014497 | Bacteria | 1368 |
| 386 | Ga0182008_10182788 | 3300014497 | Bacteria | 1061 |
| 387 | Ga0182008_10449875 | 3300014497 | Bacteria | 700 |
| 388 | Ga0182008_10467990 | 3300014497 | Bacteria | 688 |
| 389 | Ga0182008_10481325 | 3300014497 | Bacteria | 680 |
| 390 | Ga0182008_10542372 | 3300014497 | Bacteria | 645 |
| 391 | Ga0182008_10779233 | 3300014497 | Bacteria | 553 |
| 392 | Ga0157377_10065212 | 3300014745 | Bacteria | 2091 |
| 393 | Ga0157377_10116083 | 3300014745 | Bacteria | 1616 |
| 394 | Ga0157379_10214339 | 3300014968 | Bacteria | 1744 |
| 395 | Ga0157379_10537179 | 3300014968 | Bacteria | 1087 |
| 396 | Ga0157379_10772597 | 3300014968 | Bacteria | 905 |
| 397 | Ga0157379_11696340 | 3300014968 | Bacteria | 619 |
| 398 | Ga0157376_10339974 | 3300014969 | Bacteria | 1433 |
| 399 | Ga0157376_10485766 | 3300014969 | Bacteria | 1211 |
| 400 | Ga0157376_10989796 | 3300014969 | Bacteria | 863 |
| 401 | Ga0157376_11306218 | 3300014969 | Bacteria | 756 |
| 402 | Ga0182006_1015493 | 3300015261 | Bacteria | 3268 |
| 403 | Ga0182007_10026946 | 3300015262 | Bacteria | 1986 |
| 404 | Ga0182007_10058360 | 3300015262 | Bacteria | 1266 |
| 405 | Ga0182007_10068174 | 3300015262 | Bacteria | 1166 |
| 406 | Ga0182005_1020653 | 3300015265 | Bacteria | 1811 |
| 407 | Ga0182005_1098920 | 3300015265 | Bacteria | 816 |
| 408 | Ga0163161_10139333 | 3300017792 | Bacteria | 1836 |
| 409 | Ga0163161_10559063 | 3300017792 | Bacteria | 939 |
| 410 | Ga0163161_10952873 | 3300017792 | Bacteria | 730 |
| 411 | Ga0163161_11244958 | 3300017792 | Bacteria | 645 |
| 412 | Ga0163161_11781990 | 3300017792 | Bacteria | 547 |
| 413 | Ga0213871_10228380 | 3300021441 | Bacteria | 587 |
| 414 | Ga0224572_1038675 | 3300024225 | Bacteria | 901 |
| 415 | Ga0228598_1037682 | 3300024227 | Bacteria | 953 |
| 416 | Ga0207656_10081982 | 3300025321 | Bacteria | 1451 |
| 417 | Ga0207656_10091229 | 3300025321 | Bacteria | 1383 |
| 418 | Ga0207656_10225329 | 3300025321 | Bacteria | 912 |
| 419 | Ga0207653_10101679 | 3300025885 | Bacteria | 1017 |
| 420 | Ga0207682_10017510 | 3300025893 | Bacteria | 2799 |
| 421 | Ga0207682_10387834 | 3300025893 | Bacteria | 660 |
| 422 | Ga0207692_10356251 | 3300025898 | Bacteria | 903 |
| 423 | Ga0207642_10054106 | 3300025899 | Bacteria | 1829 |
| 424 | Ga0207642_10173014 | 3300025899 | Bacteria | 1170 |
| 425 | Ga0207642_10307922 | 3300025899 | Bacteria | 921 |
| 426 | Ga0207642_10702610 | 3300025899 | Bacteria | 637 |
| 427 | Ga0207710_10064417 | 3300025900 | Bacteria | 1669 |
| 428 | Ga0207710_10082212 | 3300025900 | Bacteria | 1496 |
| 429 | Ga0207710_10432951 | 3300025900 | Bacteria | 678 |
| 430 | Ga0207688_10046979 | 3300025901 | Bacteria | 2411 |
| 431 | Ga0207688_10196745 | 3300025901 | Bacteria | 1207 |
| 432 | Ga0207688_10976130 | 3300025901 | Bacteria | 536 |
| 433 | Ga0207688_11058623 | 3300025901 | Bacteria | 512 |
| 434 | Ga0207680_10111807 | 3300025903 | Bacteria | 1773 |
| 435 | Ga0207680_10355676 | 3300025903 | Bacteria | 1029 |
| 436 | Ga0207680_10397833 | 3300025903 | Bacteria | 973 |
| 437 | Ga0207680_10454225 | 3300025903 | Bacteria | 910 |
| 438 | Ga0207680_10469876 | 3300025903 | Bacteria | 894 |
| 439 | Ga0207647_10107570 | 3300025904 | Bacteria | 1650 |
| 440 | Ga0207647_10168644 | 3300025904 | Bacteria | 1275 |
| 441 | Ga0207647_10241107 | 3300025904 | Bacteria | 1038 |
| 442 | Ga0207699_10146902 | 3300025906 | Bacteria | 1555 |
| 443 | Ga0207699_10157876 | 3300025906 | Bacteria | 1507 |
| 444 | Ga0207699_11223633 | 3300025906 | Bacteria | 556 |
| 445 | Ga0207699_11337724 | 3300025906 | Bacteria | 530 |
| 446 | Ga0207645_10114813 | 3300025907 | Bacteria | 1745 |
| 447 | Ga0207645_10355727 | 3300025907 | Bacteria | 980 |
| 448 | Ga0207643_10042725 | 3300025908 | Bacteria | 2556 |
| 449 | Ga0207643_10049055 | 3300025908 | Bacteria | 2392 |
| 450 | Ga0207643_10390288 | 3300025908 | Bacteria | 879 |
| 451 | Ga0207705_11009052 | 3300025909 | Bacteria | 643 |
| 452 | Ga0207684_10110516 | 3300025910 | Bacteria | 2352 |
| 453 | Ga0207684_11095854 | 3300025910 | Bacteria | 663 |
| 454 | Ga0207654_10297845 | 3300025911 | Bacteria | 1096 |
| 455 | Ga0207654_11020141 | 3300025911 | Bacteria | 602 |
| 456 | Ga0207654_11353230 | 3300025911 | Bacteria | 519 |
| 457 | Ga0207695_10162110 | 3300025913 | Bacteria | 2167 |
| 458 | Ga0207695_10339216 | 3300025913 | Bacteria | 1391 |
| 459 | Ga0207695_10750367 | 3300025913 | Bacteria | 856 |
| 460 | Ga0207671_10232424 | 3300025914 | Bacteria | 1447 |
| 461 | Ga0207671_10244928 | 3300025914 | Bacteria | 1409 |
| 462 | Ga0207671_11080835 | 3300025914 | Bacteria | 631 |
| 463 | Ga0207693_10455965 | 3300025915 | Bacteria | 999 |
| 464 | Ga0207693_10589718 | 3300025915 | Bacteria | 865 |
| 465 | Ga0207663_10101214 | 3300025916 | Bacteria | 1936 |
| 466 | Ga0207660_10371392 | 3300025917 | Bacteria | 1149 |
| 467 | Ga0207662_10100932 | 3300025918 | Bacteria | 1788 |
| 468 | Ga0207657_10178365 | 3300025919 | Bacteria | 1718 |
| 469 | Ga0207657_10509141 | 3300025919 | Bacteria | 943 |
| 470 | Ga0207657_10532591 | 3300025919 | Bacteria | 919 |
| 471 | Ga0207649_10200251 | 3300025920 | Bacteria | 1410 |
| 472 | Ga0207649_11553419 | 3300025920 | Bacteria | 524 |
| 473 | Ga0207652_11074155 | 3300025921 | Bacteria | 705 |
| 474 | Ga0207646_10000010 | 3300025922 | Bacteria | 421163 |
| 475 | Ga0207646_10111221 | 3300025922 | Bacteria | 2458 |
| 476 | Ga0207681_10217254 | 3300025923 | Bacteria | 1477 |
| 477 | Ga0207681_10254438 | 3300025923 | Bacteria | 1372 |
| 478 | Ga0207681_11075510 | 3300025923 | Bacteria | 675 |
| 479 | Ga0207694_10243254 | 3300025924 | Bacteria | 1471 |
| 480 | Ga0207694_10277948 | 3300025924 | Bacteria | 1375 |
| 481 | Ga0207694_10878373 | 3300025924 | Bacteria | 758 |
| 482 | Ga0207650_10213267 | 3300025925 | Bacteria | 1551 |
| 483 | Ga0207650_10240700 | 3300025925 | Bacteria | 1462 |
| 484 | Ga0207650_10379787 | 3300025925 | Bacteria | 1167 |
| 485 | Ga0207650_10945502 | 3300025925 | Bacteria | 732 |
| 486 | Ga0207659_10123813 | 3300025926 | Bacteria | 1985 |
| 487 | Ga0207659_10272209 | 3300025926 | Bacteria | 1382 |
| 488 | Ga0207659_10455781 | 3300025926 | Bacteria | 1078 |
| 489 | Ga0207659_10853706 | 3300025926 | Bacteria | 783 |
| 490 | Ga0207659_11612928 | 3300025926 | Bacteria | 554 |
| 491 | Ga0207687_10213942 | 3300025927 | Bacteria | 1514 |
| 492 | Ga0207687_10234457 | 3300025927 | Bacteria | 1451 |
| 493 | Ga0207687_10237886 | 3300025927 | Bacteria | 1442 |
| 494 | Ga0207700_10295475 | 3300025928 | Bacteria | 1397 |
| 495 | Ga0207700_10955295 | 3300025928 | Bacteria | 767 |
| 496 | Ga0207664_10298280 | 3300025929 | Bacteria | 1417 |
| 497 | Ga0207664_11422812 | 3300025929 | Bacteria | 614 |
| 498 | Ga0207644_10531145 | 3300025931 | Bacteria | 972 |
| 499 | Ga0207644_11061382 | 3300025931 | Bacteria | 680 |
| 500 | Ga0207644_11831820 | 3300025931 | Bacteria | 508 |
| 501 | Ga0207690_10060871 | 3300025932 | Bacteria | 2564 |
| 502 | Ga0207690_10152133 | 3300025932 | Bacteria | 1716 |
| 503 | Ga0207690_10380600 | 3300025932 | Bacteria | 1121 |
| 504 | Ga0207690_10902205 | 3300025932 | Bacteria | 733 |
| 505 | Ga0207706_10053328 | 3300025933 | Bacteria | 3570 |
| 506 | Ga0207706_10098511 | 3300025933 | Bacteria | 2572 |
| 507 | Ga0207706_10127007 | 3300025933 | Bacteria | 2243 |
| 508 | Ga0207686_10133748 | 3300025934 | Bacteria | 1704 |
| 509 | Ga0207686_10525984 | 3300025934 | Bacteria | 921 |
| 510 | Ga0207686_11397339 | 3300025934 | Bacteria | 576 |
| 511 | Ga0207709_10155549 | 3300025935 | Bacteria | 1589 |
| 512 | Ga0207709_10172260 | 3300025935 | Bacteria | 1520 |
| 513 | Ga0207709_10302636 | 3300025935 | Bacteria | 1190 |
| 514 | Ga0207709_11223009 | 3300025935 | Bacteria | 619 |
| 515 | Ga0207670_10219292 | 3300025936 | Bacteria | 1455 |
| 516 | Ga0207670_10220529 | 3300025936 | Bacteria | 1451 |
| 517 | Ga0207669_10147814 | 3300025937 | Bacteria | 1641 |
| 518 | Ga0207669_10177678 | 3300025937 | Bacteria | 1522 |
| 519 | Ga0207669_10181141 | 3300025937 | Bacteria | 1510 |
| 520 | Ga0207669_10224014 | 3300025937 | Bacteria | 1382 |
| 521 | Ga0207669_10455505 | 3300025937 | Bacteria | 1015 |
| 522 | Ga0207704_10181517 | 3300025938 | Bacteria | 1521 |
| 523 | Ga0207704_10200535 | 3300025938 | Bacteria | 1460 |
| 524 | Ga0207704_10203473 | 3300025938 | Bacteria | 1451 |
| 525 | Ga0207665_10891101 | 3300025939 | Bacteria | 705 |
| 526 | Ga0207691_10226247 | 3300025940 | Bacteria | 1621 |
| 527 | Ga0207691_10420151 | 3300025940 | Bacteria | 1139 |
| 528 | Ga0207691_10473945 | 3300025940 | Bacteria | 1064 |
| 529 | Ga0207691_10933339 | 3300025940 | Bacteria | 726 |
| 530 | Ga0207691_11001011 | 3300025940 | Bacteria | 697 |
| 531 | Ga0207711_10139662 | 3300025941 | Bacteria | 2179 |
| 532 | Ga0207711_10203365 | 3300025941 | Bacteria | 1808 |
| 533 | Ga0207711_11720593 | 3300025941 | Bacteria | 570 |
| 534 | Ga0207689_10188350 | 3300025942 | Bacteria | 1702 |
| 535 | Ga0207689_10535867 | 3300025942 | Bacteria | 983 |
| 536 | Ga0207661_10202280 | 3300025944 | Bacteria | 1746 |
| 537 | Ga0207661_10207634 | 3300025944 | Bacteria | 1725 |
| 538 | Ga0207661_10306152 | 3300025944 | Bacteria | 1425 |
| 539 | Ga0207679_10135595 | 3300025945 | Bacteria | 1982 |
| 540 | Ga0207679_10587599 | 3300025945 | Bacteria | 1002 |
| 541 | Ga0207679_10657283 | 3300025945 | Bacteria | 948 |
| 542 | Ga0207679_11568214 | 3300025945 | Bacteria | 604 |
| 543 | Ga0207667_10331701 | 3300025949 | Bacteria | 1553 |
| 544 | Ga0207651_10204576 | 3300025960 | Bacteria | 1585 |
| 545 | Ga0207651_10229638 | 3300025960 | Bacteria | 1505 |
| 546 | Ga0207651_10885256 | 3300025960 | Bacteria | 795 |
| 547 | Ga0207651_11055095 | 3300025960 | Bacteria | 727 |
| 548 | Ga0207651_11425939 | 3300025960 | Bacteria | 623 |
| 549 | Ga0207712_10225239 | 3300025961 | Bacteria | 1502 |
| 550 | Ga0207712_10261959 | 3300025961 | Bacteria | 1403 |
| 551 | Ga0207712_11187219 | 3300025961 | Bacteria | 681 |
| 552 | Ga0207668_10267678 | 3300025972 | Bacteria | 1395 |
| 553 | Ga0207668_10756586 | 3300025972 | Bacteria | 857 |
| 554 | Ga0207640_10199591 | 3300025981 | Bacteria | 1515 |
| 555 | Ga0207640_10244083 | 3300025981 | Bacteria | 1390 |
| 556 | Ga0207640_11271419 | 3300025981 | Bacteria | 656 |
| 557 | Ga0207658_10062311 | 3300025986 | Bacteria | 2791 |
| 558 | Ga0207658_10387065 | 3300025986 | Bacteria | 1226 |
| 559 | Ga0207658_11154024 | 3300025986 | Bacteria | 708 |
| 560 | Ga0207658_12088053 | 3300025986 | Bacteria | 515 |
| 561 | Ga0207677_10226749 | 3300026023 | Bacteria | 1502 |
| 562 | Ga0207677_10256445 | 3300026023 | Bacteria | 1423 |
| 563 | Ga0207677_10495512 | 3300026023 | Bacteria | 1055 |
| 564 | Ga0207677_10520976 | 3300026023 | Bacteria | 1031 |
| 565 | Ga0207677_11286202 | 3300026023 | Bacteria | 671 |
| 566 | Ga0207677_12140303 | 3300026023 | Bacteria | 520 |
| 567 | Ga0207703_10292311 | 3300026035 | Bacteria | 1483 |
| 568 | Ga0207703_10782549 | 3300026035 | Bacteria | 910 |
| 569 | Ga0207703_11186872 | 3300026035 | Bacteria | 734 |
| 570 | Ga0207703_12106901 | 3300026035 | Bacteria | 540 |
| 571 | Ga0207639_10271863 | 3300026041 | Bacteria | 1487 |
| 572 | Ga0207639_10309285 | 3300026041 | Bacteria | 1399 |
| 573 | Ga0207639_10344918 | 3300026041 | Bacteria | 1328 |
| 574 | Ga0207639_10594077 | 3300026041 | Bacteria | 1020 |
| 575 | Ga0207678_10043671 | 3300026067 | Bacteria | 3878 |
| 576 | Ga0207678_10142125 | 3300026067 | Bacteria | 2048 |
| 577 | Ga0207678_10176721 | 3300026067 | Bacteria | 1823 |
| 578 | Ga0207678_10179906 | 3300026067 | Bacteria | 1806 |
| 579 | Ga0207678_10275835 | 3300026067 | Bacteria | 1442 |
| 580 | Ga0207678_10478187 | 3300026067 | Bacteria | 1085 |
| 581 | Ga0207678_10538138 | 3300026067 | Bacteria | 1021 |
| 582 | Ga0207678_11732579 | 3300026067 | Bacteria | 548 |
| 583 | Ga0207708_10199132 | 3300026075 | Bacteria | 1597 |
| 584 | Ga0207708_10219507 | 3300026075 | Bacteria | 1523 |
| 585 | Ga0207708_10919934 | 3300026075 | Bacteria | 758 |
| 586 | Ga0207702_10277123 | 3300026078 | Bacteria | 1584 |
| 587 | Ga0207702_10351197 | 3300026078 | Bacteria | 1411 |
| 588 | Ga0207702_10409422 | 3300026078 | Bacteria | 1309 |
| 589 | Ga0207702_10634515 | 3300026078 | Bacteria | 1050 |
| 590 | Ga0207702_12274285 | 3300026078 | Bacteria | 530 |
| 591 | Ga0207648_10145252 | 3300026089 | Bacteria | 2092 |
| 592 | Ga0207648_10170798 | 3300026089 | Bacteria | 1922 |
| 593 | Ga0207648_10284301 | 3300026089 | Bacteria | 1480 |
| 594 | Ga0207648_10576419 | 3300026089 | Bacteria | 1035 |
| 595 | Ga0207648_10677502 | 3300026089 | Bacteria | 954 |
| 596 | Ga0207648_12270945 | 3300026089 | Bacteria | 503 |
| 597 | Ga0207676_10254430 | 3300026095 | Bacteria | 1582 |
| 598 | Ga0207676_10594191 | 3300026095 | Bacteria | 1062 |
| 599 | Ga0207674_10185122 | 3300026116 | Bacteria | 2033 |
| 600 | Ga0207674_11153920 | 3300026116 | Bacteria | 744 |
| 601 | Ga0207674_11987182 | 3300026116 | Bacteria | 547 |
| 602 | Ga0207675_100184625 | 3300026118 | Bacteria | 1998 |
| 603 | Ga0207675_100295979 | 3300026118 | Bacteria | 1575 |
| 604 | Ga0207675_100297233 | 3300026118 | Bacteria | 1572 |
| 605 | Ga0207683_10053467 | 3300026121 | Bacteria | 3541 |
| 606 | Ga0207683_10187484 | 3300026121 | Bacteria | 1877 |
| 607 | Ga0207683_10203801 | 3300026121 | Bacteria | 1799 |
| 608 | Ga0207683_10249223 | 3300026121 | Bacteria | 1621 |
| 609 | Ga0207683_10269107 | 3300026121 | Bacteria | 1556 |
| 610 | Ga0207683_10678683 | 3300026121 | Bacteria | 955 |
| 611 | Ga0207698_10151177 | 3300026142 | Bacteria | 2015 |
| 612 | Ga0207698_10281204 | 3300026142 | Bacteria | 1539 |
| 613 | Ga0207698_11119658 | 3300026142 | Bacteria | 800 |
| 614 | Ga0207698_11732531 | 3300026142 | Bacteria | 640 |
| 615 | Ga0209973_1055450 | 3300027252 | Bacteria | 603 |
| 616 | Ga0209970_1015752 | 3300027614 | Bacteria | 1259 |
| 617 | Ga0210002_1028915 | 3300027617 | Bacteria | 916 |
| 618 | Ga0209971_1054772 | 3300027682 | Bacteria | 964 |
| 619 | Ga0209966_1034857 | 3300027695 | Bacteria | 1031 |
| 620 | Ga0209998_10029308 | 3300027717 | Bacteria | 1213 |
| 621 | Ga0268266_10141488 | 3300028379 | Bacteria | 2159 |
| 622 | Ga0268266_10311744 | 3300028379 | Bacteria | 1470 |
| 623 | Ga0268265_10268875 | 3300028380 | Bacteria | 1519 |
| 624 | Ga0268265_10950603 | 3300028380 | Bacteria | 846 |
| 625 | Ga0268264_10352046 | 3300028381 | Bacteria | 1402 |
| 626 | Ga0265336_10039272 | 3300028666 | Bacteria | 1451 |
| 627 | Ga0265338_10123350 | 3300028800 | Bacteria | 2060 |
| 628 | Ga0265773_1006783 | 3300031018 | Bacteria | 875 |
| 629 | Ga0265332_10195331 | 3300031238 | Bacteria | 842 |
| 630 | Ga0265328_10043793 | 3300031239 | Bacteria | 1646 |
| 631 | Ga0265328_10155588 | 3300031239 | Bacteria | 861 |
| 632 | Ga0265329_10046286 | 3300031242 | Bacteria | 1390 |
| 633 | Ga0265329_10177809 | 3300031242 | Bacteria | 695 |
| 634 | Ga0265331_10068852 | 3300031250 | Bacteria | 1658 |
| 635 | Ga0265327_10011656 | 3300031251 | Bacteria | 6027 |
| 636 | Ga0265327_10085889 | 3300031251 | Bacteria | 1544 |
| 637 | Ga0265327_10090393 | 3300031251 | Bacteria | 1494 |
| 638 | Ga0265327_10092989 | 3300031251 | Bacteria | 1467 |
| 639 | Ga0265316_10581045 | 3300031344 | Bacteria | 796 |
| 640 | Ga0307509_10203355 | 3300031507 | Bacteria | 1814 |
| 641 | Ga0307408_100242339 | 3300031548 | Bacteria | 1482 |
| 642 | Ga0307408_100256302 | 3300031548 | Bacteria | 1445 |
| 643 | Ga0307408_100320976 | 3300031548 | Bacteria | 1304 |
| 644 | Ga0307408_100458320 | 3300031548 | Bacteria | 1107 |
| 645 | Ga0307408_100898549 | 3300031548 | Bacteria | 810 |
| 646 | Ga0307408_101881296 | 3300031548 | Bacteria | 573 |
| 647 | Ga0307408_101902116 | 3300031548 | Bacteria | 570 |
| 648 | Ga0307408_102036602 | 3300031548 | Bacteria | 552 |
| 649 | Ga0265314_10155969 | 3300031711 | Bacteria | 1394 |
| 650 | Ga0265342_10155701 | 3300031712 | Bacteria | 1266 |
| 651 | Ga0307516_10201716 | 3300031730 | Bacteria | 1708 |
| 652 | Ga0307405_10056128 | 3300031731 | Bacteria | 2468 |
| 653 | Ga0307405_10106019 | 3300031731 | Bacteria | 1894 |
| 654 | Ga0307405_10135819 | 3300031731 | Bacteria | 1707 |
| 655 | Ga0307405_10139368 | 3300031731 | Bacteria | 1688 |
| 656 | Ga0307405_10519874 | 3300031731 | Bacteria | 957 |
| 657 | Ga0307405_10605880 | 3300031731 | Bacteria | 894 |
| 658 | Ga0307405_10923846 | 3300031731 | Bacteria | 739 |
| 659 | Ga0307405_11935707 | 3300031731 | Bacteria | 526 |
| 660 | Ga0307405_11959334 | 3300031731 | Bacteria | 523 |
| 661 | Ga0307413_10034385 | 3300031824 | Bacteria | 2896 |
| 662 | Ga0307413_10162488 | 3300031824 | Bacteria | 1570 |
| 663 | Ga0307413_10170641 | 3300031824 | Bacteria | 1539 |
| 664 | Ga0307413_10176981 | 3300031824 | Bacteria | 1516 |
| 665 | Ga0307413_10482180 | 3300031824 | Bacteria | 991 |
| 666 | Ga0307413_10843731 | 3300031824 | Bacteria | 773 |
| 667 | Ga0307413_11769685 | 3300031824 | Bacteria | 552 |
| 668 | Ga0307410_10164312 | 3300031852 | Bacteria | 1666 |
| 669 | Ga0307410_10170043 | 3300031852 | Bacteria | 1641 |
| 670 | Ga0307410_10186729 | 3300031852 | Bacteria | 1573 |
| 671 | Ga0307410_10244362 | 3300031852 | Bacteria | 1392 |
| 672 | Ga0307410_10276123 | 3300031852 | Bacteria | 1316 |
| 673 | Ga0307410_10284624 | 3300031852 | Bacteria | 1298 |
| 674 | Ga0307410_10285707 | 3300031852 | Bacteria | 1296 |
| 675 | Ga0307410_10357583 | 3300031852 | Bacteria | 1168 |
| 676 | Ga0307410_10559862 | 3300031852 | Bacteria | 948 |
| 677 | Ga0307410_10692253 | 3300031852 | Bacteria | 858 |
| 678 | Ga0307410_10807009 | 3300031852 | Bacteria | 798 |
| 679 | Ga0307410_11805059 | 3300031852 | Bacteria | 543 |
| 680 | Ga0307410_12082808 | 3300031852 | Bacteria | 507 |
| 681 | Ga0326468_10003656 | 3300031889 | Bacteria | 1312 |
| 682 | Ga0307406_10035859 | 3300031901 | Bacteria | 3053 |
| 683 | Ga0307406_10109708 | 3300031901 | Bacteria | 1897 |
| 684 | Ga0307406_10120589 | 3300031901 | Bacteria | 1822 |
| 685 | Ga0307406_10152680 | 3300031901 | Bacteria | 1649 |
| 686 | Ga0307406_10282126 | 3300031901 | Bacteria | 1267 |
| 687 | Ga0307406_10332891 | 3300031901 | Bacteria | 1179 |
| 688 | Ga0307406_10397553 | 3300031901 | Bacteria | 1091 |
| 689 | Ga0307406_10407733 | 3300031901 | Bacteria | 1079 |
| 690 | Ga0307406_10722889 | 3300031901 | Bacteria | 833 |
| 691 | Ga0307406_10732327 | 3300031901 | Bacteria | 828 |
| 692 | Ga0307406_10772625 | 3300031901 | Bacteria | 808 |
| 693 | Ga0307406_11283018 | 3300031901 | Bacteria | 638 |
| 694 | Ga0307407_10050611 | 3300031903 | Bacteria | 2377 |
| 695 | Ga0307407_10057762 | 3300031903 | Bacteria | 2252 |
| 696 | Ga0307407_10160094 | 3300031903 | Bacteria | 1472 |
| 697 | Ga0307407_10164153 | 3300031903 | Bacteria | 1456 |
| 698 | Ga0307407_10173505 | 3300031903 | Bacteria | 1422 |
| 699 | Ga0307407_10188913 | 3300031903 | Bacteria | 1371 |
| 700 | Ga0307407_10217999 | 3300031903 | Bacteria | 1288 |
| 701 | Ga0307407_10275224 | 3300031903 | Bacteria | 1163 |
| 702 | Ga0307407_10341972 | 3300031903 | Bacteria | 1057 |
| 703 | Ga0307407_10447749 | 3300031903 | Bacteria | 936 |
| 704 | Ga0307407_10464182 | 3300031903 | Bacteria | 921 |
| 705 | Ga0307407_10506739 | 3300031903 | Bacteria | 886 |
| 706 | Ga0307407_10553657 | 3300031903 | Bacteria | 850 |
| 707 | Ga0307412_10214107 | 3300031911 | Bacteria | 1472 |
| 708 | Ga0307412_10243070 | 3300031911 | Bacteria | 1393 |
| 709 | Ga0307412_10254872 | 3300031911 | Bacteria | 1364 |
| 710 | Ga0307412_10262841 | 3300031911 | Bacteria | 1346 |
| 711 | Ga0307412_10283139 | 3300031911 | Bacteria | 1302 |
| 712 | Ga0307412_10453393 | 3300031911 | Bacteria | 1057 |
| 713 | Ga0307412_10845564 | 3300031911 | Bacteria | 798 |
| 714 | Ga0307412_10987745 | 3300031911 | Bacteria | 743 |
| 715 | Ga0307412_11446072 | 3300031911 | Bacteria | 623 |
| 716 | Ga0307412_11833857 | 3300031911 | Bacteria | 558 |
| 717 | Ga0307412_11913933 | 3300031911 | Bacteria | 547 |
| 718 | Ga0307409_100016294 | 3300031995 | Bacteria | 4912 |
| 719 | Ga0307409_100177755 | 3300031995 | Bacteria | 1880 |
| 720 | Ga0307409_100326307 | 3300031995 | Bacteria | 1438 |
| 721 | Ga0307409_100332343 | 3300031995 | Bacteria | 1426 |
| 722 | Ga0307409_100363674 | 3300031995 | Bacteria | 1369 |
| 723 | Ga0307409_100670502 | 3300031995 | Bacteria | 1033 |
| 724 | Ga0307409_100911980 | 3300031995 | Bacteria | 893 |
| 725 | Ga0307409_100912902 | 3300031995 | Bacteria | 892 |
| 726 | Ga0307409_101517788 | 3300031995 | Bacteria | 697 |
| 727 | Ga0307409_101707470 | 3300031995 | Bacteria | 658 |
| 728 | Ga0307409_101823167 | 3300031995 | Bacteria | 637 |
| 729 | Ga0307409_102199846 | 3300031995 | Bacteria | 581 |
| 730 | Ga0307409_102204510 | 3300031995 | Bacteria | 580 |
| 731 | Ga0307409_102233918 | 3300031995 | Bacteria | 576 |
| 732 | Ga0307416_100161755 | 3300032002 | Bacteria | 2070 |
| 733 | Ga0307416_100449667 | 3300032002 | Bacteria | 1340 |
| 734 | Ga0307416_100507523 | 3300032002 | Bacteria | 1271 |
| 735 | Ga0307416_100614509 | 3300032002 | Bacteria | 1168 |
| 736 | Ga0307416_101611522 | 3300032002 | Bacteria | 754 |
| 737 | Ga0307416_101746597 | 3300032002 | Bacteria | 726 |
| 738 | Ga0307416_101930726 | 3300032002 | Bacteria | 693 |
| 739 | Ga0307416_101978886 | 3300032002 | Bacteria | 685 |
| 740 | Ga0307416_102362689 | 3300032002 | Bacteria | 631 |
| 741 | Ga0307414_10172061 | 3300032004 | Bacteria | 1732 |
| 742 | Ga0307414_10227577 | 3300032004 | Bacteria | 1535 |
| 743 | Ga0307414_10270764 | 3300032004 | Bacteria | 1422 |
| 744 | Ga0307414_10296609 | 3300032004 | Bacteria | 1365 |
| 745 | Ga0307414_10296641 | 3300032004 | Bacteria | 1365 |
| 746 | Ga0307414_10302509 | 3300032004 | Bacteria | 1353 |
| 747 | Ga0307414_10432597 | 3300032004 | Bacteria | 1150 |
| 748 | Ga0307414_10631763 | 3300032004 | Bacteria | 963 |
| 749 | Ga0307414_10804139 | 3300032004 | Bacteria | 857 |
| 750 | Ga0307414_10985288 | 3300032004 | Bacteria | 775 |
| 751 | Ga0307414_11505262 | 3300032004 | Bacteria | 626 |
| 752 | Ga0307414_11544412 | 3300032004 | Bacteria | 618 |
| 753 | Ga0307411_10173278 | 3300032005 | Bacteria | 1629 |
| 754 | Ga0307411_10219035 | 3300032005 | Bacteria | 1475 |
| 755 | Ga0307411_10240599 | 3300032005 | Bacteria | 1416 |
| 756 | Ga0307411_10242739 | 3300032005 | Bacteria | 1411 |
| 757 | Ga0307411_10282615 | 3300032005 | Bacteria | 1321 |
| 758 | Ga0307411_10297611 | 3300032005 | Bacteria | 1292 |
| 759 | Ga0307411_10325187 | 3300032005 | Bacteria | 1243 |
| 760 | Ga0307411_10518169 | 3300032005 | Bacteria | 1011 |
| 761 | Ga0307411_10586649 | 3300032005 | Bacteria | 956 |
| 762 | Ga0307411_10664660 | 3300032005 | Bacteria | 903 |
| 763 | Ga0307411_10676122 | 3300032005 | Bacteria | 896 |
| 764 | Ga0307411_10827564 | 3300032005 | Bacteria | 817 |
| 765 | Ga0307411_10986595 | 3300032005 | Bacteria | 753 |
| 766 | Ga0307411_11819889 | 3300032005 | Bacteria | 565 |
| 767 | Ga0307415_100033076 | 3300032126 | Bacteria | 3353 |
| 768 | Ga0307415_100252173 | 3300032126 | Bacteria | 1434 |
| 769 | Ga0307415_100287559 | 3300032126 | Bacteria | 1355 |
| 770 | Ga0307415_100709674 | 3300032126 | Bacteria | 908 |
| 771 | Ga0307415_101909892 | 3300032126 | Bacteria | 576 |
| 772 | Ga0307507_10617867 | 3300033179 | Bacteria | 556 |
| 773 | Ga0316212_1008725 | 3300033547 | Bacteria | 1456 |
| 774 | Ga0373959_0120477 | 3300034820 | Bacteria | 641 |
| 775 | Ga0373960_0081620 | 3300035121 | Bacteria | 1019 |
| 776 | Ga0373960_0176132 | 3300035121 | Bacteria | 744 |
| 777 | Ga0373955_0235830 | 3300035172 | Bacteria | 1095 |
| 778 | Ga0373931_0607647 | 3300035691 | Bacteria | 715 |
| 779 | Ga0395905_0004335 | 3300037471 | Bacteria | 14779 |
| 780 | Ga0395905_0215474 | 3300037471 | Bacteria | 1798 |
| 781 | Ga0436360_0827082 | 3300039438 | Bacteria | 1812 |
| 782 | Ga0436362_0885107 | 3300039453 | Bacteria | 1685 |
| 783 | Ga0439439_0074473 | 3300041406 | Bacteria | 912 |
| 784 | Ga0439439_0176265 | 3300041406 | Bacteria | 614 |
| 785 | Ga0439447_050517 | 3300041407 | Bacteria | 994 |
| 786 | Ga0439447_098076 | 3300041407 | Bacteria | 673 |
| 787 | Ga0439447_104153 | 3300041407 | Bacteria | 651 |
| 788 | Ga0439461_0080635 | 3300041410 | Bacteria | 768 |
| 789 | Ga0439465_0089234 | 3300041413 | Bacteria | 1053 |
| 790 | Ga0439465_0208334 | 3300041413 | Bacteria | 714 |
| 791 | Ga0439465_0372319 | 3300041413 | Bacteria | 541 |
| 792 | Ga0451798_0300609 | 3300041458 | Bacteria | 649 |
| 793 | Ga0451807_1611986 | 3300041486 | Bacteria | 531 |
| 794 | Ga0451807_2139995 | 3300041486 | Bacteria | 615 |
| 795 | Ga0451847_0954215 | 3300041503 | Bacteria | 537 |
| 796 | Ga0451849_0997460 | 3300041505 | Bacteria | 555 |
| 797 | Ga0451853_2348868 | 3300041512 | Bacteria | 726 |
| 798 | Ga0439431_0038857 | 3300041997 | Bacteria | 1206 |
| 799 | Ga0439431_0148282 | 3300041997 | Bacteria | 666 |
| 800 | Ga0439433_0025404 | 3300041999 | Bacteria | 1338 |
| 801 | Ga0439433_0129048 | 3300041999 | Bacteria | 641 |
| 802 | Ga0439442_079447 | 3300042002 | Bacteria | 701 |
| 803 | Ga0439442_117565 | 3300042002 | Bacteria | 581 |
| 804 | Ga0439445_0042540 | 3300042004 | Bacteria | 1210 |
| 805 | Ga0439448_0053264 | 3300042005 | Bacteria | 1328 |
| 806 | Ga0439448_0205600 | 3300042005 | Bacteria | 691 |
| 807 | Ga0439449_0250156 | 3300042007 | Bacteria | 666 |
| 808 | Ga0439450_030580 | 3300042008 | Bacteria | 1209 |
| 809 | Ga0439455_0010655 | 3300042012 | Bacteria | 2026 |
| 810 | Ga0439456_128430 | 3300042013 | Bacteria | 584 |
| 811 | Ga0439457_023857 | 3300042014 | Bacteria | 1354 |
| 812 | Ga0439463_113819 | 3300042016 | Bacteria | 699 |
| 813 | Ga0450919_021688 | 3300042121 | Bacteria | 726 |
| 814 | Ga0450888_024445 | 3300042126 | Bacteria | 786 |
| 815 | Ga0450892_031132 | 3300042130 | Bacteria | 560 |
| 816 | Ga0450895_007049 | 3300042132 | Bacteria | 927 |
| 817 | Ga0450898_126898 | 3300042134 | Bacteria | 547 |
| 818 | Ga0450907_069682 | 3300042146 | Bacteria | 609 |
| 819 | Ga0439458_0009994 | 3300042157 | Bacteria | 2114 |
| 820 | Ga0439458_0223147 | 3300042157 | Bacteria | 520 |
| 821 | Ga0450908_069932 | 3300042184 | Bacteria | 623 |
| 822 | Ga0439434_0366723 | 3300042435 | Bacteria | 504 |
| 823 | Ga0439435_0315044 | 3300042436 | Bacteria | 538 |
| 824 | Ga0439459_0114233 | 3300042438 | Bacteria | 674 |
| 825 | Ga0439459_0140276 | 3300042438 | Bacteria | 624 |
| 826 | Ga0439464_0179563 | 3300042439 | Bacteria | 670 |
| 827 | Ga0439460_0122903 | 3300042461 | Bacteria | 850 |
| 828 | Ga0450918_030785 | 3300042531 | Bacteria | 948 |
| 829 | Ga0451577_0245817 | 3300042876 | Bacteria | 1619 |
| 830 | Ga0439440_0162322 | 3300042993 | Bacteria | 646 |
| 831 | Ga0453684_0610709 | 3300044712 | Bacteria | 1194 |
| 832 | Ga0495617_023652 | 3300046452 | Bacteria | 2075 |
| 833 | Ga0495627_047391 | 3300046453 | Bacteria | 1303 |
| 834 | Ga0495592_0338017 | 3300046454 | Bacteria | 969 |
| 835 | Ga0495592_0561832 | 3300046454 | Bacteria | 700 |
| 836 | Ga0495603_0012825 | 3300046455 | Bacteria | 5068 |
| 837 | Ga0495603_0221622 | 3300046455 | Bacteria | 1091 |
| 838 | Ga0495603_0536320 | 3300046455 | Bacteria | 670 |
| 839 | Ga0495590_0028057 | 3300046457 | Bacteria | 1974 |
| 840 | Ga0495590_0036034 | 3300046457 | Bacteria | 1726 |
| 841 | Ga0495590_0060800 | 3300046457 | Bacteria | 1323 |
| 842 | Ga0495591_019147 | 3300046458 | Bacteria | 2298 |
| 843 | Ga0495591_030736 | 3300046458 | Bacteria | 1619 |
| 844 | Ga0495591_034555 | 3300046458 | Bacteria | 1486 |
| 845 | Ga0495629_0000263 | 3300046459 | Bacteria | 45659 |
| 846 | Ga0495629_0288340 | 3300046459 | Bacteria | 1125 |
| 847 | Ga0495629_0625564 | 3300046459 | Bacteria | 718 |
| 848 | Ga0495638_0036148 | 3300046460 | Bacteria | 3147 |
| 849 | Ga0495638_0143296 | 3300046460 | Bacteria | 1392 |
| 850 | Ga0495638_0264427 | 3300046460 | Bacteria | 942 |
| 851 | Ga0495651_0205590 | 3300046462 | Bacteria | 1374 |
| 852 | Ga0495651_0968877 | 3300046462 | Bacteria | 517 |
| 853 | Ga0495653_0192224 | 3300046463 | Bacteria | 1391 |
| 854 | Ga0495653_0220409 | 3300046463 | Bacteria | 1275 |
| 855 | Ga0495653_0496351 | 3300046463 | Bacteria | 761 |
| 856 | Ga0495650_0004350 | 3300046471 | Bacteria | 9759 |
| 857 | Ga0495650_0061568 | 3300046471 | Bacteria | 1502 |
| 858 | Ga0495580_0036349 | 3300046472 | Bacteria | 3536 |
| 859 | Ga0495580_0072797 | 3300046472 | Bacteria | 2399 |
| 860 | Ga0495580_0460160 | 3300046472 | Bacteria | 853 |
| 861 | Ga0495580_0569641 | 3300046472 | Bacteria | 750 |
| 862 | Ga0495580_0954730 | 3300046472 | Bacteria | 549 |
| 863 | Ga0495582_0133140 | 3300046473 | Bacteria | 1405 |
| 864 | Ga0495582_0322670 | 3300046473 | Bacteria | 888 |
| 865 | Ga0495605_0082825 | 3300046474 | Bacteria | 1498 |
| 866 | Ga0495605_0149829 | 3300046474 | Bacteria | 1042 |
| 867 | Ga0495605_0187008 | 3300046474 | Bacteria | 908 |
| 868 | Ga0495605_0218427 | 3300046474 | Bacteria | 824 |
| 869 | Ga0495639_0105210 | 3300046475 | Bacteria | 1335 |
| 870 | Ga0495662_0028384 | 3300046476 | Bacteria | 2700 |
| 871 | Ga0495662_0061616 | 3300046476 | Bacteria | 1812 |
| 872 | Ga0495664_0028943 | 3300046477 | Bacteria | 3237 |
| 873 | Ga0495664_0128024 | 3300046477 | Bacteria | 1536 |
| 874 | Ga0495664_0179338 | 3300046477 | Bacteria | 1284 |
| 875 | Ga0495664_0285338 | 3300046477 | Bacteria | 997 |
| 876 | Ga0495584_0291281 | 3300046491 | Bacteria | 829 |
| 877 | Ga0495585_0027127 | 3300046492 | Bacteria | 3270 |
| 878 | Ga0495594_0051879 | 3300046499 | Bacteria | 2257 |
| 879 | Ga0495596_0047802 | 3300046500 | Bacteria | 1678 |
| 880 | Ga0495596_0074587 | 3300046500 | Bacteria | 1317 |
| 881 | Ga0495596_0182214 | 3300046500 | Bacteria | 816 |
| 882 | Ga0495596_0421129 | 3300046500 | Bacteria | 520 |
| 883 | Ga0495607_0100579 | 3300046501 | Bacteria | 1549 |
| 884 | Ga0495607_0102625 | 3300046501 | Bacteria | 1529 |
| 885 | Ga0495607_0119694 | 3300046501 | Bacteria | 1384 |
| 886 | Ga0495583_0030946 | 3300046506 | Bacteria | 2600 |
| 887 | Ga0495583_0197426 | 3300046506 | Bacteria | 818 |
| 888 | Ga0495583_0323698 | 3300046506 | Bacteria | 610 |
| 889 | Ga0495606_0087627 | 3300046507 | Bacteria | 1921 |
| 890 | Ga0495606_0096472 | 3300046507 | Bacteria | 1808 |
| 891 | Ga0495606_0145798 | 3300046507 | Bacteria | 1394 |
| 892 | Ga0495606_0164978 | 3300046507 | Bacteria | 1289 |
| 893 | Ga0495606_0229280 | 3300046507 | Bacteria | 1042 |
| 894 | Ga0495606_0315715 | 3300046507 | Bacteria | 841 |
| 895 | Ga0495606_0385527 | 3300046507 | Bacteria | 734 |
| 896 | Ga0495608_0168574 | 3300046511 | Bacteria | 1389 |
| 897 | Ga0495608_0398850 | 3300046511 | Bacteria | 841 |
| 898 | Ga0495610_0120335 | 3300046512 | Bacteria | 1151 |
| 899 | Ga0495616_0066018 | 3300046513 | Bacteria | 1761 |
| 900 | Ga0495616_0077831 | 3300046513 | Bacteria | 1591 |
| 901 | Ga0495616_0140212 | 3300046513 | Bacteria | 1101 |
| 902 | Ga0495618_0118889 | 3300046514 | Bacteria | 1692 |
| 903 | Ga0495620_0046725 | 3300046515 | Bacteria | 1867 |
| 904 | Ga0495620_0056267 | 3300046515 | Bacteria | 1655 |
| 905 | Ga0495620_0101675 | 3300046515 | Bacteria | 1145 |
| 906 | Ga0495628_0216553 | 3300046516 | Bacteria | 1439 |
| 907 | Ga0495628_0632330 | 3300046516 | Bacteria | 761 |
| 908 | Ga0495630_0171274 | 3300046517 | Bacteria | 1654 |
| 909 | Ga0495630_0266556 | 3300046517 | Bacteria | 1308 |
| 910 | Ga0495630_0275790 | 3300046517 | Bacteria | 1284 |
| 911 | Ga0495631_0027819 | 3300046518 | Bacteria | 2584 |
| 912 | Ga0495631_0055206 | 3300046518 | Bacteria | 1730 |
| 913 | Ga0495631_0079453 | 3300046518 | Bacteria | 1416 |
| 914 | Ga0495631_0203616 | 3300046518 | Bacteria | 846 |
| 915 | Ga0495632_0057041 | 3300046519 | Bacteria | 1907 |
| 916 | Ga0495632_0157143 | 3300046519 | Bacteria | 1049 |
| 917 | Ga0495632_0361299 | 3300046519 | Bacteria | 637 |
| 918 | Ga0495637_0103780 | 3300046520 | Bacteria | 1108 |
| 919 | Ga0495643_0084364 | 3300046522 | Bacteria | 1648 |
| 920 | Ga0495643_0390634 | 3300046522 | Bacteria | 616 |
| 921 | Ga0495644_0046853 | 3300046523 | Bacteria | 1624 |
| 922 | Ga0495644_0096439 | 3300046523 | Bacteria | 1117 |
| 923 | Ga0495648_0102517 | 3300046524 | Bacteria | 1576 |
| 924 | Ga0495648_0113515 | 3300046524 | Bacteria | 1469 |
| 925 | Ga0495663_0027530 | 3300046525 | Bacteria | 1668 |
| 926 | Ga0495663_0106046 | 3300046525 | Bacteria | 930 |
| 927 | Ga0495666_0111630 | 3300046526 | Bacteria | 1283 |
| 928 | Ga0495642_0000545 | 3300046528 | Bacteria | 18971 |
| 929 | Ga0495642_0076620 | 3300046528 | Bacteria | 1404 |
| 930 | Ga0495652_0013910 | 3300046529 | Bacteria | 7234 |
| 931 | Ga0495652_0206402 | 3300046529 | Bacteria | 1487 |
| 932 | Ga0495652_0600733 | 3300046529 | Bacteria | 750 |
| 933 | Ga0495654_0010396 | 3300046530 | Bacteria | 5065 |
| 934 | Ga0495654_0096790 | 3300046530 | Bacteria | 1363 |
| 935 | Ga0495654_0272030 | 3300046530 | Bacteria | 699 |
| 936 | Ga0495665_0000205 | 3300046531 | Bacteria | 30190 |
| 937 | Ga0495665_0120608 | 3300046531 | Bacteria | 1373 |
| 938 | Ga0495665_0342771 | 3300046531 | Bacteria | 761 |
| 939 | Ga0495640_0444051 | 3300046533 | Bacteria | 793 |
| 940 | Ga0495586_0070011 | 3300046535 | Bacteria | 1915 |
| 941 | Ga0495586_0281372 | 3300046535 | Bacteria | 952 |
| 942 | Ga0495586_0536245 | 3300046535 | Bacteria | 675 |
| 943 | Ga0495587_0006183 | 3300046536 | Bacteria | 7814 |
| 944 | Ga0495587_0508950 | 3300046536 | Bacteria | 665 |
| 945 | Ga0495598_0068166 | 3300046537 | Bacteria | 1114 |
| 946 | Ga0495598_0117404 | 3300046537 | Bacteria | 898 |
| 947 | Ga0495609_0127967 | 3300046538 | Bacteria | 1089 |
| 948 | Ga0495609_0213386 | 3300046538 | Bacteria | 803 |
| 949 | Ga0495621_0116707 | 3300046539 | Bacteria | 1028 |
| 950 | Ga0495597_0052004 | 3300046542 | Bacteria | 1804 |
| 951 | Ga0495597_0083149 | 3300046542 | Bacteria | 1367 |
| 952 | Ga0495597_0096101 | 3300046542 | Bacteria | 1253 |
| 953 | Ga0495645_0000514 | 3300046543 | Bacteria | 26695 |
| 954 | Ga0495645_0006429 | 3300046543 | Bacteria | 8153 |
| 955 | Ga0495645_0068334 | 3300046543 | Bacteria | 2565 |
| 956 | Ga0495645_0213537 | 3300046543 | Bacteria | 1301 |
| 957 | Ga0495645_0586054 | 3300046543 | Bacteria | 687 |
| 958 | Ga0495622_0088243 | 3300046557 | Bacteria | 1425 |
| 959 | Ga0495622_0440620 | 3300046557 | Bacteria | 559 |
| 960 | Ga0495633_0076037 | 3300046558 | Bacteria | 1563 |
| 961 | Ga0495667_0034705 | 3300046559 | Bacteria | 3372 |
| 962 | Ga0495656_0070881 | 3300046615 | Bacteria | 1547 |
| 963 | Ga0495656_0091680 | 3300046615 | Bacteria | 1390 |
| 964 | Ga0495656_0724223 | 3300046615 | Bacteria | 536 |
| 965 | Ga0495668_0058835 | 3300046616 | Bacteria | 2120 |
| 966 | Ga0495668_0088168 | 3300046616 | Bacteria | 1701 |
| 967 | Ga0495668_0096759 | 3300046616 | Bacteria | 1615 |
| 968 | Ga0495668_0339228 | 3300046616 | Bacteria | 825 |
| 969 | Ga0495634_0209492 | 3300046642 | Bacteria | 1207 |
| 970 | Ga0495611_0047987 | 3300046648 | Bacteria | 1917 |
| 971 | Ga0495611_0279908 | 3300046648 | Bacteria | 770 |
| 972 | Ga0495625_0393084 | 3300046660 | Bacteria | 868 |
| 973 | Ga0495625_0461688 | 3300046660 | Bacteria | 783 |
| 974 | Ga0495625_0851205 | 3300046660 | Bacteria | 526 |
| 975 | Ga0495635_0025286 | 3300046663 | Bacteria | 4135 |
| 976 | Ga0495635_0178333 | 3300046663 | Bacteria | 1444 |
| 977 | Ga0495635_0198417 | 3300046663 | Bacteria | 1361 |
| 978 | Ga0495661_0090932 | 3300046665 | Bacteria | 1736 |
| 979 | Ga0495661_0106988 | 3300046665 | Bacteria | 1564 |
| 980 | Ga0495661_0383022 | 3300046665 | Bacteria | 686 |
| 981 | Ga0495588_0105933 | 3300046674 | Bacteria | 1479 |
| 982 | Ga0495588_0251651 | 3300046674 | Bacteria | 931 |
| 983 | Ga0495588_0705053 | 3300046674 | Bacteria | 528 |
| 984 | Ga0495657_0145758 | 3300046675 | Bacteria | 1473 |
| 985 | Ga0495599_0497844 | 3300046678 | Bacteria | 717 |
| 986 | Ga0495599_0639301 | 3300046678 | Bacteria | 617 |
| 987 | Ga0495623_0009456 | 3300046679 | Bacteria | 6329 |
| 988 | Ga0495623_0031770 | 3300046679 | Bacteria | 3394 |
| 989 | Ga0495623_0103985 | 3300046679 | Bacteria | 1727 |
| 990 | Ga0495646_0049912 | 3300046680 | Bacteria | 2538 |
| 991 | Ga0495646_0053550 | 3300046680 | Bacteria | 2432 |
| 992 | Ga0495646_0132744 | 3300046680 | Bacteria | 1400 |
| 993 | Ga0495658_0108468 | 3300046683 | Bacteria | 1666 |
| 994 | Ga0495669_0033933 | 3300046684 | Bacteria | 2248 |
| 995 | Ga0495669_0183232 | 3300046684 | Bacteria | 998 |
| 996 | Ga0495669_0342740 | 3300046684 | Bacteria | 722 |
| 997 | Ga0495613_0205297 | 3300046689 | Bacteria | 1387 |
| 998 | Ga0495613_0445761 | 3300046689 | Bacteria | 877 |
| 999 | Ga0495624_0160099 | 3300046690 | Bacteria | 1375 |
| 1000 | Ga0495624_0350034 | 3300046690 | Bacteria | 888 |
| 1001 | Ga0495670_0093433 | 3300046691 | Bacteria | 1541 |
| 1002 | Ga0495670_0108275 | 3300046691 | Bacteria | 1436 |
| 1003 | Ga0495670_0167384 | 3300046691 | Bacteria | 1157 |
| 1004 | Ga0495671_0077149 | 3300046692 | Bacteria | 1633 |
| 1005 | Ga0495671_0179492 | 3300046692 | Bacteria | 1028 |
| 1006 | Ga0495649_0017123 | 3300046694 | Bacteria | 4095 |
| 1007 | Ga0495649_0091568 | 3300046694 | Bacteria | 1620 |
| 1008 | Ga0495649_0125289 | 3300046694 | Bacteria | 1357 |
| 1009 | Ga0495649_0437015 | 3300046694 | Bacteria | 654 |
| 1010 | Ga0495589_0023413 | 3300046794 | Bacteria | 3147 |
| 1011 | Ga0495589_0065478 | 3300046794 | Bacteria | 1781 |
| 1012 | Ga0495589_0109860 | 3300046794 | Bacteria | 1331 |
| 1013 | Ga0495600_0049909 | 3300046809 | Bacteria | 2730 |
| 1014 | Ga0495660_0146966 | 3300046810 | Bacteria | 1167 |
| 1015 | Ga0495660_0292446 | 3300046810 | Bacteria | 741 |
| 1016 | Ga0495581_0023720 | 3300047315 | Bacteria | 3554 |
| 1017 | Ga0495581_0139362 | 3300047315 | Bacteria | 1414 |
| 1018 | Ga0495581_0244168 | 3300047315 | Bacteria | 1050 |
| 1019 | Ga0495581_0865919 | 3300047315 | Bacteria | 517 |
| 1020 | Ga0495604_0190254 | 3300047317 | Bacteria | 1430 |
| 1021 | Ga0495604_0750047 | 3300047317 | Bacteria | 617 |
| 1022 | Ga0495636_0147336 | 3300047318 | Bacteria | 1054 |
| 1023 | Ga0495636_0235159 | 3300047318 | Bacteria | 844 |
| 1024 | Ga0495636_0270133 | 3300047318 | Bacteria | 790 |
| 1025 | Ga0495674_0034103 | 3300047319 | Bacteria | 4605 |
| 1026 | Ga0495674_0451764 | 3300047319 | Bacteria | 1032 |
| 1027 | Ga0495674_0496515 | 3300047319 | Bacteria | 976 |
| 1028 | Ga0495674_0752002 | 3300047319 | Bacteria | 761 |
| 1029 | Ga0495672_0074202 | 3300047320 | Bacteria | 1916 |
| 1030 | Ga0495672_0145530 | 3300047320 | Bacteria | 1233 |
| 1031 | Ga0495672_0153322 | 3300047320 | Bacteria | 1193 |
| 1032 | Ga0495672_0206298 | 3300047320 | Bacteria | 979 |
| 1033 | Ga0495672_0407090 | 3300047320 | Bacteria | 621 |
| 1034 | Ga0495676_0646415 | 3300047321 | Bacteria | 686 |
| 1035 | Ga0495680_0128592 | 3300047322 | Bacteria | 1863 |
| 1036 | Ga0495680_0267210 | 3300047322 | Bacteria | 1208 |
| 1037 | Ga0495680_0873886 | 3300047322 | Bacteria | 582 |
| 1038 | Ga0495683_0003370 | 3300047323 | Bacteria | 9335 |
| 1039 | Ga0495683_0013555 | 3300047323 | Bacteria | 4260 |
| 1040 | Ga0495683_0063048 | 3300047323 | Bacteria | 1832 |
| 1041 | Ga0495683_0070920 | 3300047323 | Bacteria | 1710 |
| 1042 | Ga0495683_0143651 | 3300047323 | Bacteria | 1116 |
| 1043 | Ga0495683_0265195 | 3300047323 | Bacteria | 749 |
| 1044 | Ga0495687_000170 | 3300047443 | Bacteria | 96886 |
| 1045 | Ga0495687_030716 | 3300047443 | Bacteria | 2472 |
| 1046 | Ga0495675_0059584 | 3300047444 | Bacteria | 2420 |
| 1047 | Ga0495675_0124642 | 3300047444 | Bacteria | 1603 |
| 1048 | Ga0495675_0316623 | 3300047444 | Bacteria | 924 |
| 1049 | Ga0495677_0060175 | 3300047445 | Bacteria | 1407 |
| 1050 | Ga0495677_0121765 | 3300047445 | Bacteria | 995 |
| 1051 | Ga0495679_045178 | 3300047446 | Bacteria | 1346 |
| 1052 | Ga0495679_109404 | 3300047446 | Bacteria | 761 |
| 1053 | Ga0495685_020734 | 3300047447 | Bacteria | 2259 |
| 1054 | Ga0495685_033094 | 3300047447 | Bacteria | 1776 |
| 1055 | Ga0495685_043158 | 3300047447 | Bacteria | 1539 |
| 1056 | Ga0495685_055435 | 3300047447 | Bacteria | 1340 |
| 1057 | Ga0495673_0053034 | 3300047469 | Bacteria | 1770 |
| 1058 | Ga0495673_0116088 | 3300047469 | Bacteria | 1064 |
| 1059 | Ga0495673_0179610 | 3300047469 | Bacteria | 802 |
| 1060 | Ga0495681_0016946 | 3300047470 | Bacteria | 4063 |
| 1061 | Ga0495681_0039069 | 3300047470 | Bacteria | 2320 |
| 1062 | Ga0495681_0071396 | 3300047470 | Bacteria | 1572 |
| 1063 | Ga0495681_0229312 | 3300047470 | Bacteria | 742 |
| 1064 | Ga0495684_0102744 | 3300047471 | Bacteria | 2160 |
| 1065 | Ga0495684_0227413 | 3300047471 | Bacteria | 1365 |
| 1066 | Ga0495686_0430770 | 3300047472 | Bacteria | 703 |
| 1067 | Ga0495593_0015868 | 3300047673 | Bacteria | 4256 |
| 1068 | Ga0495593_0076271 | 3300047673 | Bacteria | 1737 |
| 1069 | Ga0495593_0399219 | 3300047673 | Bacteria | 687 |
| 1070 | Ga0495602_0221394 | 3300048088 | Bacteria | 1428 |
| 1071 | Ga0495602_0261125 | 3300048088 | Bacteria | 1284 |
| 1072 | Ga0495614_0284615 | 3300048089 | Bacteria | 761 |
| 1073 | Ga0495615_0120103 | 3300048090 | Bacteria | 759 |
| 1074 | Ga0495626_0174356 | 3300048091 | Bacteria | 895 |
| 1075 | Ga0495626_0287096 | 3300048091 | Bacteria | 652 |
| 1076 | Ga0496100_0002134 | 3300048903 | Bacteria | 9952 |
| 1077 | Ga0496100_0169411 | 3300048903 | Bacteria | 1571 |
| 1078 | Ga0496100_0310998 | 3300048903 | Bacteria | 1181 |
| 1079 | Ga0496100_0541816 | 3300048903 | Bacteria | 900 |
| 1080 | Ga0496100_0640562 | 3300048903 | Bacteria | 827 |
| 1081 | Ga0496100_0972432 | 3300048903 | Bacteria | 668 |
| 1082 | Ga0496101_0005093 | 3300048904 | Bacteria | 8357 |
| 1083 | Ga0496101_0149019 | 3300048904 | Bacteria | 1788 |
| 1084 | Ga0496101_0538996 | 3300048904 | Bacteria | 923 |
| 1085 | Ga0496101_0910259 | 3300048904 | Bacteria | 692 |
| 1086 | Ga0496102_0127845 | 3300048905 | Bacteria | 2376 |
| 1087 | Ga0496102_0154577 | 3300048905 | Bacteria | 2156 |
| 1088 | Ga0496102_0231774 | 3300048905 | Bacteria | 1741 |
| 1089 | Ga0496102_0333193 | 3300048905 | Bacteria | 1429 |
| 1090 | Ga0496102_1349096 | 3300048905 | Bacteria | 632 |
| 1091 | Ga0496102_1574080 | 3300048905 | Bacteria | 576 |
| 1092 | Ga0496103_0037311 | 3300048906 | Bacteria | 2977 |
| 1093 | Ga0496103_0060967 | 3300048906 | Bacteria | 2345 |
| 1094 | Ga0496103_0172350 | 3300048906 | Bacteria | 1389 |
| 1095 | Ga0496103_0178616 | 3300048906 | Bacteria | 1364 |
| 1096 | Ga0496103_0626407 | 3300048906 | Bacteria | 684 |
| 1097 | Ga0496104_0170608 | 3300048907 | Bacteria | 2086 |
| 1098 | Ga0496104_0206858 | 3300048907 | Bacteria | 1874 |
| 1099 | Ga0496104_0258482 | 3300048907 | Bacteria | 1654 |
| 1100 | Ga0496104_0329188 | 3300048907 | Bacteria | 1441 |
| 1101 | Ga0496104_0346370 | 3300048907 | Bacteria | 1398 |
| 1102 | Ga0496104_1231058 | 3300048907 | Bacteria | 652 |
| 1103 | Ga0496105_0084948 | 3300048908 | Bacteria | 2615 |
| 1104 | Ga0496105_0171028 | 3300048908 | Bacteria | 1781 |
| 1105 | Ga0496105_0263427 | 3300048908 | Bacteria | 1393 |
| 1106 | Ga0496105_0268060 | 3300048908 | Bacteria | 1379 |
| 1107 | Ga0496105_0269192 | 3300048908 | Bacteria | 1376 |
| 1108 | Ga0496105_0277656 | 3300048908 | Bacteria | 1352 |
| 1109 | Ga0496105_0692262 | 3300048908 | Bacteria | 783 |
| 1110 | Ga0496106_0085865 | 3300048909 | Bacteria | 2423 |
| 1111 | Ga0496106_0191748 | 3300048909 | Bacteria | 1625 |
| 1112 | Ga0496106_0380939 | 3300048909 | Bacteria | 1133 |
| 1113 | Ga0496106_0882494 | 3300048909 | Bacteria | 707 |
| 1114 | Ga0496106_1555755 | 3300048909 | Bacteria | 507 |
| 1115 | Ga0496107_0236104 | 3300048910 | Bacteria | 1360 |
| 1116 | Ga0496107_0262240 | 3300048910 | Bacteria | 1286 |
| 1117 | Ga0496107_0303272 | 3300048910 | Bacteria | 1189 |
| 1118 | Ga0496107_0664849 | 3300048910 | Bacteria | 767 |
| 1119 | Ga0496107_0811778 | 3300048910 | Bacteria | 685 |
| 1120 | Ga0496107_0904724 | 3300048910 | Bacteria | 643 |
| 1121 | Ga0496108_0102233 | 3300048911 | Bacteria | 2445 |
| 1122 | Ga0496108_0195500 | 3300048911 | Bacteria | 1754 |
| 1123 | Ga0496108_0216698 | 3300048911 | Bacteria | 1662 |
| 1124 | Ga0496108_0315503 | 3300048911 | Bacteria | 1362 |
| 1125 | Ga0496108_0511718 | 3300048911 | Bacteria | 1048 |
| 1126 | Ga0496108_0902212 | 3300048911 | Bacteria | 758 |
| 1127 | Ga0496108_1124780 | 3300048911 | Bacteria | 666 |
| 1128 | Ga0496109_0103528 | 3300048912 | Bacteria | 2642 |
| 1129 | Ga0496109_0288118 | 3300048912 | Bacteria | 1548 |
| 1130 | Ga0496109_0380318 | 3300048912 | Bacteria | 1334 |
| 1131 | Ga0496109_0419974 | 3300048912 | Bacteria | 1263 |
| 1132 | Ga0496109_0442017 | 3300048912 | Bacteria | 1228 |
| 1133 | Ga0496109_0471412 | 3300048912 | Bacteria | 1185 |
| 1134 | Ga0496109_0755499 | 3300048912 | Bacteria | 910 |
| 1135 | Ga0496109_1548605 | 3300048912 | Bacteria | 598 |
| 1136 | Ga0496110_0251779 | 3300048913 | Bacteria | 1607 |
| 1137 | Ga0496110_0275015 | 3300048913 | Bacteria | 1533 |
| 1138 | Ga0496110_0318118 | 3300048913 | Bacteria | 1417 |
| 1139 | Ga0496110_0947448 | 3300048913 | Bacteria | 767 |
| 1140 | Ga0496110_1159165 | 3300048913 | Bacteria | 681 |
| 1141 | Ga0496110_1532789 | 3300048913 | Bacteria | 576 |
| 1142 | Ga0496111_0209343 | 3300048914 | Bacteria | 1448 |
| 1143 | Ga0496112_0075262 | 3300048915 | Bacteria | 3339 |
| 1144 | Ga0496112_1022967 | 3300048915 | Bacteria | 746 |
| 1145 | Ga0496113_0093666 | 3300048916 | Bacteria | 2319 |
| 1146 | Ga0496113_0110023 | 3300048916 | Bacteria | 2143 |
| 1147 | Ga0496113_0240208 | 3300048916 | Bacteria | 1445 |
| 1148 | Ga0496113_1536318 | 3300048916 | Bacteria | 513 |
| 1149 | Ga0496114_0076167 | 3300048917 | Bacteria | 2827 |
| 1150 | Ga0496114_0125598 | 3300048917 | Bacteria | 2211 |
| 1151 | Ga0496114_0341850 | 3300048917 | Bacteria | 1323 |
| 1152 | Ga0496114_0420956 | 3300048917 | Bacteria | 1183 |
| 1153 | Ga0496114_0689346 | 3300048917 | Bacteria | 896 |
| 1154 | Ga0496114_1109825 | 3300048917 | Bacteria | 676 |
| 1155 | Ga0496114_1337093 | 3300048917 | Bacteria | 604 |
| 1156 | Ga0496115_0167788 | 3300048918 | Bacteria | 1815 |
| 1157 | Ga0496115_1020758 | 3300048918 | Bacteria | 631 |
| 1158 | Ga0496117_0045148 | 3300048920 | Bacteria | 3186 |
| 1159 | Ga0496118_0141973 | 3300048921 | Bacteria | 1520 |
| 1160 | Ga0496119_0110315 | 3300048922 | Bacteria | 1528 |
| 1161 | Ga0496120_0495162 | 3300048923 | Bacteria | 526 |
| 1162 | Ga0496120_0533606 | 3300048923 | Bacteria | 500 |
| 1163 | Ga0496121_0190843 | 3300048924 | Bacteria | 1469 |
| 1164 | Ga0496121_0227811 | 3300048924 | Bacteria | 1307 |
| 1165 | Ga0496124_0491067 | 3300048927 | Bacteria | 826 |
| 1166 | Ga0496125_0088039 | 3300048928 | Bacteria | 2342 |
| 1167 | Ga0496126_0053525 | 3300048929 | Bacteria | 3661 |
| 1168 | Ga0496126_0276733 | 3300048929 | Bacteria | 1391 |
| 1169 | Ga0496126_1165877 | 3300048929 | Bacteria | 568 |
| 1170 | Ga0495678_057059 | 3300049459 | Bacteria | 1481 |
| 1171 | Ga0495678_123896 | 3300049459 | Bacteria | 864 |
| 1172 | Ga0495682_0040152 | 3300049460 | Bacteria | 1716 |
| 1173 | Ga0495682_0045928 | 3300049460 | Bacteria | 1595 |
| 1174 | Ga0495682_0269536 | 3300049460 | Bacteria | 601 |
| 1175 | Ga0501300_002737 | 3300049523 | Bacteria | 2634 |
| 1176 | Ga0501303_066496 | 3300049526 | Bacteria | 503 |
| 1177 | Ga0501198_017318 | 3300049649 | Bacteria | 1121 |
| 1178 | Ga0501199_070109 | 3300049650 | Bacteria | 502 |
| 1179 | Ga0501202_096751 | 3300049652 | Bacteria | 713 |
| 1180 | Ga0501202_206560 | 3300049652 | Bacteria | 539 |
| 1181 | Ga0501206_025272 | 3300049653 | Bacteria | 864 |
| 1182 | Ga0501207_073542 | 3300049654 | Bacteria | 646 |
| 1183 | Ga0501207_132015 | 3300049654 | Bacteria | 526 |
| 1184 | Ga0501208_153166 | 3300049655 | Bacteria | 523 |
| 1185 | Ga0501216_012979 | 3300049660 | Bacteria | 1375 |
| 1186 | Ga0501216_134265 | 3300049660 | Bacteria | 576 |
| 1187 | Ga0501217_173709 | 3300049661 | Bacteria | 657 |
| 1188 | Ga0501223_018734 | 3300049663 | Bacteria | 1361 |
| 1189 | Ga0501224_087071 | 3300049664 | Bacteria | 502 |
| 1190 | Ga0501228_018991 | 3300049666 | Bacteria | 762 |
| 1191 | Ga0501239_003927 | 3300049672 | Bacteria | 1437 |
| 1192 | Ga0501240_006305 | 3300049673 | Bacteria | 1455 |
| 1193 | Ga0501240_103683 | 3300049673 | Bacteria | 549 |
| 1194 | Ga0501242_056705 | 3300049674 | Bacteria | 587 |
| 1195 | Ga0501243_041358 | 3300049675 | Bacteria | 811 |
| 1196 | Ga0501247_022906 | 3300049677 | Bacteria | 820 |
| 1197 | Ga0501248_019538 | 3300049678 | Bacteria | 689 |
| 1198 | Ga0501249_174833 | 3300049679 | Bacteria | 552 |
| 1199 | Ga0501250_036976 | 3300049680 | Bacteria | 701 |
| 1200 | Ga0501251_078707 | 3300049681 | Bacteria | 575 |
| 1201 | Ga0501251_115961 | 3300049681 | Bacteria | 503 |
| 1202 | Ga0501252_034884 | 3300049682 | Bacteria | 710 |
| 1203 | Ga0501253_010244 | 3300049683 | Bacteria | 1405 |
| 1204 | Ga0501255_086591 | 3300049684 | Bacteria | 532 |
| 1205 | Ga0501256_005780 | 3300049685 | Bacteria | 1098 |
| 1206 | Ga0501259_010900 | 3300049688 | Bacteria | 1494 |
| 1207 | Ga0501261_044537 | 3300049690 | Bacteria | 709 |
| 1208 | Ga0501221_058714 | 3300049704 | Bacteria | 885 |
| 1209 | Ga0501225_0073065 | 3300049705 | Bacteria | 977 |
| 1210 | Ga0501225_0263656 | 3300049705 | Bacteria | 571 |
| 1211 | Ga0501241_163082 | 3300049758 | Bacteria | 520 |
| 1212 | Ga0501263_030106 | 3300049760 | Bacteria | 764 |
| 1213 | Ga0501270_006913 | 3300049767 | Bacteria | 1383 |
| 1214 | Ga0501270_134809 | 3300049767 | Bacteria | 550 |
| 1215 | Ga0501272_071852 | 3300049769 | Bacteria | 507 |
| 1216 | Ga0501273_022040 | 3300049770 | Bacteria | 868 |
| 1217 | Ga0501273_060907 | 3300049770 | Bacteria | 595 |
| 1218 | Ga0501275_005373 | 3300049772 | Bacteria | 1228 |
| 1219 | Ga0501279_009351 | 3300049775 | Bacteria | 1312 |
| 1220 | Ga0501279_015333 | 3300049775 | Bacteria | 1061 |
| 1221 | Ga0501283_130070 | 3300049779 | Bacteria | 510 |
| 1222 | Ga0501045_1100666 | 3300049824 | Bacteria | 581 |
| 1223 | Ga0501212_040222 | 3300049851 | Bacteria | 771 |
| 1224 | nmdc:mga07m45_165119_c1 | 3300050496 | Bacteria | 1286 |
| 1225 | nmdc:mga09592_399642_c1 | 3300050508 | Bacteria | 1188 |
| 1226 | nmdc:mga09592_769299_c1 | 3300050508 | Bacteria | 816 |
| 1227 | nmdc:mga0qj67_242353_c1 | 3300050509 | Bacteria | 1463 |
| 1228 | nmdc:mga0qj67_244501_c1 | 3300050509 | Bacteria | 1456 |
| 1229 | nmdc:mga0qj67_296309_c1 | 3300050509 | Bacteria | 1311 |
| 1230 | nmdc:mga0qj67_757627_c1 | 3300050509 | Bacteria | 770 |
| 1231 | nmdc:mga06r32_1032900_c1 | 3300050510 | Bacteria | 773 |
| 1232 | nmdc:mga06r32_1063149_c1 | 3300050510 | Bacteria | 760 |
| 1233 | nmdc:mga06r32_575181_c1 | 3300050510 | Bacteria | 1099 |
| 1234 | nmdc:mga08y16_462029_c1 | 3300050511 | Bacteria | 1294 |
| 1235 | nmdc:mga08y16_825027_c1 | 3300050511 | Bacteria | 918 |
| 1236 | nmdc:mga0rr50_1243187_c1 | 3300050513 | Bacteria | 632 |
| 1237 | Ga0495655_0050320 | 3300053083 | Bacteria | 1100 |
| 1238 | Ga0495655_0246426 | 3300053083 | Bacteria | 599 |
| 1239 | Ga0500608_020766 | 3300053122 | Bacteria | 3024 |
| 1240 | 2512347125 | 2512047030 | Bacteria | 9031815 |
| 1241 | 2512349955 | 2512047030 | Bacteria | 9031815 |
| 1242 | 2514055052 | 2513237166 | Bacteria | 10373764 |
| 1243 | 2516024662 | 2515154189 | Bacteria | 9629850 |
| 1244 | 2753571618 | 2751185846 | Bacteria | 7242164 |
| 1245 | 2753767667 | 2751185897 | Bacteria | 5322941 |
| 1246 | 2792838879 | 2791355137 | Bacteria | 9654227 |
| 1247 | 2842341345 | 2842333319 | Bacteria | 8899485 |
| 1248 | 2842341370 | 2842333319 | Bacteria | 8899485 |
| 1249 | 2842341741 | 2842333319 | Bacteria | 8899485 |
| 1250 | 2842341776 | 2842333319 | Bacteria | 8899485 |
| 1251 | 2869258128 | 2869256925 | Bacteria | 6981691 |
| 1252 | 2900643250 | 2900634093 | Bacteria | 10263517 |
| 1253 | 2900643356 | 2900634093 | Bacteria | 10263517 |
| 1254 | 2902689976 | 2902682994 | Bacteria | 8951596 |
| 1255 | 2904616873 | 2904615490 | Bacteria | 10047340 |
| 1256 | 2946791336 | 2946787523 | Bacteria | 4366789 |
| 1257 | 3004174583 | 3004167301 | Bacteria | 8330599 |
| 1258 | 3004174824 | 3004167301 | Bacteria | 8330599 |
| 1259 | 3004342122 | 3004334049 | Bacteria | 8449246 |
| 1260 | 8004320295 | 8004312739 | Bacteria | 7444653 |
| 1261 | 8016605234 | 8016603502 | Bacteria | 8731218 |
| 1262 | 8016605290 | 8016603502 | Bacteria | 8731218 |
| 1263 | 8016605323 | 8016603502 | Bacteria | 8731218 |
| 1264 | 8016613097 | 8016603502 | Bacteria | 8731218 |
| 1265 | 8016613116 | 8016603502 | Bacteria | 8731218 |
| 1266 | Ga0105244_10446216 | |||
| 1267 | JGI24740J21852_10075385 | |||
| 1268 | JGI24739J22299_10048622 | |||
| 1269 | JGI24737J22298_10043895 | |||
| 1270 | JGI24743J22301_10016746 | |||
| 1271 | JGI24735J21928_10038814 | |||
| 1272 | JGI24750J21931_1033108 | |||
| 1273 | JGI24745J21846_1008427 | |||
| 1274 | JGI24748J21848_1022131 | |||
| 1275 | JGI24738J21930_10031770 | |||
| 1276 | JGI24738J21930_10098169 | |||
| 1277 | JGI24749J21850_1013788 | |||
| 1278 | JGI24744J21845_10065150 | |||
| 1279 | JGI24744J21845_10084576 | |||
| 1280 | JGI24742J22300_10011327 | |||
| 1281 | JGI24751J29686_10020433 | |||
| 1282 | rootL2_10147005 | |||
| 1283 | Ga0007410J51695_1069272 | |||
| 1284 | Ga0007416J51690_1066597 | |||
| 1285 | Ga0070658_10322838 | |||
| 1286 | Ga0070658_10376036 | |||
| 1287 | Ga0070658_10700254 | |||
| 1288 | Ga0070676_10206008 | |||
| 1289 | Ga0070676_10398524 | |||
| 1290 | Ga0070683_100673647 | |||
| 1291 | Ga0070683_100860183 | |||
| 1292 | Ga0070683_101342447 | |||
| 1293 | Ga0070690_100076274 | |||
| 1294 | Ga0070690_100176442 | |||
| 1295 | Ga0070690_100863778 | |||
| 1296 | Ga0070670_100289512 | |||
| 1297 | Ga0070670_100931284 | |||
| 1298 | Ga0070670_101040227 | |||
| 1299 | Ga0070677_10451856 | |||
| 1300 | Ga0068869_100614772 | |||
| 1301 | Ga0068869_101891599 | |||
| 1302 | Ga0070666_10127659 | |||
| 1303 | Ga0070666_10155880 | |||
| 1304 | Ga0070666_10196442 | |||
| 1305 | Ga0070666_10707744 | |||
| 1306 | Ga0070680_100291100 | |||
| 1307 | Ga0070682_100047626 | |||
| 1308 | Ga0070682_100127703 | |||
| 1309 | Ga0070682_100232196 | |||
| 1310 | Ga0070682_100348634 | |||
| 1311 | Ga0068868_100035886 | |||
| 1312 | Ga0068868_100310703 | |||
| 1313 | Ga0068868_100813167 | |||
| 1314 | Ga0068868_101006867 | |||
| 1315 | Ga0068868_101411374 | |||
| 1316 | Ga0068868_101996699 | |||
| 1317 | Ga0070660_100133744 | |||
| 1318 | Ga0070660_100217276 | |||
| 1319 | Ga0070660_100586085 | |||
| 1320 | Ga0070660_100631401 | |||
| 1321 | Ga0070689_100229827 | |||
| 1322 | Ga0070689_100238210 | |||
| 1323 | Ga0070691_10075394 | |||
| 1324 | Ga0070691_10155101 | |||
| 1325 | Ga0070691_10311065 | |||
| 1326 | Ga0070687_100081095 | |||
| 1327 | Ga0070687_100121237 | |||
| 1328 | Ga0070661_100237655 | |||
| 1329 | Ga0070661_100342304 | |||
| 1330 | Ga0070692_10090870 | |||
| 1331 | Ga0070692_10101068 | |||
| 1332 | Ga0070668_100261538 | |||
| 1333 | Ga0070669_100079724 | |||
| 1334 | Ga0070669_100132930 | |||
| 1335 | Ga0070669_100266586 | |||
| 1336 | Ga0070669_100577689 | |||
| 1337 | Ga0070675_100148798 | |||
| 1338 | Ga0070675_100206088 | |||
| 1339 | Ga0070675_100945754 | |||
| 1340 | Ga0070675_102052671 | |||
| 1341 | Ga0070671_100080209 | |||
| 1342 | Ga0070671_100556377 | |||
| 1343 | Ga0070671_101423457 | |||
| 1344 | Ga0070674_100138267 | |||
| 1345 | Ga0070674_100141575 | |||
| 1346 | Ga0070674_100882812 | |||
| 1347 | Ga0070673_100206576 | |||
| 1348 | Ga0070673_100263621 | |||
| 1349 | Ga0070673_100306049 | |||
| 1350 | Ga0070673_100592016 | |||
| 1351 | Ga0070673_102219006 | |||
| 1352 | Ga0070688_100180293 | |||
| 1353 | Ga0070688_100188306 | |||
| 1354 | Ga0070688_101533574 | |||
| 1355 | Ga0070659_100230238 | |||
| 1356 | Ga0070659_100399967 | |||
| 1357 | Ga0070659_101238727 | |||
| 1358 | Ga0070667_100234051 | |||
| 1359 | Ga0070667_100254748 | |||
| 1360 | Ga0070667_100417609 | |||
| 1361 | Ga0070667_101152939 | |||
| 1362 | Ga0070667_101420702 | |||
| 1363 | Ga0070703_10114692 | |||
| 1364 | Ga0070703_10165847 | |||
| 1365 | Ga0070709_10191833 | |||
| 1366 | Ga0070709_10258746 | |||
| 1367 | Ga0070714_100204469 | |||
| 1368 | Ga0070714_100212290 | |||
| 1369 | Ga0070714_101925590 | |||
| 1370 | Ga0070713_100223595 | |||
| 1371 | Ga0070713_100628513 | |||
| 1372 | Ga0070713_101401031 | |||
| 1373 | Ga0070710_11338472 | |||
| 1374 | Ga0070701_10107413 | |||
| 1375 | Ga0070701_10108264 | |||
| 1376 | Ga0070711_100415920 | |||
| 1377 | Ga0070705_100161616 | |||
| 1378 | Ga0070705_100398297 | |||
| 1379 | Ga0070705_100428057 | |||
| 1380 | Ga0070700_100093770 | |||
| 1381 | Ga0070700_100184474 | |||
| 1382 | Ga0070700_101019078 | |||
| 1383 | Ga0070694_100058448 | |||
| 1384 | Ga0070694_100116185 | |||
| 1385 | Ga0070694_100472260 | |||
| 1386 | Ga0070694_100975822 | |||
| 1387 | Ga0070694_101465665 | |||
| 1388 | Ga0070708_100073139 | |||
| 1389 | Ga0070708_101256225 | |||
| 1390 | Ga0070663_100056086 | |||
| 1391 | Ga0070663_100179196 | |||
| 1392 | Ga0070663_100215612 | |||
| 1393 | Ga0070663_100218255 | |||
| 1394 | Ga0070663_100235485 | |||
| 1395 | Ga0070663_100354031 | |||
| 1396 | Ga0070663_100485483 | |||
| 1397 | Ga0070678_100168375 | |||
| 1398 | Ga0070678_100179777 | |||
| 1399 | Ga0070678_100231064 | |||
| 1400 | Ga0070678_100526465 | |||
| 1401 | Ga0070678_100779996 | |||
| 1402 | Ga0070678_101897394 | |||
| 1403 | Ga0070678_102400382 | |||
| 1404 | Ga0070662_100219086 | |||
| 1405 | Ga0070662_100275160 | |||
| 1406 | Ga0070662_100550755 | |||
| 1407 | Ga0070662_100918136 | |||
| 1408 | Ga0070681_11440439 | |||
| 1409 | Ga0068867_100210797 | |||
| 1410 | Ga0068867_100253286 | |||
| 1411 | Ga0068867_102339022 | |||
| 1412 | Ga0070685_10140688 | |||
| 1413 | Ga0070685_10481633 | |||
| 1414 | Ga0070685_10706526 | |||
| 1415 | Ga0070685_10824106 | |||
| 1416 | Ga0070706_100122781 | |||
| 1417 | Ga0070706_100449020 | |||
| 1418 | Ga0070707_100000007 | |||
| 1419 | Ga0070707_101609441 | |||
| 1420 | Ga0070698_100049864 | |||
| 1421 | Ga0070698_100157038 | |||
| 1422 | Ga0070699_100018019 | |||
| 1423 | Ga0070699_100084597 | |||
| 1424 | Ga0070699_100140825 | |||
| 1425 | Ga0070679_101221960 | |||
| 1426 | Ga0070679_101523359 | |||
| 1427 | Ga0070679_101869413 | |||
| 1428 | Ga0070684_100270005 | |||
| 1429 | Ga0070684_100282209 | |||
| 1430 | Ga0070684_100410004 | |||
| 1431 | Ga0070697_100029875 | |||
| 1432 | Ga0070697_100033549 | |||
| 1433 | Ga0068853_100207357 | |||
| 1434 | Ga0068853_100309860 | |||
| 1435 | Ga0068853_100674801 | |||
| 1436 | Ga0070672_100270996 | |||
| 1437 | Ga0070672_100355467 | |||
| 1438 | Ga0070672_100448078 | |||
| 1439 | Ga0070672_100775940 | |||
| 1440 | Ga0070672_101614744 | |||
| 1441 | Ga0070686_100013115 | |||
| 1442 | Ga0070686_100113836 | |||
| 1443 | Ga0070686_100133681 | |||
| 1444 | Ga0070686_100514309 | |||
| 1445 | Ga0070695_100214298 | |||
| 1446 | Ga0070695_101631310 | |||
| 1447 | Ga0070696_100394813 | |||
| 1448 | Ga0070693_100106003 | |||
| 1449 | Ga0070693_100112817 | |||
| 1450 | Ga0070665_100121418 | |||
| 1451 | Ga0070665_100240142 | |||
| 1452 | Ga0070665_100291744 | |||
| 1453 | Ga0070665_101576236 | |||
| 1454 | Ga0070704_100226942 | |||
| 1455 | Ga0068855_100288933 | |||
| 1456 | Ga0068855_102080435 | |||
| 1457 | Ga0070664_100276476 | |||
| 1458 | Ga0070664_100329572 | |||
| 1459 | Ga0070664_101380973 | |||
| 1460 | Ga0068857_100262766 | |||
| 1461 | Ga0068857_100827487 | |||
| 1462 | Ga0068854_100143804 | |||
| 1463 | Ga0068854_100445414 | |||
| 1464 | Ga0068854_100513900 | |||
| 1465 | Ga0068854_101020220 | |||
| 1466 | Ga0068856_100217350 | |||
| 1467 | Ga0068856_100392445 | |||
| 1468 | Ga0068856_100693589 | |||
| 1469 | Ga0068856_101234487 | |||
| 1470 | Ga0070702_100140492 | |||
| 1471 | Ga0070702_100447213 | |||
| 1472 | Ga0070702_100467592 | |||
| 1473 | Ga0070702_100619891 | |||
| 1474 | Ga0068852_100182823 | |||
| 1475 | Ga0068852_100269607 | |||
| 1476 | Ga0068852_100523443 | |||
| 1477 | Ga0068852_100752883 | |||
| 1478 | Ga0068852_101527723 | |||
| 1479 | Ga0068859_100326179 | |||
| 1480 | Ga0068859_101955481 | |||
| 1481 | Ga0068859_102876218 | |||
| 1482 | Ga0068864_100255090 | |||
| 1483 | Ga0068864_100289621 | |||
| 1484 | Ga0068864_100298123 | |||
| 1485 | Ga0068864_101500946 | |||
| 1486 | Ga0068866_10059176 | |||
| 1487 | Ga0068866_10082102 | |||
| 1488 | Ga0068866_10129037 | |||
| 1489 | Ga0068866_10316049 | |||
| 1490 | Ga0068866_10537144 | |||
| 1491 | Ga0068861_100163416 | |||
| 1492 | Ga0068861_100164862 | |||
| 1493 | Ga0068861_102453206 | |||
| 1494 | Ga0068851_10105009 | |||
| 1495 | Ga0068851_10115648 | |||
| 1496 | Ga0068851_10128625 | |||
| 1497 | Ga0068870_10058705 | |||
| 1498 | Ga0068870_10126529 | |||
| 1499 | Ga0068870_10127391 | |||
| 1500 | Ga0068870_10709567 | |||
| 1501 | Ga0068863_100363307 | |||
| 1502 | Ga0068863_100382163 | |||
| 1503 | Ga0068863_101716408 | |||
| 1504 | Ga0068863_102507481 | |||
| 1505 | Ga0068858_100327399 | |||
| 1506 | Ga0068858_100386408 | |||
| 1507 | Ga0068858_101115700 | |||
| 1508 | Ga0068860_100270067 | |||
| 1509 | Ga0068860_100314356 | |||
| 1510 | Ga0068860_100448608 | |||
| 1511 | Ga0068862_100226532 | |||
| 1512 | Ga0068862_100262876 | |||
| 1513 | Ga0070717_10079647 | |||
| 1514 | Ga0070717_10169654 | |||
| 1515 | Ga0070717_10703016 | |||
| 1516 | Ga0075363_100947220 | |||
| 1517 | Ga0075432_10103406 | |||
| 1518 | Ga0075432_10573666 | |||
| 1519 | Ga0070716_100008163 | |||
| 1520 | Ga0070716_100357374 | |||
| 1521 | Ga0070716_100664260 | |||
| 1522 | Ga0070712_100391001 | |||
| 1523 | Ga0075366_10248641 | |||
| 1524 | Ga0097621_100246623 | |||
| 1525 | Ga0097621_100444594 | |||
| 1526 | Ga0097621_100973855 | |||
| 1527 | Ga0068871_100036623 | |||
| 1528 | Ga0068871_100222844 | |||
| 1529 | Ga0068871_100363941 | |||
| 1530 | Ga0068871_100705600 | |||
| 1531 | Ga0075428_101760753 | |||
| 1532 | Ga0075430_100117831 | |||
| 1533 | Ga0075430_101263358 | |||
| 1534 | Ga0075431_100617805 | |||
| 1535 | Ga0075431_100773162 | |||
| 1536 | Ga0075431_101328650 | |||
| 1537 | Ga0075429_100312589 | |||
| 1538 | Ga0075429_100446361 | |||
| 1539 | Ga0068865_100205805 | |||
| 1540 | Ga0068865_100220245 | |||
| 1541 | Ga0068865_100227814 | |||
| 1542 | Ga0068865_100457341 | |||
| 1543 | Ga0068865_100716349 | |||
| 1544 | Ga0097620_100326231 | |||
| 1545 | Ga0097620_101955544 | |||
| 1546 | Ga0097620_102876253 | |||
| 1547 | Ga0075435_100576717 | |||
| 1548 | Ga0105251_10306132 | |||
| 1549 | Ga0105244_10067108 | |||
| 1550 | Ga0105244_10321305 | |||
| 1551 | Ga0105250_10114752 | |||
| 1552 | Ga0105240_10258777 | |||
| 1553 | Ga0105240_10448802 | |||
| 1554 | Ga0105240_11048037 | |||
| 1555 | Ga0111539_10538945 | |||
| 1556 | Ga0111539_12600487 | |||
| 1557 | Ga0105245_10254336 | |||
| 1558 | Ga0105245_10648974 | |||
| 1559 | Ga0105245_10968147 | |||
| 1560 | Ga0105245_11733074 | |||
| 1561 | Ga0105245_12434956 | |||
| 1562 | Ga0105247_10102325 | |||
| 1563 | Ga0105247_10174051 | |||
| 1564 | Ga0105247_10250874 | |||
| 1565 | Ga0105247_10440054 | |||
| 1566 | Ga0105243_10123671 | |||
| 1567 | Ga0105243_10161637 | |||
| 1568 | Ga0105243_10245964 | |||
| 1569 | Ga0105243_10391531 | |||
| 1570 | Ga0105243_10541887 | |||
| 1571 | Ga0105243_12007017 | |||
| 1572 | Ga0105241_10718732 | |||
| 1573 | Ga0105242_10135978 | |||
| 1574 | Ga0105242_10206094 | |||
| 1575 | Ga0105242_10312017 | |||
| 1576 | Ga0105242_10770952 | |||
| 1577 | Ga0105242_13111309 | |||
| 1578 | Ga0105248_10361670 | |||
| 1579 | Ga0105248_10364424 | |||
| 1580 | Ga0105248_10623182 | |||
| 1581 | Ga0105237_10187553 | |||
| 1582 | Ga0105237_10247040 | |||
| 1583 | Ga0105237_10288859 | |||
| 1584 | Ga0105237_10560816 | |||
| 1585 | Ga0105237_10664183 | |||
| 1586 | Ga0105237_11059527 | |||
| 1587 | Ga0105237_11304788 | |||
| 1588 | Ga0105237_11620349 | |||
| 1589 | Ga0105238_10212369 | |||
| 1590 | Ga0105238_10251586 | |||
| 1591 | Ga0105238_10271229 | |||
| 1592 | Ga0105238_10492074 | |||
| 1593 | Ga0105249_10218416 | |||
| 1594 | Ga0105249_10336293 | |||
| 1595 | Ga0105249_11052789 | |||
| 1596 | Ga0105249_11871349 | |||
| 1597 | Ga0105239_10285132 | |||
| 1598 | Ga0105239_10371991 | |||
| 1599 | Ga0105239_10387503 | |||
| 1600 | Ga0105239_12133050 | |||
| 1601 | Ga0105246_10083590 | |||
| 1602 | Ga0105246_10113072 | |||
| 1603 | Ga0105246_10304329 | |||
| 1604 | Ga0105246_11295462 | |||
| 1605 | Ga0105246_11696477 | |||
| 1606 | Ga0157341_1013489 | |||
| 1607 | Ga0157373_10827986 | |||
| 1608 | Ga0157371_10059895 | |||
| 1609 | Ga0157371_10132399 | |||
| 1610 | Ga0157371_10902836 | |||
| 1611 | Ga0157370_10254568 | |||
| 1612 | Ga0157370_11769847 | |||
| 1613 | Ga0157369_10042214 | |||
| 1614 | Ga0157369_10272875 | |||
| 1615 | Ga0157369_11594000 | |||
| 1616 | Ga0157374_10087909 | |||
| 1617 | Ga0157374_10200266 | |||
| 1618 | Ga0157374_10296674 | |||
| 1619 | Ga0157374_10297273 | |||
| 1620 | Ga0157374_10955074 | |||
| 1621 | Ga0157374_12726747 | |||
| 1622 | Ga0157378_10871081 | |||
| 1623 | Ga0157378_11195784 | |||
| 1624 | Ga0157378_13097797 | |||
| 1625 | Ga0163162_10248003 | |||
| 1626 | Ga0163162_10823584 | |||
| 1627 | Ga0163162_10837849 | |||
| 1628 | Ga0163162_10861900 | |||
| 1629 | Ga0163162_10933409 | |||
| 1630 | Ga0163162_11325364 | |||
| 1631 | Ga0163162_11582625 | |||
| 1632 | Ga0163162_12917569 | |||
| 1633 | Ga0157372_10409779 | |||
| 1634 | Ga0157372_11559451 | |||
| 1635 | Ga0157372_12616374 | |||
| 1636 | Ga0157375_10155470 | |||
| 1637 | Ga0157375_10270996 | |||
| 1638 | Ga0157375_10290764 | |||
| 1639 | Ga0157375_10317125 | |||
| 1640 | Ga0157375_10803846 | |||
| 1641 | Ga0157375_11010822 | |||
| 1642 | Ga0157375_11605608 | |||
| 1643 | Ga0157375_12973672 | |||
| 1644 | Ga0163163_10289466 | |||
| 1645 | Ga0163163_10353639 | |||
| 1646 | Ga0163163_10358006 | |||
| 1647 | Ga0157380_10188246 | |||
| 1648 | Ga0157380_10217327 | |||
| 1649 | Ga0157380_12532236 | |||
| 1650 | Ga0182008_10109608 | |||
| 1651 | Ga0182008_10182788 | |||
| 1652 | Ga0182008_10449875 | |||
| 1653 | Ga0182008_10467990 | |||
| 1654 | Ga0182008_10481325 | |||
| 1655 | Ga0182008_10542372 | |||
| 1656 | Ga0182008_10779233 | |||
| 1657 | Ga0157377_10065212 | |||
| 1658 | Ga0157377_10116083 | |||
| 1659 | Ga0157379_10214339 | |||
| 1660 | Ga0157379_10537179 | |||
| 1661 | Ga0157379_10772597 | |||
| 1662 | Ga0157379_11696340 | |||
| 1663 | Ga0157376_10339974 | |||
| 1664 | Ga0157376_10485766 | |||
| 1665 | Ga0157376_10989796 | |||
| 1666 | Ga0157376_11306218 | |||
| 1667 | Ga0182006_1015493 | |||
| 1668 | Ga0182007_10026946 | |||
| 1669 | Ga0182007_10058360 | |||
| 1670 | Ga0182007_10068174 | |||
| 1671 | Ga0182005_1020653 | |||
| 1672 | Ga0182005_1098920 | |||
| 1673 | Ga0163161_10139333 | |||
| 1674 | Ga0163161_10559063 | |||
| 1675 | Ga0163161_10952873 | |||
| 1676 | Ga0163161_11244958 | |||
| 1677 | Ga0163161_11781990 | |||
| 1678 | Ga0213871_10228380 | |||
| 1679 | Ga0224572_1038675 | |||
| 1680 | Ga0228598_1037682 | |||
| 1681 | Ga0207656_10081982 | |||
| 1682 | Ga0207656_10091229 | |||
| 1683 | Ga0207656_10225329 | |||
| 1684 | Ga0207653_10101679 | |||
| 1685 | Ga0207682_10017510 | |||
| 1686 | Ga0207682_10387834 | |||
| 1687 | Ga0207692_10356251 | |||
| 1688 | Ga0207642_10054106 | |||
| 1689 | Ga0207642_10173014 | |||
| 1690 | Ga0207642_10307922 | |||
| 1691 | Ga0207642_10702610 | |||
| 1692 | Ga0207710_10064417 | |||
| 1693 | Ga0207710_10082212 | |||
| 1694 | Ga0207710_10432951 | |||
| 1695 | Ga0207688_10046979 | |||
| 1696 | Ga0207688_10196745 | |||
| 1697 | Ga0207688_10976130 | |||
| 1698 | Ga0207688_11058623 | |||
| 1699 | Ga0207680_10111807 | |||
| 1700 | Ga0207680_10355676 | |||
| 1701 | Ga0207680_10397833 | |||
| 1702 | Ga0207680_10454225 | |||
| 1703 | Ga0207680_10469876 | |||
| 1704 | Ga0207647_10107570 | |||
| 1705 | Ga0207647_10168644 | |||
| 1706 | Ga0207647_10241107 | |||
| 1707 | Ga0207699_10146902 | |||
| 1708 | Ga0207699_10157876 | |||
| 1709 | Ga0207699_11223633 | |||
| 1710 | Ga0207699_11337724 | |||
| 1711 | Ga0207645_10114813 | |||
| 1712 | Ga0207645_10355727 | |||
| 1713 | Ga0207643_10042725 | |||
| 1714 | Ga0207643_10049055 | |||
| 1715 | Ga0207643_10390288 | |||
| 1716 | Ga0207705_11009052 | |||
| 1717 | Ga0207684_10110516 | |||
| 1718 | Ga0207684_11095854 | |||
| 1719 | Ga0207654_10297845 | |||
| 1720 | Ga0207654_11020141 | |||
| 1721 | Ga0207654_11353230 | |||
| 1722 | Ga0207695_10162110 | |||
| 1723 | Ga0207695_10339216 | |||
| 1724 | Ga0207695_10750367 | |||
| 1725 | Ga0207671_10232424 | |||
| 1726 | Ga0207671_10244928 | |||
| 1727 | Ga0207671_11080835 | |||
| 1728 | Ga0207693_10455965 | |||
| 1729 | Ga0207693_10589718 | |||
| 1730 | Ga0207663_10101214 | |||
| 1731 | Ga0207660_10371392 | |||
| 1732 | Ga0207662_10100932 | |||
| 1733 | Ga0207657_10178365 | |||
| 1734 | Ga0207657_10509141 | |||
| 1735 | Ga0207657_10532591 | |||
| 1736 | Ga0207649_10200251 | |||
| 1737 | Ga0207649_11553419 | |||
| 1738 | Ga0207652_11074155 | |||
| 1739 | Ga0207646_10000010 | |||
| 1740 | Ga0207646_10111221 | |||
| 1741 | Ga0207681_10217254 | |||
| 1742 | Ga0207681_10254438 | |||
| 1743 | Ga0207681_11075510 | |||
| 1744 | Ga0207694_10243254 | |||
| 1745 | Ga0207694_10277948 | |||
| 1746 | Ga0207694_10878373 | |||
| 1747 | Ga0207650_10213267 | |||
| 1748 | Ga0207650_10240700 | |||
| 1749 | Ga0207650_10379787 | |||
| 1750 | Ga0207650_10945502 | |||
| 1751 | Ga0207659_10123813 | |||
| 1752 | Ga0207659_10272209 | |||
| 1753 | Ga0207659_10455781 | |||
| 1754 | Ga0207659_10853706 | |||
| 1755 | Ga0207659_11612928 | |||
| 1756 | Ga0207687_10213942 | |||
| 1757 | Ga0207687_10234457 | |||
| 1758 | Ga0207687_10237886 | |||
| 1759 | Ga0207700_10295475 | |||
| 1760 | Ga0207700_10955295 | |||
| 1761 | Ga0207664_10298280 | |||
| 1762 | Ga0207664_11422812 | |||
| 1763 | Ga0207644_10531145 | |||
| 1764 | Ga0207644_11061382 | |||
| 1765 | Ga0207644_11831820 | |||
| 1766 | Ga0207690_10060871 | |||
| 1767 | Ga0207690_10152133 | |||
| 1768 | Ga0207690_10380600 | |||
| 1769 | Ga0207690_10902205 | |||
| 1770 | Ga0207706_10053328 | |||
| 1771 | Ga0207706_10098511 | |||
| 1772 | Ga0207706_10127007 | |||
| 1773 | Ga0207686_10133748 | |||
| 1774 | Ga0207686_10525984 | |||
| 1775 | Ga0207686_11397339 | |||
| 1776 | Ga0207709_10155549 | |||
| 1777 | Ga0207709_10172260 | |||
| 1778 | Ga0207709_10302636 | |||
| 1779 | Ga0207709_11223009 | |||
| 1780 | Ga0207670_10219292 | |||
| 1781 | Ga0207670_10220529 | |||
| 1782 | Ga0207669_10147814 | |||
| 1783 | Ga0207669_10177678 | |||
| 1784 | Ga0207669_10181141 | |||
| 1785 | Ga0207669_10224014 | |||
| 1786 | Ga0207669_10455505 | |||
| 1787 | Ga0207704_10181517 | |||
| 1788 | Ga0207704_10200535 | |||
| 1789 | Ga0207704_10203473 | |||
| 1790 | Ga0207665_10891101 | |||
| 1791 | Ga0207691_10226247 | |||
| 1792 | Ga0207691_10420151 | |||
| 1793 | Ga0207691_10473945 | |||
| 1794 | Ga0207691_10933339 | |||
| 1795 | Ga0207691_11001011 | |||
| 1796 | Ga0207711_10139662 | |||
| 1797 | Ga0207711_10203365 | |||
| 1798 | Ga0207711_11720593 | |||
| 1799 | Ga0207689_10188350 | |||
| 1800 | Ga0207689_10535867 | |||
| 1801 | Ga0207661_10202280 | |||
| 1802 | Ga0207661_10207634 | |||
| 1803 | Ga0207661_10306152 | |||
| 1804 | Ga0207679_10135595 | |||
| 1805 | Ga0207679_10587599 | |||
| 1806 | Ga0207679_10657283 | |||
| 1807 | Ga0207679_11568214 | |||
| 1808 | Ga0207667_10331701 | |||
| 1809 | Ga0207651_10204576 | |||
| 1810 | Ga0207651_10229638 | |||
| 1811 | Ga0207651_10885256 | |||
| 1812 | Ga0207651_11055095 | |||
| 1813 | Ga0207651_11425939 | |||
| 1814 | Ga0207712_10225239 | |||
| 1815 | Ga0207712_10261959 | |||
| 1816 | Ga0207712_11187219 | |||
| 1817 | Ga0207668_10267678 | |||
| 1818 | Ga0207668_10756586 | |||
| 1819 | Ga0207640_10199591 | |||
| 1820 | Ga0207640_10244083 | |||
| 1821 | Ga0207640_11271419 | |||
| 1822 | Ga0207658_10062311 | |||
| 1823 | Ga0207658_10387065 | |||
| 1824 | Ga0207658_11154024 | |||
| 1825 | Ga0207658_12088053 | |||
| 1826 | Ga0207677_10226749 | |||
| 1827 | Ga0207677_10256445 | |||
| 1828 | Ga0207677_10495512 | |||
| 1829 | Ga0207677_10520976 | |||
| 1830 | Ga0207677_11286202 | |||
| 1831 | Ga0207677_12140303 | |||
| 1832 | Ga0207703_10292311 | |||
| 1833 | Ga0207703_10782549 | |||
| 1834 | Ga0207703_11186872 | |||
| 1835 | Ga0207703_12106901 | |||
| 1836 | Ga0207639_10271863 | |||
| 1837 | Ga0207639_10309285 | |||
| 1838 | Ga0207639_10344918 | |||
| 1839 | Ga0207639_10594077 | |||
| 1840 | Ga0207678_10043671 | |||
| 1841 | Ga0207678_10142125 | |||
| 1842 | Ga0207678_10176721 | |||
| 1843 | Ga0207678_10179906 | |||
| 1844 | Ga0207678_10275835 | |||
| 1845 | Ga0207678_10478187 | |||
| 1846 | Ga0207678_10538138 | |||
| 1847 | Ga0207678_11732579 | |||
| 1848 | Ga0207708_10199132 | |||
| 1849 | Ga0207708_10219507 | |||
| 1850 | Ga0207708_10919934 | |||
| 1851 | Ga0207702_10277123 | |||
| 1852 | Ga0207702_10351197 | |||
| 1853 | Ga0207702_10409422 | |||
| 1854 | Ga0207702_10634515 | |||
| 1855 | Ga0207702_12274285 | |||
| 1856 | Ga0207648_10145252 | |||
| 1857 | Ga0207648_10170798 | |||
| 1858 | Ga0207648_10284301 | |||
| 1859 | Ga0207648_10576419 | |||
| 1860 | Ga0207648_10677502 | |||
| 1861 | Ga0207648_12270945 | |||
| 1862 | Ga0207676_10254430 | |||
| 1863 | Ga0207676_10594191 | |||
| 1864 | Ga0207674_10185122 | |||
| 1865 | Ga0207674_11153920 | |||
| 1866 | Ga0207674_11987182 | |||
| 1867 | Ga0207675_100184625 | |||
| 1868 | Ga0207675_100295979 | |||
| 1869 | Ga0207675_100297233 | |||
| 1870 | Ga0207683_10053467 | |||
| 1871 | Ga0207683_10187484 | |||
| 1872 | Ga0207683_10203801 | |||
| 1873 | Ga0207683_10249223 | |||
| 1874 | Ga0207683_10269107 | |||
| 1875 | Ga0207683_10678683 | |||
| 1876 | Ga0207698_10151177 | |||
| 1877 | Ga0207698_10281204 | |||
| 1878 | Ga0207698_11119658 | |||
| 1879 | Ga0207698_11732531 | |||
| 1880 | Ga0209973_1055450 | |||
| 1881 | Ga0209970_1015752 | |||
| 1882 | Ga0210002_1028915 | |||
| 1883 | Ga0209971_1054772 | |||
| 1884 | Ga0209966_1034857 | |||
| 1885 | Ga0209998_10029308 | |||
| 1886 | Ga0268266_10141488 | |||
| 1887 | Ga0268266_10311744 | |||
| 1888 | Ga0268265_10268875 | |||
| 1889 | Ga0268265_10950603 | |||
| 1890 | Ga0268264_10352046 | |||
| 1891 | Ga0265336_10039272 | |||
| 1892 | Ga0265338_10123350 | |||
| 1893 | Ga0265773_1006783 | |||
| 1894 | Ga0265332_10195331 | |||
| 1895 | Ga0265328_10043793 | |||
| 1896 | Ga0265328_10155588 | |||
| 1897 | Ga0265329_10046286 | |||
| 1898 | Ga0265329_10177809 | |||
| 1899 | Ga0265331_10068852 | |||
| 1900 | Ga0265327_10011656 | |||
| 1901 | Ga0265327_10085889 | |||
| 1902 | Ga0265327_10090393 | |||
| 1903 | Ga0265327_10092989 | |||
| 1904 | Ga0265316_10581045 | |||
| 1905 | Ga0307509_10203355 | |||
| 1906 | Ga0307408_100242339 | |||
| 1907 | Ga0307408_100256302 | |||
| 1908 | Ga0307408_100320976 | |||
| 1909 | Ga0307408_100458320 | |||
| 1910 | Ga0307408_100898549 | |||
| 1911 | Ga0307408_101881296 | |||
| 1912 | Ga0307408_101902116 | |||
| 1913 | Ga0307408_102036602 | |||
| 1914 | Ga0265314_10155969 | |||
| 1915 | Ga0265342_10155701 | |||
| 1916 | Ga0307516_10201716 | |||
| 1917 | Ga0307405_10056128 | |||
| 1918 | Ga0307405_10106019 | |||
| 1919 | Ga0307405_10135819 | |||
| 1920 | Ga0307405_10139368 | |||
| 1921 | Ga0307405_10519874 | |||
| 1922 | Ga0307405_10605880 | |||
| 1923 | Ga0307405_10923846 | |||
| 1924 | Ga0307405_11935707 | |||
| 1925 | Ga0307405_11959334 | |||
| 1926 | Ga0307413_10034385 | |||
| 1927 | Ga0307413_10162488 | |||
| 1928 | Ga0307413_10170641 | |||
| 1929 | Ga0307413_10176981 | |||
| 1930 | Ga0307413_10482180 | |||
| 1931 | Ga0307413_10843731 | |||
| 1932 | Ga0307413_11769685 | |||
| 1933 | Ga0307410_10164312 | |||
| 1934 | Ga0307410_10170043 | |||
| 1935 | Ga0307410_10186729 | |||
| 1936 | Ga0307410_10244362 | |||
| 1937 | Ga0307410_10276123 | |||
| 1938 | Ga0307410_10284624 | |||
| 1939 | Ga0307410_10285707 | |||
| 1940 | Ga0307410_10357583 | |||
| 1941 | Ga0307410_10559862 | |||
| 1942 | Ga0307410_10692253 | |||
| 1943 | Ga0307410_10807009 | |||
| 1944 | Ga0307410_11805059 | |||
| 1945 | Ga0307410_12082808 | |||
| 1946 | Ga0326468_10003656 | |||
| 1947 | Ga0307406_10035859 | |||
| 1948 | Ga0307406_10109708 | |||
| 1949 | Ga0307406_10120589 | |||
| 1950 | Ga0307406_10152680 | |||
| 1951 | Ga0307406_10282126 | |||
| 1952 | Ga0307406_10332891 | |||
| 1953 | Ga0307406_10397553 | |||
| 1954 | Ga0307406_10407733 | |||
| 1955 | Ga0307406_10722889 | |||
| 1956 | Ga0307406_10732327 | |||
| 1957 | Ga0307406_10772625 | |||
| 1958 | Ga0307406_11283018 | |||
| 1959 | Ga0307407_10050611 | |||
| 1960 | Ga0307407_10057762 | |||
| 1961 | Ga0307407_10160094 | |||
| 1962 | Ga0307407_10164153 | |||
| 1963 | Ga0307407_10173505 | |||
| 1964 | Ga0307407_10188913 | |||
| 1965 | Ga0307407_10217999 | |||
| 1966 | Ga0307407_10275224 | |||
| 1967 | Ga0307407_10341972 | |||
| 1968 | Ga0307407_10447749 | |||
| 1969 | Ga0307407_10464182 | |||
| 1970 | Ga0307407_10506739 | |||
| 1971 | Ga0307407_10553657 | |||
| 1972 | Ga0307412_10214107 | |||
| 1973 | Ga0307412_10243070 | |||
| 1974 | Ga0307412_10254872 | |||
| 1975 | Ga0307412_10262841 | |||
| 1976 | Ga0307412_10283139 | |||
| 1977 | Ga0307412_10453393 | |||
| 1978 | Ga0307412_10845564 | |||
| 1979 | Ga0307412_10987745 | |||
| 1980 | Ga0307412_11446072 | |||
| 1981 | Ga0307412_11833857 | |||
| 1982 | Ga0307412_11913933 | |||
| 1983 | Ga0307409_100016294 | |||
| 1984 | Ga0307409_100177755 | |||
| 1985 | Ga0307409_100326307 | |||
| 1986 | Ga0307409_100332343 | |||
| 1987 | Ga0307409_100363674 | |||
| 1988 | Ga0307409_100670502 | |||
| 1989 | Ga0307409_100911980 | |||
| 1990 | Ga0307409_100912902 | |||
| 1991 | Ga0307409_101517788 | |||
| 1992 | Ga0307409_101707470 | |||
| 1993 | Ga0307409_101823167 | |||
| 1994 | Ga0307409_102199846 | |||
| 1995 | Ga0307409_102204510 | |||
| 1996 | Ga0307409_102233918 | |||
| 1997 | Ga0307416_100161755 | |||
| 1998 | Ga0307416_100449667 | |||
| 1999 | Ga0307416_100507523 | |||
| 2000 | Ga0307416_100614509 | |||
| 2001 | Ga0307416_101611522 | |||
| 2002 | Ga0307416_101746597 | |||
| 2003 | Ga0307416_101930726 | |||
| 2004 | Ga0307416_101978886 | |||
| 2005 | Ga0307416_102362689 | |||
| 2006 | Ga0307414_10172061 | |||
| 2007 | Ga0307414_10227577 | |||
| 2008 | Ga0307414_10270764 | |||
| 2009 | Ga0307414_10296609 | |||
| 2010 | Ga0307414_10296641 | |||
| 2011 | Ga0307414_10302509 | |||
| 2012 | Ga0307414_10432597 | |||
| 2013 | Ga0307414_10631763 | |||
| 2014 | Ga0307414_10804139 | |||
| 2015 | Ga0307414_10985288 | |||
| 2016 | Ga0307414_11505262 | |||
| 2017 | Ga0307414_11544412 | |||
| 2018 | Ga0307411_10173278 | |||
| 2019 | Ga0307411_10219035 | |||
| 2020 | Ga0307411_10240599 | |||
| 2021 | Ga0307411_10242739 | |||
| 2022 | Ga0307411_10282615 | |||
| 2023 | Ga0307411_10297611 | |||
| 2024 | Ga0307411_10325187 | |||
| 2025 | Ga0307411_10518169 | |||
| 2026 | Ga0307411_10586649 | |||
| 2027 | Ga0307411_10664660 | |||
| 2028 | Ga0307411_10676122 | |||
| 2029 | Ga0307411_10827564 | |||
| 2030 | Ga0307411_10986595 | |||
| 2031 | Ga0307411_11819889 | |||
| 2032 | Ga0307415_100033076 | |||
| 2033 | Ga0307415_100252173 | |||
| 2034 | Ga0307415_100287559 | |||
| 2035 | Ga0307415_100709674 | |||
| 2036 | Ga0307415_101909892 | |||
| 2037 | Ga0307507_10617867 | |||
| 2038 | Ga0316212_1008725 | |||
| 2039 | Ga0373959_0120477 | |||
| 2040 | Ga0373960_0081620 | |||
| 2041 | Ga0373960_0176132 | |||
| 2042 | Ga0373955_0235830 | |||
| 2043 | Ga0373931_0607647 | |||
| 2044 | Ga0395905_0004335 | |||
| 2045 | Ga0395905_0215474 | |||
| 2046 | Ga0436360_0827082 | |||
| 2047 | Ga0436362_0885107 | |||
| 2048 | Ga0439439_0074473 | |||
| 2049 | Ga0439439_0176265 | |||
| 2050 | Ga0439447_050517 | |||
| 2051 | Ga0439447_098076 | |||
| 2052 | Ga0439447_104153 | |||
| 2053 | Ga0439461_0080635 | |||
| 2054 | Ga0439465_0089234 | |||
| 2055 | Ga0439465_0208334 | |||
| 2056 | Ga0439465_0372319 | |||
| 2057 | Ga0451798_0300609 | |||
| 2058 | Ga0451807_1611986 | |||
| 2059 | Ga0451807_2139995 | |||
| 2060 | Ga0451847_0954215 | |||
| 2061 | Ga0451849_0997460 | |||
| 2062 | Ga0451853_2348868 | |||
| 2063 | Ga0439431_0038857 | |||
| 2064 | Ga0439431_0148282 | |||
| 2065 | Ga0439433_0025404 | |||
| 2066 | Ga0439433_0129048 | |||
| 2067 | Ga0439442_079447 | |||
| 2068 | Ga0439442_117565 | |||
| 2069 | Ga0439445_0042540 | |||
| 2070 | Ga0439448_0053264 | |||
| 2071 | Ga0439448_0205600 | |||
| 2072 | Ga0439449_0250156 | |||
| 2073 | Ga0439450_030580 | |||
| 2074 | Ga0439455_0010655 | |||
| 2075 | Ga0439456_128430 | |||
| 2076 | Ga0439457_023857 | |||
| 2077 | Ga0439463_113819 | |||
| 2078 | Ga0450919_021688 | |||
| 2079 | Ga0450888_024445 | |||
| 2080 | Ga0450892_031132 | |||
| 2081 | Ga0450895_007049 | |||
| 2082 | Ga0450898_126898 | |||
| 2083 | Ga0450907_069682 | |||
| 2084 | Ga0439458_0009994 | |||
| 2085 | Ga0439458_0223147 | |||
| 2086 | Ga0450908_069932 | |||
| 2087 | Ga0439434_0366723 | |||
| 2088 | Ga0439435_0315044 | |||
| 2089 | Ga0439459_0114233 | |||
| 2090 | Ga0439459_0140276 | |||
| 2091 | Ga0439464_0179563 | |||
| 2092 | Ga0439460_0122903 | |||
| 2093 | Ga0450918_030785 | |||
| 2094 | Ga0451577_0245817 | |||
| 2095 | Ga0439440_0162322 | |||
| 2096 | Ga0453684_0610709 | |||
| 2097 | Ga0495617_023652 | |||
| 2098 | Ga0495627_047391 | |||
| 2099 | Ga0495592_0338017 | |||
| 2100 | Ga0495592_0561832 | |||
| 2101 | Ga0495603_0012825 | |||
| 2102 | Ga0495603_0221622 | |||
| 2103 | Ga0495603_0536320 | |||
| 2104 | Ga0495590_0028057 | |||
| 2105 | Ga0495590_0036034 | |||
| 2106 | Ga0495590_0060800 | |||
| 2107 | Ga0495591_019147 | |||
| 2108 | Ga0495591_030736 | |||
| 2109 | Ga0495591_034555 | |||
| 2110 | Ga0495629_0000263 | |||
| 2111 | Ga0495629_0288340 | |||
| 2112 | Ga0495629_0625564 | |||
| 2113 | Ga0495638_0036148 | |||
| 2114 | Ga0495638_0143296 | |||
| 2115 | Ga0495638_0264427 | |||
| 2116 | Ga0495651_0205590 | |||
| 2117 | Ga0495651_0968877 | |||
| 2118 | Ga0495653_0192224 | |||
| 2119 | Ga0495653_0220409 | |||
| 2120 | Ga0495653_0496351 | |||
| 2121 | Ga0495650_0004350 | |||
| 2122 | Ga0495650_0061568 | |||
| 2123 | Ga0495580_0036349 | |||
| 2124 | Ga0495580_0072797 | |||
| 2125 | Ga0495580_0460160 | |||
| 2126 | Ga0495580_0569641 | |||
| 2127 | Ga0495580_0954730 | |||
| 2128 | Ga0495582_0133140 | |||
| 2129 | Ga0495582_0322670 | |||
| 2130 | Ga0495605_0082825 | |||
| 2131 | Ga0495605_0149829 | |||
| 2132 | Ga0495605_0187008 | |||
| 2133 | Ga0495605_0218427 | |||
| 2134 | Ga0495639_0105210 | |||
| 2135 | Ga0495662_0028384 | |||
| 2136 | Ga0495662_0061616 | |||
| 2137 | Ga0495664_0028943 | |||
| 2138 | Ga0495664_0128024 | |||
| 2139 | Ga0495664_0179338 | |||
| 2140 | Ga0495664_0285338 | |||
| 2141 | Ga0495584_0291281 | |||
| 2142 | Ga0495585_0027127 | |||
| 2143 | Ga0495594_0051879 | |||
| 2144 | Ga0495596_0047802 | |||
| 2145 | Ga0495596_0074587 | |||
| 2146 | Ga0495596_0182214 | |||
| 2147 | Ga0495596_0421129 | |||
| 2148 | Ga0495607_0100579 | |||
| 2149 | Ga0495607_0102625 | |||
| 2150 | Ga0495607_0119694 | |||
| 2151 | Ga0495583_0030946 | |||
| 2152 | Ga0495583_0197426 | |||
| 2153 | Ga0495583_0323698 | |||
| 2154 | Ga0495606_0087627 | |||
| 2155 | Ga0495606_0096472 | |||
| 2156 | Ga0495606_0145798 | |||
| 2157 | Ga0495606_0164978 | |||
| 2158 | Ga0495606_0229280 | |||
| 2159 | Ga0495606_0315715 | |||
| 2160 | Ga0495606_0385527 | |||
| 2161 | Ga0495608_0168574 | |||
| 2162 | Ga0495608_0398850 | |||
| 2163 | Ga0495610_0120335 | |||
| 2164 | Ga0495616_0066018 | |||
| 2165 | Ga0495616_0077831 | |||
| 2166 | Ga0495616_0140212 | |||
| 2167 | Ga0495618_0118889 | |||
| 2168 | Ga0495620_0046725 | |||
| 2169 | Ga0495620_0056267 | |||
| 2170 | Ga0495620_0101675 | |||
| 2171 | Ga0495628_0216553 | |||
| 2172 | Ga0495628_0632330 | |||
| 2173 | Ga0495630_0171274 | |||
| 2174 | Ga0495630_0266556 | |||
| 2175 | Ga0495630_0275790 | |||
| 2176 | Ga0495631_0027819 | |||
| 2177 | Ga0495631_0055206 | |||
| 2178 | Ga0495631_0079453 | |||
| 2179 | Ga0495631_0203616 | |||
| 2180 | Ga0495632_0057041 | |||
| 2181 | Ga0495632_0157143 | |||
| 2182 | Ga0495632_0361299 | |||
| 2183 | Ga0495637_0103780 | |||
| 2184 | Ga0495643_0084364 | |||
| 2185 | Ga0495643_0390634 | |||
| 2186 | Ga0495644_0046853 | |||
| 2187 | Ga0495644_0096439 | |||
| 2188 | Ga0495648_0102517 | |||
| 2189 | Ga0495648_0113515 | |||
| 2190 | Ga0495663_0027530 | |||
| 2191 | Ga0495663_0106046 | |||
| 2192 | Ga0495666_0111630 | |||
| 2193 | Ga0495642_0000545 | |||
| 2194 | Ga0495642_0076620 | |||
| 2195 | Ga0495652_0013910 | |||
| 2196 | Ga0495652_0206402 | |||
| 2197 | Ga0495652_0600733 | |||
| 2198 | Ga0495654_0010396 | |||
| 2199 | Ga0495654_0096790 | |||
| 2200 | Ga0495654_0272030 | |||
| 2201 | Ga0495665_0000205 | |||
| 2202 | Ga0495665_0120608 | |||
| 2203 | Ga0495665_0342771 | |||
| 2204 | Ga0495640_0444051 | |||
| 2205 | Ga0495586_0070011 | |||
| 2206 | Ga0495586_0281372 | |||
| 2207 | Ga0495586_0536245 | |||
| 2208 | Ga0495587_0006183 | |||
| 2209 | Ga0495587_0508950 | |||
| 2210 | Ga0495598_0068166 | |||
| 2211 | Ga0495598_0117404 | |||
| 2212 | Ga0495609_0127967 | |||
| 2213 | Ga0495609_0213386 | |||
| 2214 | Ga0495621_0116707 | |||
| 2215 | Ga0495597_0052004 | |||
| 2216 | Ga0495597_0083149 | |||
| 2217 | Ga0495597_0096101 | |||
| 2218 | Ga0495645_0000514 | |||
| 2219 | Ga0495645_0006429 | |||
| 2220 | Ga0495645_0068334 | |||
| 2221 | Ga0495645_0213537 | |||
| 2222 | Ga0495645_0586054 | |||
| 2223 | Ga0495622_0088243 | |||
| 2224 | Ga0495622_0440620 | |||
| 2225 | Ga0495633_0076037 | |||
| 2226 | Ga0495667_0034705 | |||
| 2227 | Ga0495656_0070881 | |||
| 2228 | Ga0495656_0091680 | |||
| 2229 | Ga0495656_0724223 | |||
| 2230 | Ga0495668_0058835 | |||
| 2231 | Ga0495668_0088168 | |||
| 2232 | Ga0495668_0096759 | |||
| 2233 | Ga0495668_0339228 | |||
| 2234 | Ga0495634_0209492 | |||
| 2235 | Ga0495611_0047987 | |||
| 2236 | Ga0495611_0279908 | |||
| 2237 | Ga0495625_0393084 | |||
| 2238 | Ga0495625_0461688 | |||
| 2239 | Ga0495625_0851205 | |||
| 2240 | Ga0495635_0025286 | |||
| 2241 | Ga0495635_0178333 | |||
| 2242 | Ga0495635_0198417 | |||
| 2243 | Ga0495661_0090932 | |||
| 2244 | Ga0495661_0106988 | |||
| 2245 | Ga0495661_0383022 | |||
| 2246 | Ga0495588_0105933 | |||
| 2247 | Ga0495588_0251651 | |||
| 2248 | Ga0495588_0705053 | |||
| 2249 | Ga0495657_0145758 | |||
| 2250 | Ga0495599_0497844 | |||
| 2251 | Ga0495599_0639301 | |||
| 2252 | Ga0495623_0009456 | |||
| 2253 | Ga0495623_0031770 | |||
| 2254 | Ga0495623_0103985 | |||
| 2255 | Ga0495646_0049912 | |||
| 2256 | Ga0495646_0053550 | |||
| 2257 | Ga0495646_0132744 | |||
| 2258 | Ga0495658_0108468 | |||
| 2259 | Ga0495669_0033933 | |||
| 2260 | Ga0495669_0183232 | |||
| 2261 | Ga0495669_0342740 | |||
| 2262 | Ga0495613_0205297 | |||
| 2263 | Ga0495613_0445761 | |||
| 2264 | Ga0495624_0160099 | |||
| 2265 | Ga0495624_0350034 | |||
| 2266 | Ga0495670_0093433 | |||
| 2267 | Ga0495670_0108275 | |||
| 2268 | Ga0495670_0167384 | |||
| 2269 | Ga0495671_0077149 | |||
| 2270 | Ga0495671_0179492 | |||
| 2271 | Ga0495649_0017123 | |||
| 2272 | Ga0495649_0091568 | |||
| 2273 | Ga0495649_0125289 | |||
| 2274 | Ga0495649_0437015 | |||
| 2275 | Ga0495589_0023413 | |||
| 2276 | Ga0495589_0065478 | |||
| 2277 | Ga0495589_0109860 | |||
| 2278 | Ga0495600_0049909 | |||
| 2279 | Ga0495660_0146966 | |||
| 2280 | Ga0495660_0292446 | |||
| 2281 | Ga0495581_0023720 | |||
| 2282 | Ga0495581_0139362 | |||
| 2283 | Ga0495581_0244168 | |||
| 2284 | Ga0495581_0865919 | |||
| 2285 | Ga0495604_0190254 | |||
| 2286 | Ga0495604_0750047 | |||
| 2287 | Ga0495636_0147336 | |||
| 2288 | Ga0495636_0235159 | |||
| 2289 | Ga0495636_0270133 | |||
| 2290 | Ga0495674_0034103 | |||
| 2291 | Ga0495674_0451764 | |||
| 2292 | Ga0495674_0496515 | |||
| 2293 | Ga0495674_0752002 | |||
| 2294 | Ga0495672_0074202 | |||
| 2295 | Ga0495672_0145530 | |||
| 2296 | Ga0495672_0153322 | |||
| 2297 | Ga0495672_0206298 | |||
| 2298 | Ga0495672_0407090 | |||
| 2299 | Ga0495676_0646415 | |||
| 2300 | Ga0495680_0128592 | |||
| 2301 | Ga0495680_0267210 | |||
| 2302 | Ga0495680_0873886 | |||
| 2303 | Ga0495683_0003370 | |||
| 2304 | Ga0495683_0013555 | |||
| 2305 | Ga0495683_0063048 | |||
| 2306 | Ga0495683_0070920 | |||
| 2307 | Ga0495683_0143651 | |||
| 2308 | Ga0495683_0265195 | |||
| 2309 | Ga0495687_000170 | |||
| 2310 | Ga0495687_030716 | |||
| 2311 | Ga0495675_0059584 | |||
| 2312 | Ga0495675_0124642 | |||
| 2313 | Ga0495675_0316623 | |||
| 2314 | Ga0495677_0060175 | |||
| 2315 | Ga0495677_0121765 | |||
| 2316 | Ga0495679_045178 | |||
| 2317 | Ga0495679_109404 | |||
| 2318 | Ga0495685_020734 | |||
| 2319 | Ga0495685_033094 | |||
| 2320 | Ga0495685_043158 | |||
| 2321 | Ga0495685_055435 | |||
| 2322 | Ga0495673_0053034 | |||
| 2323 | Ga0495673_0116088 | |||
| 2324 | Ga0495673_0179610 | |||
| 2325 | Ga0495681_0016946 | |||
| 2326 | Ga0495681_0039069 | |||
| 2327 | Ga0495681_0071396 | |||
| 2328 | Ga0495681_0229312 | |||
| 2329 | Ga0495684_0102744 | |||
| 2330 | Ga0495684_0227413 | |||
| 2331 | Ga0495686_0430770 | |||
| 2332 | Ga0495593_0015868 | |||
| 2333 | Ga0495593_0076271 | |||
| 2334 | Ga0495593_0399219 | |||
| 2335 | Ga0495602_0221394 | |||
| 2336 | Ga0495602_0261125 | |||
| 2337 | Ga0495614_0284615 | |||
| 2338 | Ga0495615_0120103 | |||
| 2339 | Ga0495626_0174356 | |||
| 2340 | Ga0495626_0287096 | |||
| 2341 | Ga0496100_0002134 | |||
| 2342 | Ga0496100_0169411 | |||
| 2343 | Ga0496100_0310998 | |||
| 2344 | Ga0496100_0541816 | |||
| 2345 | Ga0496100_0640562 | |||
| 2346 | Ga0496100_0972432 | |||
| 2347 | Ga0496101_0005093 | |||
| 2348 | Ga0496101_0149019 | |||
| 2349 | Ga0496101_0538996 | |||
| 2350 | Ga0496101_0910259 | |||
| 2351 | Ga0496102_0127845 | |||
| 2352 | Ga0496102_0154577 | |||
| 2353 | Ga0496102_0231774 | |||
| 2354 | Ga0496102_0333193 | |||
| 2355 | Ga0496102_1349096 | |||
| 2356 | Ga0496102_1574080 | |||
| 2357 | Ga0496103_0037311 | |||
| 2358 | Ga0496103_0060967 | |||
| 2359 | Ga0496103_0172350 | |||
| 2360 | Ga0496103_0178616 | |||
| 2361 | Ga0496103_0626407 | |||
| 2362 | Ga0496104_0170608 | |||
| 2363 | Ga0496104_0206858 | |||
| 2364 | Ga0496104_0258482 | |||
| 2365 | Ga0496104_0329188 | |||
| 2366 | Ga0496104_0346370 | |||
| 2367 | Ga0496104_1231058 | |||
| 2368 | Ga0496105_0084948 | |||
| 2369 | Ga0496105_0171028 | |||
| 2370 | Ga0496105_0263427 | |||
| 2371 | Ga0496105_0268060 | |||
| 2372 | Ga0496105_0269192 | |||
| 2373 | Ga0496105_0277656 | |||
| 2374 | Ga0496105_0692262 | |||
| 2375 | Ga0496106_0085865 | |||
| 2376 | Ga0496106_0191748 | |||
| 2377 | Ga0496106_0380939 | |||
| 2378 | Ga0496106_0882494 | |||
| 2379 | Ga0496106_1555755 | |||
| 2380 | Ga0496107_0236104 | |||
| 2381 | Ga0496107_0262240 | |||
| 2382 | Ga0496107_0303272 | |||
| 2383 | Ga0496107_0664849 | |||
| 2384 | Ga0496107_0811778 | |||
| 2385 | Ga0496107_0904724 | |||
| 2386 | Ga0496108_0102233 | |||
| 2387 | Ga0496108_0195500 | |||
| 2388 | Ga0496108_0216698 | |||
| 2389 | Ga0496108_0315503 | |||
| 2390 | Ga0496108_0511718 | |||
| 2391 | Ga0496108_0902212 | |||
| 2392 | Ga0496108_1124780 | |||
| 2393 | Ga0496109_0103528 | |||
| 2394 | Ga0496109_0288118 | |||
| 2395 | Ga0496109_0380318 | |||
| 2396 | Ga0496109_0419974 | |||
| 2397 | Ga0496109_0442017 | |||
| 2398 | Ga0496109_0471412 | |||
| 2399 | Ga0496109_0755499 | |||
| 2400 | Ga0496109_1548605 | |||
| 2401 | Ga0496110_0251779 | |||
| 2402 | Ga0496110_0275015 | |||
| 2403 | Ga0496110_0318118 | |||
| 2404 | Ga0496110_0947448 | |||
| 2405 | Ga0496110_1159165 | |||
| 2406 | Ga0496110_1532789 | |||
| 2407 | Ga0496111_0209343 | |||
| 2408 | Ga0496112_0075262 | |||
| 2409 | Ga0496112_1022967 | |||
| 2410 | Ga0496113_0093666 | |||
| 2411 | Ga0496113_0110023 | |||
| 2412 | Ga0496113_0240208 | |||
| 2413 | Ga0496113_1536318 | |||
| 2414 | Ga0496114_0076167 | |||
| 2415 | Ga0496114_0125598 | |||
| 2416 | Ga0496114_0341850 | |||
| 2417 | Ga0496114_0420956 | |||
| 2418 | Ga0496114_0689346 | |||
| 2419 | Ga0496114_1109825 | |||
| 2420 | Ga0496114_1337093 | |||
| 2421 | Ga0496115_0167788 | |||
| 2422 | Ga0496115_1020758 | |||
| 2423 | Ga0496117_0045148 | |||
| 2424 | Ga0496118_0141973 | |||
| 2425 | Ga0496119_0110315 | |||
| 2426 | Ga0496120_0495162 | |||
| 2427 | Ga0496120_0533606 | |||
| 2428 | Ga0496121_0190843 | |||
| 2429 | Ga0496121_0227811 | |||
| 2430 | Ga0496124_0491067 | |||
| 2431 | Ga0496125_0088039 | |||
| 2432 | Ga0496126_0053525 | |||
| 2433 | Ga0496126_0276733 | |||
| 2434 | Ga0496126_1165877 | |||
| 2435 | Ga0495678_057059 | |||
| 2436 | Ga0495678_123896 | |||
| 2437 | Ga0495682_0040152 | |||
| 2438 | Ga0495682_0045928 | |||
| 2439 | Ga0495682_0269536 | |||
| 2440 | Ga0501300_002737 | |||
| 2441 | Ga0501303_066496 | |||
| 2442 | Ga0501198_017318 | |||
| 2443 | Ga0501199_070109 | |||
| 2444 | Ga0501202_096751 | |||
| 2445 | Ga0501202_206560 | |||
| 2446 | Ga0501206_025272 | |||
| 2447 | Ga0501207_073542 | |||
| 2448 | Ga0501207_132015 | |||
| 2449 | Ga0501208_153166 | |||
| 2450 | Ga0501216_012979 | |||
| 2451 | Ga0501216_134265 | |||
| 2452 | Ga0501217_173709 | |||
| 2453 | Ga0501223_018734 | |||
| 2454 | Ga0501224_087071 | |||
| 2455 | Ga0501228_018991 | |||
| 2456 | Ga0501239_003927 | |||
| 2457 | Ga0501240_006305 | |||
| 2458 | Ga0501240_103683 | |||
| 2459 | Ga0501242_056705 | |||
| 2460 | Ga0501243_041358 | |||
| 2461 | Ga0501247_022906 | |||
| 2462 | Ga0501248_019538 | |||
| 2463 | Ga0501249_174833 | |||
| 2464 | Ga0501250_036976 | |||
| 2465 | Ga0501251_078707 | |||
| 2466 | Ga0501251_115961 | |||
| 2467 | Ga0501252_034884 | |||
| 2468 | Ga0501253_010244 | |||
| 2469 | Ga0501255_086591 | |||
| 2470 | Ga0501256_005780 | |||
| 2471 | Ga0501259_010900 | |||
| 2472 | Ga0501261_044537 | |||
| 2473 | Ga0501221_058714 | |||
| 2474 | Ga0501225_0073065 | |||
| 2475 | Ga0501225_0263656 | |||
| 2476 | Ga0501241_163082 | |||
| 2477 | Ga0501263_030106 | |||
| 2478 | Ga0501270_006913 | |||
| 2479 | Ga0501270_134809 | |||
| 2480 | Ga0501272_071852 | |||
| 2481 | Ga0501273_022040 | |||
| 2482 | Ga0501273_060907 | |||
| 2483 | Ga0501275_005373 | |||
| 2484 | Ga0501279_009351 | |||
| 2485 | Ga0501279_015333 | |||
| 2486 | Ga0501283_130070 | |||
| 2487 | Ga0501045_1100666 | |||
| 2488 | Ga0501212_040222 | |||
| 2489 | nmdc:mga07m45_165119_c1 | |||
| 2490 | nmdc:mga09592_399642_c1 | |||
| 2491 | nmdc:mga09592_769299_c1 | |||
| 2492 | nmdc:mga0qj67_242353_c1 | |||
| 2493 | nmdc:mga0qj67_244501_c1 | |||
| 2494 | nmdc:mga0qj67_296309_c1 | |||
| 2495 | nmdc:mga0qj67_757627_c1 | |||
| 2496 | nmdc:mga06r32_1032900_c1 | |||
| 2497 | nmdc:mga06r32_1063149_c1 | |||
| 2498 | nmdc:mga06r32_575181_c1 | |||
| 2499 | nmdc:mga08y16_462029_c1 | |||
| 2500 | nmdc:mga08y16_825027_c1 | |||
| 2501 | nmdc:mga0rr50_1243187_c1 | |||
| 2502 | Ga0495655_0050320 | |||
| 2503 | Ga0495655_0246426 | |||
| 2504 | Ga0500608_020766 | |||
| 2505 | 2512347125 | |||
| 2506 | 2512349955 | |||
| 2507 | 2514055052 | |||
| 2508 | 2516024662 | |||
| 2509 | 2753571618 | |||
| 2510 | 2753767667 | |||
| 2511 | 2792838879 | |||
| 2512 | 2842341345 | |||
| 2513 | 2842341370 | |||
| 2514 | 2842341741 | |||
| 2515 | 2842341776 | |||
| 2516 | 2869258128 | |||
| 2517 | 2900643250 | |||
| 2518 | 2900643356 | |||
| 2519 | 2902689976 | |||
| 2520 | 2904616873 | |||
| 2521 | 2946791336 | |||
| 2522 | 3004174583 | |||
| 2523 | 3004174824 | |||
| 2524 | 3004342122 | |||
| 2525 | 8004320295 | |||
| 2526 | 8016605234 | |||
| 2527 | 8016605290 | |||
| 2528 | 8016605323 | |||
| 2529 | 8016613097 | |||
| 2530 | 8016613116 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy