F492344

General Info

Members Datasets Scaffolds Average Seq Length
1265 352 2530 287

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0035615|Ga0373953_0035615_928_1785
Length 285
Sequence MCDQDHFEDDRLKYEALGLVTRKQFGIMLGAGIAMMLPQVANAVTVTESEVSVKTPDGTADCYFVHPASGTAPGVLVWPDIFGLRQAFRQMGKRLAESGYSVLVVNPFYRAQKGLPNGATNPTIQQNMPLMQALNETTHMTDAKAFIGWLDQQASVAKNRKMGTQGYCMGGPIAFRTAAAVPDRVGAVASFHGGGLVANGDNSPHLQAAKSKAQFLIAIAESDDKPRPTEKDVLKDTFAKANLPAEIEVYGAAHGWCPPDSGVYNEPLAEKAWGRLLALYGKALA

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
348 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 3.16
Rhizosphere 94.7
Stem 0
Stem Tuber 0
Unclassified 14.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0035615 3300035117 Bacteria 1957
2 JGI25406J46586_10000119 3300003203 Bacteria 34447
3 JGI25406J46586_10005975 3300003203 Bacteria 5631
4 Ga0058859_11818552 3300004798 Bacteria 1642
5 Ga0058863_11917217 3300004799 Bacteria 3023
6 Ga0058861_11260298 3300004800 Bacteria 949
7 Ga0058860_12121912 3300004801 Unclassified 999
8 Ga0058862_12607417 3300004803 Unclassified 897
9 Ga0065712_10242818 3300005290 Bacteria 960
10 Ga0065715_10001683 3300005293 Bacteria 5763
11 Ga0065715_10228106 3300005293 Bacteria 1235
12 Ga0065707_10005960 3300005295 Bacteria 3177
13 Ga0065707_10098319 3300005295 Bacteria 3091
14 Ga0065707_10256145 3300005295 Bacteria 1110
15 Ga0070658_10168557 3300005327 Bacteria 1839
16 Ga0070676_10012701 3300005328 Bacteria 4605
17 Ga0070676_10024880 3300005328 Bacteria 3378
18 Ga0070676_10080790 3300005328 Unclassified 1972
19 Ga0070683_100000003 3300005329 Bacteria 375084
20 Ga0070683_100061543 3300005329 Bacteria 3491
21 Ga0070683_100107191 3300005329 Bacteria 2634
22 Ga0070683_100140613 3300005329 Bacteria 2287
23 Ga0070683_100198932 3300005329 Bacteria 1903
24 Ga0070690_100023683 3300005330 Bacteria 3768
25 Ga0070690_100231062 3300005330 Bacteria 1300
26 Ga0070670_100010911 3300005331 Bacteria 7759
27 Ga0070670_100194535 3300005331 Bacteria 1762
28 Ga0070670_100229889 3300005331 Bacteria 1614
29 Ga0070677_10002416 3300005333 Bacteria 5957
30 Ga0070677_10075317 3300005333 Bacteria 1430
31 Ga0068869_100033702 3300005334 Bacteria 3617
32 Ga0068869_100130032 3300005334 Bacteria 1934
33 Ga0068869_100504095 3300005334 Bacteria 1011
34 Ga0070666_10000425 3300005335 Bacteria 26114
35 Ga0070666_10001250 3300005335 Bacteria 15380
36 Ga0070666_10006737 3300005335 Bacteria 7073
37 Ga0070666_10014622 3300005335 Bacteria 4998
38 Ga0070666_10053199 3300005335 Archaea 2730
39 Ga0070666_10068703 3300005335 Bacteria 2408
40 Ga0070680_100016531 3300005336 Bacteria 5806
41 Ga0070682_100110235 3300005337 Bacteria 1833
42 Ga0068868_100017351 3300005338 Bacteria 5361
43 Ga0068868_100019353 3300005338 Bacteria 5100
44 Ga0068868_100026769 3300005338 Bacteria 4397
45 Ga0068868_100102997 3300005338 Bacteria 2312
46 Ga0068868_100432475 3300005338 Bacteria 1141
47 Ga0070660_100013374 3300005339 Bacteria 5885
48 Ga0070660_100079605 3300005339 Bacteria 2571
49 Ga0070660_100515219 3300005339 Unclassified 996
50 Ga0070689_100020029 3300005340 Bacteria 4959
51 Ga0070689_100030902 3300005340 Bacteria 4067
52 Ga0070689_100047269 3300005340 Bacteria 3318
53 Ga0070689_100055601 3300005340 Bacteria 3067
54 Ga0070689_100084488 3300005340 Bacteria 2495
55 Ga0070689_100444668 3300005340 Bacteria 1102
56 Ga0070691_10007935 3300005341 Bacteria 4854
57 Ga0070691_10012595 3300005341 Bacteria 3873
58 Ga0070687_100012661 3300005343 Bacteria 3731
59 Ga0070687_100013402 3300005343 Unclassified 3653
60 Ga0070687_100038203 3300005343 Bacteria 2405
61 Ga0070661_100007019 3300005344 Bacteria 7771
62 Ga0070661_100044735 3300005344 Bacteria 3235
63 Ga0070668_100073197 3300005347 Bacteria 2671
64 Ga0070668_100230204 3300005347 Bacteria 1532
65 Ga0070669_100002792 3300005353 Bacteria 12603
66 Ga0070669_100010531 3300005353 Bacteria 6566
67 Ga0070669_100024037 3300005353 Bacteria 4367
68 Ga0070669_100031975 3300005353 Bacteria 3800
69 Ga0070669_100256598 3300005353 Bacteria 1394
70 Ga0070675_100001488 3300005354 Bacteria 17297
71 Ga0070675_100042270 3300005354 Bacteria 3724
72 Ga0070675_100062365 3300005354 Bacteria 3080
73 Ga0070675_100188459 3300005354 Bacteria 1786
74 Ga0070675_100280275 3300005354 Bacteria 1464
75 Ga0070675_100295559 3300005354 Bacteria 1426
76 Ga0070671_100004399 3300005355 Bacteria 11137
77 Ga0070671_100004706 3300005355 Bacteria 10841
78 Ga0070671_100081316 3300005355 Unclassified 2709
79 Ga0070674_100003670 3300005356 Bacteria 8654
80 Ga0070674_100029420 3300005356 Bacteria 3618
81 Ga0070674_100139600 3300005356 Unclassified 1817
82 Ga0070673_100068478 3300005364 Bacteria 2842
83 Ga0070673_100123135 3300005364 Unclassified 2166
84 Ga0070673_100153675 3300005364 Bacteria 1951
85 Ga0070673_100158260 3300005364 Bacteria 1924
86 Ga0070688_100015938 3300005365 Bacteria 4286
87 Ga0070688_100053675 3300005365 Bacteria 2522
88 Ga0070688_100218979 3300005365 Bacteria 1340
89 Ga0070659_100067799 3300005366 Bacteria 2830
90 Ga0070667_100003388 3300005367 Bacteria 13590
91 Ga0070667_100045080 3300005367 Bacteria 3706
92 Ga0070667_100092577 3300005367 Unclassified 2601
93 Ga0070667_100192714 3300005367 Bacteria 1806
94 Ga0070703_10057257 3300005406 Bacteria 1265
95 Ga0070709_10093290 3300005434 Bacteria 1990
96 Ga0070709_10109666 3300005434 Bacteria 1853
97 Ga0070714_100009111 3300005435 Bacteria 7786
98 Ga0070714_100206452 3300005435 Bacteria 1799
99 Ga0070713_100001622 3300005436 Bacteria 14423
100 Ga0070713_100002857 3300005436 Bacteria 11290
101 Ga0070713_100102671 3300005436 Bacteria 2480
102 Ga0070713_100106740 3300005436 Bacteria 2435
103 Ga0070701_10015238 3300005438 Bacteria 3545
104 Ga0070701_10023753 3300005438 Bacteria 2957
105 Ga0070701_10046287 3300005438 Unclassified 2235
106 Ga0070711_100067047 3300005439 Bacteria 2517
107 Ga0070711_100127601 3300005439 Bacteria 1890
108 Ga0070705_100007521 3300005440 Bacteria 5364
109 Ga0070705_100011019 3300005440 Bacteria 4547
110 Ga0070700_100050592 3300005441 Unclassified 2583
111 Ga0070700_100171759 3300005441 Bacteria 1502
112 Ga0070694_100002259 3300005444 Bacteria 11391
113 Ga0070694_100061191 3300005444 Unclassified 2569
114 Ga0070694_100133560 3300005444 Bacteria 1796
115 Ga0070694_100196867 3300005444 Bacteria 1500
116 Ga0070708_100052221 3300005445 Bacteria 3624
117 Ga0070708_100360243 3300005445 Bacteria 1371
118 Ga0070663_100332451 3300005455 Bacteria 1225
119 Ga0070678_100131873 3300005456 Bacteria 1986
120 Ga0070678_100345810 3300005456 Bacteria 1277
121 Ga0070678_100582231 3300005456 Bacteria 997
122 Ga0070662_100026566 3300005457 Unclassified 4011
123 Ga0070662_100047164 3300005457 Unclassified 3098
124 Ga0070662_100153790 3300005457 Bacteria 1794
125 Ga0070681_10031838 3300005458 Bacteria 5294
126 Ga0070681_10083225 3300005458 Bacteria 3154
127 Ga0070681_10106266 3300005458 Bacteria 2748
128 Ga0070681_10270347 3300005458 Bacteria 1611
129 Ga0070681_10411811 3300005458 Bacteria 1263
130 Ga0068867_100038870 3300005459 Bacteria 3466
131 Ga0068867_100220084 3300005459 Bacteria 1529
132 Ga0068867_100617348 3300005459 Unclassified 947
133 Ga0070685_10008639 3300005466 Bacteria 5242
134 Ga0070685_10332208 3300005466 Bacteria 1034
135 Ga0070707_100036513 3300005468 Bacteria 4688
136 Ga0070707_100115866 3300005468 Bacteria 2601
137 Ga0070698_100029222 3300005471 Bacteria 5722
138 Ga0070698_100120781 3300005471 Unclassified 2581
139 Ga0070699_100001327 3300005518 Bacteria 22790
140 Ga0070699_100008993 3300005518 Bacteria 8652
141 Ga0070699_100105270 3300005518 Unclassified 2475
142 Ga0070699_100136495 3300005518 Unclassified 2164
143 Ga0070699_100258468 3300005518 Bacteria 1557
144 Ga0070679_100000302 3300005530 Bacteria 42063
145 Ga0070679_100043673 3300005530 Unclassified 4463
146 Ga0070679_100046043 3300005530 Bacteria 4346
147 Ga0070679_100529536 3300005530 Unclassified 1122
148 Ga0070684_100000014 3300005535 Bacteria 158815
149 Ga0070684_100002999 3300005535 Bacteria 12566
150 Ga0070684_100012985 3300005535 Bacteria 6699
151 Ga0070684_100094925 3300005535 Bacteria 2657
152 Ga0070684_100351087 3300005535 Bacteria 1357
153 Ga0070697_100020675 3300005536 Bacteria 5209
154 Ga0070697_100116941 3300005536 Unclassified 2227
155 Ga0068853_100002146 3300005539 Bacteria 14679
156 Ga0070672_100007627 3300005543 Bacteria 7362
157 Ga0070672_100070432 3300005543 Unclassified 2779
158 Ga0070672_100077832 3300005543 Unclassified 2653
159 Ga0070672_100080430 3300005543 Unclassified 2611
160 Ga0070672_100131831 3300005543 Bacteria 2055
161 Ga0070672_100180056 3300005543 Bacteria 1761
162 Ga0070672_100209187 3300005543 Bacteria 1633
163 Ga0070672_100249078 3300005543 Bacteria 1496
164 Ga0070686_100000149 3300005544 Bacteria 47841
165 Ga0070686_100013516 3300005544 Bacteria 4678
166 Ga0070686_100223620 3300005544 Bacteria 1362
167 Ga0070686_100453832 3300005544 Bacteria 986
168 Ga0070695_100023341 3300005545 Bacteria 3800
169 Ga0070695_100060209 3300005545 Bacteria 2460
170 Ga0070695_100060895 3300005545 Bacteria 2447
171 Ga0070695_100275229 3300005545 Bacteria 1235
172 Ga0070696_100021367 3300005546 Bacteria 4387
173 Ga0070696_100025110 3300005546 Bacteria 4050
174 Ga0070696_100026932 3300005546 Bacteria 3913
175 Ga0070696_100119566 3300005546 Unclassified 1905
176 Ga0070693_100026839 3300005547 Bacteria 3113
177 Ga0070665_100006507 3300005548 Bacteria 11876
178 Ga0070665_100024170 3300005548 Bacteria 6120
179 Ga0070665_100040388 3300005548 Bacteria 4690
180 Ga0070665_100054433 3300005548 Bacteria 4013
181 Ga0070665_100121382 3300005548 Bacteria 2615
182 Ga0070665_100235929 3300005548 Bacteria 1829
183 Ga0070704_100003359 3300005549 Bacteria 9167
184 Ga0070704_100061746 3300005549 Bacteria 2684
185 Ga0070704_100100767 3300005549 Unclassified 2175
186 Ga0070704_100114264 3300005549 Bacteria 2060
187 Ga0070704_100311448 3300005549 Bacteria 1316
188 Ga0068855_100002984 3300005563 Bacteria 20678
189 Ga0068855_100017262 3300005563 Bacteria 8686
190 Ga0068855_100031217 3300005563 Bacteria 6363
191 Ga0068855_100059840 3300005563 Bacteria 4456
192 Ga0068855_100494631 3300005563 Unclassified 1330
193 Ga0068855_100502014 3300005563 Unclassified 1318
194 Ga0070664_100000492 3300005564 Bacteria 29880
195 Ga0070664_100001335 3300005564 Bacteria 19670
196 Ga0070664_100040409 3300005564 Bacteria 3932
197 Ga0070664_100122511 3300005564 Bacteria 2278
198 Ga0070664_100179807 3300005564 Bacteria 1880
199 Ga0070664_100258120 3300005564 Bacteria 1568
200 Ga0070664_100317916 3300005564 Bacteria 1410
201 Ga0068857_100002613 3300005577 Bacteria 14785
202 Ga0068857_100011187 3300005577 Bacteria 7804
203 Ga0068857_100047722 3300005577 Bacteria 3803
204 Ga0068857_100052484 3300005577 Unclassified 3617
205 Ga0068857_100130673 3300005577 Bacteria 2265
206 Ga0068857_100160266 3300005577 Bacteria 2041
207 Ga0068857_100300944 3300005577 Bacteria 1478
208 Ga0068854_100021164 3300005578 Bacteria 4411
209 Ga0068854_100046159 3300005578 Bacteria 3101
210 Ga0068856_100001937 3300005614 Bacteria 21587
211 Ga0068856_100004199 3300005614 Bacteria 14388
212 Ga0068856_100015788 3300005614 Bacteria 7302
213 Ga0068856_100115313 3300005614 Bacteria 2686
214 Ga0068856_100128318 3300005614 Unclassified 2540
215 Ga0068856_100205807 3300005614 Bacteria 1982
216 Ga0068856_100607880 3300005614 Bacteria 1114
217 Ga0070702_100003201 3300005615 Bacteria 7272
218 Ga0070702_100201444 3300005615 Bacteria 1318
219 Ga0070702_100211549 3300005615 Bacteria 1291
220 Ga0068852_100001781 3300005616 Bacteria 14646
221 Ga0068852_100035743 3300005616 Bacteria 4148
222 Ga0068852_100158401 3300005616 Bacteria 2111
223 Ga0068859_100004134 3300005617 Bacteria 14817
224 Ga0068859_100004521 3300005617 Bacteria 14186
225 Ga0068859_100030564 3300005617 Bacteria 5406
226 Ga0068859_100033211 3300005617 Bacteria 5183
227 Ga0068859_100081354 3300005617 Bacteria 3281
228 Ga0068859_100081997 3300005617 Bacteria 3268
229 Ga0068859_100147305 3300005617 Bacteria 2429
230 Ga0068859_100272424 3300005617 Bacteria 1785
231 Ga0068859_100640873 3300005617 Bacteria 1155
232 Ga0068864_100002489 3300005618 Bacteria 15223
233 Ga0068864_100023269 3300005618 Bacteria 5202
234 Ga0068864_100025597 3300005618 Unclassified 4972
235 Ga0068864_100059439 3300005618 Bacteria 3307
236 Ga0068864_100249290 3300005618 Bacteria 1648
237 Ga0068864_100422580 3300005618 Bacteria 1270
238 Ga0068866_10048247 3300005718 Bacteria 2152
239 Ga0068861_100018284 3300005719 Bacteria 4992
240 Ga0068861_100043183 3300005719 Bacteria 3382
241 Ga0068861_100069471 3300005719 Bacteria 2725
242 Ga0068861_100163980 3300005719 Unclassified 1836
243 Ga0068861_100318858 3300005719 Bacteria 1353
244 Ga0068851_10097203 3300005834 Bacteria 1558
245 Ga0068870_10013371 3300005840 Unclassified 3856
246 Ga0068870_10014953 3300005840 Bacteria 3674
247 Ga0068863_100005664 3300005841 Bacteria 12268
248 Ga0068863_100008318 3300005841 Bacteria 10135
249 Ga0068863_100040394 3300005841 Unclassified 4435
250 Ga0068863_100474395 3300005841 Unclassified 1230
251 Ga0068863_100555617 3300005841 Unclassified 1134
252 Ga0068858_100002905 3300005842 Bacteria 17241
253 Ga0068858_100005100 3300005842 Bacteria 12868
254 Ga0068858_100008332 3300005842 Bacteria 9974
255 Ga0068858_100052419 3300005842 Bacteria 3774
256 Ga0068858_100108057 3300005842 Bacteria 2597
257 Ga0068858_100135568 3300005842 Bacteria 2310
258 Ga0068858_100148751 3300005842 Bacteria 2201
259 Ga0068858_100152695 3300005842 Bacteria 2172
260 Ga0068858_100218074 3300005842 Bacteria 1806
261 Ga0068858_100241234 3300005842 Bacteria 1715
262 Ga0068858_100473576 3300005842 Bacteria 1208
263 Ga0068858_100480116 3300005842 Bacteria 1200
264 Ga0068860_100031160 3300005843 Bacteria 5127
265 Ga0068860_100038063 3300005843 Bacteria 4602
266 Ga0068860_100044555 3300005843 Bacteria 4228
267 Ga0068860_100246495 3300005843 Bacteria 1739
268 Ga0068862_100000840 3300005844 Bacteria 30227
269 Ga0068862_100005392 3300005844 Bacteria 10699
270 Ga0068862_100016263 3300005844 Bacteria 6191
271 Ga0068862_100036118 3300005844 Bacteria 4187
272 Ga0068862_100045111 3300005844 Bacteria 3761
273 Ga0068862_100074584 3300005844 Bacteria 2933
274 Ga0068862_100124832 3300005844 Bacteria 2272
275 Ga0068862_100240398 3300005844 Bacteria 1646
276 Ga0068862_100694614 3300005844 Unclassified 985
277 Ga0068862_100695032 3300005844 Bacteria 985
278 Ga0081539_10000017 3300005985 Bacteria 375107
279 Ga0081539_10000285 3300005985 Bacteria 114370
280 Ga0081539_10047920 3300005985 Bacteria 2435
281 Ga0081539_10057486 3300005985 Bacteria 2152
282 Ga0081539_10122253 3300005985 Unclassified 1291
283 Ga0070717_10096581 3300006028 Bacteria 2503
284 Ga0070717_10157115 3300006028 Unclassified 1971
285 Ga0075368_10011931 3300006042 Bacteria 3171
286 Ga0075363_100010441 3300006048 Bacteria 4413
287 Ga0070716_100056446 3300006173 Bacteria 2252
288 Ga0070716_100350595 3300006173 Bacteria 1045
289 Ga0075369_10038930 3300006186 Bacteria 2029
290 Ga0097621_100005426 3300006237 Bacteria 8990
291 Ga0097621_100010218 3300006237 Bacteria 6854
292 Ga0097621_100028334 3300006237 Bacteria 4414
293 Ga0097621_100071850 3300006237 Bacteria 2861
294 Ga0097621_100089762 3300006237 Unclassified 2570
295 Ga0097621_100130326 3300006237 Bacteria 2140
296 Ga0097621_100135694 3300006237 Bacteria 2098
297 Ga0097621_100176074 3300006237 Bacteria 1846
298 Ga0097621_100192714 3300006237 Bacteria 1766
299 Ga0097621_100311238 3300006237 Bacteria 1393
300 Ga0097621_100341509 3300006237 Bacteria 1330
301 Ga0097621_100401340 3300006237 Unclassified 1227
302 Ga0097621_100598170 3300006237 Bacteria 1008
303 Ga0097621_100748161 3300006237 Bacteria 903
304 Ga0068871_100029054 3300006358 Bacteria 4340
305 Ga0068871_100042327 3300006358 Bacteria 3656
306 Ga0068871_100047644 3300006358 Bacteria 3457
307 Ga0068871_100049292 3300006358 Bacteria 3403
308 Ga0068871_100084470 3300006358 Bacteria 2634
309 Ga0068871_100085655 3300006358 Bacteria 2617
310 Ga0068871_100090586 3300006358 Bacteria 2547
311 Ga0068871_100110220 3300006358 Unclassified 2314
312 Ga0068871_100142932 3300006358 Bacteria 2036
313 Ga0075428_100000056 3300006844 Bacteria 89990
314 Ga0075428_100015436 3300006844 Bacteria 8466
315 Ga0075428_100016708 3300006844 Bacteria 8101
316 Ga0075428_100019016 3300006844 Bacteria 7597
317 Ga0075428_100019500 3300006844 Bacteria 7506
318 Ga0075428_100101266 3300006844 Bacteria 3140
319 Ga0075428_100185876 3300006844 Bacteria 2248
320 Ga0075428_100233308 3300006844 Bacteria 1986
321 Ga0075428_100260483 3300006844 Unclassified 1867
322 Ga0075428_100405430 3300006844 Bacteria 1461
323 Ga0075430_100001665 3300006846 Bacteria 18164
324 Ga0075430_100040576 3300006846 Bacteria 3940
325 Ga0075430_100053941 3300006846 Unclassified 3383
326 Ga0075431_100005129 3300006847 Bacteria 12883
327 Ga0075431_100014576 3300006847 Bacteria 7954
328 Ga0075431_100053866 3300006847 Bacteria 4148
329 Ga0075431_100072135 3300006847 Bacteria 3563
330 Ga0075431_100110346 3300006847 Bacteria 2839
331 Ga0075431_100153962 3300006847 Bacteria 2366
332 Ga0075431_100378490 3300006847 Unclassified 1420
333 Ga0075433_10006669 3300006852 Bacteria 9141
334 Ga0075433_10015777 3300006852 Bacteria 6208
335 Ga0075433_10277688 3300006852 Bacteria 1484
336 Ga0075433_10409953 3300006852 Bacteria 1195
337 Ga0075433_10628909 3300006852 Bacteria 942
338 Ga0075434_100008968 3300006871 Bacteria 9314
339 Ga0075434_100010775 3300006871 Bacteria 8585
340 Ga0075434_100018968 3300006871 Bacteria 6648
341 Ga0075434_100022212 3300006871 Bacteria 6180
342 Ga0075434_100031745 3300006871 Bacteria 5208
343 Ga0075434_100031834 3300006871 Bacteria 5201
344 Ga0075434_100032945 3300006871 Bacteria 5111
345 Ga0075434_100053344 3300006871 Bacteria 4018
346 Ga0075434_100055569 3300006871 Bacteria 3934
347 Ga0075434_100261397 3300006871 Bacteria 1750
348 Ga0075434_100297381 3300006871 Bacteria 1634
349 Ga0075434_100821008 3300006871 Bacteria 946
350 Ga0075429_100005206 3300006880 Bacteria 11185
351 Ga0075429_100006221 3300006880 Bacteria 10328
352 Ga0075429_100070194 3300006880 Bacteria 3050
353 Ga0075429_100070915 3300006880 Bacteria 3034
354 Ga0075429_100117368 3300006880 Bacteria 2326
355 Ga0075429_100268238 3300006880 Bacteria 1495
356 Ga0075429_100270228 3300006880 Bacteria 1489
357 Ga0068865_100066595 3300006881 Bacteria 2542
358 Ga0068865_100073886 3300006881 Bacteria 2426
359 Ga0068865_100086615 3300006881 Bacteria 2261
360 Ga0068865_100193177 3300006881 Bacteria 1576
361 Ga0075436_100001549 3300006914 Bacteria 15697
362 Ga0075436_100211917 3300006914 Bacteria 1373
363 Ga0075436_100365852 3300006914 Bacteria 1041
364 Ga0097620_100004134 3300006931 Bacteria 14817
365 Ga0097620_100004521 3300006931 Bacteria 14186
366 Ga0097620_100030564 3300006931 Bacteria 5406
367 Ga0097620_100033210 3300006931 Bacteria 5183
368 Ga0097620_100081361 3300006931 Bacteria 3281
369 Ga0097620_100082001 3300006931 Bacteria 3268
370 Ga0097620_100147305 3300006931 Bacteria 2429
371 Ga0097620_100272427 3300006931 Bacteria 1785
372 Ga0097620_100640828 3300006931 Bacteria 1155
373 Ga0075435_100000010 3300007076 Bacteria 112658
374 Ga0075435_100003072 3300007076 Bacteria 11260
375 Ga0075435_100003595 3300007076 Bacteria 10543
376 Ga0075435_100007095 3300007076 Bacteria 7956
377 Ga0075435_100031895 3300007076 Bacteria 4157
378 Ga0075435_100056213 3300007076 Bacteria 3180
379 Ga0075435_100095310 3300007076 Unclassified 2461
380 Ga0075435_100131640 3300007076 Bacteria 2093
381 Ga0075435_100164768 3300007076 Bacteria 1869
382 Ga0075435_100184670 3300007076 Bacteria 1763
383 Ga0075435_100458917 3300007076 Bacteria 1099
384 Ga0105240_10003771 3300009093 Bacteria 23410
385 Ga0105240_10007340 3300009093 Bacteria 16039
386 Ga0105240_10045239 3300009093 Bacteria 5585
387 Ga0105240_10048104 3300009093 Bacteria 5392
388 Ga0105240_10110389 3300009093 Unclassified 3329
389 Ga0105240_10158316 3300009093 Unclassified 2692
390 Ga0105240_10454561 3300009093 Bacteria 1432
391 Ga0105240_10618847 3300009093 Bacteria 1190
392 Ga0105240_10958827 3300009093 Bacteria 917
393 Ga0111539_10000002 3300009094 Bacteria 983359
394 Ga0111539_10005233 3300009094 Bacteria 16808
395 Ga0111539_10010564 3300009094 Bacteria 11626
396 Ga0111539_10010813 3300009094 Bacteria 11489
397 Ga0111539_10036295 3300009094 Bacteria 5962
398 Ga0111539_10037657 3300009094 Bacteria 5840
399 Ga0111539_10080094 3300009094 Unclassified 3842
400 Ga0111539_10350141 3300009094 Bacteria 1719
401 Ga0111539_10621840 3300009094 Bacteria 1258
402 Ga0105245_10000947 3300009098 Bacteria 26402
403 Ga0105245_10005502 3300009098 Bacteria 11125
404 Ga0105245_10006166 3300009098 Bacteria 10551
405 Ga0105245_10008147 3300009098 Bacteria 9165
406 Ga0105245_10089627 3300009098 Bacteria 2828
407 Ga0105245_10102648 3300009098 Unclassified 2648
408 Ga0105245_10105997 3300009098 Bacteria 2607
409 Ga0105245_10121187 3300009098 Bacteria 2444
410 Ga0105245_10137756 3300009098 Bacteria 2295
411 Ga0105245_10149288 3300009098 Unclassified 2209
412 Ga0105245_10256690 3300009098 Bacteria 1700
413 Ga0105247_10016166 3300009101 Bacteria 4471
414 Ga0105247_10071535 3300009101 Bacteria 2169
415 Ga0114129_10002802 3300009147 Bacteria 24335
416 Ga0114129_10004604 3300009147 Bacteria 19474
417 Ga0114129_10018430 3300009147 Bacteria 9941
418 Ga0114129_10033579 3300009147 Bacteria 7250
419 Ga0114129_10046527 3300009147 Bacteria 6097
420 Ga0114129_10048496 3300009147 Bacteria 5968
421 Ga0114129_10048880 3300009147 Bacteria 5945
422 Ga0114129_10057309 3300009147 Bacteria 5453
423 Ga0114129_10065314 3300009147 Bacteria 5079
424 Ga0114129_10065470 3300009147 Bacteria 5072
425 Ga0114129_10097308 3300009147 Bacteria 4074
426 Ga0114129_10150757 3300009147 Bacteria 3182
427 Ga0114129_10151640 3300009147 Bacteria 3172
428 Ga0114129_10190346 3300009147 Unclassified 2786
429 Ga0114129_10238897 3300009147 Bacteria 2443
430 Ga0114129_10266368 3300009147 Bacteria 2294
431 Ga0114129_10599768 3300009147 Bacteria 1427
432 Ga0114129_10837141 3300009147 Bacteria 1171
433 Ga0105243_10024153 3300009148 Bacteria 4635
434 Ga0105243_10048536 3300009148 Bacteria 3347
435 Ga0105241_10001247 3300009174 Bacteria 19418
436 Ga0105241_10040992 3300009174 Bacteria 3497
437 Ga0105241_10053952 3300009174 Bacteria 3076
438 Ga0105241_10070832 3300009174 Unclassified 2706
439 Ga0105241_10225951 3300009174 Unclassified 1576
440 Ga0105241_10386439 3300009174 Unclassified 1224
441 Ga0105242_10002034 3300009176 Bacteria 15919
442 Ga0105242_10067925 3300009176 Bacteria 2948
443 Ga0105242_10138527 3300009176 Bacteria 2109
444 Ga0105242_10314848 3300009176 Unclassified 1433
445 Ga0105242_10426204 3300009176 Bacteria 1244
446 Ga0105248_10000732 3300009177 Bacteria 36950
447 Ga0105248_10004514 3300009177 Bacteria 15398
448 Ga0105248_10011483 3300009177 Bacteria 9759
449 Ga0105248_10020051 3300009177 Bacteria 7404
450 Ga0105248_10029385 3300009177 Bacteria 6131
451 Ga0105248_10050486 3300009177 Bacteria 4665
452 Ga0105248_10052260 3300009177 Bacteria 4585
453 Ga0105248_10053042 3300009177 Bacteria 4550
454 Ga0105248_10059938 3300009177 Bacteria 4274
455 Ga0105248_10065126 3300009177 Bacteria 4091
456 Ga0105248_10076703 3300009177 Bacteria 3756
457 Ga0105248_10094858 3300009177 Bacteria 3359
458 Ga0105248_10182136 3300009177 Unclassified 2367
459 Ga0105248_10187783 3300009177 Bacteria 2329
460 Ga0105248_10226971 3300009177 Bacteria 2102
461 Ga0105248_10269216 3300009177 Bacteria 1918
462 Ga0105248_10278253 3300009177 Bacteria 1884
463 Ga0105248_10365662 3300009177 Bacteria 1624
464 Ga0105248_10752451 3300009177 Bacteria 1100
465 Ga0105248_10779011 3300009177 Unclassified 1079
466 Ga0105237_10005644 3300009545 Bacteria 14089
467 Ga0105237_10011307 3300009545 Bacteria 9445
468 Ga0105237_10014420 3300009545 Bacteria 8266
469 Ga0105237_10015435 3300009545 Bacteria 7949
470 Ga0105237_10066658 3300009545 Bacteria 3595
471 Ga0105238_10002827 3300009551 Bacteria 17320
472 Ga0105238_10012423 3300009551 Bacteria 8589
473 Ga0105238_10028958 3300009551 Bacteria 5641
474 Ga0105238_10065680 3300009551 Bacteria 3630
475 Ga0105238_10162867 3300009551 Unclassified 2206
476 Ga0105238_10167970 3300009551 Bacteria 2170
477 Ga0105249_10000823 3300009553 Bacteria 27980
478 Ga0105249_10085317 3300009553 Bacteria 2942
479 Ga0105249_10090363 3300009553 Bacteria 2863
480 Ga0105239_10007060 3300010375 Bacteria 12928
481 Ga0105239_10021625 3300010375 Bacteria 7092
482 Ga0105239_10192899 3300010375 Bacteria 2280
483 Ga0105239_10226954 3300010375 Unclassified 2095
484 Ga0105239_10228268 3300010375 Bacteria 2089
485 Ga0105239_10489206 3300010375 Unclassified 1398
486 Ga0105239_10818561 3300010375 Unclassified 1067
487 Ga0105246_10018784 3300011119 Unclassified 4407
488 Ga0105246_10031268 3300011119 Bacteria 3522
489 Ga0105246_10040295 3300011119 Bacteria 3152
490 Ga0105246_10344619 3300011119 Unclassified 1219
491 Ga0157373_10038552 3300013100 Unclassified 3425
492 Ga0157371_10152094 3300013102 Bacteria 1651
493 Ga0157370_10002040 3300013104 Bacteria 24804
494 Ga0157370_10004725 3300013104 Bacteria 15528
495 Ga0157370_10007265 3300013104 Bacteria 12089
496 Ga0157370_10168440 3300013104 Bacteria 2037
497 Ga0157370_10353347 3300013104 Bacteria 1355
498 Ga0157369_10002554 3300013105 Bacteria 21788
499 Ga0157369_10013404 3300013105 Bacteria 9270
500 Ga0157369_10025201 3300013105 Bacteria 6604
501 Ga0157369_10034298 3300013105 Bacteria 5571
502 Ga0157369_10066560 3300013105 Unclassified 3876
503 Ga0157369_10132585 3300013105 Unclassified 2639
504 Ga0157369_10321202 3300013105 Bacteria 1609
505 Ga0157369_10568733 3300013105 Unclassified 1171
506 Ga0157374_10015334 3300013296 Bacteria 6721
507 Ga0157374_10016451 3300013296 Bacteria 6502
508 Ga0157374_10020467 3300013296 Bacteria 5870
509 Ga0157374_10035463 3300013296 Bacteria 4564
510 Ga0157374_10087838 3300013296 Bacteria 2960
511 Ga0157374_10527156 3300013296 Unclassified 1187
512 Ga0157378_10005441 3300013297 Bacteria 11161
513 Ga0157378_10009756 3300013297 Bacteria 8368
514 Ga0157378_10050722 3300013297 Bacteria 3692
515 Ga0157378_10067391 3300013297 Bacteria 3207
516 Ga0157378_10231845 3300013297 Bacteria 1760
517 Ga0157378_10291065 3300013297 Bacteria 1577
518 Ga0157378_10386674 3300013297 Bacteria 1375
519 Ga0157378_10410116 3300013297 Bacteria 1337
520 Ga0157378_10550282 3300013297 Bacteria 1159
521 Ga0163162_10000523 3300013306 Bacteria 35637
522 Ga0163162_10008601 3300013306 Bacteria 9950
523 Ga0163162_10013410 3300013306 Bacteria 8001
524 Ga0163162_10016225 3300013306 Bacteria 7285
525 Ga0163162_10048770 3300013306 Unclassified 4243
526 Ga0163162_10080122 3300013306 Unclassified 3333
527 Ga0163162_10181237 3300013306 Bacteria 2232
528 Ga0163162_10554270 3300013306 Bacteria 1278
529 Ga0163162_10584113 3300013306 Bacteria 1244
530 Ga0157372_10020520 3300013307 Bacteria 7129
531 Ga0157372_10101349 3300013307 Bacteria 3287
532 Ga0157372_10114613 3300013307 Bacteria 3090
533 Ga0157372_10135551 3300013307 Bacteria 2835
534 Ga0157372_11069439 3300013307 Bacteria 934
535 Ga0157375_10002834 3300013308 Bacteria 15010
536 Ga0157375_10065990 3300013308 Bacteria 3610
537 Ga0157375_10088975 3300013308 Unclassified 3143
538 Ga0157375_10268882 3300013308 Bacteria 1867
539 Ga0157375_10533902 3300013308 Bacteria 1336
540 Ga0157375_10772588 3300013308 Bacteria 1111
541 Ga0157375_11059228 3300013308 Bacteria 948
542 Ga0163163_10000519 3300014325 Bacteria 34361
543 Ga0163163_10012292 3300014325 Bacteria 7796
544 Ga0163163_10025838 3300014325 Bacteria 5603
545 Ga0163163_10027913 3300014325 Bacteria 5412
546 Ga0163163_10039336 3300014325 Bacteria 4615
547 Ga0163163_10047478 3300014325 Bacteria 4221
548 Ga0163163_10074324 3300014325 Unclassified 3391
549 Ga0163163_10292684 3300014325 Unclassified 1681
550 Ga0163163_10551027 3300014325 Bacteria 1216
551 Ga0163163_10569450 3300014325 Bacteria 1196
552 Ga0157380_10002501 3300014326 Bacteria 12388
553 Ga0157380_10010757 3300014326 Bacteria 6593
554 Ga0157380_10031559 3300014326 Bacteria 4068
555 Ga0157380_10215357 3300014326 Unclassified 1715
556 Ga0157380_10251604 3300014326 Unclassified 1599
557 Ga0157380_10550328 3300014326 Bacteria 1132
558 Ga0157377_10014582 3300014745 Bacteria 4001
559 Ga0157377_10027036 3300014745 Bacteria 3077
560 Ga0157377_10052001 3300014745 Bacteria 2312
561 Ga0157377_10096921 3300014745 Bacteria 1750
562 Ga0157379_10024368 3300014968 Bacteria 5372
563 Ga0157379_10032183 3300014968 Unclassified 4674
564 Ga0157379_10034436 3300014968 Bacteria 4516
565 Ga0157379_10035809 3300014968 Bacteria 4425
566 Ga0157379_10069607 3300014968 Bacteria 3147
567 Ga0157379_10177376 3300014968 Unclassified 1924
568 Ga0157379_10332657 3300014968 Bacteria 1388
569 Ga0157379_10475349 3300014968 Bacteria 1156
570 Ga0157379_10552911 3300014968 Bacteria 1071
571 Ga0157376_10001464 3300014969 Bacteria 15555
572 Ga0157376_10018430 3300014969 Bacteria 5352
573 Ga0157376_10030077 3300014969 Bacteria 4332
574 Ga0157376_10036034 3300014969 Bacteria 4005
575 Ga0157376_10111007 3300014969 Bacteria 2414
576 Ga0157376_10131246 3300014969 Bacteria 2236
577 Ga0157376_10134695 3300014969 Bacteria 2209
578 Ga0157376_10140026 3300014969 Bacteria 2169
579 Ga0157376_10162452 3300014969 Unclassified 2026
580 Ga0157376_10163472 3300014969 Bacteria 2020
581 Ga0157376_10328337 3300014969 Unclassified 1457
582 Ga0157376_10367418 3300014969 Bacteria 1382
583 Ga0157376_10520827 3300014969 Bacteria 1172
584 Ga0157376_10685225 3300014969 Unclassified 1028
585 Ga0163161_10059162 3300017792 Bacteria 2786
586 Ga0206352_11354533 3300020078 Bacteria 1046
587 Ga0154015_1222796 3300020610 Unclassified 1425
588 Ga0213876_10202830 3300021384 Unclassified 1054
589 Ga0213875_10011417 3300021388 Bacteria 4419
590 Ga0213875_10018482 3300021388 Bacteria 3358
591 Ga0213875_10025438 3300021388 Bacteria 2820
592 Ga0213875_10054213 3300021388 Bacteria 1878
593 Ga0207697_10000251 3300025315 Bacteria 29559
594 Ga0207697_10004674 3300025315 Bacteria 6495
595 Ga0207682_10004064 3300025893 Bacteria 6217
596 Ga0207682_10033729 3300025893 Bacteria 2062
597 Ga0207642_10152192 3300025899 Bacteria 1233
598 Ga0207688_10016882 3300025901 Bacteria 3965
599 Ga0207688_10027862 3300025901 Bacteria 3107
600 Ga0207688_10277646 3300025901 Bacteria 1020
601 Ga0207680_10003712 3300025903 Bacteria 7179
602 Ga0207680_10038400 3300025903 Bacteria 2771
603 Ga0207680_10170274 3300025903 Bacteria 1466
604 Ga0207680_10208439 3300025903 Bacteria 1335
605 Ga0207699_10018329 3300025906 Bacteria 3707
606 Ga0207699_10076098 3300025906 Unclassified 2067
607 Ga0207699_10149616 3300025906 Bacteria 1543
608 Ga0207645_10000804 3300025907 Bacteria 26273
609 Ga0207645_10017281 3300025907 Bacteria 4765
610 Ga0207643_10005115 3300025908 Bacteria 7019
611 Ga0207643_10022431 3300025908 Bacteria 3476
612 Ga0207643_10074668 3300025908 Bacteria 1956
613 Ga0207705_10047827 3300025909 Bacteria 3077
614 Ga0207684_10294329 3300025910 Bacteria 1400
615 Ga0207684_10422770 3300025910 Bacteria 1145
616 Ga0207654_10002296 3300025911 Bacteria 9802
617 Ga0207654_10041480 3300025911 Bacteria 2599
618 Ga0207654_10103783 3300025911 Bacteria 1756
619 Ga0207654_10126426 3300025911 Unclassified 1612
620 Ga0207707_10000469 3300025912 Bacteria 41694
621 Ga0207707_10012066 3300025912 Bacteria 7515
622 Ga0207707_10044280 3300025912 Bacteria 3881
623 Ga0207707_10058030 3300025912 Bacteria 3369
624 Ga0207707_10177976 3300025912 Bacteria 1857
625 Ga0207695_10002673 3300025913 Bacteria 26047
626 Ga0207695_10017159 3300025913 Bacteria 8436
627 Ga0207695_10069924 3300025913 Bacteria 3591
628 Ga0207695_10077984 3300025913 Bacteria 3363
629 Ga0207695_10080223 3300025913 Unclassified 3305
630 Ga0207695_10102855 3300025913 Bacteria 2849
631 Ga0207695_10163172 3300025913 Unclassified 2158
632 Ga0207695_10169693 3300025913 Unclassified 2108
633 Ga0207695_10173796 3300025913 Bacteria 2078
634 Ga0207695_10377002 3300025913 Bacteria 1304
635 Ga0207671_10017277 3300025914 Bacteria 5569
636 Ga0207671_10021931 3300025914 Bacteria 4838
637 Ga0207671_10036388 3300025914 Bacteria 3651
638 Ga0207671_10052496 3300025914 Bacteria 3021
639 Ga0207660_10012897 3300025917 Bacteria 5474
640 Ga0207660_10019519 3300025917 Bacteria 4532
641 Ga0207660_10316966 3300025917 Unclassified 1244
642 Ga0207662_10003470 3300025918 Bacteria 8120
643 Ga0207662_10010254 3300025918 Bacteria 5170
644 Ga0207662_10039592 3300025918 Bacteria 2766
645 Ga0207662_10182555 3300025918 Bacteria 1351
646 Ga0207657_10004759 3300025919 Bacteria 14330
647 Ga0207657_10088541 3300025919 Bacteria 2587
648 Ga0207657_10375185 3300025919 Unclassified 1120
649 Ga0207649_10047194 3300025920 Bacteria 2649
650 Ga0207649_10067064 3300025920 Bacteria 2277
651 Ga0207652_10003282 3300025921 Bacteria 13394
652 Ga0207652_10020903 3300025921 Bacteria 5396
653 Ga0207652_10173993 3300025921 Bacteria 1933
654 Ga0207652_10237024 3300025921 Unclassified 1644
655 Ga0207652_10449403 3300025921 Unclassified 1162
656 Ga0207646_10085333 3300025922 Bacteria 2825
657 Ga0207646_10167566 3300025922 Bacteria 1983
658 Ga0207681_10001189 3300025923 Bacteria 16756
659 Ga0207681_10002783 3300025923 Bacteria 11067
660 Ga0207681_10014104 3300025923 Bacteria 4956
661 Ga0207681_10030400 3300025923 Bacteria 3521
662 Ga0207681_10076646 3300025923 Unclassified 2348
663 Ga0207681_10237119 3300025923 Bacteria 1418
664 Ga0207694_10002185 3300025924 Bacteria 16071
665 Ga0207694_10004422 3300025924 Bacteria 10990
666 Ga0207694_10010532 3300025924 Bacteria 6975
667 Ga0207694_10025618 3300025924 Bacteria 4484
668 Ga0207694_10051810 3300025924 Bacteria 3181
669 Ga0207694_10069761 3300025924 Bacteria 2746
670 Ga0207650_10000510 3300025925 Bacteria 32441
671 Ga0207650_10192535 3300025925 Bacteria 1630
672 Ga0207650_10255919 3300025925 Bacteria 1419
673 Ga0207659_10000406 3300025926 Bacteria 25932
674 Ga0207659_10001544 3300025926 Bacteria 13670
675 Ga0207659_10021429 3300025926 Bacteria 4289
676 Ga0207659_10040497 3300025926 Bacteria 3258
677 Ga0207659_10071013 3300025926 Unclassified 2541
678 Ga0207659_10199160 3300025926 Bacteria 1598
679 Ga0207687_10008146 3300025927 Bacteria 6860
680 Ga0207687_10020100 3300025927 Bacteria 4429
681 Ga0207687_10028830 3300025927 Bacteria 3730
682 Ga0207687_10087112 3300025927 Bacteria 2269
683 Ga0207687_10093899 3300025927 Bacteria 2194
684 Ga0207687_10103150 3300025927 Unclassified 2103
685 Ga0207687_10118133 3300025927 Bacteria 1979
686 Ga0207687_10191354 3300025927 Bacteria 1593
687 Ga0207687_10193413 3300025927 Bacteria 1585
688 Ga0207687_10360949 3300025927 Bacteria 1186
689 Ga0207687_10434738 3300025927 Unclassified 1086
690 Ga0207700_10000647 3300025928 Bacteria 20348
691 Ga0207700_10063912 3300025928 Bacteria 2801
692 Ga0207700_10390856 3300025928 Bacteria 1218
693 Ga0207664_10016657 3300025929 Bacteria 5367
694 Ga0207664_10059041 3300025929 Unclassified 3054
695 Ga0207664_10238272 3300025929 Bacteria 1583
696 Ga0207664_10263842 3300025929 Unclassified 1507
697 Ga0207644_10008275 3300025931 Bacteria 6815
698 Ga0207644_10038363 3300025931 Bacteria 3374
699 Ga0207644_10061465 3300025931 Bacteria 2721
700 Ga0207644_10062961 3300025931 Unclassified 2692
701 Ga0207644_10221293 3300025931 Bacteria 1501
702 Ga0207690_10015894 3300025932 Bacteria 4570
703 Ga0207690_10098485 3300025932 Unclassified 2083
704 Ga0207706_10036652 3300025933 Bacteria 4356
705 Ga0207706_10045911 3300025933 Bacteria 3869
706 Ga0207706_10086552 3300025933 Unclassified 2755
707 Ga0207706_10130953 3300025933 Bacteria 2206
708 Ga0207706_10171870 3300025933 Bacteria 1904
709 Ga0207686_10001173 3300025934 Bacteria 15151
710 Ga0207686_10010878 3300025934 Bacteria 4964
711 Ga0207686_10044969 3300025934 Bacteria 2714
712 Ga0207686_10060332 3300025934 Bacteria 2400
713 Ga0207686_10096020 3300025934 Unclassified 1968
714 Ga0207686_10113719 3300025934 Bacteria 1830
715 Ga0207709_10041625 3300025935 Bacteria 2758
716 Ga0207709_10165569 3300025935 Bacteria 1546
717 Ga0207670_10001976 3300025936 Bacteria 10747
718 Ga0207670_10043533 3300025936 Bacteria 2966
719 Ga0207670_10070524 3300025936 Bacteria 2414
720 Ga0207670_10262870 3300025936 Bacteria 1338
721 Ga0207669_10000834 3300025937 Bacteria 13199
722 Ga0207669_10010564 3300025937 Bacteria 4449
723 Ga0207669_10078011 3300025937 Bacteria 2109
724 Ga0207669_10180958 3300025937 Bacteria 1511
725 Ga0207704_10016397 3300025938 Unclassified 3806
726 Ga0207704_10170130 3300025938 Bacteria 1562
727 Ga0207704_10220204 3300025938 Bacteria 1404
728 Ga0207691_10002846 3300025940 Bacteria 16847
729 Ga0207691_10007867 3300025940 Bacteria 10269
730 Ga0207691_10015722 3300025940 Bacteria 7192
731 Ga0207691_10027418 3300025940 Bacteria 5340
732 Ga0207691_10029846 3300025940 Bacteria 5099
733 Ga0207691_10055709 3300025940 Bacteria 3603
734 Ga0207691_10074840 3300025940 Bacteria 3054
735 Ga0207711_10004826 3300025941 Bacteria 11456
736 Ga0207711_10008634 3300025941 Bacteria 8519
737 Ga0207711_10011678 3300025941 Bacteria 7297
738 Ga0207711_10017341 3300025941 Bacteria 5982
739 Ga0207711_10031262 3300025941 Bacteria 4494
740 Ga0207711_10040080 3300025941 Bacteria 3984
741 Ga0207711_10124129 3300025941 Bacteria 2308
742 Ga0207711_10140317 3300025941 Bacteria 2174
743 Ga0207711_10153260 3300025941 Bacteria 2081
744 Ga0207711_10165265 3300025941 Bacteria 2005
745 Ga0207711_10235959 3300025941 Bacteria 1676
746 Ga0207711_10250000 3300025941 Bacteria 1628
747 Ga0207711_10307037 3300025941 Bacteria 1464
748 Ga0207711_10417827 3300025941 Unclassified 1247
749 Ga0207711_10605107 3300025941 Bacteria 1023
750 Ga0207689_10028011 3300025942 Bacteria 4713
751 Ga0207689_10028147 3300025942 Bacteria 4700
752 Ga0207689_10045229 3300025942 Unclassified 3641
753 Ga0207689_10070739 3300025942 Unclassified 2866
754 Ga0207661_10000014 3300025944 Bacteria 322246
755 Ga0207661_10003445 3300025944 Bacteria 10981
756 Ga0207661_10051668 3300025944 Bacteria 3280
757 Ga0207661_10131293 3300025944 Bacteria 2146
758 Ga0207661_10162110 3300025944 Bacteria 1941
759 Ga0207661_10167815 3300025944 Unclassified 1909
760 Ga0207661_10502444 3300025944 Bacteria 1108
761 Ga0207679_10008015 3300025945 Bacteria 6716
762 Ga0207679_10026100 3300025945 Bacteria 4026
763 Ga0207679_10043006 3300025945 Bacteria 3250
764 Ga0207679_10058493 3300025945 Bacteria 2857
765 Ga0207679_10091233 3300025945 Bacteria 2357
766 Ga0207679_10221065 3300025945 Bacteria 1593
767 Ga0207667_10000682 3300025949 Bacteria 44026
768 Ga0207667_10005221 3300025949 Bacteria 15843
769 Ga0207667_10014682 3300025949 Bacteria 8915
770 Ga0207667_10023929 3300025949 Bacteria 6718
771 Ga0207667_10272111 3300025949 Unclassified 1731
772 Ga0207667_10487076 3300025949 Unclassified 1252
773 Ga0207667_10691963 3300025949 Unclassified 1022
774 Ga0207651_10014979 3300025960 Bacteria 4492
775 Ga0207651_10052352 3300025960 Bacteria 2783
776 Ga0207651_10157069 3300025960 Bacteria 1778
777 Ga0207651_10163968 3300025960 Bacteria 1745
778 Ga0207651_10190054 3300025960 Unclassified 1637
779 Ga0207651_10231764 3300025960 Bacteria 1500
780 Ga0207651_10266721 3300025960 Bacteria 1408
781 Ga0207712_10031512 3300025961 Unclassified 3572
782 Ga0207712_10143758 3300025961 Unclassified 1834
783 Ga0207712_10216910 3300025961 Bacteria 1527
784 Ga0207668_10096930 3300025972 Bacteria 2181
785 Ga0207668_10203514 3300025972 Unclassified 1578
786 Ga0207640_10040764 3300025981 Unclassified 2948
787 Ga0207640_10092541 3300025981 Unclassified 2098
788 Ga0207658_10087645 3300025986 Bacteria 2404
789 Ga0207658_10123421 3300025986 Unclassified 2069
790 Ga0207658_10125042 3300025986 Bacteria 2057
791 Ga0207658_10169281 3300025986 Unclassified 1798
792 Ga0207677_10012852 3300026023 Bacteria 4833
793 Ga0207677_10036784 3300026023 Unclassified 3194
794 Ga0207677_10112647 3300026023 Bacteria 2029
795 Ga0207677_10129705 3300026023 Unclassified 1912
796 Ga0207677_10151753 3300026023 Bacteria 1789
797 Ga0207677_10177838 3300026023 Bacteria 1671
798 Ga0207677_10201256 3300026023 Unclassified 1583
799 Ga0207703_10005810 3300026035 Bacteria 9884
800 Ga0207703_10006792 3300026035 Bacteria 9121
801 Ga0207703_10010459 3300026035 Bacteria 7254
802 Ga0207703_10042382 3300026035 Bacteria 3651
803 Ga0207703_10086190 3300026035 Bacteria 2630
804 Ga0207703_10098044 3300026035 Bacteria 2478
805 Ga0207703_10105486 3300026035 Bacteria 2396
806 Ga0207703_10122403 3300026035 Bacteria 2235
807 Ga0207703_10171140 3300026035 Bacteria 1910
808 Ga0207703_10364836 3300026035 Bacteria 1333
809 Ga0207639_10007173 3300026041 Bacteria 7594
810 Ga0207639_10247590 3300026041 Bacteria 1553
811 Ga0207678_10286078 3300026067 Bacteria 1415
812 Ga0207708_10010013 3300026075 Bacteria 7041
813 Ga0207708_10015215 3300026075 Bacteria 5768
814 Ga0207708_10020342 3300026075 Bacteria 5006
815 Ga0207702_10010003 3300026078 Bacteria 7952
816 Ga0207702_10027031 3300026078 Bacteria 4765
817 Ga0207702_10038722 3300026078 Unclassified 3993
818 Ga0207702_10134529 3300026078 Bacteria 2229
819 Ga0207702_10235584 3300026078 Bacteria 1713
820 Ga0207702_10254628 3300026078 Unclassified 1650
821 Ga0207702_10287600 3300026078 Unclassified 1556
822 Ga0207641_10001693 3300026088 Bacteria 21452
823 Ga0207641_10008647 3300026088 Bacteria 8406
824 Ga0207641_10022405 3300026088 Bacteria 5200
825 Ga0207641_10078131 3300026088 Unclassified 2866
826 Ga0207641_10172170 3300026088 Bacteria 1977
827 Ga0207641_10459548 3300026088 Bacteria 1231
828 Ga0207648_10007406 3300026089 Bacteria 10802
829 Ga0207648_10014545 3300026089 Bacteria 7267
830 Ga0207648_10033812 3300026089 Unclassified 4508
831 Ga0207648_10229747 3300026089 Bacteria 1650
832 Ga0207648_10266198 3300026089 Bacteria 1530
833 Ga0207648_10576949 3300026089 Bacteria 1035
834 Ga0207648_10659308 3300026089 Bacteria 967
835 Ga0207676_10035657 3300026095 Bacteria 3778
836 Ga0207676_10093582 3300026095 Bacteria 2474
837 Ga0207676_10197404 3300026095 Bacteria 1775
838 Ga0207676_10230271 3300026095 Bacteria 1656
839 Ga0207676_10425512 3300026095 Bacteria 1246
840 Ga0207674_10001168 3300026116 Bacteria 34093
841 Ga0207674_10006848 3300026116 Bacteria 13365
842 Ga0207674_10025411 3300026116 Bacteria 6317
843 Ga0207674_10026109 3300026116 Bacteria 6214
844 Ga0207674_10027367 3300026116 Bacteria 6033
845 Ga0207674_10230386 3300026116 Bacteria 1800
846 Ga0207674_10246667 3300026116 Bacteria 1733
847 Ga0207674_10541482 3300026116 Unclassified 1125
848 Ga0207675_100000903 3300026118 Bacteria 29636
849 Ga0207675_100020152 3300026118 Bacteria 6217
850 Ga0207675_100030141 3300026118 Bacteria 5052
851 Ga0207675_100100885 3300026118 Bacteria 2719
852 Ga0207675_100159237 3300026118 Bacteria 2153
853 Ga0207675_100269909 3300026118 Bacteria 1651
854 Ga0207683_10045566 3300026121 Bacteria 3835
855 Ga0207683_10152651 3300026121 Bacteria 2085
856 Ga0207683_10238272 3300026121 Bacteria 1659
857 Ga0207698_10023487 3300026142 Bacteria 4309
858 Ga0207698_10023937 3300026142 Bacteria 4276
859 Ga0209974_10025430 3300027876 Bacteria 1959
860 Ga0207428_10000004 3300027907 Bacteria 727800
861 Ga0207428_10002859 3300027907 Bacteria 17107
862 Ga0207428_10004898 3300027907 Bacteria 12614
863 Ga0207428_10024613 3300027907 Bacteria 5054
864 Ga0207428_10085152 3300027907 Bacteria 2462
865 Ga0207428_10251830 3300027907 Bacteria 1317
866 Ga0207428_10277431 3300027907 Bacteria 1245
867 Ga0268266_10055756 3300028379 Bacteria 3398
868 Ga0268266_10060920 3300028379 Unclassified 3254
869 Ga0268266_10075877 3300028379 Unclassified 2920
870 Ga0268265_10000073 3300028380 Bacteria 128856
871 Ga0268265_10009325 3300028380 Bacteria 6632
872 Ga0268265_10024774 3300028380 Bacteria 4250
873 Ga0268265_10031751 3300028380 Bacteria 3817
874 Ga0268265_10062450 3300028380 Bacteria 2862
875 Ga0268265_10102499 3300028380 Bacteria 2315
876 Ga0268265_10212088 3300028380 Bacteria 1688
877 Ga0268265_10227380 3300028380 Bacteria 1637
878 Ga0268264_10021749 3300028381 Bacteria 5236
879 Ga0268264_10025089 3300028381 Bacteria 4871
880 Ga0268264_10081631 3300028381 Bacteria 2764
881 Ga0268264_10125913 3300028381 Bacteria 2264
882 Ga0268264_10314559 3300028381 Bacteria 1478
883 Ga0268264_10453985 3300028381 Bacteria 1242
884 Ga0265325_10089588 3300031241 Bacteria 1519
885 Ga0265331_10034626 3300031250 Bacteria 2490
886 Ga0265331_10167585 3300031250 Unclassified 995
887 Ga0265316_10059019 3300031344 Unclassified 2986
888 Ga0265314_10000282 3300031711 Bacteria 73865
889 Ga0265314_10016083 3300031711 Bacteria 5923
890 Ga0265314_10145280 3300031711 Bacteria 1461
891 Ga0307405_10020590 3300031731 Bacteria 3689
892 Ga0307416_100024955 3300032002 Bacteria 4374
893 Ga0307414_10292512 3300032004 Bacteria 1374
894 Ga0307411_10155755 3300032005 Bacteria 1704
895 Ga0373948_0000450 3300034817 Bacteria 5115
896 Ga0373950_0000380 3300034818 Bacteria 5493
897 Ga0373958_0009516 3300034819 Bacteria 1601
898 Ga0373938_0002084 3300034957 Bacteria 3215
899 Ga0373926_0073966 3300035083 Unclassified 1254
900 Ga0373929_0000150 3300035085 Bacteria 12080
901 Ga0373940_0025734 3300035088 Bacteria 1534
902 Ga0373944_0038200 3300035089 Unclassified 1474
903 Ga0373949_0000545 3300035090 Bacteria 12424
904 Ga0373951_0001989 3300035091 Bacteria 5237
905 Ga0373952_0000564 3300035092 Bacteria 6542
906 Ga0373932_0001009 3300035112 Bacteria 8146
907 Ga0373932_0012441 3300035112 Unclassified 2096
908 Ga0373936_0023516 3300035113 Unclassified 2402
909 Ga0373941_0001769 3300035115 Unclassified 4649
910 Ga0373954_0016180 3300035118 Bacteria 3337
911 Ga0373956_0019596 3300035119 Bacteria 2870
912 Ga0373960_0000414 3300035121 Bacteria 8361
913 Ga0373943_0009153 3300035170 Bacteria 4439
914 Ga0373943_0115028 3300035170 Unclassified 1423
915 Ga0373946_0001957 3300035171 Bacteria 7205
916 Ga0373946_0084807 3300035171 Bacteria 1394
917 Ga0373946_0203278 3300035171 Bacteria 950
918 Ga0373955_0010717 3300035172 Bacteria 4341
919 Ga0373955_0033486 3300035172 Unclassified 2707
920 Ga0373955_0087911 3300035172 Bacteria 1767
921 Ga0373955_0137629 3300035172 Unclassified 1429
922 Ga0373955_0148216 3300035172 Unclassified 1380
923 Ga0373955_0180283 3300035172 Bacteria 1253
924 Ga0373942_0001464 3300035207 Bacteria 6065
925 Ga0373962_0000549 3300035242 Bacteria 8429
926 Ga0373931_0082874 3300035691 Bacteria 1773
927 Ga0373931_0096874 3300035691 Unclassified 1653
928 Ga0373935_0011426 3300035692 Bacteria 5331
929 Ga0373935_0136733 3300035692 Bacteria 1652
930 Ga0373935_0383354 3300035692 Bacteria 1007
931 Ga0373927_0012421 3300035695 Bacteria 5670
932 Ga0373927_0077234 3300035695 Unclassified 2157
933 Ga0373927_0212399 3300035695 Bacteria 1271
934 Ga0373927_0271469 3300035695 Unclassified 1115
935 Ga0373947_0007354 3300035725 Bacteria 6376
936 Ga0373947_0007636 3300035725 Bacteria 6257
937 Ga0373947_0009077 3300035725 Bacteria 5715
938 Ga0373947_0021219 3300035725 Unclassified 3759
939 Ga0373937_0002587 3300036401 Bacteria 15053
940 Ga0373937_0002894 3300036401 Bacteria 14333
941 Ga0373937_0004569 3300036401 Bacteria 11745
942 Ga0373937_0016270 3300036401 Bacteria 6601
943 Ga0373937_0316107 3300036401 Bacteria 1477
944 Ga0373925_0000762 3300037068 Bacteria 29631
945 Ga0373925_0011459 3300037068 Bacteria 6418
946 Ga0373925_0044686 3300037068 Bacteria 3290
947 Ga0373925_0053724 3300037068 Unclassified 3012
948 Ga0373925_0085342 3300037068 Bacteria 2407
949 Ga0373925_0212877 3300037068 Bacteria 1540
950 Ga0373925_0272102 3300037068 Bacteria 1363
951 Ga0373925_0347378 3300037068 Bacteria 1204
952 Ga0373925_0451110 3300037068 Unclassified 1053
953 Ga0373925_0469260 3300037068 Bacteria 1032
954 Ga0395898_0263372 3300037466 Bacteria 1644
955 Ga0436364_0178301 3300037853 Bacteria 6943
956 Ga0436364_0408279 3300037853 Bacteria 14480
957 Ga0436364_0971922 3300037853 Bacteria 6651
958 Ga0436364_1201673 3300037853 Bacteria 5895
959 Ga0436364_1272981 3300037853 Unclassified 1297
960 Ga0436364_1497633 3300037853 Bacteria 14473
961 Ga0395901_0150281 3300038443 Bacteria 2448
962 Ga0436365_0512859 3300039437 Bacteria 1915
963 Ga0436365_1058523 3300039437 Bacteria 1166
964 Ga0436365_1745652 3300039437 Bacteria 6996
965 Ga0436363_0045077 3300039450 Unclassified 3839
966 Ga0436363_0774504 3300039450 Bacteria 834
967 Ga0436363_1317700 3300039450 Bacteria 1854
968 Ga0439464_0044305 3300042439 Bacteria 1274
969 Ga0451577_0023209 3300042876 Bacteria 5660
970 Ga0466966_0180236 3300044684 Unclassified 1282
971 Ga0453684_0401022 3300044712 Unclassified 1536
972 Ga0451576_0020484 3300045051 Bacteria 7201
973 Ga0451576_0057424 3300045051 Bacteria 4068
974 Ga0451576_0065700 3300045051 Unclassified 3776
975 Ga0451576_0194751 3300045051 Bacteria 2117
976 Ga0451576_0208766 3300045051 Unclassified 2039
977 Ga0466958_0090396 3300045836 Bacteria 1895
978 Ga0495603_0099277 3300046455 Bacteria 1700
979 Ga0495629_0009447 3300046459 Bacteria 7132
980 Ga0495629_0056713 3300046459 Bacteria 2739
981 Ga0495629_0184520 3300046459 Bacteria 1445
982 Ga0495629_0277414 3300046459 Bacteria 1151
983 Ga0495629_0338226 3300046459 Unclassified 1028
984 Ga0495651_0286279 3300046462 Bacteria 1111
985 Ga0495580_0000771 3300046472 Bacteria 27575
986 Ga0495580_0003605 3300046472 Bacteria 13129
987 Ga0495580_0026077 3300046472 Bacteria 4265
988 Ga0495580_0127527 3300046472 Bacteria 1766
989 Ga0495580_0268328 3300046472 Bacteria 1166
990 Ga0495582_0042507 3300046473 Bacteria 2503
991 Ga0495582_0056164 3300046473 Bacteria 2170
992 Ga0495582_0162373 3300046473 Bacteria 1271
993 Ga0495639_0053615 3300046475 Bacteria 1838
994 Ga0495662_0036778 3300046476 Bacteria 2362
995 Ga0495664_0091947 3300046477 Bacteria 1824
996 Ga0495584_0073011 3300046491 Bacteria 1724
997 Ga0495594_0098355 3300046499 Bacteria 1645
998 Ga0495594_0155002 3300046499 Bacteria 1301
999 Ga0495594_0231086 3300046499 Bacteria 1054
1000 Ga0495608_0004305 3300046511 Bacteria 10197
1001 Ga0495608_0105394 3300046511 Bacteria 1815
1002 Ga0495608_0163274 3300046511 Bacteria 1416
1003 Ga0495608_0405121 3300046511 Bacteria 834
1004 Ga0495628_0046355 3300046516 Bacteria 3453
1005 Ga0495628_0119579 3300046516 Bacteria 2022
1006 Ga0495628_0159027 3300046516 Bacteria 1718
1007 Ga0495628_0219415 3300046516 Bacteria 1428
1008 Ga0495630_0004210 3300046517 Bacteria 10077
1009 Ga0495642_0014663 3300046528 Bacteria 3039
1010 Ga0495642_0023888 3300046528 Bacteria 2416
1011 Ga0495652_0034238 3300046529 Bacteria 4428
1012 Ga0495665_0115312 3300046531 Bacteria 1408
1013 Ga0495586_0141346 3300046535 Bacteria 1351
1014 Ga0495587_0001325 3300046536 Bacteria 16452
1015 Ga0495587_0017715 3300046536 Bacteria 4423
1016 Ga0495587_0129094 3300046536 Bacteria 1445
1017 Ga0495598_0040853 3300046537 Bacteria 1354
1018 Ga0495609_0038540 3300046538 Unclassified 2154
1019 Ga0495621_0028633 3300046539 Bacteria 1895
1020 Ga0495621_0029128 3300046539 Bacteria 1881
1021 Ga0495621_0101001 3300046539 Bacteria 1098
1022 Ga0495645_0006385 3300046543 Bacteria 8182
1023 Ga0495645_0026282 3300046543 Bacteria 4225
1024 Ga0495645_0045821 3300046543 Bacteria 3190
1025 Ga0495645_0108987 3300046543 Bacteria 1961
1026 Ga0495633_0077756 3300046558 Bacteria 1545
1027 Ga0495667_0205232 3300046559 Bacteria 1260
1028 Ga0495656_0202141 3300046615 Bacteria 986
1029 Ga0495634_0049275 3300046642 Bacteria 2833
1030 Ga0495634_0172591 3300046642 Bacteria 1358
1031 Ga0495635_0295845 3300046663 Unclassified 1086
1032 Ga0495635_0317550 3300046663 Bacteria 1043
1033 Ga0495635_0338620 3300046663 Bacteria 1005
1034 Ga0495659_0030076 3300046664 Bacteria 1888
1035 Ga0495659_0038486 3300046664 Bacteria 1698
1036 Ga0495599_0033050 3300046678 Bacteria 3250
1037 Ga0495599_0252291 3300046678 Bacteria 1073
1038 Ga0495623_0137651 3300046679 Bacteria 1456
1039 Ga0495623_0166875 3300046679 Bacteria 1289
1040 Ga0495647_0071445 3300046681 Bacteria 1390
1041 Ga0495658_0048935 3300046683 Bacteria 2386
1042 Ga0495658_0076165 3300046683 Bacteria 1960
1043 Ga0495613_0005107 3300046689 Bacteria 9843
1044 Ga0495613_0041186 3300046689 Unclassified 3421
1045 Ga0495613_0088183 3300046689 Bacteria 2248
1046 Ga0495613_0213060 3300046689 Bacteria 1358
1047 Ga0495670_0203205 3300046691 Bacteria 1050
1048 Ga0495600_0263893 3300046809 Bacteria 1093
1049 Ga0495581_0084101 3300047315 Bacteria 1844
1050 Ga0495604_0022036 3300047317 Bacteria 5086
1051 Ga0495604_0078580 3300047317 Bacteria 2476
1052 Ga0495604_0168574 3300047317 Bacteria 1542
1053 Ga0495636_0009861 3300047318 Unclassified 3762
1054 Ga0495674_0037171 3300047319 Bacteria 4376
1055 Ga0495674_0079388 3300047319 Bacteria 2818
1056 Ga0495674_0155939 3300047319 Unclassified 1913
1057 Ga0495674_0198484 3300047319 Bacteria 1665
1058 Ga0495674_0217172 3300047319 Bacteria 1582
1059 Ga0495674_0238138 3300047319 Bacteria 1500
1060 Ga0495674_0285775 3300047319 Bacteria 1350
1061 Ga0495674_0454403 3300047319 Bacteria 1029
1062 Ga0495676_0088008 3300047321 Bacteria 2331
1063 Ga0495680_0046904 3300047322 Bacteria 3404
1064 Ga0495685_022850 3300047447 Bacteria 2152
1065 Ga0495684_0001265 3300047471 Bacteria 20345
1066 Ga0495684_0012461 3300047471 Bacteria 6554
1067 Ga0495684_0036331 3300047471 Unclassified 3778
1068 Ga0495684_0089673 3300047471 Unclassified 2330
1069 Ga0495686_0035823 3300047472 Bacteria 3187
1070 Ga0495602_0004904 3300048088 Bacteria 14007
1071 Ga0495602_0077780 3300048088 Bacteria 2805
1072 Ga0495602_0127546 3300048088 Bacteria 2035
1073 Ga0496100_0036898 3300048903 Bacteria 3086
1074 Ga0496100_0203848 3300048903 Bacteria 1443
1075 Ga0496101_0000265 3300048904 Bacteria 37211
1076 Ga0496101_0105661 3300048904 Bacteria 2113
1077 Ga0496101_0225649 3300048904 Bacteria 1455
1078 Ga0496102_0002617 3300048905 Bacteria 15301
1079 Ga0496102_0254704 3300048905 Bacteria 1655
1080 Ga0496102_0438860 3300048905 Bacteria 1225
1081 Ga0496103_0011791 3300048906 Bacteria 5185
1082 Ga0496104_0004942 3300048907 Bacteria 11632
1083 Ga0496104_0019182 3300048907 Bacteria 6253
1084 Ga0496104_0142928 3300048907 Bacteria 2299
1085 Ga0496104_0194026 3300048907 Bacteria 1943
1086 Ga0496104_0284201 3300048907 Bacteria 1567
1087 Ga0496105_0205897 3300048908 Bacteria 1605
1088 Ga0496106_0218919 3300048909 Bacteria 1518
1089 Ga0496107_0091134 3300048910 Bacteria 2228
1090 Ga0496107_0106462 3300048910 Bacteria 2060
1091 Ga0496108_0022389 3300048911 Bacteria 5194
1092 Ga0496108_0082881 3300048911 Bacteria 2720
1093 Ga0496108_0281663 3300048911 Bacteria 1447
1094 Ga0496108_0495195 3300048911 Bacteria 1067
1095 Ga0496109_0647409 3300048912 Bacteria 994
1096 Ga0496110_0033272 3300048913 Bacteria 4458
1097 Ga0496110_0266725 3300048913 Unclassified 1559
1098 Ga0496110_0638210 3300048913 Unclassified 964
1099 Ga0496112_0051299 3300048915 Bacteria 4046
1100 Ga0496112_0170463 3300048915 Bacteria 2142
1101 Ga0496112_0204062 3300048915 Bacteria 1935
1102 Ga0496112_0315525 3300048915 Bacteria 1508
1103 Ga0496113_0270877 3300048916 Bacteria 1357
1104 Ga0496114_0015693 3300048917 Bacteria 6094
1105 Ga0496114_0114805 3300048917 Bacteria 2310
1106 Ga0496114_0122487 3300048917 Bacteria 2238
1107 Ga0496114_0456491 3300048917 Unclassified 1131
1108 Ga0496114_0531378 3300048917 Bacteria 1040
1109 Ga0496115_0007253 3300048918 Bacteria 8148
1110 Ga0496115_0123316 3300048918 Unclassified 2133
1111 Ga0496115_0203092 3300048918 Bacteria 1637
1112 Ga0496115_0445417 3300048918 Bacteria 1047
1113 Ga0501031_0187919 3300049568 Bacteria 1349
1114 Ga0501033_0017141 3300049570 Bacteria 5475
1115 Ga0501033_0096511 3300049570 Bacteria 2160
1116 Ga0501033_0133453 3300049570 Bacteria 1797
1117 Ga0501034_0008331 3300049571 Bacteria 10968
1118 Ga0501034_0013294 3300049571 Bacteria 8481
1119 Ga0501034_0027792 3300049571 Bacteria 5752
1120 Ga0501036_0027919 3300049572 Bacteria 4772
1121 Ga0501036_0259705 3300049572 Bacteria 1455
1122 Ga0501037_0055512 3300049573 Bacteria 2896
1123 Ga0501038_0150436 3300049574 Bacteria 1898
1124 Ga0501038_0404621 3300049574 Bacteria 1055
1125 Ga0501040_0001451 3300049576 Bacteria 15024
1126 Ga0501041_0005102 3300049577 Bacteria 7660
1127 Ga0501042_0004730 3300049578 Bacteria 8689
1128 Ga0501043_0254361 3300049579 Bacteria 1352
1129 Ga0501046_0004861 3300049580 Bacteria 12108
1130 Ga0501046_0169637 3300049580 Bacteria 1638
1131 Ga0501047_0000576 3300049581 Bacteria 39085
1132 Ga0501047_0013887 3300049581 Bacteria 7649
1133 Ga0501047_0055104 3300049581 Bacteria 3845
1134 Ga0501047_0160960 3300049581 Bacteria 2116
1135 Ga0501047_0328690 3300049581 Unclassified 1367
1136 Ga0501048_0133180 3300049582 Bacteria 1756
1137 Ga0501048_0149663 3300049582 Bacteria 1651
1138 Ga0501068_0018630 3300049584 Bacteria 4020
1139 Ga0501068_0117276 3300049584 Bacteria 1658
1140 Ga0501070_0039651 3300049586 Bacteria 3928
1141 Ga0501071_0212509 3300049587 Bacteria 1455
1142 Ga0501071_0431053 3300049587 Bacteria 1008
1143 Ga0501072_0010360 3300049588 Bacteria 7104
1144 Ga0501072_0018434 3300049588 Bacteria 5375
1145 Ga0501072_0062100 3300049588 Bacteria 2947
1146 Ga0501073_0040027 3300049589 Bacteria 3319
1147 Ga0501073_0107616 3300049589 Bacteria 1934
1148 Ga0501073_0178321 3300049589 Bacteria 1470
1149 Ga0501074_0373712 3300049590 Bacteria 1011
1150 Ga0501075_0002638 3300049591 Bacteria 11981
1151 Ga0501075_0403214 3300049591 Bacteria 1042
1152 Ga0501076_0001642 3300049592 Bacteria 15089
1153 Ga0501076_0401396 3300049592 Bacteria 1127
1154 Ga0501077_0188379 3300049593 Bacteria 1311
1155 Ga0501079_0004650 3300049741 Bacteria 10169
1156 Ga0501080_0000677 3300049742 Bacteria 27199
1157 Ga0501080_0020482 3300049742 Bacteria 6124
1158 Ga0501080_0039210 3300049742 Bacteria 4421
1159 Ga0501080_0286159 3300049742 Bacteria 1497
1160 Ga0501081_0001295 3300049743 Bacteria 15234
1161 Ga0501083_0038294 3300049744 Bacteria 3260
1162 Ga0501035_0016276 3300049822 Bacteria 6861
1163 Ga0501035_0128546 3300049822 Bacteria 2210
1164 Ga0501035_0388589 3300049822 Bacteria 1163
1165 Ga0501044_0001104 3300049823 Bacteria 32100
1166 Ga0501044_0010087 3300049823 Bacteria 10265
1167 Ga0501044_0013798 3300049823 Bacteria 8732
1168 Ga0501044_0016247 3300049823 Bacteria 7999
1169 Ga0501044_0056134 3300049823 Unclassified 4043
1170 Ga0501045_0004406 3300049824 Bacteria 9716
1171 Ga0501045_0149818 3300049824 Bacteria 1735
1172 Ga0501045_0268330 3300049824 Bacteria 1271
1173 nmdc:mga03n38_11295_c1 3300050490 Bacteria 3321
1174 nmdc:mga06z11_144380_c1 3300050494 Bacteria 1348
1175 nmdc:mga05p37_127391_c1 3300050507 Bacteria 3126
1176 nmdc:mga05p37_326993_c1 3300050507 Bacteria 1812
1177 nmdc:mga05p37_329824_c1 3300050507 Bacteria 1803
1178 nmdc:mga05p37_33160_c1 3300050507 Bacteria 6324
1179 nmdc:mga05p37_38883_c1 3300050507 Bacteria 5836
1180 nmdc:mga05p37_4007_c1 3300050507 Bacteria 17218
1181 nmdc:mga05p37_401748_c1 3300050507 Unclassified 1600
1182 nmdc:mga05p37_404966_c1 3300050507 Bacteria 1592
1183 nmdc:mga05p37_406636_c1 3300050507 Bacteria 1588
1184 nmdc:mga05p37_47432_c1 3300050507 Bacteria 5283
1185 nmdc:mga05p37_47724_c1 3300050507 Bacteria 5266
1186 nmdc:mga05p37_55752_c1 3300050507 Bacteria 4865
1187 nmdc:mga05p37_68776_c1 3300050507 Unclassified 4355
1188 nmdc:mga05p37_68999_c1 3300050507 Unclassified 4348
1189 nmdc:mga09592_234650_c1 3300050508 Bacteria 1589
1190 nmdc:mga09592_53824_c1 3300050508 Bacteria 3399
1191 nmdc:mga09592_53835_c1 3300050508 Unclassified 3399
1192 nmdc:mga09592_71329_c1 3300050508 Unclassified 2949
1193 nmdc:mga0qj67_3423_c1 3300050509 Bacteria 11430
1194 nmdc:mga0qj67_5449_c1 3300050509 Bacteria 9296
1195 nmdc:mga06r32_202025_c1 3300050510 Unclassified 1975
1196 nmdc:mga06r32_311689_c1 3300050510 Unclassified 1559
1197 nmdc:mga06r32_42870_c1 3300050510 Bacteria 4305
1198 nmdc:mga06r32_7066_c1 3300050510 Bacteria 10102
1199 nmdc:mga06r32_79019_c1 3300050510 Bacteria 3199
1200 nmdc:mga06r32_8356_c1 3300050510 Bacteria 9321
1201 nmdc:mga08y16_130757_c1 3300050511 Unclassified 2611
1202 nmdc:mga08y16_17948_c1 3300050511 Bacteria 7454
1203 nmdc:mga08y16_192350_c1 3300050511 Bacteria 2116
1204 nmdc:mga08y16_212473_c1 3300050511 Bacteria 2004
1205 nmdc:mga08y16_271660_c1 3300050511 Bacteria 1750
1206 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
1207 nmdc:mga08y16_42960_c1 3300050511 Bacteria 4735
1208 nmdc:mga08y16_42987_c1 3300050511 Bacteria 4733
1209 nmdc:mga08y16_651580_c1 3300050511 Bacteria 1057
1210 nmdc:mga0n895_136171_c1 3300050512 Bacteria 2483
1211 nmdc:mga0n895_13653_c1 3300050512 Bacteria 7341
1212 nmdc:mga0n895_186291_c1 3300050512 Bacteria 2106
1213 nmdc:mga0n895_209109_c1 3300050512 Bacteria 1982
1214 nmdc:mga0n895_21247_c1 3300050512 Bacteria 6065
1215 nmdc:mga0n895_223264_c1 3300050512 Bacteria 1912
1216 nmdc:mga0n895_285268_c1 3300050512 Bacteria 1674
1217 nmdc:mga0n895_327727_c1 3300050512 Bacteria 1552
1218 nmdc:mga0n895_360588_c1 3300050512 Unclassified 1472
1219 nmdc:mga0n895_391990_c1 3300050512 Bacteria 1405
1220 nmdc:mga0n895_47808_c1 3300050512 Bacteria 4185
1221 nmdc:mga0n895_48_c1 3300050512 Bacteria 73654
1222 nmdc:mga0n895_505331_c1 3300050512 Bacteria 1217
1223 nmdc:mga0n895_54857_c1 3300050512 Bacteria 3921
1224 nmdc:mga0n895_649028_c1 3300050512 Unclassified 1054
1225 nmdc:mga0n895_8605_c1 3300050512 Bacteria 8852
1226 nmdc:mga0rr50_172709_c1 3300050513 Bacteria 1762
1227 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
1228 nmdc:mga0rr50_270265_c1 3300050513 Bacteria 1417
1229 nmdc:mga0rr50_305211_c1 3300050513 Bacteria 1332
1230 nmdc:mga0rr50_32599_c1 3300050513 Bacteria 3714
1231 nmdc:mga0rr50_327101_c1 3300050513 Bacteria 1286
1232 nmdc:mga0rr50_334367_c1 3300050513 Bacteria 1272
1233 nmdc:mga0rr50_371598_c1 3300050513 Unclassified 1205
1234 nmdc:mga0rr50_381301_c1 3300050513 Bacteria 1189
1235 nmdc:mga0rr50_40311_c1 3300050513 Unclassified 3394
1236 nmdc:mga0rr50_40598_c1 3300050513 Bacteria 3385
1237 nmdc:mga0rr50_453554_c1 3300050513 Bacteria 1087
1238 nmdc:mga0rr50_488547_c1 3300050513 Bacteria 1046
1239 nmdc:mga0rr50_5382_c1 3300050513 Bacteria 7630
1240 nmdc:mga0rr50_713524_c1 3300050513 Bacteria 856
1241 nmdc:mga08x19_143_c1 3300050514 Bacteria 62934
1242 nmdc:mga08x19_174837_c1 3300050514 Bacteria 1464
1243 nmdc:mga08x19_367357_c1 3300050514 Bacteria 1006
1244 nmdc:mga0a205_120493_c1 3300050515 Bacteria 2523
1245 nmdc:mga0a205_182498_c1 3300050515 Unclassified 1992
1246 nmdc:mga0a205_208027_c1 3300050515 Bacteria 1846
1247 nmdc:mga0a205_247261_c1 3300050515 Unclassified 1664
1248 nmdc:mga0a205_260920_c1 3300050515 Unclassified 1610
1249 nmdc:mga0a205_265420_c1 3300050515 Bacteria 1594
1250 nmdc:mga0a205_37628_c1 3300050515 Bacteria 4653
1251 nmdc:mga0a205_4847_c1 3300050515 Bacteria 12098
1252 nmdc:mga0a205_52285_c1 3300050515 Bacteria 3943
1253 nmdc:mga0a205_70329_c1 3300050515 Bacteria 3379
1254 nmdc:mga0a205_85246_c1 3300050515 Bacteria 3051
1255 nmdc:mga0a205_96889_c1 3300050515 Bacteria 2849
1256 Ga0495601_0012733 3300053077 Bacteria 5047
1257 Ga0495601_0075055 3300053077 Bacteria 2164
1258 Ga0495601_0143368 3300053077 Bacteria 1559
1259 Ga0495619_0001690 3300053085 Bacteria 14594
1260 Ga0500595_016237 3300053119 Bacteria 2777
1261 Ga0500652_000019 3300053131 Bacteria 120149
1262 Ga0500636_0018424 3300053177 Bacteria 4129
1263 Ga0501084_0373432 3300054114 Bacteria 1205
1264 Ga0501082_0005140 3300060353 Bacteria 11391
1265 Ga0530510_0038969 3300061734 Bacteria 3431
1266 Ga0373953_0035615
1267 JGI25406J46586_10000119
1268 JGI25406J46586_10005975
1269 Ga0058859_11818552
1270 Ga0058863_11917217
1271 Ga0058861_11260298
1272 Ga0058860_12121912
1273 Ga0058862_12607417
1274 Ga0065712_10242818
1275 Ga0065715_10001683
1276 Ga0065715_10228106
1277 Ga0065707_10005960
1278 Ga0065707_10098319
1279 Ga0065707_10256145
1280 Ga0070658_10168557
1281 Ga0070676_10012701
1282 Ga0070676_10024880
1283 Ga0070676_10080790
1284 Ga0070683_100000003
1285 Ga0070683_100061543
1286 Ga0070683_100107191
1287 Ga0070683_100140613
1288 Ga0070683_100198932
1289 Ga0070690_100023683
1290 Ga0070690_100231062
1291 Ga0070670_100010911
1292 Ga0070670_100194535
1293 Ga0070670_100229889
1294 Ga0070677_10002416
1295 Ga0070677_10075317
1296 Ga0068869_100033702
1297 Ga0068869_100130032
1298 Ga0068869_100504095
1299 Ga0070666_10000425
1300 Ga0070666_10001250
1301 Ga0070666_10006737
1302 Ga0070666_10014622
1303 Ga0070666_10053199
1304 Ga0070666_10068703
1305 Ga0070680_100016531
1306 Ga0070682_100110235
1307 Ga0068868_100017351
1308 Ga0068868_100019353
1309 Ga0068868_100026769
1310 Ga0068868_100102997
1311 Ga0068868_100432475
1312 Ga0070660_100013374
1313 Ga0070660_100079605
1314 Ga0070660_100515219
1315 Ga0070689_100020029
1316 Ga0070689_100030902
1317 Ga0070689_100047269
1318 Ga0070689_100055601
1319 Ga0070689_100084488
1320 Ga0070689_100444668
1321 Ga0070691_10007935
1322 Ga0070691_10012595
1323 Ga0070687_100012661
1324 Ga0070687_100013402
1325 Ga0070687_100038203
1326 Ga0070661_100007019
1327 Ga0070661_100044735
1328 Ga0070668_100073197
1329 Ga0070668_100230204
1330 Ga0070669_100002792
1331 Ga0070669_100010531
1332 Ga0070669_100024037
1333 Ga0070669_100031975
1334 Ga0070669_100256598
1335 Ga0070675_100001488
1336 Ga0070675_100042270
1337 Ga0070675_100062365
1338 Ga0070675_100188459
1339 Ga0070675_100280275
1340 Ga0070675_100295559
1341 Ga0070671_100004399
1342 Ga0070671_100004706
1343 Ga0070671_100081316
1344 Ga0070674_100003670
1345 Ga0070674_100029420
1346 Ga0070674_100139600
1347 Ga0070673_100068478
1348 Ga0070673_100123135
1349 Ga0070673_100153675
1350 Ga0070673_100158260
1351 Ga0070688_100015938
1352 Ga0070688_100053675
1353 Ga0070688_100218979
1354 Ga0070659_100067799
1355 Ga0070667_100003388
1356 Ga0070667_100045080
1357 Ga0070667_100092577
1358 Ga0070667_100192714
1359 Ga0070703_10057257
1360 Ga0070709_10093290
1361 Ga0070709_10109666
1362 Ga0070714_100009111
1363 Ga0070714_100206452
1364 Ga0070713_100001622
1365 Ga0070713_100002857
1366 Ga0070713_100102671
1367 Ga0070713_100106740
1368 Ga0070701_10015238
1369 Ga0070701_10023753
1370 Ga0070701_10046287
1371 Ga0070711_100067047
1372 Ga0070711_100127601
1373 Ga0070705_100007521
1374 Ga0070705_100011019
1375 Ga0070700_100050592
1376 Ga0070700_100171759
1377 Ga0070694_100002259
1378 Ga0070694_100061191
1379 Ga0070694_100133560
1380 Ga0070694_100196867
1381 Ga0070708_100052221
1382 Ga0070708_100360243
1383 Ga0070663_100332451
1384 Ga0070678_100131873
1385 Ga0070678_100345810
1386 Ga0070678_100582231
1387 Ga0070662_100026566
1388 Ga0070662_100047164
1389 Ga0070662_100153790
1390 Ga0070681_10031838
1391 Ga0070681_10083225
1392 Ga0070681_10106266
1393 Ga0070681_10270347
1394 Ga0070681_10411811
1395 Ga0068867_100038870
1396 Ga0068867_100220084
1397 Ga0068867_100617348
1398 Ga0070685_10008639
1399 Ga0070685_10332208
1400 Ga0070707_100036513
1401 Ga0070707_100115866
1402 Ga0070698_100029222
1403 Ga0070698_100120781
1404 Ga0070699_100001327
1405 Ga0070699_100008993
1406 Ga0070699_100105270
1407 Ga0070699_100136495
1408 Ga0070699_100258468
1409 Ga0070679_100000302
1410 Ga0070679_100043673
1411 Ga0070679_100046043
1412 Ga0070679_100529536
1413 Ga0070684_100000014
1414 Ga0070684_100002999
1415 Ga0070684_100012985
1416 Ga0070684_100094925
1417 Ga0070684_100351087
1418 Ga0070697_100020675
1419 Ga0070697_100116941
1420 Ga0068853_100002146
1421 Ga0070672_100007627
1422 Ga0070672_100070432
1423 Ga0070672_100077832
1424 Ga0070672_100080430
1425 Ga0070672_100131831
1426 Ga0070672_100180056
1427 Ga0070672_100209187
1428 Ga0070672_100249078
1429 Ga0070686_100000149
1430 Ga0070686_100013516
1431 Ga0070686_100223620
1432 Ga0070686_100453832
1433 Ga0070695_100023341
1434 Ga0070695_100060209
1435 Ga0070695_100060895
1436 Ga0070695_100275229
1437 Ga0070696_100021367
1438 Ga0070696_100025110
1439 Ga0070696_100026932
1440 Ga0070696_100119566
1441 Ga0070693_100026839
1442 Ga0070665_100006507
1443 Ga0070665_100024170
1444 Ga0070665_100040388
1445 Ga0070665_100054433
1446 Ga0070665_100121382
1447 Ga0070665_100235929
1448 Ga0070704_100003359
1449 Ga0070704_100061746
1450 Ga0070704_100100767
1451 Ga0070704_100114264
1452 Ga0070704_100311448
1453 Ga0068855_100002984
1454 Ga0068855_100017262
1455 Ga0068855_100031217
1456 Ga0068855_100059840
1457 Ga0068855_100494631
1458 Ga0068855_100502014
1459 Ga0070664_100000492
1460 Ga0070664_100001335
1461 Ga0070664_100040409
1462 Ga0070664_100122511
1463 Ga0070664_100179807
1464 Ga0070664_100258120
1465 Ga0070664_100317916
1466 Ga0068857_100002613
1467 Ga0068857_100011187
1468 Ga0068857_100047722
1469 Ga0068857_100052484
1470 Ga0068857_100130673
1471 Ga0068857_100160266
1472 Ga0068857_100300944
1473 Ga0068854_100021164
1474 Ga0068854_100046159
1475 Ga0068856_100001937
1476 Ga0068856_100004199
1477 Ga0068856_100015788
1478 Ga0068856_100115313
1479 Ga0068856_100128318
1480 Ga0068856_100205807
1481 Ga0068856_100607880
1482 Ga0070702_100003201
1483 Ga0070702_100201444
1484 Ga0070702_100211549
1485 Ga0068852_100001781
1486 Ga0068852_100035743
1487 Ga0068852_100158401
1488 Ga0068859_100004134
1489 Ga0068859_100004521
1490 Ga0068859_100030564
1491 Ga0068859_100033211
1492 Ga0068859_100081354
1493 Ga0068859_100081997
1494 Ga0068859_100147305
1495 Ga0068859_100272424
1496 Ga0068859_100640873
1497 Ga0068864_100002489
1498 Ga0068864_100023269
1499 Ga0068864_100025597
1500 Ga0068864_100059439
1501 Ga0068864_100249290
1502 Ga0068864_100422580
1503 Ga0068866_10048247
1504 Ga0068861_100018284
1505 Ga0068861_100043183
1506 Ga0068861_100069471
1507 Ga0068861_100163980
1508 Ga0068861_100318858
1509 Ga0068851_10097203
1510 Ga0068870_10013371
1511 Ga0068870_10014953
1512 Ga0068863_100005664
1513 Ga0068863_100008318
1514 Ga0068863_100040394
1515 Ga0068863_100474395
1516 Ga0068863_100555617
1517 Ga0068858_100002905
1518 Ga0068858_100005100
1519 Ga0068858_100008332
1520 Ga0068858_100052419
1521 Ga0068858_100108057
1522 Ga0068858_100135568
1523 Ga0068858_100148751
1524 Ga0068858_100152695
1525 Ga0068858_100218074
1526 Ga0068858_100241234
1527 Ga0068858_100473576
1528 Ga0068858_100480116
1529 Ga0068860_100031160
1530 Ga0068860_100038063
1531 Ga0068860_100044555
1532 Ga0068860_100246495
1533 Ga0068862_100000840
1534 Ga0068862_100005392
1535 Ga0068862_100016263
1536 Ga0068862_100036118
1537 Ga0068862_100045111
1538 Ga0068862_100074584
1539 Ga0068862_100124832
1540 Ga0068862_100240398
1541 Ga0068862_100694614
1542 Ga0068862_100695032
1543 Ga0081539_10000017
1544 Ga0081539_10000285
1545 Ga0081539_10047920
1546 Ga0081539_10057486
1547 Ga0081539_10122253
1548 Ga0070717_10096581
1549 Ga0070717_10157115
1550 Ga0075368_10011931
1551 Ga0075363_100010441
1552 Ga0070716_100056446
1553 Ga0070716_100350595
1554 Ga0075369_10038930
1555 Ga0097621_100005426
1556 Ga0097621_100010218
1557 Ga0097621_100028334
1558 Ga0097621_100071850
1559 Ga0097621_100089762
1560 Ga0097621_100130326
1561 Ga0097621_100135694
1562 Ga0097621_100176074
1563 Ga0097621_100192714
1564 Ga0097621_100311238
1565 Ga0097621_100341509
1566 Ga0097621_100401340
1567 Ga0097621_100598170
1568 Ga0097621_100748161
1569 Ga0068871_100029054
1570 Ga0068871_100042327
1571 Ga0068871_100047644
1572 Ga0068871_100049292
1573 Ga0068871_100084470
1574 Ga0068871_100085655
1575 Ga0068871_100090586
1576 Ga0068871_100110220
1577 Ga0068871_100142932
1578 Ga0075428_100000056
1579 Ga0075428_100015436
1580 Ga0075428_100016708
1581 Ga0075428_100019016
1582 Ga0075428_100019500
1583 Ga0075428_100101266
1584 Ga0075428_100185876
1585 Ga0075428_100233308
1586 Ga0075428_100260483
1587 Ga0075428_100405430
1588 Ga0075430_100001665
1589 Ga0075430_100040576
1590 Ga0075430_100053941
1591 Ga0075431_100005129
1592 Ga0075431_100014576
1593 Ga0075431_100053866
1594 Ga0075431_100072135
1595 Ga0075431_100110346
1596 Ga0075431_100153962
1597 Ga0075431_100378490
1598 Ga0075433_10006669
1599 Ga0075433_10015777
1600 Ga0075433_10277688
1601 Ga0075433_10409953
1602 Ga0075433_10628909
1603 Ga0075434_100008968
1604 Ga0075434_100010775
1605 Ga0075434_100018968
1606 Ga0075434_100022212
1607 Ga0075434_100031745
1608 Ga0075434_100031834
1609 Ga0075434_100032945
1610 Ga0075434_100053344
1611 Ga0075434_100055569
1612 Ga0075434_100261397
1613 Ga0075434_100297381
1614 Ga0075434_100821008
1615 Ga0075429_100005206
1616 Ga0075429_100006221
1617 Ga0075429_100070194
1618 Ga0075429_100070915
1619 Ga0075429_100117368
1620 Ga0075429_100268238
1621 Ga0075429_100270228
1622 Ga0068865_100066595
1623 Ga0068865_100073886
1624 Ga0068865_100086615
1625 Ga0068865_100193177
1626 Ga0075436_100001549
1627 Ga0075436_100211917
1628 Ga0075436_100365852
1629 Ga0097620_100004134
1630 Ga0097620_100004521
1631 Ga0097620_100030564
1632 Ga0097620_100033210
1633 Ga0097620_100081361
1634 Ga0097620_100082001
1635 Ga0097620_100147305
1636 Ga0097620_100272427
1637 Ga0097620_100640828
1638 Ga0075435_100000010
1639 Ga0075435_100003072
1640 Ga0075435_100003595
1641 Ga0075435_100007095
1642 Ga0075435_100031895
1643 Ga0075435_100056213
1644 Ga0075435_100095310
1645 Ga0075435_100131640
1646 Ga0075435_100164768
1647 Ga0075435_100184670
1648 Ga0075435_100458917
1649 Ga0105240_10003771
1650 Ga0105240_10007340
1651 Ga0105240_10045239
1652 Ga0105240_10048104
1653 Ga0105240_10110389
1654 Ga0105240_10158316
1655 Ga0105240_10454561
1656 Ga0105240_10618847
1657 Ga0105240_10958827
1658 Ga0111539_10000002
1659 Ga0111539_10005233
1660 Ga0111539_10010564
1661 Ga0111539_10010813
1662 Ga0111539_10036295
1663 Ga0111539_10037657
1664 Ga0111539_10080094
1665 Ga0111539_10350141
1666 Ga0111539_10621840
1667 Ga0105245_10000947
1668 Ga0105245_10005502
1669 Ga0105245_10006166
1670 Ga0105245_10008147
1671 Ga0105245_10089627
1672 Ga0105245_10102648
1673 Ga0105245_10105997
1674 Ga0105245_10121187
1675 Ga0105245_10137756
1676 Ga0105245_10149288
1677 Ga0105245_10256690
1678 Ga0105247_10016166
1679 Ga0105247_10071535
1680 Ga0114129_10002802
1681 Ga0114129_10004604
1682 Ga0114129_10018430
1683 Ga0114129_10033579
1684 Ga0114129_10046527
1685 Ga0114129_10048496
1686 Ga0114129_10048880
1687 Ga0114129_10057309
1688 Ga0114129_10065314
1689 Ga0114129_10065470
1690 Ga0114129_10097308
1691 Ga0114129_10150757
1692 Ga0114129_10151640
1693 Ga0114129_10190346
1694 Ga0114129_10238897
1695 Ga0114129_10266368
1696 Ga0114129_10599768
1697 Ga0114129_10837141
1698 Ga0105243_10024153
1699 Ga0105243_10048536
1700 Ga0105241_10001247
1701 Ga0105241_10040992
1702 Ga0105241_10053952
1703 Ga0105241_10070832
1704 Ga0105241_10225951
1705 Ga0105241_10386439
1706 Ga0105242_10002034
1707 Ga0105242_10067925
1708 Ga0105242_10138527
1709 Ga0105242_10314848
1710 Ga0105242_10426204
1711 Ga0105248_10000732
1712 Ga0105248_10004514
1713 Ga0105248_10011483
1714 Ga0105248_10020051
1715 Ga0105248_10029385
1716 Ga0105248_10050486
1717 Ga0105248_10052260
1718 Ga0105248_10053042
1719 Ga0105248_10059938
1720 Ga0105248_10065126
1721 Ga0105248_10076703
1722 Ga0105248_10094858
1723 Ga0105248_10182136
1724 Ga0105248_10187783
1725 Ga0105248_10226971
1726 Ga0105248_10269216
1727 Ga0105248_10278253
1728 Ga0105248_10365662
1729 Ga0105248_10752451
1730 Ga0105248_10779011
1731 Ga0105237_10005644
1732 Ga0105237_10011307
1733 Ga0105237_10014420
1734 Ga0105237_10015435
1735 Ga0105237_10066658
1736 Ga0105238_10002827
1737 Ga0105238_10012423
1738 Ga0105238_10028958
1739 Ga0105238_10065680
1740 Ga0105238_10162867
1741 Ga0105238_10167970
1742 Ga0105249_10000823
1743 Ga0105249_10085317
1744 Ga0105249_10090363
1745 Ga0105239_10007060
1746 Ga0105239_10021625
1747 Ga0105239_10192899
1748 Ga0105239_10226954
1749 Ga0105239_10228268
1750 Ga0105239_10489206
1751 Ga0105239_10818561
1752 Ga0105246_10018784
1753 Ga0105246_10031268
1754 Ga0105246_10040295
1755 Ga0105246_10344619
1756 Ga0157373_10038552
1757 Ga0157371_10152094
1758 Ga0157370_10002040
1759 Ga0157370_10004725
1760 Ga0157370_10007265
1761 Ga0157370_10168440
1762 Ga0157370_10353347
1763 Ga0157369_10002554
1764 Ga0157369_10013404
1765 Ga0157369_10025201
1766 Ga0157369_10034298
1767 Ga0157369_10066560
1768 Ga0157369_10132585
1769 Ga0157369_10321202
1770 Ga0157369_10568733
1771 Ga0157374_10015334
1772 Ga0157374_10016451
1773 Ga0157374_10020467
1774 Ga0157374_10035463
1775 Ga0157374_10087838
1776 Ga0157374_10527156
1777 Ga0157378_10005441
1778 Ga0157378_10009756
1779 Ga0157378_10050722
1780 Ga0157378_10067391
1781 Ga0157378_10231845
1782 Ga0157378_10291065
1783 Ga0157378_10386674
1784 Ga0157378_10410116
1785 Ga0157378_10550282
1786 Ga0163162_10000523
1787 Ga0163162_10008601
1788 Ga0163162_10013410
1789 Ga0163162_10016225
1790 Ga0163162_10048770
1791 Ga0163162_10080122
1792 Ga0163162_10181237
1793 Ga0163162_10554270
1794 Ga0163162_10584113
1795 Ga0157372_10020520
1796 Ga0157372_10101349
1797 Ga0157372_10114613
1798 Ga0157372_10135551
1799 Ga0157372_11069439
1800 Ga0157375_10002834
1801 Ga0157375_10065990
1802 Ga0157375_10088975
1803 Ga0157375_10268882
1804 Ga0157375_10533902
1805 Ga0157375_10772588
1806 Ga0157375_11059228
1807 Ga0163163_10000519
1808 Ga0163163_10012292
1809 Ga0163163_10025838
1810 Ga0163163_10027913
1811 Ga0163163_10039336
1812 Ga0163163_10047478
1813 Ga0163163_10074324
1814 Ga0163163_10292684
1815 Ga0163163_10551027
1816 Ga0163163_10569450
1817 Ga0157380_10002501
1818 Ga0157380_10010757
1819 Ga0157380_10031559
1820 Ga0157380_10215357
1821 Ga0157380_10251604
1822 Ga0157380_10550328
1823 Ga0157377_10014582
1824 Ga0157377_10027036
1825 Ga0157377_10052001
1826 Ga0157377_10096921
1827 Ga0157379_10024368
1828 Ga0157379_10032183
1829 Ga0157379_10034436
1830 Ga0157379_10035809
1831 Ga0157379_10069607
1832 Ga0157379_10177376
1833 Ga0157379_10332657
1834 Ga0157379_10475349
1835 Ga0157379_10552911
1836 Ga0157376_10001464
1837 Ga0157376_10018430
1838 Ga0157376_10030077
1839 Ga0157376_10036034
1840 Ga0157376_10111007
1841 Ga0157376_10131246
1842 Ga0157376_10134695
1843 Ga0157376_10140026
1844 Ga0157376_10162452
1845 Ga0157376_10163472
1846 Ga0157376_10328337
1847 Ga0157376_10367418
1848 Ga0157376_10520827
1849 Ga0157376_10685225
1850 Ga0163161_10059162
1851 Ga0206352_11354533
1852 Ga0154015_1222796
1853 Ga0213876_10202830
1854 Ga0213875_10011417
1855 Ga0213875_10018482
1856 Ga0213875_10025438
1857 Ga0213875_10054213
1858 Ga0207697_10000251
1859 Ga0207697_10004674
1860 Ga0207682_10004064
1861 Ga0207682_10033729
1862 Ga0207642_10152192
1863 Ga0207688_10016882
1864 Ga0207688_10027862
1865 Ga0207688_10277646
1866 Ga0207680_10003712
1867 Ga0207680_10038400
1868 Ga0207680_10170274
1869 Ga0207680_10208439
1870 Ga0207699_10018329
1871 Ga0207699_10076098
1872 Ga0207699_10149616
1873 Ga0207645_10000804
1874 Ga0207645_10017281
1875 Ga0207643_10005115
1876 Ga0207643_10022431
1877 Ga0207643_10074668
1878 Ga0207705_10047827
1879 Ga0207684_10294329
1880 Ga0207684_10422770
1881 Ga0207654_10002296
1882 Ga0207654_10041480
1883 Ga0207654_10103783
1884 Ga0207654_10126426
1885 Ga0207707_10000469
1886 Ga0207707_10012066
1887 Ga0207707_10044280
1888 Ga0207707_10058030
1889 Ga0207707_10177976
1890 Ga0207695_10002673
1891 Ga0207695_10017159
1892 Ga0207695_10069924
1893 Ga0207695_10077984
1894 Ga0207695_10080223
1895 Ga0207695_10102855
1896 Ga0207695_10163172
1897 Ga0207695_10169693
1898 Ga0207695_10173796
1899 Ga0207695_10377002
1900 Ga0207671_10017277
1901 Ga0207671_10021931
1902 Ga0207671_10036388
1903 Ga0207671_10052496
1904 Ga0207660_10012897
1905 Ga0207660_10019519
1906 Ga0207660_10316966
1907 Ga0207662_10003470
1908 Ga0207662_10010254
1909 Ga0207662_10039592
1910 Ga0207662_10182555
1911 Ga0207657_10004759
1912 Ga0207657_10088541
1913 Ga0207657_10375185
1914 Ga0207649_10047194
1915 Ga0207649_10067064
1916 Ga0207652_10003282
1917 Ga0207652_10020903
1918 Ga0207652_10173993
1919 Ga0207652_10237024
1920 Ga0207652_10449403
1921 Ga0207646_10085333
1922 Ga0207646_10167566
1923 Ga0207681_10001189
1924 Ga0207681_10002783
1925 Ga0207681_10014104
1926 Ga0207681_10030400
1927 Ga0207681_10076646
1928 Ga0207681_10237119
1929 Ga0207694_10002185
1930 Ga0207694_10004422
1931 Ga0207694_10010532
1932 Ga0207694_10025618
1933 Ga0207694_10051810
1934 Ga0207694_10069761
1935 Ga0207650_10000510
1936 Ga0207650_10192535
1937 Ga0207650_10255919
1938 Ga0207659_10000406
1939 Ga0207659_10001544
1940 Ga0207659_10021429
1941 Ga0207659_10040497
1942 Ga0207659_10071013
1943 Ga0207659_10199160
1944 Ga0207687_10008146
1945 Ga0207687_10020100
1946 Ga0207687_10028830
1947 Ga0207687_10087112
1948 Ga0207687_10093899
1949 Ga0207687_10103150
1950 Ga0207687_10118133
1951 Ga0207687_10191354
1952 Ga0207687_10193413
1953 Ga0207687_10360949
1954 Ga0207687_10434738
1955 Ga0207700_10000647
1956 Ga0207700_10063912
1957 Ga0207700_10390856
1958 Ga0207664_10016657
1959 Ga0207664_10059041
1960 Ga0207664_10238272
1961 Ga0207664_10263842
1962 Ga0207644_10008275
1963 Ga0207644_10038363
1964 Ga0207644_10061465
1965 Ga0207644_10062961
1966 Ga0207644_10221293
1967 Ga0207690_10015894
1968 Ga0207690_10098485
1969 Ga0207706_10036652
1970 Ga0207706_10045911
1971 Ga0207706_10086552
1972 Ga0207706_10130953
1973 Ga0207706_10171870
1974 Ga0207686_10001173
1975 Ga0207686_10010878
1976 Ga0207686_10044969
1977 Ga0207686_10060332
1978 Ga0207686_10096020
1979 Ga0207686_10113719
1980 Ga0207709_10041625
1981 Ga0207709_10165569
1982 Ga0207670_10001976
1983 Ga0207670_10043533
1984 Ga0207670_10070524
1985 Ga0207670_10262870
1986 Ga0207669_10000834
1987 Ga0207669_10010564
1988 Ga0207669_10078011
1989 Ga0207669_10180958
1990 Ga0207704_10016397
1991 Ga0207704_10170130
1992 Ga0207704_10220204
1993 Ga0207691_10002846
1994 Ga0207691_10007867
1995 Ga0207691_10015722
1996 Ga0207691_10027418
1997 Ga0207691_10029846
1998 Ga0207691_10055709
1999 Ga0207691_10074840
2000 Ga0207711_10004826
2001 Ga0207711_10008634
2002 Ga0207711_10011678
2003 Ga0207711_10017341
2004 Ga0207711_10031262
2005 Ga0207711_10040080
2006 Ga0207711_10124129
2007 Ga0207711_10140317
2008 Ga0207711_10153260
2009 Ga0207711_10165265
2010 Ga0207711_10235959
2011 Ga0207711_10250000
2012 Ga0207711_10307037
2013 Ga0207711_10417827
2014 Ga0207711_10605107
2015 Ga0207689_10028011
2016 Ga0207689_10028147
2017 Ga0207689_10045229
2018 Ga0207689_10070739
2019 Ga0207661_10000014
2020 Ga0207661_10003445
2021 Ga0207661_10051668
2022 Ga0207661_10131293
2023 Ga0207661_10162110
2024 Ga0207661_10167815
2025 Ga0207661_10502444
2026 Ga0207679_10008015
2027 Ga0207679_10026100
2028 Ga0207679_10043006
2029 Ga0207679_10058493
2030 Ga0207679_10091233
2031 Ga0207679_10221065
2032 Ga0207667_10000682
2033 Ga0207667_10005221
2034 Ga0207667_10014682
2035 Ga0207667_10023929
2036 Ga0207667_10272111
2037 Ga0207667_10487076
2038 Ga0207667_10691963
2039 Ga0207651_10014979
2040 Ga0207651_10052352
2041 Ga0207651_10157069
2042 Ga0207651_10163968
2043 Ga0207651_10190054
2044 Ga0207651_10231764
2045 Ga0207651_10266721
2046 Ga0207712_10031512
2047 Ga0207712_10143758
2048 Ga0207712_10216910
2049 Ga0207668_10096930
2050 Ga0207668_10203514
2051 Ga0207640_10040764
2052 Ga0207640_10092541
2053 Ga0207658_10087645
2054 Ga0207658_10123421
2055 Ga0207658_10125042
2056 Ga0207658_10169281
2057 Ga0207677_10012852
2058 Ga0207677_10036784
2059 Ga0207677_10112647
2060 Ga0207677_10129705
2061 Ga0207677_10151753
2062 Ga0207677_10177838
2063 Ga0207677_10201256
2064 Ga0207703_10005810
2065 Ga0207703_10006792
2066 Ga0207703_10010459
2067 Ga0207703_10042382
2068 Ga0207703_10086190
2069 Ga0207703_10098044
2070 Ga0207703_10105486
2071 Ga0207703_10122403
2072 Ga0207703_10171140
2073 Ga0207703_10364836
2074 Ga0207639_10007173
2075 Ga0207639_10247590
2076 Ga0207678_10286078
2077 Ga0207708_10010013
2078 Ga0207708_10015215
2079 Ga0207708_10020342
2080 Ga0207702_10010003
2081 Ga0207702_10027031
2082 Ga0207702_10038722
2083 Ga0207702_10134529
2084 Ga0207702_10235584
2085 Ga0207702_10254628
2086 Ga0207702_10287600
2087 Ga0207641_10001693
2088 Ga0207641_10008647
2089 Ga0207641_10022405
2090 Ga0207641_10078131
2091 Ga0207641_10172170
2092 Ga0207641_10459548
2093 Ga0207648_10007406
2094 Ga0207648_10014545
2095 Ga0207648_10033812
2096 Ga0207648_10229747
2097 Ga0207648_10266198
2098 Ga0207648_10576949
2099 Ga0207648_10659308
2100 Ga0207676_10035657
2101 Ga0207676_10093582
2102 Ga0207676_10197404
2103 Ga0207676_10230271
2104 Ga0207676_10425512
2105 Ga0207674_10001168
2106 Ga0207674_10006848
2107 Ga0207674_10025411
2108 Ga0207674_10026109
2109 Ga0207674_10027367
2110 Ga0207674_10230386
2111 Ga0207674_10246667
2112 Ga0207674_10541482
2113 Ga0207675_100000903
2114 Ga0207675_100020152
2115 Ga0207675_100030141
2116 Ga0207675_100100885
2117 Ga0207675_100159237
2118 Ga0207675_100269909
2119 Ga0207683_10045566
2120 Ga0207683_10152651
2121 Ga0207683_10238272
2122 Ga0207698_10023487
2123 Ga0207698_10023937
2124 Ga0209974_10025430
2125 Ga0207428_10000004
2126 Ga0207428_10002859
2127 Ga0207428_10004898
2128 Ga0207428_10024613
2129 Ga0207428_10085152
2130 Ga0207428_10251830
2131 Ga0207428_10277431
2132 Ga0268266_10055756
2133 Ga0268266_10060920
2134 Ga0268266_10075877
2135 Ga0268265_10000073
2136 Ga0268265_10009325
2137 Ga0268265_10024774
2138 Ga0268265_10031751
2139 Ga0268265_10062450
2140 Ga0268265_10102499
2141 Ga0268265_10212088
2142 Ga0268265_10227380
2143 Ga0268264_10021749
2144 Ga0268264_10025089
2145 Ga0268264_10081631
2146 Ga0268264_10125913
2147 Ga0268264_10314559
2148 Ga0268264_10453985
2149 Ga0265325_10089588
2150 Ga0265331_10034626
2151 Ga0265331_10167585
2152 Ga0265316_10059019
2153 Ga0265314_10000282
2154 Ga0265314_10016083
2155 Ga0265314_10145280
2156 Ga0307405_10020590
2157 Ga0307416_100024955
2158 Ga0307414_10292512
2159 Ga0307411_10155755
2160 Ga0373948_0000450
2161 Ga0373950_0000380
2162 Ga0373958_0009516
2163 Ga0373938_0002084
2164 Ga0373926_0073966
2165 Ga0373929_0000150
2166 Ga0373940_0025734
2167 Ga0373944_0038200
2168 Ga0373949_0000545
2169 Ga0373951_0001989
2170 Ga0373952_0000564
2171 Ga0373932_0001009
2172 Ga0373932_0012441
2173 Ga0373936_0023516
2174 Ga0373941_0001769
2175 Ga0373954_0016180
2176 Ga0373956_0019596
2177 Ga0373960_0000414
2178 Ga0373943_0009153
2179 Ga0373943_0115028
2180 Ga0373946_0001957
2181 Ga0373946_0084807
2182 Ga0373946_0203278
2183 Ga0373955_0010717
2184 Ga0373955_0033486
2185 Ga0373955_0087911
2186 Ga0373955_0137629
2187 Ga0373955_0148216
2188 Ga0373955_0180283
2189 Ga0373942_0001464
2190 Ga0373962_0000549
2191 Ga0373931_0082874
2192 Ga0373931_0096874
2193 Ga0373935_0011426
2194 Ga0373935_0136733
2195 Ga0373935_0383354
2196 Ga0373927_0012421
2197 Ga0373927_0077234
2198 Ga0373927_0212399
2199 Ga0373927_0271469
2200 Ga0373947_0007354
2201 Ga0373947_0007636
2202 Ga0373947_0009077
2203 Ga0373947_0021219
2204 Ga0373937_0002587
2205 Ga0373937_0002894
2206 Ga0373937_0004569
2207 Ga0373937_0016270
2208 Ga0373937_0316107
2209 Ga0373925_0000762
2210 Ga0373925_0011459
2211 Ga0373925_0044686
2212 Ga0373925_0053724
2213 Ga0373925_0085342
2214 Ga0373925_0212877
2215 Ga0373925_0272102
2216 Ga0373925_0347378
2217 Ga0373925_0451110
2218 Ga0373925_0469260
2219 Ga0395898_0263372
2220 Ga0436364_0178301
2221 Ga0436364_0408279
2222 Ga0436364_0971922
2223 Ga0436364_1201673
2224 Ga0436364_1272981
2225 Ga0436364_1497633
2226 Ga0395901_0150281
2227 Ga0436365_0512859
2228 Ga0436365_1058523
2229 Ga0436365_1745652
2230 Ga0436363_0045077
2231 Ga0436363_0774504
2232 Ga0436363_1317700
2233 Ga0439464_0044305
2234 Ga0451577_0023209
2235 Ga0466966_0180236
2236 Ga0453684_0401022
2237 Ga0451576_0020484
2238 Ga0451576_0057424
2239 Ga0451576_0065700
2240 Ga0451576_0194751
2241 Ga0451576_0208766
2242 Ga0466958_0090396
2243 Ga0495603_0099277
2244 Ga0495629_0009447
2245 Ga0495629_0056713
2246 Ga0495629_0184520
2247 Ga0495629_0277414
2248 Ga0495629_0338226
2249 Ga0495651_0286279
2250 Ga0495580_0000771
2251 Ga0495580_0003605
2252 Ga0495580_0026077
2253 Ga0495580_0127527
2254 Ga0495580_0268328
2255 Ga0495582_0042507
2256 Ga0495582_0056164
2257 Ga0495582_0162373
2258 Ga0495639_0053615
2259 Ga0495662_0036778
2260 Ga0495664_0091947
2261 Ga0495584_0073011
2262 Ga0495594_0098355
2263 Ga0495594_0155002
2264 Ga0495594_0231086
2265 Ga0495608_0004305
2266 Ga0495608_0105394
2267 Ga0495608_0163274
2268 Ga0495608_0405121
2269 Ga0495628_0046355
2270 Ga0495628_0119579
2271 Ga0495628_0159027
2272 Ga0495628_0219415
2273 Ga0495630_0004210
2274 Ga0495642_0014663
2275 Ga0495642_0023888
2276 Ga0495652_0034238
2277 Ga0495665_0115312
2278 Ga0495586_0141346
2279 Ga0495587_0001325
2280 Ga0495587_0017715
2281 Ga0495587_0129094
2282 Ga0495598_0040853
2283 Ga0495609_0038540
2284 Ga0495621_0028633
2285 Ga0495621_0029128
2286 Ga0495621_0101001
2287 Ga0495645_0006385
2288 Ga0495645_0026282
2289 Ga0495645_0045821
2290 Ga0495645_0108987
2291 Ga0495633_0077756
2292 Ga0495667_0205232
2293 Ga0495656_0202141
2294 Ga0495634_0049275
2295 Ga0495634_0172591
2296 Ga0495635_0295845
2297 Ga0495635_0317550
2298 Ga0495635_0338620
2299 Ga0495659_0030076
2300 Ga0495659_0038486
2301 Ga0495599_0033050
2302 Ga0495599_0252291
2303 Ga0495623_0137651
2304 Ga0495623_0166875
2305 Ga0495647_0071445
2306 Ga0495658_0048935
2307 Ga0495658_0076165
2308 Ga0495613_0005107
2309 Ga0495613_0041186
2310 Ga0495613_0088183
2311 Ga0495613_0213060
2312 Ga0495670_0203205
2313 Ga0495600_0263893
2314 Ga0495581_0084101
2315 Ga0495604_0022036
2316 Ga0495604_0078580
2317 Ga0495604_0168574
2318 Ga0495636_0009861
2319 Ga0495674_0037171
2320 Ga0495674_0079388
2321 Ga0495674_0155939
2322 Ga0495674_0198484
2323 Ga0495674_0217172
2324 Ga0495674_0238138
2325 Ga0495674_0285775
2326 Ga0495674_0454403
2327 Ga0495676_0088008
2328 Ga0495680_0046904
2329 Ga0495685_022850
2330 Ga0495684_0001265
2331 Ga0495684_0012461
2332 Ga0495684_0036331
2333 Ga0495684_0089673
2334 Ga0495686_0035823
2335 Ga0495602_0004904
2336 Ga0495602_0077780
2337 Ga0495602_0127546
2338 Ga0496100_0036898
2339 Ga0496100_0203848
2340 Ga0496101_0000265
2341 Ga0496101_0105661
2342 Ga0496101_0225649
2343 Ga0496102_0002617
2344 Ga0496102_0254704
2345 Ga0496102_0438860
2346 Ga0496103_0011791
2347 Ga0496104_0004942
2348 Ga0496104_0019182
2349 Ga0496104_0142928
2350 Ga0496104_0194026
2351 Ga0496104_0284201
2352 Ga0496105_0205897
2353 Ga0496106_0218919
2354 Ga0496107_0091134
2355 Ga0496107_0106462
2356 Ga0496108_0022389
2357 Ga0496108_0082881
2358 Ga0496108_0281663
2359 Ga0496108_0495195
2360 Ga0496109_0647409
2361 Ga0496110_0033272
2362 Ga0496110_0266725
2363 Ga0496110_0638210
2364 Ga0496112_0051299
2365 Ga0496112_0170463
2366 Ga0496112_0204062
2367 Ga0496112_0315525
2368 Ga0496113_0270877
2369 Ga0496114_0015693
2370 Ga0496114_0114805
2371 Ga0496114_0122487
2372 Ga0496114_0456491
2373 Ga0496114_0531378
2374 Ga0496115_0007253
2375 Ga0496115_0123316
2376 Ga0496115_0203092
2377 Ga0496115_0445417
2378 Ga0501031_0187919
2379 Ga0501033_0017141
2380 Ga0501033_0096511
2381 Ga0501033_0133453
2382 Ga0501034_0008331
2383 Ga0501034_0013294
2384 Ga0501034_0027792
2385 Ga0501036_0027919
2386 Ga0501036_0259705
2387 Ga0501037_0055512
2388 Ga0501038_0150436
2389 Ga0501038_0404621
2390 Ga0501040_0001451
2391 Ga0501041_0005102
2392 Ga0501042_0004730
2393 Ga0501043_0254361
2394 Ga0501046_0004861
2395 Ga0501046_0169637
2396 Ga0501047_0000576
2397 Ga0501047_0013887
2398 Ga0501047_0055104
2399 Ga0501047_0160960
2400 Ga0501047_0328690
2401 Ga0501048_0133180
2402 Ga0501048_0149663
2403 Ga0501068_0018630
2404 Ga0501068_0117276
2405 Ga0501070_0039651
2406 Ga0501071_0212509
2407 Ga0501071_0431053
2408 Ga0501072_0010360
2409 Ga0501072_0018434
2410 Ga0501072_0062100
2411 Ga0501073_0040027
2412 Ga0501073_0107616
2413 Ga0501073_0178321
2414 Ga0501074_0373712
2415 Ga0501075_0002638
2416 Ga0501075_0403214
2417 Ga0501076_0001642
2418 Ga0501076_0401396
2419 Ga0501077_0188379
2420 Ga0501079_0004650
2421 Ga0501080_0000677
2422 Ga0501080_0020482
2423 Ga0501080_0039210
2424 Ga0501080_0286159
2425 Ga0501081_0001295
2426 Ga0501083_0038294
2427 Ga0501035_0016276
2428 Ga0501035_0128546
2429 Ga0501035_0388589
2430 Ga0501044_0001104
2431 Ga0501044_0010087
2432 Ga0501044_0013798
2433 Ga0501044_0016247
2434 Ga0501044_0056134
2435 Ga0501045_0004406
2436 Ga0501045_0149818
2437 Ga0501045_0268330
2438 nmdc:mga03n38_11295_c1
2439 nmdc:mga06z11_144380_c1
2440 nmdc:mga05p37_127391_c1
2441 nmdc:mga05p37_326993_c1
2442 nmdc:mga05p37_329824_c1
2443 nmdc:mga05p37_33160_c1
2444 nmdc:mga05p37_38883_c1
2445 nmdc:mga05p37_4007_c1
2446 nmdc:mga05p37_401748_c1
2447 nmdc:mga05p37_404966_c1
2448 nmdc:mga05p37_406636_c1
2449 nmdc:mga05p37_47432_c1
2450 nmdc:mga05p37_47724_c1
2451 nmdc:mga05p37_55752_c1
2452 nmdc:mga05p37_68776_c1
2453 nmdc:mga05p37_68999_c1
2454 nmdc:mga09592_234650_c1
2455 nmdc:mga09592_53824_c1
2456 nmdc:mga09592_53835_c1
2457 nmdc:mga09592_71329_c1
2458 nmdc:mga0qj67_3423_c1
2459 nmdc:mga0qj67_5449_c1
2460 nmdc:mga06r32_202025_c1
2461 nmdc:mga06r32_311689_c1
2462 nmdc:mga06r32_42870_c1
2463 nmdc:mga06r32_7066_c1
2464 nmdc:mga06r32_79019_c1
2465 nmdc:mga06r32_8356_c1
2466 nmdc:mga08y16_130757_c1
2467 nmdc:mga08y16_17948_c1
2468 nmdc:mga08y16_192350_c1
2469 nmdc:mga08y16_212473_c1
2470 nmdc:mga08y16_271660_c1
2471 nmdc:mga08y16_2_c1
2472 nmdc:mga08y16_42960_c1
2473 nmdc:mga08y16_42987_c1
2474 nmdc:mga08y16_651580_c1
2475 nmdc:mga0n895_136171_c1
2476 nmdc:mga0n895_13653_c1
2477 nmdc:mga0n895_186291_c1
2478 nmdc:mga0n895_209109_c1
2479 nmdc:mga0n895_21247_c1
2480 nmdc:mga0n895_223264_c1
2481 nmdc:mga0n895_285268_c1
2482 nmdc:mga0n895_327727_c1
2483 nmdc:mga0n895_360588_c1
2484 nmdc:mga0n895_391990_c1
2485 nmdc:mga0n895_47808_c1
2486 nmdc:mga0n895_48_c1
2487 nmdc:mga0n895_505331_c1
2488 nmdc:mga0n895_54857_c1
2489 nmdc:mga0n895_649028_c1
2490 nmdc:mga0n895_8605_c1
2491 nmdc:mga0rr50_172709_c1
2492 nmdc:mga0rr50_18_c1
2493 nmdc:mga0rr50_270265_c1
2494 nmdc:mga0rr50_305211_c1
2495 nmdc:mga0rr50_32599_c1
2496 nmdc:mga0rr50_327101_c1
2497 nmdc:mga0rr50_334367_c1
2498 nmdc:mga0rr50_371598_c1
2499 nmdc:mga0rr50_381301_c1
2500 nmdc:mga0rr50_40311_c1
2501 nmdc:mga0rr50_40598_c1
2502 nmdc:mga0rr50_453554_c1
2503 nmdc:mga0rr50_488547_c1
2504 nmdc:mga0rr50_5382_c1
2505 nmdc:mga0rr50_713524_c1
2506 nmdc:mga08x19_143_c1
2507 nmdc:mga08x19_174837_c1
2508 nmdc:mga08x19_367357_c1
2509 nmdc:mga0a205_120493_c1
2510 nmdc:mga0a205_182498_c1
2511 nmdc:mga0a205_208027_c1
2512 nmdc:mga0a205_247261_c1
2513 nmdc:mga0a205_260920_c1
2514 nmdc:mga0a205_265420_c1
2515 nmdc:mga0a205_37628_c1
2516 nmdc:mga0a205_4847_c1
2517 nmdc:mga0a205_52285_c1
2518 nmdc:mga0a205_70329_c1
2519 nmdc:mga0a205_85246_c1
2520 nmdc:mga0a205_96889_c1
2521 Ga0495601_0012733
2522 Ga0495601_0075055
2523 Ga0495601_0143368
2524 Ga0495619_0001690
2525 Ga0500595_016237
2526 Ga0500652_000019
2527 Ga0500636_0018424
2528 Ga0501084_0373432
2529 Ga0501082_0005140
2530 Ga0530510_0038969

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

60

284

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8713 45 284
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.8618 51 287
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8613 51 287
1ziy-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a 0.8611 51 287
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.861 45 284
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9193 49 282 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9075 47 286 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8969 49 282 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8653 45 284 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.855 45 284 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8D1E9-F1-model_v4 Dienelactone hydrolase 0.9999 75 287 GO:0016787
AF-A0A3N5P008-F1-model_v4 Dienelactone hydrolase family protein 0.9966 141 287 GO:0016787
AF-A0A2V8FJU0-F1-model_v4 Dienelactone hydrolase 0.9944 102 287 GO:0016787
AF-A0A2V8D1E9-F1-model_v4 Dienelactone hydrolase 0.9906 75 287 GO:0016787
AF-A0A2V8FJU0-F1-model_v4 Dienelactone hydrolase 0.9891 102 287 GO:0016787

Map