F492344
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1265 | 352 | 2530 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300035117|Ga0373953_0035615|Ga0373953_0035615_928_1785 |
| Length | 285 |
| Sequence | MCDQDHFEDDRLKYEALGLVTRKQFGIMLGAGIAMMLPQVANAVTVTESEVSVKTPDGTADCYFVHPASGTAPGVLVWPDIFGLRQAFRQMGKRLAESGYSVLVVNPFYRAQKGLPNGATNPTIQQNMPLMQALNETTHMTDAKAFIGWLDQQASVAKNRKMGTQGYCMGGPIAFRTAAAVPDRVGAVASFHGGGLVANGDNSPHLQAAKSKAQFLIAIAESDDKPRPTEKDVLKDTFAKANLPAEIEVYGAAHGWCPPDSGVYNEPLAEKAWGRLLALYGKALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 349 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 3.16 |
| Rhizosphere | 94.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373953_0035615 | 3300035117 | Bacteria | 1957 |
| 2 | JGI25406J46586_10000119 | 3300003203 | Bacteria | 34447 |
| 3 | JGI25406J46586_10005975 | 3300003203 | Bacteria | 5631 |
| 4 | Ga0058859_11818552 | 3300004798 | Bacteria | 1642 |
| 5 | Ga0058863_11917217 | 3300004799 | Bacteria | 3023 |
| 6 | Ga0058861_11260298 | 3300004800 | Bacteria | 949 |
| 7 | Ga0058860_12121912 | 3300004801 | Unclassified | 999 |
| 8 | Ga0058862_12607417 | 3300004803 | Unclassified | 897 |
| 9 | Ga0065712_10242818 | 3300005290 | Bacteria | 960 |
| 10 | Ga0065715_10001683 | 3300005293 | Bacteria | 5763 |
| 11 | Ga0065715_10228106 | 3300005293 | Bacteria | 1235 |
| 12 | Ga0065707_10005960 | 3300005295 | Bacteria | 3177 |
| 13 | Ga0065707_10098319 | 3300005295 | Bacteria | 3091 |
| 14 | Ga0065707_10256145 | 3300005295 | Bacteria | 1110 |
| 15 | Ga0070658_10168557 | 3300005327 | Bacteria | 1839 |
| 16 | Ga0070676_10012701 | 3300005328 | Bacteria | 4605 |
| 17 | Ga0070676_10024880 | 3300005328 | Bacteria | 3378 |
| 18 | Ga0070676_10080790 | 3300005328 | Unclassified | 1972 |
| 19 | Ga0070683_100000003 | 3300005329 | Bacteria | 375084 |
| 20 | Ga0070683_100061543 | 3300005329 | Bacteria | 3491 |
| 21 | Ga0070683_100107191 | 3300005329 | Bacteria | 2634 |
| 22 | Ga0070683_100140613 | 3300005329 | Bacteria | 2287 |
| 23 | Ga0070683_100198932 | 3300005329 | Bacteria | 1903 |
| 24 | Ga0070690_100023683 | 3300005330 | Bacteria | 3768 |
| 25 | Ga0070690_100231062 | 3300005330 | Bacteria | 1300 |
| 26 | Ga0070670_100010911 | 3300005331 | Bacteria | 7759 |
| 27 | Ga0070670_100194535 | 3300005331 | Bacteria | 1762 |
| 28 | Ga0070670_100229889 | 3300005331 | Bacteria | 1614 |
| 29 | Ga0070677_10002416 | 3300005333 | Bacteria | 5957 |
| 30 | Ga0070677_10075317 | 3300005333 | Bacteria | 1430 |
| 31 | Ga0068869_100033702 | 3300005334 | Bacteria | 3617 |
| 32 | Ga0068869_100130032 | 3300005334 | Bacteria | 1934 |
| 33 | Ga0068869_100504095 | 3300005334 | Bacteria | 1011 |
| 34 | Ga0070666_10000425 | 3300005335 | Bacteria | 26114 |
| 35 | Ga0070666_10001250 | 3300005335 | Bacteria | 15380 |
| 36 | Ga0070666_10006737 | 3300005335 | Bacteria | 7073 |
| 37 | Ga0070666_10014622 | 3300005335 | Bacteria | 4998 |
| 38 | Ga0070666_10053199 | 3300005335 | Archaea | 2730 |
| 39 | Ga0070666_10068703 | 3300005335 | Bacteria | 2408 |
| 40 | Ga0070680_100016531 | 3300005336 | Bacteria | 5806 |
| 41 | Ga0070682_100110235 | 3300005337 | Bacteria | 1833 |
| 42 | Ga0068868_100017351 | 3300005338 | Bacteria | 5361 |
| 43 | Ga0068868_100019353 | 3300005338 | Bacteria | 5100 |
| 44 | Ga0068868_100026769 | 3300005338 | Bacteria | 4397 |
| 45 | Ga0068868_100102997 | 3300005338 | Bacteria | 2312 |
| 46 | Ga0068868_100432475 | 3300005338 | Bacteria | 1141 |
| 47 | Ga0070660_100013374 | 3300005339 | Bacteria | 5885 |
| 48 | Ga0070660_100079605 | 3300005339 | Bacteria | 2571 |
| 49 | Ga0070660_100515219 | 3300005339 | Unclassified | 996 |
| 50 | Ga0070689_100020029 | 3300005340 | Bacteria | 4959 |
| 51 | Ga0070689_100030902 | 3300005340 | Bacteria | 4067 |
| 52 | Ga0070689_100047269 | 3300005340 | Bacteria | 3318 |
| 53 | Ga0070689_100055601 | 3300005340 | Bacteria | 3067 |
| 54 | Ga0070689_100084488 | 3300005340 | Bacteria | 2495 |
| 55 | Ga0070689_100444668 | 3300005340 | Bacteria | 1102 |
| 56 | Ga0070691_10007935 | 3300005341 | Bacteria | 4854 |
| 57 | Ga0070691_10012595 | 3300005341 | Bacteria | 3873 |
| 58 | Ga0070687_100012661 | 3300005343 | Bacteria | 3731 |
| 59 | Ga0070687_100013402 | 3300005343 | Unclassified | 3653 |
| 60 | Ga0070687_100038203 | 3300005343 | Bacteria | 2405 |
| 61 | Ga0070661_100007019 | 3300005344 | Bacteria | 7771 |
| 62 | Ga0070661_100044735 | 3300005344 | Bacteria | 3235 |
| 63 | Ga0070668_100073197 | 3300005347 | Bacteria | 2671 |
| 64 | Ga0070668_100230204 | 3300005347 | Bacteria | 1532 |
| 65 | Ga0070669_100002792 | 3300005353 | Bacteria | 12603 |
| 66 | Ga0070669_100010531 | 3300005353 | Bacteria | 6566 |
| 67 | Ga0070669_100024037 | 3300005353 | Bacteria | 4367 |
| 68 | Ga0070669_100031975 | 3300005353 | Bacteria | 3800 |
| 69 | Ga0070669_100256598 | 3300005353 | Bacteria | 1394 |
| 70 | Ga0070675_100001488 | 3300005354 | Bacteria | 17297 |
| 71 | Ga0070675_100042270 | 3300005354 | Bacteria | 3724 |
| 72 | Ga0070675_100062365 | 3300005354 | Bacteria | 3080 |
| 73 | Ga0070675_100188459 | 3300005354 | Bacteria | 1786 |
| 74 | Ga0070675_100280275 | 3300005354 | Bacteria | 1464 |
| 75 | Ga0070675_100295559 | 3300005354 | Bacteria | 1426 |
| 76 | Ga0070671_100004399 | 3300005355 | Bacteria | 11137 |
| 77 | Ga0070671_100004706 | 3300005355 | Bacteria | 10841 |
| 78 | Ga0070671_100081316 | 3300005355 | Unclassified | 2709 |
| 79 | Ga0070674_100003670 | 3300005356 | Bacteria | 8654 |
| 80 | Ga0070674_100029420 | 3300005356 | Bacteria | 3618 |
| 81 | Ga0070674_100139600 | 3300005356 | Unclassified | 1817 |
| 82 | Ga0070673_100068478 | 3300005364 | Bacteria | 2842 |
| 83 | Ga0070673_100123135 | 3300005364 | Unclassified | 2166 |
| 84 | Ga0070673_100153675 | 3300005364 | Bacteria | 1951 |
| 85 | Ga0070673_100158260 | 3300005364 | Bacteria | 1924 |
| 86 | Ga0070688_100015938 | 3300005365 | Bacteria | 4286 |
| 87 | Ga0070688_100053675 | 3300005365 | Bacteria | 2522 |
| 88 | Ga0070688_100218979 | 3300005365 | Bacteria | 1340 |
| 89 | Ga0070659_100067799 | 3300005366 | Bacteria | 2830 |
| 90 | Ga0070667_100003388 | 3300005367 | Bacteria | 13590 |
| 91 | Ga0070667_100045080 | 3300005367 | Bacteria | 3706 |
| 92 | Ga0070667_100092577 | 3300005367 | Unclassified | 2601 |
| 93 | Ga0070667_100192714 | 3300005367 | Bacteria | 1806 |
| 94 | Ga0070703_10057257 | 3300005406 | Bacteria | 1265 |
| 95 | Ga0070709_10093290 | 3300005434 | Bacteria | 1990 |
| 96 | Ga0070709_10109666 | 3300005434 | Bacteria | 1853 |
| 97 | Ga0070714_100009111 | 3300005435 | Bacteria | 7786 |
| 98 | Ga0070714_100206452 | 3300005435 | Bacteria | 1799 |
| 99 | Ga0070713_100001622 | 3300005436 | Bacteria | 14423 |
| 100 | Ga0070713_100002857 | 3300005436 | Bacteria | 11290 |
| 101 | Ga0070713_100102671 | 3300005436 | Bacteria | 2480 |
| 102 | Ga0070713_100106740 | 3300005436 | Bacteria | 2435 |
| 103 | Ga0070701_10015238 | 3300005438 | Bacteria | 3545 |
| 104 | Ga0070701_10023753 | 3300005438 | Bacteria | 2957 |
| 105 | Ga0070701_10046287 | 3300005438 | Unclassified | 2235 |
| 106 | Ga0070711_100067047 | 3300005439 | Bacteria | 2517 |
| 107 | Ga0070711_100127601 | 3300005439 | Bacteria | 1890 |
| 108 | Ga0070705_100007521 | 3300005440 | Bacteria | 5364 |
| 109 | Ga0070705_100011019 | 3300005440 | Bacteria | 4547 |
| 110 | Ga0070700_100050592 | 3300005441 | Unclassified | 2583 |
| 111 | Ga0070700_100171759 | 3300005441 | Bacteria | 1502 |
| 112 | Ga0070694_100002259 | 3300005444 | Bacteria | 11391 |
| 113 | Ga0070694_100061191 | 3300005444 | Unclassified | 2569 |
| 114 | Ga0070694_100133560 | 3300005444 | Bacteria | 1796 |
| 115 | Ga0070694_100196867 | 3300005444 | Bacteria | 1500 |
| 116 | Ga0070708_100052221 | 3300005445 | Bacteria | 3624 |
| 117 | Ga0070708_100360243 | 3300005445 | Bacteria | 1371 |
| 118 | Ga0070663_100332451 | 3300005455 | Bacteria | 1225 |
| 119 | Ga0070678_100131873 | 3300005456 | Bacteria | 1986 |
| 120 | Ga0070678_100345810 | 3300005456 | Bacteria | 1277 |
| 121 | Ga0070678_100582231 | 3300005456 | Bacteria | 997 |
| 122 | Ga0070662_100026566 | 3300005457 | Unclassified | 4011 |
| 123 | Ga0070662_100047164 | 3300005457 | Unclassified | 3098 |
| 124 | Ga0070662_100153790 | 3300005457 | Bacteria | 1794 |
| 125 | Ga0070681_10031838 | 3300005458 | Bacteria | 5294 |
| 126 | Ga0070681_10083225 | 3300005458 | Bacteria | 3154 |
| 127 | Ga0070681_10106266 | 3300005458 | Bacteria | 2748 |
| 128 | Ga0070681_10270347 | 3300005458 | Bacteria | 1611 |
| 129 | Ga0070681_10411811 | 3300005458 | Bacteria | 1263 |
| 130 | Ga0068867_100038870 | 3300005459 | Bacteria | 3466 |
| 131 | Ga0068867_100220084 | 3300005459 | Bacteria | 1529 |
| 132 | Ga0068867_100617348 | 3300005459 | Unclassified | 947 |
| 133 | Ga0070685_10008639 | 3300005466 | Bacteria | 5242 |
| 134 | Ga0070685_10332208 | 3300005466 | Bacteria | 1034 |
| 135 | Ga0070707_100036513 | 3300005468 | Bacteria | 4688 |
| 136 | Ga0070707_100115866 | 3300005468 | Bacteria | 2601 |
| 137 | Ga0070698_100029222 | 3300005471 | Bacteria | 5722 |
| 138 | Ga0070698_100120781 | 3300005471 | Unclassified | 2581 |
| 139 | Ga0070699_100001327 | 3300005518 | Bacteria | 22790 |
| 140 | Ga0070699_100008993 | 3300005518 | Bacteria | 8652 |
| 141 | Ga0070699_100105270 | 3300005518 | Unclassified | 2475 |
| 142 | Ga0070699_100136495 | 3300005518 | Unclassified | 2164 |
| 143 | Ga0070699_100258468 | 3300005518 | Bacteria | 1557 |
| 144 | Ga0070679_100000302 | 3300005530 | Bacteria | 42063 |
| 145 | Ga0070679_100043673 | 3300005530 | Unclassified | 4463 |
| 146 | Ga0070679_100046043 | 3300005530 | Bacteria | 4346 |
| 147 | Ga0070679_100529536 | 3300005530 | Unclassified | 1122 |
| 148 | Ga0070684_100000014 | 3300005535 | Bacteria | 158815 |
| 149 | Ga0070684_100002999 | 3300005535 | Bacteria | 12566 |
| 150 | Ga0070684_100012985 | 3300005535 | Bacteria | 6699 |
| 151 | Ga0070684_100094925 | 3300005535 | Bacteria | 2657 |
| 152 | Ga0070684_100351087 | 3300005535 | Bacteria | 1357 |
| 153 | Ga0070697_100020675 | 3300005536 | Bacteria | 5209 |
| 154 | Ga0070697_100116941 | 3300005536 | Unclassified | 2227 |
| 155 | Ga0068853_100002146 | 3300005539 | Bacteria | 14679 |
| 156 | Ga0070672_100007627 | 3300005543 | Bacteria | 7362 |
| 157 | Ga0070672_100070432 | 3300005543 | Unclassified | 2779 |
| 158 | Ga0070672_100077832 | 3300005543 | Unclassified | 2653 |
| 159 | Ga0070672_100080430 | 3300005543 | Unclassified | 2611 |
| 160 | Ga0070672_100131831 | 3300005543 | Bacteria | 2055 |
| 161 | Ga0070672_100180056 | 3300005543 | Bacteria | 1761 |
| 162 | Ga0070672_100209187 | 3300005543 | Bacteria | 1633 |
| 163 | Ga0070672_100249078 | 3300005543 | Bacteria | 1496 |
| 164 | Ga0070686_100000149 | 3300005544 | Bacteria | 47841 |
| 165 | Ga0070686_100013516 | 3300005544 | Bacteria | 4678 |
| 166 | Ga0070686_100223620 | 3300005544 | Bacteria | 1362 |
| 167 | Ga0070686_100453832 | 3300005544 | Bacteria | 986 |
| 168 | Ga0070695_100023341 | 3300005545 | Bacteria | 3800 |
| 169 | Ga0070695_100060209 | 3300005545 | Bacteria | 2460 |
| 170 | Ga0070695_100060895 | 3300005545 | Bacteria | 2447 |
| 171 | Ga0070695_100275229 | 3300005545 | Bacteria | 1235 |
| 172 | Ga0070696_100021367 | 3300005546 | Bacteria | 4387 |
| 173 | Ga0070696_100025110 | 3300005546 | Bacteria | 4050 |
| 174 | Ga0070696_100026932 | 3300005546 | Bacteria | 3913 |
| 175 | Ga0070696_100119566 | 3300005546 | Unclassified | 1905 |
| 176 | Ga0070693_100026839 | 3300005547 | Bacteria | 3113 |
| 177 | Ga0070665_100006507 | 3300005548 | Bacteria | 11876 |
| 178 | Ga0070665_100024170 | 3300005548 | Bacteria | 6120 |
| 179 | Ga0070665_100040388 | 3300005548 | Bacteria | 4690 |
| 180 | Ga0070665_100054433 | 3300005548 | Bacteria | 4013 |
| 181 | Ga0070665_100121382 | 3300005548 | Bacteria | 2615 |
| 182 | Ga0070665_100235929 | 3300005548 | Bacteria | 1829 |
| 183 | Ga0070704_100003359 | 3300005549 | Bacteria | 9167 |
| 184 | Ga0070704_100061746 | 3300005549 | Bacteria | 2684 |
| 185 | Ga0070704_100100767 | 3300005549 | Unclassified | 2175 |
| 186 | Ga0070704_100114264 | 3300005549 | Bacteria | 2060 |
| 187 | Ga0070704_100311448 | 3300005549 | Bacteria | 1316 |
| 188 | Ga0068855_100002984 | 3300005563 | Bacteria | 20678 |
| 189 | Ga0068855_100017262 | 3300005563 | Bacteria | 8686 |
| 190 | Ga0068855_100031217 | 3300005563 | Bacteria | 6363 |
| 191 | Ga0068855_100059840 | 3300005563 | Bacteria | 4456 |
| 192 | Ga0068855_100494631 | 3300005563 | Unclassified | 1330 |
| 193 | Ga0068855_100502014 | 3300005563 | Unclassified | 1318 |
| 194 | Ga0070664_100000492 | 3300005564 | Bacteria | 29880 |
| 195 | Ga0070664_100001335 | 3300005564 | Bacteria | 19670 |
| 196 | Ga0070664_100040409 | 3300005564 | Bacteria | 3932 |
| 197 | Ga0070664_100122511 | 3300005564 | Bacteria | 2278 |
| 198 | Ga0070664_100179807 | 3300005564 | Bacteria | 1880 |
| 199 | Ga0070664_100258120 | 3300005564 | Bacteria | 1568 |
| 200 | Ga0070664_100317916 | 3300005564 | Bacteria | 1410 |
| 201 | Ga0068857_100002613 | 3300005577 | Bacteria | 14785 |
| 202 | Ga0068857_100011187 | 3300005577 | Bacteria | 7804 |
| 203 | Ga0068857_100047722 | 3300005577 | Bacteria | 3803 |
| 204 | Ga0068857_100052484 | 3300005577 | Unclassified | 3617 |
| 205 | Ga0068857_100130673 | 3300005577 | Bacteria | 2265 |
| 206 | Ga0068857_100160266 | 3300005577 | Bacteria | 2041 |
| 207 | Ga0068857_100300944 | 3300005577 | Bacteria | 1478 |
| 208 | Ga0068854_100021164 | 3300005578 | Bacteria | 4411 |
| 209 | Ga0068854_100046159 | 3300005578 | Bacteria | 3101 |
| 210 | Ga0068856_100001937 | 3300005614 | Bacteria | 21587 |
| 211 | Ga0068856_100004199 | 3300005614 | Bacteria | 14388 |
| 212 | Ga0068856_100015788 | 3300005614 | Bacteria | 7302 |
| 213 | Ga0068856_100115313 | 3300005614 | Bacteria | 2686 |
| 214 | Ga0068856_100128318 | 3300005614 | Unclassified | 2540 |
| 215 | Ga0068856_100205807 | 3300005614 | Bacteria | 1982 |
| 216 | Ga0068856_100607880 | 3300005614 | Bacteria | 1114 |
| 217 | Ga0070702_100003201 | 3300005615 | Bacteria | 7272 |
| 218 | Ga0070702_100201444 | 3300005615 | Bacteria | 1318 |
| 219 | Ga0070702_100211549 | 3300005615 | Bacteria | 1291 |
| 220 | Ga0068852_100001781 | 3300005616 | Bacteria | 14646 |
| 221 | Ga0068852_100035743 | 3300005616 | Bacteria | 4148 |
| 222 | Ga0068852_100158401 | 3300005616 | Bacteria | 2111 |
| 223 | Ga0068859_100004134 | 3300005617 | Bacteria | 14817 |
| 224 | Ga0068859_100004521 | 3300005617 | Bacteria | 14186 |
| 225 | Ga0068859_100030564 | 3300005617 | Bacteria | 5406 |
| 226 | Ga0068859_100033211 | 3300005617 | Bacteria | 5183 |
| 227 | Ga0068859_100081354 | 3300005617 | Bacteria | 3281 |
| 228 | Ga0068859_100081997 | 3300005617 | Bacteria | 3268 |
| 229 | Ga0068859_100147305 | 3300005617 | Bacteria | 2429 |
| 230 | Ga0068859_100272424 | 3300005617 | Bacteria | 1785 |
| 231 | Ga0068859_100640873 | 3300005617 | Bacteria | 1155 |
| 232 | Ga0068864_100002489 | 3300005618 | Bacteria | 15223 |
| 233 | Ga0068864_100023269 | 3300005618 | Bacteria | 5202 |
| 234 | Ga0068864_100025597 | 3300005618 | Unclassified | 4972 |
| 235 | Ga0068864_100059439 | 3300005618 | Bacteria | 3307 |
| 236 | Ga0068864_100249290 | 3300005618 | Bacteria | 1648 |
| 237 | Ga0068864_100422580 | 3300005618 | Bacteria | 1270 |
| 238 | Ga0068866_10048247 | 3300005718 | Bacteria | 2152 |
| 239 | Ga0068861_100018284 | 3300005719 | Bacteria | 4992 |
| 240 | Ga0068861_100043183 | 3300005719 | Bacteria | 3382 |
| 241 | Ga0068861_100069471 | 3300005719 | Bacteria | 2725 |
| 242 | Ga0068861_100163980 | 3300005719 | Unclassified | 1836 |
| 243 | Ga0068861_100318858 | 3300005719 | Bacteria | 1353 |
| 244 | Ga0068851_10097203 | 3300005834 | Bacteria | 1558 |
| 245 | Ga0068870_10013371 | 3300005840 | Unclassified | 3856 |
| 246 | Ga0068870_10014953 | 3300005840 | Bacteria | 3674 |
| 247 | Ga0068863_100005664 | 3300005841 | Bacteria | 12268 |
| 248 | Ga0068863_100008318 | 3300005841 | Bacteria | 10135 |
| 249 | Ga0068863_100040394 | 3300005841 | Unclassified | 4435 |
| 250 | Ga0068863_100474395 | 3300005841 | Unclassified | 1230 |
| 251 | Ga0068863_100555617 | 3300005841 | Unclassified | 1134 |
| 252 | Ga0068858_100002905 | 3300005842 | Bacteria | 17241 |
| 253 | Ga0068858_100005100 | 3300005842 | Bacteria | 12868 |
| 254 | Ga0068858_100008332 | 3300005842 | Bacteria | 9974 |
| 255 | Ga0068858_100052419 | 3300005842 | Bacteria | 3774 |
| 256 | Ga0068858_100108057 | 3300005842 | Bacteria | 2597 |
| 257 | Ga0068858_100135568 | 3300005842 | Bacteria | 2310 |
| 258 | Ga0068858_100148751 | 3300005842 | Bacteria | 2201 |
| 259 | Ga0068858_100152695 | 3300005842 | Bacteria | 2172 |
| 260 | Ga0068858_100218074 | 3300005842 | Bacteria | 1806 |
| 261 | Ga0068858_100241234 | 3300005842 | Bacteria | 1715 |
| 262 | Ga0068858_100473576 | 3300005842 | Bacteria | 1208 |
| 263 | Ga0068858_100480116 | 3300005842 | Bacteria | 1200 |
| 264 | Ga0068860_100031160 | 3300005843 | Bacteria | 5127 |
| 265 | Ga0068860_100038063 | 3300005843 | Bacteria | 4602 |
| 266 | Ga0068860_100044555 | 3300005843 | Bacteria | 4228 |
| 267 | Ga0068860_100246495 | 3300005843 | Bacteria | 1739 |
| 268 | Ga0068862_100000840 | 3300005844 | Bacteria | 30227 |
| 269 | Ga0068862_100005392 | 3300005844 | Bacteria | 10699 |
| 270 | Ga0068862_100016263 | 3300005844 | Bacteria | 6191 |
| 271 | Ga0068862_100036118 | 3300005844 | Bacteria | 4187 |
| 272 | Ga0068862_100045111 | 3300005844 | Bacteria | 3761 |
| 273 | Ga0068862_100074584 | 3300005844 | Bacteria | 2933 |
| 274 | Ga0068862_100124832 | 3300005844 | Bacteria | 2272 |
| 275 | Ga0068862_100240398 | 3300005844 | Bacteria | 1646 |
| 276 | Ga0068862_100694614 | 3300005844 | Unclassified | 985 |
| 277 | Ga0068862_100695032 | 3300005844 | Bacteria | 985 |
| 278 | Ga0081539_10000017 | 3300005985 | Bacteria | 375107 |
| 279 | Ga0081539_10000285 | 3300005985 | Bacteria | 114370 |
| 280 | Ga0081539_10047920 | 3300005985 | Bacteria | 2435 |
| 281 | Ga0081539_10057486 | 3300005985 | Bacteria | 2152 |
| 282 | Ga0081539_10122253 | 3300005985 | Unclassified | 1291 |
| 283 | Ga0070717_10096581 | 3300006028 | Bacteria | 2503 |
| 284 | Ga0070717_10157115 | 3300006028 | Unclassified | 1971 |
| 285 | Ga0075368_10011931 | 3300006042 | Bacteria | 3171 |
| 286 | Ga0075363_100010441 | 3300006048 | Bacteria | 4413 |
| 287 | Ga0070716_100056446 | 3300006173 | Bacteria | 2252 |
| 288 | Ga0070716_100350595 | 3300006173 | Bacteria | 1045 |
| 289 | Ga0075369_10038930 | 3300006186 | Bacteria | 2029 |
| 290 | Ga0097621_100005426 | 3300006237 | Bacteria | 8990 |
| 291 | Ga0097621_100010218 | 3300006237 | Bacteria | 6854 |
| 292 | Ga0097621_100028334 | 3300006237 | Bacteria | 4414 |
| 293 | Ga0097621_100071850 | 3300006237 | Bacteria | 2861 |
| 294 | Ga0097621_100089762 | 3300006237 | Unclassified | 2570 |
| 295 | Ga0097621_100130326 | 3300006237 | Bacteria | 2140 |
| 296 | Ga0097621_100135694 | 3300006237 | Bacteria | 2098 |
| 297 | Ga0097621_100176074 | 3300006237 | Bacteria | 1846 |
| 298 | Ga0097621_100192714 | 3300006237 | Bacteria | 1766 |
| 299 | Ga0097621_100311238 | 3300006237 | Bacteria | 1393 |
| 300 | Ga0097621_100341509 | 3300006237 | Bacteria | 1330 |
| 301 | Ga0097621_100401340 | 3300006237 | Unclassified | 1227 |
| 302 | Ga0097621_100598170 | 3300006237 | Bacteria | 1008 |
| 303 | Ga0097621_100748161 | 3300006237 | Bacteria | 903 |
| 304 | Ga0068871_100029054 | 3300006358 | Bacteria | 4340 |
| 305 | Ga0068871_100042327 | 3300006358 | Bacteria | 3656 |
| 306 | Ga0068871_100047644 | 3300006358 | Bacteria | 3457 |
| 307 | Ga0068871_100049292 | 3300006358 | Bacteria | 3403 |
| 308 | Ga0068871_100084470 | 3300006358 | Bacteria | 2634 |
| 309 | Ga0068871_100085655 | 3300006358 | Bacteria | 2617 |
| 310 | Ga0068871_100090586 | 3300006358 | Bacteria | 2547 |
| 311 | Ga0068871_100110220 | 3300006358 | Unclassified | 2314 |
| 312 | Ga0068871_100142932 | 3300006358 | Bacteria | 2036 |
| 313 | Ga0075428_100000056 | 3300006844 | Bacteria | 89990 |
| 314 | Ga0075428_100015436 | 3300006844 | Bacteria | 8466 |
| 315 | Ga0075428_100016708 | 3300006844 | Bacteria | 8101 |
| 316 | Ga0075428_100019016 | 3300006844 | Bacteria | 7597 |
| 317 | Ga0075428_100019500 | 3300006844 | Bacteria | 7506 |
| 318 | Ga0075428_100101266 | 3300006844 | Bacteria | 3140 |
| 319 | Ga0075428_100185876 | 3300006844 | Bacteria | 2248 |
| 320 | Ga0075428_100233308 | 3300006844 | Bacteria | 1986 |
| 321 | Ga0075428_100260483 | 3300006844 | Unclassified | 1867 |
| 322 | Ga0075428_100405430 | 3300006844 | Bacteria | 1461 |
| 323 | Ga0075430_100001665 | 3300006846 | Bacteria | 18164 |
| 324 | Ga0075430_100040576 | 3300006846 | Bacteria | 3940 |
| 325 | Ga0075430_100053941 | 3300006846 | Unclassified | 3383 |
| 326 | Ga0075431_100005129 | 3300006847 | Bacteria | 12883 |
| 327 | Ga0075431_100014576 | 3300006847 | Bacteria | 7954 |
| 328 | Ga0075431_100053866 | 3300006847 | Bacteria | 4148 |
| 329 | Ga0075431_100072135 | 3300006847 | Bacteria | 3563 |
| 330 | Ga0075431_100110346 | 3300006847 | Bacteria | 2839 |
| 331 | Ga0075431_100153962 | 3300006847 | Bacteria | 2366 |
| 332 | Ga0075431_100378490 | 3300006847 | Unclassified | 1420 |
| 333 | Ga0075433_10006669 | 3300006852 | Bacteria | 9141 |
| 334 | Ga0075433_10015777 | 3300006852 | Bacteria | 6208 |
| 335 | Ga0075433_10277688 | 3300006852 | Bacteria | 1484 |
| 336 | Ga0075433_10409953 | 3300006852 | Bacteria | 1195 |
| 337 | Ga0075433_10628909 | 3300006852 | Bacteria | 942 |
| 338 | Ga0075434_100008968 | 3300006871 | Bacteria | 9314 |
| 339 | Ga0075434_100010775 | 3300006871 | Bacteria | 8585 |
| 340 | Ga0075434_100018968 | 3300006871 | Bacteria | 6648 |
| 341 | Ga0075434_100022212 | 3300006871 | Bacteria | 6180 |
| 342 | Ga0075434_100031745 | 3300006871 | Bacteria | 5208 |
| 343 | Ga0075434_100031834 | 3300006871 | Bacteria | 5201 |
| 344 | Ga0075434_100032945 | 3300006871 | Bacteria | 5111 |
| 345 | Ga0075434_100053344 | 3300006871 | Bacteria | 4018 |
| 346 | Ga0075434_100055569 | 3300006871 | Bacteria | 3934 |
| 347 | Ga0075434_100261397 | 3300006871 | Bacteria | 1750 |
| 348 | Ga0075434_100297381 | 3300006871 | Bacteria | 1634 |
| 349 | Ga0075434_100821008 | 3300006871 | Bacteria | 946 |
| 350 | Ga0075429_100005206 | 3300006880 | Bacteria | 11185 |
| 351 | Ga0075429_100006221 | 3300006880 | Bacteria | 10328 |
| 352 | Ga0075429_100070194 | 3300006880 | Bacteria | 3050 |
| 353 | Ga0075429_100070915 | 3300006880 | Bacteria | 3034 |
| 354 | Ga0075429_100117368 | 3300006880 | Bacteria | 2326 |
| 355 | Ga0075429_100268238 | 3300006880 | Bacteria | 1495 |
| 356 | Ga0075429_100270228 | 3300006880 | Bacteria | 1489 |
| 357 | Ga0068865_100066595 | 3300006881 | Bacteria | 2542 |
| 358 | Ga0068865_100073886 | 3300006881 | Bacteria | 2426 |
| 359 | Ga0068865_100086615 | 3300006881 | Bacteria | 2261 |
| 360 | Ga0068865_100193177 | 3300006881 | Bacteria | 1576 |
| 361 | Ga0075436_100001549 | 3300006914 | Bacteria | 15697 |
| 362 | Ga0075436_100211917 | 3300006914 | Bacteria | 1373 |
| 363 | Ga0075436_100365852 | 3300006914 | Bacteria | 1041 |
| 364 | Ga0097620_100004134 | 3300006931 | Bacteria | 14817 |
| 365 | Ga0097620_100004521 | 3300006931 | Bacteria | 14186 |
| 366 | Ga0097620_100030564 | 3300006931 | Bacteria | 5406 |
| 367 | Ga0097620_100033210 | 3300006931 | Bacteria | 5183 |
| 368 | Ga0097620_100081361 | 3300006931 | Bacteria | 3281 |
| 369 | Ga0097620_100082001 | 3300006931 | Bacteria | 3268 |
| 370 | Ga0097620_100147305 | 3300006931 | Bacteria | 2429 |
| 371 | Ga0097620_100272427 | 3300006931 | Bacteria | 1785 |
| 372 | Ga0097620_100640828 | 3300006931 | Bacteria | 1155 |
| 373 | Ga0075435_100000010 | 3300007076 | Bacteria | 112658 |
| 374 | Ga0075435_100003072 | 3300007076 | Bacteria | 11260 |
| 375 | Ga0075435_100003595 | 3300007076 | Bacteria | 10543 |
| 376 | Ga0075435_100007095 | 3300007076 | Bacteria | 7956 |
| 377 | Ga0075435_100031895 | 3300007076 | Bacteria | 4157 |
| 378 | Ga0075435_100056213 | 3300007076 | Bacteria | 3180 |
| 379 | Ga0075435_100095310 | 3300007076 | Unclassified | 2461 |
| 380 | Ga0075435_100131640 | 3300007076 | Bacteria | 2093 |
| 381 | Ga0075435_100164768 | 3300007076 | Bacteria | 1869 |
| 382 | Ga0075435_100184670 | 3300007076 | Bacteria | 1763 |
| 383 | Ga0075435_100458917 | 3300007076 | Bacteria | 1099 |
| 384 | Ga0105240_10003771 | 3300009093 | Bacteria | 23410 |
| 385 | Ga0105240_10007340 | 3300009093 | Bacteria | 16039 |
| 386 | Ga0105240_10045239 | 3300009093 | Bacteria | 5585 |
| 387 | Ga0105240_10048104 | 3300009093 | Bacteria | 5392 |
| 388 | Ga0105240_10110389 | 3300009093 | Unclassified | 3329 |
| 389 | Ga0105240_10158316 | 3300009093 | Unclassified | 2692 |
| 390 | Ga0105240_10454561 | 3300009093 | Bacteria | 1432 |
| 391 | Ga0105240_10618847 | 3300009093 | Bacteria | 1190 |
| 392 | Ga0105240_10958827 | 3300009093 | Bacteria | 917 |
| 393 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 394 | Ga0111539_10005233 | 3300009094 | Bacteria | 16808 |
| 395 | Ga0111539_10010564 | 3300009094 | Bacteria | 11626 |
| 396 | Ga0111539_10010813 | 3300009094 | Bacteria | 11489 |
| 397 | Ga0111539_10036295 | 3300009094 | Bacteria | 5962 |
| 398 | Ga0111539_10037657 | 3300009094 | Bacteria | 5840 |
| 399 | Ga0111539_10080094 | 3300009094 | Unclassified | 3842 |
| 400 | Ga0111539_10350141 | 3300009094 | Bacteria | 1719 |
| 401 | Ga0111539_10621840 | 3300009094 | Bacteria | 1258 |
| 402 | Ga0105245_10000947 | 3300009098 | Bacteria | 26402 |
| 403 | Ga0105245_10005502 | 3300009098 | Bacteria | 11125 |
| 404 | Ga0105245_10006166 | 3300009098 | Bacteria | 10551 |
| 405 | Ga0105245_10008147 | 3300009098 | Bacteria | 9165 |
| 406 | Ga0105245_10089627 | 3300009098 | Bacteria | 2828 |
| 407 | Ga0105245_10102648 | 3300009098 | Unclassified | 2648 |
| 408 | Ga0105245_10105997 | 3300009098 | Bacteria | 2607 |
| 409 | Ga0105245_10121187 | 3300009098 | Bacteria | 2444 |
| 410 | Ga0105245_10137756 | 3300009098 | Bacteria | 2295 |
| 411 | Ga0105245_10149288 | 3300009098 | Unclassified | 2209 |
| 412 | Ga0105245_10256690 | 3300009098 | Bacteria | 1700 |
| 413 | Ga0105247_10016166 | 3300009101 | Bacteria | 4471 |
| 414 | Ga0105247_10071535 | 3300009101 | Bacteria | 2169 |
| 415 | Ga0114129_10002802 | 3300009147 | Bacteria | 24335 |
| 416 | Ga0114129_10004604 | 3300009147 | Bacteria | 19474 |
| 417 | Ga0114129_10018430 | 3300009147 | Bacteria | 9941 |
| 418 | Ga0114129_10033579 | 3300009147 | Bacteria | 7250 |
| 419 | Ga0114129_10046527 | 3300009147 | Bacteria | 6097 |
| 420 | Ga0114129_10048496 | 3300009147 | Bacteria | 5968 |
| 421 | Ga0114129_10048880 | 3300009147 | Bacteria | 5945 |
| 422 | Ga0114129_10057309 | 3300009147 | Bacteria | 5453 |
| 423 | Ga0114129_10065314 | 3300009147 | Bacteria | 5079 |
| 424 | Ga0114129_10065470 | 3300009147 | Bacteria | 5072 |
| 425 | Ga0114129_10097308 | 3300009147 | Bacteria | 4074 |
| 426 | Ga0114129_10150757 | 3300009147 | Bacteria | 3182 |
| 427 | Ga0114129_10151640 | 3300009147 | Bacteria | 3172 |
| 428 | Ga0114129_10190346 | 3300009147 | Unclassified | 2786 |
| 429 | Ga0114129_10238897 | 3300009147 | Bacteria | 2443 |
| 430 | Ga0114129_10266368 | 3300009147 | Bacteria | 2294 |
| 431 | Ga0114129_10599768 | 3300009147 | Bacteria | 1427 |
| 432 | Ga0114129_10837141 | 3300009147 | Bacteria | 1171 |
| 433 | Ga0105243_10024153 | 3300009148 | Bacteria | 4635 |
| 434 | Ga0105243_10048536 | 3300009148 | Bacteria | 3347 |
| 435 | Ga0105241_10001247 | 3300009174 | Bacteria | 19418 |
| 436 | Ga0105241_10040992 | 3300009174 | Bacteria | 3497 |
| 437 | Ga0105241_10053952 | 3300009174 | Bacteria | 3076 |
| 438 | Ga0105241_10070832 | 3300009174 | Unclassified | 2706 |
| 439 | Ga0105241_10225951 | 3300009174 | Unclassified | 1576 |
| 440 | Ga0105241_10386439 | 3300009174 | Unclassified | 1224 |
| 441 | Ga0105242_10002034 | 3300009176 | Bacteria | 15919 |
| 442 | Ga0105242_10067925 | 3300009176 | Bacteria | 2948 |
| 443 | Ga0105242_10138527 | 3300009176 | Bacteria | 2109 |
| 444 | Ga0105242_10314848 | 3300009176 | Unclassified | 1433 |
| 445 | Ga0105242_10426204 | 3300009176 | Bacteria | 1244 |
| 446 | Ga0105248_10000732 | 3300009177 | Bacteria | 36950 |
| 447 | Ga0105248_10004514 | 3300009177 | Bacteria | 15398 |
| 448 | Ga0105248_10011483 | 3300009177 | Bacteria | 9759 |
| 449 | Ga0105248_10020051 | 3300009177 | Bacteria | 7404 |
| 450 | Ga0105248_10029385 | 3300009177 | Bacteria | 6131 |
| 451 | Ga0105248_10050486 | 3300009177 | Bacteria | 4665 |
| 452 | Ga0105248_10052260 | 3300009177 | Bacteria | 4585 |
| 453 | Ga0105248_10053042 | 3300009177 | Bacteria | 4550 |
| 454 | Ga0105248_10059938 | 3300009177 | Bacteria | 4274 |
| 455 | Ga0105248_10065126 | 3300009177 | Bacteria | 4091 |
| 456 | Ga0105248_10076703 | 3300009177 | Bacteria | 3756 |
| 457 | Ga0105248_10094858 | 3300009177 | Bacteria | 3359 |
| 458 | Ga0105248_10182136 | 3300009177 | Unclassified | 2367 |
| 459 | Ga0105248_10187783 | 3300009177 | Bacteria | 2329 |
| 460 | Ga0105248_10226971 | 3300009177 | Bacteria | 2102 |
| 461 | Ga0105248_10269216 | 3300009177 | Bacteria | 1918 |
| 462 | Ga0105248_10278253 | 3300009177 | Bacteria | 1884 |
| 463 | Ga0105248_10365662 | 3300009177 | Bacteria | 1624 |
| 464 | Ga0105248_10752451 | 3300009177 | Bacteria | 1100 |
| 465 | Ga0105248_10779011 | 3300009177 | Unclassified | 1079 |
| 466 | Ga0105237_10005644 | 3300009545 | Bacteria | 14089 |
| 467 | Ga0105237_10011307 | 3300009545 | Bacteria | 9445 |
| 468 | Ga0105237_10014420 | 3300009545 | Bacteria | 8266 |
| 469 | Ga0105237_10015435 | 3300009545 | Bacteria | 7949 |
| 470 | Ga0105237_10066658 | 3300009545 | Bacteria | 3595 |
| 471 | Ga0105238_10002827 | 3300009551 | Bacteria | 17320 |
| 472 | Ga0105238_10012423 | 3300009551 | Bacteria | 8589 |
| 473 | Ga0105238_10028958 | 3300009551 | Bacteria | 5641 |
| 474 | Ga0105238_10065680 | 3300009551 | Bacteria | 3630 |
| 475 | Ga0105238_10162867 | 3300009551 | Unclassified | 2206 |
| 476 | Ga0105238_10167970 | 3300009551 | Bacteria | 2170 |
| 477 | Ga0105249_10000823 | 3300009553 | Bacteria | 27980 |
| 478 | Ga0105249_10085317 | 3300009553 | Bacteria | 2942 |
| 479 | Ga0105249_10090363 | 3300009553 | Bacteria | 2863 |
| 480 | Ga0105239_10007060 | 3300010375 | Bacteria | 12928 |
| 481 | Ga0105239_10021625 | 3300010375 | Bacteria | 7092 |
| 482 | Ga0105239_10192899 | 3300010375 | Bacteria | 2280 |
| 483 | Ga0105239_10226954 | 3300010375 | Unclassified | 2095 |
| 484 | Ga0105239_10228268 | 3300010375 | Bacteria | 2089 |
| 485 | Ga0105239_10489206 | 3300010375 | Unclassified | 1398 |
| 486 | Ga0105239_10818561 | 3300010375 | Unclassified | 1067 |
| 487 | Ga0105246_10018784 | 3300011119 | Unclassified | 4407 |
| 488 | Ga0105246_10031268 | 3300011119 | Bacteria | 3522 |
| 489 | Ga0105246_10040295 | 3300011119 | Bacteria | 3152 |
| 490 | Ga0105246_10344619 | 3300011119 | Unclassified | 1219 |
| 491 | Ga0157373_10038552 | 3300013100 | Unclassified | 3425 |
| 492 | Ga0157371_10152094 | 3300013102 | Bacteria | 1651 |
| 493 | Ga0157370_10002040 | 3300013104 | Bacteria | 24804 |
| 494 | Ga0157370_10004725 | 3300013104 | Bacteria | 15528 |
| 495 | Ga0157370_10007265 | 3300013104 | Bacteria | 12089 |
| 496 | Ga0157370_10168440 | 3300013104 | Bacteria | 2037 |
| 497 | Ga0157370_10353347 | 3300013104 | Bacteria | 1355 |
| 498 | Ga0157369_10002554 | 3300013105 | Bacteria | 21788 |
| 499 | Ga0157369_10013404 | 3300013105 | Bacteria | 9270 |
| 500 | Ga0157369_10025201 | 3300013105 | Bacteria | 6604 |
| 501 | Ga0157369_10034298 | 3300013105 | Bacteria | 5571 |
| 502 | Ga0157369_10066560 | 3300013105 | Unclassified | 3876 |
| 503 | Ga0157369_10132585 | 3300013105 | Unclassified | 2639 |
| 504 | Ga0157369_10321202 | 3300013105 | Bacteria | 1609 |
| 505 | Ga0157369_10568733 | 3300013105 | Unclassified | 1171 |
| 506 | Ga0157374_10015334 | 3300013296 | Bacteria | 6721 |
| 507 | Ga0157374_10016451 | 3300013296 | Bacteria | 6502 |
| 508 | Ga0157374_10020467 | 3300013296 | Bacteria | 5870 |
| 509 | Ga0157374_10035463 | 3300013296 | Bacteria | 4564 |
| 510 | Ga0157374_10087838 | 3300013296 | Bacteria | 2960 |
| 511 | Ga0157374_10527156 | 3300013296 | Unclassified | 1187 |
| 512 | Ga0157378_10005441 | 3300013297 | Bacteria | 11161 |
| 513 | Ga0157378_10009756 | 3300013297 | Bacteria | 8368 |
| 514 | Ga0157378_10050722 | 3300013297 | Bacteria | 3692 |
| 515 | Ga0157378_10067391 | 3300013297 | Bacteria | 3207 |
| 516 | Ga0157378_10231845 | 3300013297 | Bacteria | 1760 |
| 517 | Ga0157378_10291065 | 3300013297 | Bacteria | 1577 |
| 518 | Ga0157378_10386674 | 3300013297 | Bacteria | 1375 |
| 519 | Ga0157378_10410116 | 3300013297 | Bacteria | 1337 |
| 520 | Ga0157378_10550282 | 3300013297 | Bacteria | 1159 |
| 521 | Ga0163162_10000523 | 3300013306 | Bacteria | 35637 |
| 522 | Ga0163162_10008601 | 3300013306 | Bacteria | 9950 |
| 523 | Ga0163162_10013410 | 3300013306 | Bacteria | 8001 |
| 524 | Ga0163162_10016225 | 3300013306 | Bacteria | 7285 |
| 525 | Ga0163162_10048770 | 3300013306 | Unclassified | 4243 |
| 526 | Ga0163162_10080122 | 3300013306 | Unclassified | 3333 |
| 527 | Ga0163162_10181237 | 3300013306 | Bacteria | 2232 |
| 528 | Ga0163162_10554270 | 3300013306 | Bacteria | 1278 |
| 529 | Ga0163162_10584113 | 3300013306 | Bacteria | 1244 |
| 530 | Ga0157372_10020520 | 3300013307 | Bacteria | 7129 |
| 531 | Ga0157372_10101349 | 3300013307 | Bacteria | 3287 |
| 532 | Ga0157372_10114613 | 3300013307 | Bacteria | 3090 |
| 533 | Ga0157372_10135551 | 3300013307 | Bacteria | 2835 |
| 534 | Ga0157372_11069439 | 3300013307 | Bacteria | 934 |
| 535 | Ga0157375_10002834 | 3300013308 | Bacteria | 15010 |
| 536 | Ga0157375_10065990 | 3300013308 | Bacteria | 3610 |
| 537 | Ga0157375_10088975 | 3300013308 | Unclassified | 3143 |
| 538 | Ga0157375_10268882 | 3300013308 | Bacteria | 1867 |
| 539 | Ga0157375_10533902 | 3300013308 | Bacteria | 1336 |
| 540 | Ga0157375_10772588 | 3300013308 | Bacteria | 1111 |
| 541 | Ga0157375_11059228 | 3300013308 | Bacteria | 948 |
| 542 | Ga0163163_10000519 | 3300014325 | Bacteria | 34361 |
| 543 | Ga0163163_10012292 | 3300014325 | Bacteria | 7796 |
| 544 | Ga0163163_10025838 | 3300014325 | Bacteria | 5603 |
| 545 | Ga0163163_10027913 | 3300014325 | Bacteria | 5412 |
| 546 | Ga0163163_10039336 | 3300014325 | Bacteria | 4615 |
| 547 | Ga0163163_10047478 | 3300014325 | Bacteria | 4221 |
| 548 | Ga0163163_10074324 | 3300014325 | Unclassified | 3391 |
| 549 | Ga0163163_10292684 | 3300014325 | Unclassified | 1681 |
| 550 | Ga0163163_10551027 | 3300014325 | Bacteria | 1216 |
| 551 | Ga0163163_10569450 | 3300014325 | Bacteria | 1196 |
| 552 | Ga0157380_10002501 | 3300014326 | Bacteria | 12388 |
| 553 | Ga0157380_10010757 | 3300014326 | Bacteria | 6593 |
| 554 | Ga0157380_10031559 | 3300014326 | Bacteria | 4068 |
| 555 | Ga0157380_10215357 | 3300014326 | Unclassified | 1715 |
| 556 | Ga0157380_10251604 | 3300014326 | Unclassified | 1599 |
| 557 | Ga0157380_10550328 | 3300014326 | Bacteria | 1132 |
| 558 | Ga0157377_10014582 | 3300014745 | Bacteria | 4001 |
| 559 | Ga0157377_10027036 | 3300014745 | Bacteria | 3077 |
| 560 | Ga0157377_10052001 | 3300014745 | Bacteria | 2312 |
| 561 | Ga0157377_10096921 | 3300014745 | Bacteria | 1750 |
| 562 | Ga0157379_10024368 | 3300014968 | Bacteria | 5372 |
| 563 | Ga0157379_10032183 | 3300014968 | Unclassified | 4674 |
| 564 | Ga0157379_10034436 | 3300014968 | Bacteria | 4516 |
| 565 | Ga0157379_10035809 | 3300014968 | Bacteria | 4425 |
| 566 | Ga0157379_10069607 | 3300014968 | Bacteria | 3147 |
| 567 | Ga0157379_10177376 | 3300014968 | Unclassified | 1924 |
| 568 | Ga0157379_10332657 | 3300014968 | Bacteria | 1388 |
| 569 | Ga0157379_10475349 | 3300014968 | Bacteria | 1156 |
| 570 | Ga0157379_10552911 | 3300014968 | Bacteria | 1071 |
| 571 | Ga0157376_10001464 | 3300014969 | Bacteria | 15555 |
| 572 | Ga0157376_10018430 | 3300014969 | Bacteria | 5352 |
| 573 | Ga0157376_10030077 | 3300014969 | Bacteria | 4332 |
| 574 | Ga0157376_10036034 | 3300014969 | Bacteria | 4005 |
| 575 | Ga0157376_10111007 | 3300014969 | Bacteria | 2414 |
| 576 | Ga0157376_10131246 | 3300014969 | Bacteria | 2236 |
| 577 | Ga0157376_10134695 | 3300014969 | Bacteria | 2209 |
| 578 | Ga0157376_10140026 | 3300014969 | Bacteria | 2169 |
| 579 | Ga0157376_10162452 | 3300014969 | Unclassified | 2026 |
| 580 | Ga0157376_10163472 | 3300014969 | Bacteria | 2020 |
| 581 | Ga0157376_10328337 | 3300014969 | Unclassified | 1457 |
| 582 | Ga0157376_10367418 | 3300014969 | Bacteria | 1382 |
| 583 | Ga0157376_10520827 | 3300014969 | Bacteria | 1172 |
| 584 | Ga0157376_10685225 | 3300014969 | Unclassified | 1028 |
| 585 | Ga0163161_10059162 | 3300017792 | Bacteria | 2786 |
| 586 | Ga0206352_11354533 | 3300020078 | Bacteria | 1046 |
| 587 | Ga0154015_1222796 | 3300020610 | Unclassified | 1425 |
| 588 | Ga0213876_10202830 | 3300021384 | Unclassified | 1054 |
| 589 | Ga0213875_10011417 | 3300021388 | Bacteria | 4419 |
| 590 | Ga0213875_10018482 | 3300021388 | Bacteria | 3358 |
| 591 | Ga0213875_10025438 | 3300021388 | Bacteria | 2820 |
| 592 | Ga0213875_10054213 | 3300021388 | Bacteria | 1878 |
| 593 | Ga0207697_10000251 | 3300025315 | Bacteria | 29559 |
| 594 | Ga0207697_10004674 | 3300025315 | Bacteria | 6495 |
| 595 | Ga0207682_10004064 | 3300025893 | Bacteria | 6217 |
| 596 | Ga0207682_10033729 | 3300025893 | Bacteria | 2062 |
| 597 | Ga0207642_10152192 | 3300025899 | Bacteria | 1233 |
| 598 | Ga0207688_10016882 | 3300025901 | Bacteria | 3965 |
| 599 | Ga0207688_10027862 | 3300025901 | Bacteria | 3107 |
| 600 | Ga0207688_10277646 | 3300025901 | Bacteria | 1020 |
| 601 | Ga0207680_10003712 | 3300025903 | Bacteria | 7179 |
| 602 | Ga0207680_10038400 | 3300025903 | Bacteria | 2771 |
| 603 | Ga0207680_10170274 | 3300025903 | Bacteria | 1466 |
| 604 | Ga0207680_10208439 | 3300025903 | Bacteria | 1335 |
| 605 | Ga0207699_10018329 | 3300025906 | Bacteria | 3707 |
| 606 | Ga0207699_10076098 | 3300025906 | Unclassified | 2067 |
| 607 | Ga0207699_10149616 | 3300025906 | Bacteria | 1543 |
| 608 | Ga0207645_10000804 | 3300025907 | Bacteria | 26273 |
| 609 | Ga0207645_10017281 | 3300025907 | Bacteria | 4765 |
| 610 | Ga0207643_10005115 | 3300025908 | Bacteria | 7019 |
| 611 | Ga0207643_10022431 | 3300025908 | Bacteria | 3476 |
| 612 | Ga0207643_10074668 | 3300025908 | Bacteria | 1956 |
| 613 | Ga0207705_10047827 | 3300025909 | Bacteria | 3077 |
| 614 | Ga0207684_10294329 | 3300025910 | Bacteria | 1400 |
| 615 | Ga0207684_10422770 | 3300025910 | Bacteria | 1145 |
| 616 | Ga0207654_10002296 | 3300025911 | Bacteria | 9802 |
| 617 | Ga0207654_10041480 | 3300025911 | Bacteria | 2599 |
| 618 | Ga0207654_10103783 | 3300025911 | Bacteria | 1756 |
| 619 | Ga0207654_10126426 | 3300025911 | Unclassified | 1612 |
| 620 | Ga0207707_10000469 | 3300025912 | Bacteria | 41694 |
| 621 | Ga0207707_10012066 | 3300025912 | Bacteria | 7515 |
| 622 | Ga0207707_10044280 | 3300025912 | Bacteria | 3881 |
| 623 | Ga0207707_10058030 | 3300025912 | Bacteria | 3369 |
| 624 | Ga0207707_10177976 | 3300025912 | Bacteria | 1857 |
| 625 | Ga0207695_10002673 | 3300025913 | Bacteria | 26047 |
| 626 | Ga0207695_10017159 | 3300025913 | Bacteria | 8436 |
| 627 | Ga0207695_10069924 | 3300025913 | Bacteria | 3591 |
| 628 | Ga0207695_10077984 | 3300025913 | Bacteria | 3363 |
| 629 | Ga0207695_10080223 | 3300025913 | Unclassified | 3305 |
| 630 | Ga0207695_10102855 | 3300025913 | Bacteria | 2849 |
| 631 | Ga0207695_10163172 | 3300025913 | Unclassified | 2158 |
| 632 | Ga0207695_10169693 | 3300025913 | Unclassified | 2108 |
| 633 | Ga0207695_10173796 | 3300025913 | Bacteria | 2078 |
| 634 | Ga0207695_10377002 | 3300025913 | Bacteria | 1304 |
| 635 | Ga0207671_10017277 | 3300025914 | Bacteria | 5569 |
| 636 | Ga0207671_10021931 | 3300025914 | Bacteria | 4838 |
| 637 | Ga0207671_10036388 | 3300025914 | Bacteria | 3651 |
| 638 | Ga0207671_10052496 | 3300025914 | Bacteria | 3021 |
| 639 | Ga0207660_10012897 | 3300025917 | Bacteria | 5474 |
| 640 | Ga0207660_10019519 | 3300025917 | Bacteria | 4532 |
| 641 | Ga0207660_10316966 | 3300025917 | Unclassified | 1244 |
| 642 | Ga0207662_10003470 | 3300025918 | Bacteria | 8120 |
| 643 | Ga0207662_10010254 | 3300025918 | Bacteria | 5170 |
| 644 | Ga0207662_10039592 | 3300025918 | Bacteria | 2766 |
| 645 | Ga0207662_10182555 | 3300025918 | Bacteria | 1351 |
| 646 | Ga0207657_10004759 | 3300025919 | Bacteria | 14330 |
| 647 | Ga0207657_10088541 | 3300025919 | Bacteria | 2587 |
| 648 | Ga0207657_10375185 | 3300025919 | Unclassified | 1120 |
| 649 | Ga0207649_10047194 | 3300025920 | Bacteria | 2649 |
| 650 | Ga0207649_10067064 | 3300025920 | Bacteria | 2277 |
| 651 | Ga0207652_10003282 | 3300025921 | Bacteria | 13394 |
| 652 | Ga0207652_10020903 | 3300025921 | Bacteria | 5396 |
| 653 | Ga0207652_10173993 | 3300025921 | Bacteria | 1933 |
| 654 | Ga0207652_10237024 | 3300025921 | Unclassified | 1644 |
| 655 | Ga0207652_10449403 | 3300025921 | Unclassified | 1162 |
| 656 | Ga0207646_10085333 | 3300025922 | Bacteria | 2825 |
| 657 | Ga0207646_10167566 | 3300025922 | Bacteria | 1983 |
| 658 | Ga0207681_10001189 | 3300025923 | Bacteria | 16756 |
| 659 | Ga0207681_10002783 | 3300025923 | Bacteria | 11067 |
| 660 | Ga0207681_10014104 | 3300025923 | Bacteria | 4956 |
| 661 | Ga0207681_10030400 | 3300025923 | Bacteria | 3521 |
| 662 | Ga0207681_10076646 | 3300025923 | Unclassified | 2348 |
| 663 | Ga0207681_10237119 | 3300025923 | Bacteria | 1418 |
| 664 | Ga0207694_10002185 | 3300025924 | Bacteria | 16071 |
| 665 | Ga0207694_10004422 | 3300025924 | Bacteria | 10990 |
| 666 | Ga0207694_10010532 | 3300025924 | Bacteria | 6975 |
| 667 | Ga0207694_10025618 | 3300025924 | Bacteria | 4484 |
| 668 | Ga0207694_10051810 | 3300025924 | Bacteria | 3181 |
| 669 | Ga0207694_10069761 | 3300025924 | Bacteria | 2746 |
| 670 | Ga0207650_10000510 | 3300025925 | Bacteria | 32441 |
| 671 | Ga0207650_10192535 | 3300025925 | Bacteria | 1630 |
| 672 | Ga0207650_10255919 | 3300025925 | Bacteria | 1419 |
| 673 | Ga0207659_10000406 | 3300025926 | Bacteria | 25932 |
| 674 | Ga0207659_10001544 | 3300025926 | Bacteria | 13670 |
| 675 | Ga0207659_10021429 | 3300025926 | Bacteria | 4289 |
| 676 | Ga0207659_10040497 | 3300025926 | Bacteria | 3258 |
| 677 | Ga0207659_10071013 | 3300025926 | Unclassified | 2541 |
| 678 | Ga0207659_10199160 | 3300025926 | Bacteria | 1598 |
| 679 | Ga0207687_10008146 | 3300025927 | Bacteria | 6860 |
| 680 | Ga0207687_10020100 | 3300025927 | Bacteria | 4429 |
| 681 | Ga0207687_10028830 | 3300025927 | Bacteria | 3730 |
| 682 | Ga0207687_10087112 | 3300025927 | Bacteria | 2269 |
| 683 | Ga0207687_10093899 | 3300025927 | Bacteria | 2194 |
| 684 | Ga0207687_10103150 | 3300025927 | Unclassified | 2103 |
| 685 | Ga0207687_10118133 | 3300025927 | Bacteria | 1979 |
| 686 | Ga0207687_10191354 | 3300025927 | Bacteria | 1593 |
| 687 | Ga0207687_10193413 | 3300025927 | Bacteria | 1585 |
| 688 | Ga0207687_10360949 | 3300025927 | Bacteria | 1186 |
| 689 | Ga0207687_10434738 | 3300025927 | Unclassified | 1086 |
| 690 | Ga0207700_10000647 | 3300025928 | Bacteria | 20348 |
| 691 | Ga0207700_10063912 | 3300025928 | Bacteria | 2801 |
| 692 | Ga0207700_10390856 | 3300025928 | Bacteria | 1218 |
| 693 | Ga0207664_10016657 | 3300025929 | Bacteria | 5367 |
| 694 | Ga0207664_10059041 | 3300025929 | Unclassified | 3054 |
| 695 | Ga0207664_10238272 | 3300025929 | Bacteria | 1583 |
| 696 | Ga0207664_10263842 | 3300025929 | Unclassified | 1507 |
| 697 | Ga0207644_10008275 | 3300025931 | Bacteria | 6815 |
| 698 | Ga0207644_10038363 | 3300025931 | Bacteria | 3374 |
| 699 | Ga0207644_10061465 | 3300025931 | Bacteria | 2721 |
| 700 | Ga0207644_10062961 | 3300025931 | Unclassified | 2692 |
| 701 | Ga0207644_10221293 | 3300025931 | Bacteria | 1501 |
| 702 | Ga0207690_10015894 | 3300025932 | Bacteria | 4570 |
| 703 | Ga0207690_10098485 | 3300025932 | Unclassified | 2083 |
| 704 | Ga0207706_10036652 | 3300025933 | Bacteria | 4356 |
| 705 | Ga0207706_10045911 | 3300025933 | Bacteria | 3869 |
| 706 | Ga0207706_10086552 | 3300025933 | Unclassified | 2755 |
| 707 | Ga0207706_10130953 | 3300025933 | Bacteria | 2206 |
| 708 | Ga0207706_10171870 | 3300025933 | Bacteria | 1904 |
| 709 | Ga0207686_10001173 | 3300025934 | Bacteria | 15151 |
| 710 | Ga0207686_10010878 | 3300025934 | Bacteria | 4964 |
| 711 | Ga0207686_10044969 | 3300025934 | Bacteria | 2714 |
| 712 | Ga0207686_10060332 | 3300025934 | Bacteria | 2400 |
| 713 | Ga0207686_10096020 | 3300025934 | Unclassified | 1968 |
| 714 | Ga0207686_10113719 | 3300025934 | Bacteria | 1830 |
| 715 | Ga0207709_10041625 | 3300025935 | Bacteria | 2758 |
| 716 | Ga0207709_10165569 | 3300025935 | Bacteria | 1546 |
| 717 | Ga0207670_10001976 | 3300025936 | Bacteria | 10747 |
| 718 | Ga0207670_10043533 | 3300025936 | Bacteria | 2966 |
| 719 | Ga0207670_10070524 | 3300025936 | Bacteria | 2414 |
| 720 | Ga0207670_10262870 | 3300025936 | Bacteria | 1338 |
| 721 | Ga0207669_10000834 | 3300025937 | Bacteria | 13199 |
| 722 | Ga0207669_10010564 | 3300025937 | Bacteria | 4449 |
| 723 | Ga0207669_10078011 | 3300025937 | Bacteria | 2109 |
| 724 | Ga0207669_10180958 | 3300025937 | Bacteria | 1511 |
| 725 | Ga0207704_10016397 | 3300025938 | Unclassified | 3806 |
| 726 | Ga0207704_10170130 | 3300025938 | Bacteria | 1562 |
| 727 | Ga0207704_10220204 | 3300025938 | Bacteria | 1404 |
| 728 | Ga0207691_10002846 | 3300025940 | Bacteria | 16847 |
| 729 | Ga0207691_10007867 | 3300025940 | Bacteria | 10269 |
| 730 | Ga0207691_10015722 | 3300025940 | Bacteria | 7192 |
| 731 | Ga0207691_10027418 | 3300025940 | Bacteria | 5340 |
| 732 | Ga0207691_10029846 | 3300025940 | Bacteria | 5099 |
| 733 | Ga0207691_10055709 | 3300025940 | Bacteria | 3603 |
| 734 | Ga0207691_10074840 | 3300025940 | Bacteria | 3054 |
| 735 | Ga0207711_10004826 | 3300025941 | Bacteria | 11456 |
| 736 | Ga0207711_10008634 | 3300025941 | Bacteria | 8519 |
| 737 | Ga0207711_10011678 | 3300025941 | Bacteria | 7297 |
| 738 | Ga0207711_10017341 | 3300025941 | Bacteria | 5982 |
| 739 | Ga0207711_10031262 | 3300025941 | Bacteria | 4494 |
| 740 | Ga0207711_10040080 | 3300025941 | Bacteria | 3984 |
| 741 | Ga0207711_10124129 | 3300025941 | Bacteria | 2308 |
| 742 | Ga0207711_10140317 | 3300025941 | Bacteria | 2174 |
| 743 | Ga0207711_10153260 | 3300025941 | Bacteria | 2081 |
| 744 | Ga0207711_10165265 | 3300025941 | Bacteria | 2005 |
| 745 | Ga0207711_10235959 | 3300025941 | Bacteria | 1676 |
| 746 | Ga0207711_10250000 | 3300025941 | Bacteria | 1628 |
| 747 | Ga0207711_10307037 | 3300025941 | Bacteria | 1464 |
| 748 | Ga0207711_10417827 | 3300025941 | Unclassified | 1247 |
| 749 | Ga0207711_10605107 | 3300025941 | Bacteria | 1023 |
| 750 | Ga0207689_10028011 | 3300025942 | Bacteria | 4713 |
| 751 | Ga0207689_10028147 | 3300025942 | Bacteria | 4700 |
| 752 | Ga0207689_10045229 | 3300025942 | Unclassified | 3641 |
| 753 | Ga0207689_10070739 | 3300025942 | Unclassified | 2866 |
| 754 | Ga0207661_10000014 | 3300025944 | Bacteria | 322246 |
| 755 | Ga0207661_10003445 | 3300025944 | Bacteria | 10981 |
| 756 | Ga0207661_10051668 | 3300025944 | Bacteria | 3280 |
| 757 | Ga0207661_10131293 | 3300025944 | Bacteria | 2146 |
| 758 | Ga0207661_10162110 | 3300025944 | Bacteria | 1941 |
| 759 | Ga0207661_10167815 | 3300025944 | Unclassified | 1909 |
| 760 | Ga0207661_10502444 | 3300025944 | Bacteria | 1108 |
| 761 | Ga0207679_10008015 | 3300025945 | Bacteria | 6716 |
| 762 | Ga0207679_10026100 | 3300025945 | Bacteria | 4026 |
| 763 | Ga0207679_10043006 | 3300025945 | Bacteria | 3250 |
| 764 | Ga0207679_10058493 | 3300025945 | Bacteria | 2857 |
| 765 | Ga0207679_10091233 | 3300025945 | Bacteria | 2357 |
| 766 | Ga0207679_10221065 | 3300025945 | Bacteria | 1593 |
| 767 | Ga0207667_10000682 | 3300025949 | Bacteria | 44026 |
| 768 | Ga0207667_10005221 | 3300025949 | Bacteria | 15843 |
| 769 | Ga0207667_10014682 | 3300025949 | Bacteria | 8915 |
| 770 | Ga0207667_10023929 | 3300025949 | Bacteria | 6718 |
| 771 | Ga0207667_10272111 | 3300025949 | Unclassified | 1731 |
| 772 | Ga0207667_10487076 | 3300025949 | Unclassified | 1252 |
| 773 | Ga0207667_10691963 | 3300025949 | Unclassified | 1022 |
| 774 | Ga0207651_10014979 | 3300025960 | Bacteria | 4492 |
| 775 | Ga0207651_10052352 | 3300025960 | Bacteria | 2783 |
| 776 | Ga0207651_10157069 | 3300025960 | Bacteria | 1778 |
| 777 | Ga0207651_10163968 | 3300025960 | Bacteria | 1745 |
| 778 | Ga0207651_10190054 | 3300025960 | Unclassified | 1637 |
| 779 | Ga0207651_10231764 | 3300025960 | Bacteria | 1500 |
| 780 | Ga0207651_10266721 | 3300025960 | Bacteria | 1408 |
| 781 | Ga0207712_10031512 | 3300025961 | Unclassified | 3572 |
| 782 | Ga0207712_10143758 | 3300025961 | Unclassified | 1834 |
| 783 | Ga0207712_10216910 | 3300025961 | Bacteria | 1527 |
| 784 | Ga0207668_10096930 | 3300025972 | Bacteria | 2181 |
| 785 | Ga0207668_10203514 | 3300025972 | Unclassified | 1578 |
| 786 | Ga0207640_10040764 | 3300025981 | Unclassified | 2948 |
| 787 | Ga0207640_10092541 | 3300025981 | Unclassified | 2098 |
| 788 | Ga0207658_10087645 | 3300025986 | Bacteria | 2404 |
| 789 | Ga0207658_10123421 | 3300025986 | Unclassified | 2069 |
| 790 | Ga0207658_10125042 | 3300025986 | Bacteria | 2057 |
| 791 | Ga0207658_10169281 | 3300025986 | Unclassified | 1798 |
| 792 | Ga0207677_10012852 | 3300026023 | Bacteria | 4833 |
| 793 | Ga0207677_10036784 | 3300026023 | Unclassified | 3194 |
| 794 | Ga0207677_10112647 | 3300026023 | Bacteria | 2029 |
| 795 | Ga0207677_10129705 | 3300026023 | Unclassified | 1912 |
| 796 | Ga0207677_10151753 | 3300026023 | Bacteria | 1789 |
| 797 | Ga0207677_10177838 | 3300026023 | Bacteria | 1671 |
| 798 | Ga0207677_10201256 | 3300026023 | Unclassified | 1583 |
| 799 | Ga0207703_10005810 | 3300026035 | Bacteria | 9884 |
| 800 | Ga0207703_10006792 | 3300026035 | Bacteria | 9121 |
| 801 | Ga0207703_10010459 | 3300026035 | Bacteria | 7254 |
| 802 | Ga0207703_10042382 | 3300026035 | Bacteria | 3651 |
| 803 | Ga0207703_10086190 | 3300026035 | Bacteria | 2630 |
| 804 | Ga0207703_10098044 | 3300026035 | Bacteria | 2478 |
| 805 | Ga0207703_10105486 | 3300026035 | Bacteria | 2396 |
| 806 | Ga0207703_10122403 | 3300026035 | Bacteria | 2235 |
| 807 | Ga0207703_10171140 | 3300026035 | Bacteria | 1910 |
| 808 | Ga0207703_10364836 | 3300026035 | Bacteria | 1333 |
| 809 | Ga0207639_10007173 | 3300026041 | Bacteria | 7594 |
| 810 | Ga0207639_10247590 | 3300026041 | Bacteria | 1553 |
| 811 | Ga0207678_10286078 | 3300026067 | Bacteria | 1415 |
| 812 | Ga0207708_10010013 | 3300026075 | Bacteria | 7041 |
| 813 | Ga0207708_10015215 | 3300026075 | Bacteria | 5768 |
| 814 | Ga0207708_10020342 | 3300026075 | Bacteria | 5006 |
| 815 | Ga0207702_10010003 | 3300026078 | Bacteria | 7952 |
| 816 | Ga0207702_10027031 | 3300026078 | Bacteria | 4765 |
| 817 | Ga0207702_10038722 | 3300026078 | Unclassified | 3993 |
| 818 | Ga0207702_10134529 | 3300026078 | Bacteria | 2229 |
| 819 | Ga0207702_10235584 | 3300026078 | Bacteria | 1713 |
| 820 | Ga0207702_10254628 | 3300026078 | Unclassified | 1650 |
| 821 | Ga0207702_10287600 | 3300026078 | Unclassified | 1556 |
| 822 | Ga0207641_10001693 | 3300026088 | Bacteria | 21452 |
| 823 | Ga0207641_10008647 | 3300026088 | Bacteria | 8406 |
| 824 | Ga0207641_10022405 | 3300026088 | Bacteria | 5200 |
| 825 | Ga0207641_10078131 | 3300026088 | Unclassified | 2866 |
| 826 | Ga0207641_10172170 | 3300026088 | Bacteria | 1977 |
| 827 | Ga0207641_10459548 | 3300026088 | Bacteria | 1231 |
| 828 | Ga0207648_10007406 | 3300026089 | Bacteria | 10802 |
| 829 | Ga0207648_10014545 | 3300026089 | Bacteria | 7267 |
| 830 | Ga0207648_10033812 | 3300026089 | Unclassified | 4508 |
| 831 | Ga0207648_10229747 | 3300026089 | Bacteria | 1650 |
| 832 | Ga0207648_10266198 | 3300026089 | Bacteria | 1530 |
| 833 | Ga0207648_10576949 | 3300026089 | Bacteria | 1035 |
| 834 | Ga0207648_10659308 | 3300026089 | Bacteria | 967 |
| 835 | Ga0207676_10035657 | 3300026095 | Bacteria | 3778 |
| 836 | Ga0207676_10093582 | 3300026095 | Bacteria | 2474 |
| 837 | Ga0207676_10197404 | 3300026095 | Bacteria | 1775 |
| 838 | Ga0207676_10230271 | 3300026095 | Bacteria | 1656 |
| 839 | Ga0207676_10425512 | 3300026095 | Bacteria | 1246 |
| 840 | Ga0207674_10001168 | 3300026116 | Bacteria | 34093 |
| 841 | Ga0207674_10006848 | 3300026116 | Bacteria | 13365 |
| 842 | Ga0207674_10025411 | 3300026116 | Bacteria | 6317 |
| 843 | Ga0207674_10026109 | 3300026116 | Bacteria | 6214 |
| 844 | Ga0207674_10027367 | 3300026116 | Bacteria | 6033 |
| 845 | Ga0207674_10230386 | 3300026116 | Bacteria | 1800 |
| 846 | Ga0207674_10246667 | 3300026116 | Bacteria | 1733 |
| 847 | Ga0207674_10541482 | 3300026116 | Unclassified | 1125 |
| 848 | Ga0207675_100000903 | 3300026118 | Bacteria | 29636 |
| 849 | Ga0207675_100020152 | 3300026118 | Bacteria | 6217 |
| 850 | Ga0207675_100030141 | 3300026118 | Bacteria | 5052 |
| 851 | Ga0207675_100100885 | 3300026118 | Bacteria | 2719 |
| 852 | Ga0207675_100159237 | 3300026118 | Bacteria | 2153 |
| 853 | Ga0207675_100269909 | 3300026118 | Bacteria | 1651 |
| 854 | Ga0207683_10045566 | 3300026121 | Bacteria | 3835 |
| 855 | Ga0207683_10152651 | 3300026121 | Bacteria | 2085 |
| 856 | Ga0207683_10238272 | 3300026121 | Bacteria | 1659 |
| 857 | Ga0207698_10023487 | 3300026142 | Bacteria | 4309 |
| 858 | Ga0207698_10023937 | 3300026142 | Bacteria | 4276 |
| 859 | Ga0209974_10025430 | 3300027876 | Bacteria | 1959 |
| 860 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 861 | Ga0207428_10002859 | 3300027907 | Bacteria | 17107 |
| 862 | Ga0207428_10004898 | 3300027907 | Bacteria | 12614 |
| 863 | Ga0207428_10024613 | 3300027907 | Bacteria | 5054 |
| 864 | Ga0207428_10085152 | 3300027907 | Bacteria | 2462 |
| 865 | Ga0207428_10251830 | 3300027907 | Bacteria | 1317 |
| 866 | Ga0207428_10277431 | 3300027907 | Bacteria | 1245 |
| 867 | Ga0268266_10055756 | 3300028379 | Bacteria | 3398 |
| 868 | Ga0268266_10060920 | 3300028379 | Unclassified | 3254 |
| 869 | Ga0268266_10075877 | 3300028379 | Unclassified | 2920 |
| 870 | Ga0268265_10000073 | 3300028380 | Bacteria | 128856 |
| 871 | Ga0268265_10009325 | 3300028380 | Bacteria | 6632 |
| 872 | Ga0268265_10024774 | 3300028380 | Bacteria | 4250 |
| 873 | Ga0268265_10031751 | 3300028380 | Bacteria | 3817 |
| 874 | Ga0268265_10062450 | 3300028380 | Bacteria | 2862 |
| 875 | Ga0268265_10102499 | 3300028380 | Bacteria | 2315 |
| 876 | Ga0268265_10212088 | 3300028380 | Bacteria | 1688 |
| 877 | Ga0268265_10227380 | 3300028380 | Bacteria | 1637 |
| 878 | Ga0268264_10021749 | 3300028381 | Bacteria | 5236 |
| 879 | Ga0268264_10025089 | 3300028381 | Bacteria | 4871 |
| 880 | Ga0268264_10081631 | 3300028381 | Bacteria | 2764 |
| 881 | Ga0268264_10125913 | 3300028381 | Bacteria | 2264 |
| 882 | Ga0268264_10314559 | 3300028381 | Bacteria | 1478 |
| 883 | Ga0268264_10453985 | 3300028381 | Bacteria | 1242 |
| 884 | Ga0265325_10089588 | 3300031241 | Bacteria | 1519 |
| 885 | Ga0265331_10034626 | 3300031250 | Bacteria | 2490 |
| 886 | Ga0265331_10167585 | 3300031250 | Unclassified | 995 |
| 887 | Ga0265316_10059019 | 3300031344 | Unclassified | 2986 |
| 888 | Ga0265314_10000282 | 3300031711 | Bacteria | 73865 |
| 889 | Ga0265314_10016083 | 3300031711 | Bacteria | 5923 |
| 890 | Ga0265314_10145280 | 3300031711 | Bacteria | 1461 |
| 891 | Ga0307405_10020590 | 3300031731 | Bacteria | 3689 |
| 892 | Ga0307416_100024955 | 3300032002 | Bacteria | 4374 |
| 893 | Ga0307414_10292512 | 3300032004 | Bacteria | 1374 |
| 894 | Ga0307411_10155755 | 3300032005 | Bacteria | 1704 |
| 895 | Ga0373948_0000450 | 3300034817 | Bacteria | 5115 |
| 896 | Ga0373950_0000380 | 3300034818 | Bacteria | 5493 |
| 897 | Ga0373958_0009516 | 3300034819 | Bacteria | 1601 |
| 898 | Ga0373938_0002084 | 3300034957 | Bacteria | 3215 |
| 899 | Ga0373926_0073966 | 3300035083 | Unclassified | 1254 |
| 900 | Ga0373929_0000150 | 3300035085 | Bacteria | 12080 |
| 901 | Ga0373940_0025734 | 3300035088 | Bacteria | 1534 |
| 902 | Ga0373944_0038200 | 3300035089 | Unclassified | 1474 |
| 903 | Ga0373949_0000545 | 3300035090 | Bacteria | 12424 |
| 904 | Ga0373951_0001989 | 3300035091 | Bacteria | 5237 |
| 905 | Ga0373952_0000564 | 3300035092 | Bacteria | 6542 |
| 906 | Ga0373932_0001009 | 3300035112 | Bacteria | 8146 |
| 907 | Ga0373932_0012441 | 3300035112 | Unclassified | 2096 |
| 908 | Ga0373936_0023516 | 3300035113 | Unclassified | 2402 |
| 909 | Ga0373941_0001769 | 3300035115 | Unclassified | 4649 |
| 910 | Ga0373954_0016180 | 3300035118 | Bacteria | 3337 |
| 911 | Ga0373956_0019596 | 3300035119 | Bacteria | 2870 |
| 912 | Ga0373960_0000414 | 3300035121 | Bacteria | 8361 |
| 913 | Ga0373943_0009153 | 3300035170 | Bacteria | 4439 |
| 914 | Ga0373943_0115028 | 3300035170 | Unclassified | 1423 |
| 915 | Ga0373946_0001957 | 3300035171 | Bacteria | 7205 |
| 916 | Ga0373946_0084807 | 3300035171 | Bacteria | 1394 |
| 917 | Ga0373946_0203278 | 3300035171 | Bacteria | 950 |
| 918 | Ga0373955_0010717 | 3300035172 | Bacteria | 4341 |
| 919 | Ga0373955_0033486 | 3300035172 | Unclassified | 2707 |
| 920 | Ga0373955_0087911 | 3300035172 | Bacteria | 1767 |
| 921 | Ga0373955_0137629 | 3300035172 | Unclassified | 1429 |
| 922 | Ga0373955_0148216 | 3300035172 | Unclassified | 1380 |
| 923 | Ga0373955_0180283 | 3300035172 | Bacteria | 1253 |
| 924 | Ga0373942_0001464 | 3300035207 | Bacteria | 6065 |
| 925 | Ga0373962_0000549 | 3300035242 | Bacteria | 8429 |
| 926 | Ga0373931_0082874 | 3300035691 | Bacteria | 1773 |
| 927 | Ga0373931_0096874 | 3300035691 | Unclassified | 1653 |
| 928 | Ga0373935_0011426 | 3300035692 | Bacteria | 5331 |
| 929 | Ga0373935_0136733 | 3300035692 | Bacteria | 1652 |
| 930 | Ga0373935_0383354 | 3300035692 | Bacteria | 1007 |
| 931 | Ga0373927_0012421 | 3300035695 | Bacteria | 5670 |
| 932 | Ga0373927_0077234 | 3300035695 | Unclassified | 2157 |
| 933 | Ga0373927_0212399 | 3300035695 | Bacteria | 1271 |
| 934 | Ga0373927_0271469 | 3300035695 | Unclassified | 1115 |
| 935 | Ga0373947_0007354 | 3300035725 | Bacteria | 6376 |
| 936 | Ga0373947_0007636 | 3300035725 | Bacteria | 6257 |
| 937 | Ga0373947_0009077 | 3300035725 | Bacteria | 5715 |
| 938 | Ga0373947_0021219 | 3300035725 | Unclassified | 3759 |
| 939 | Ga0373937_0002587 | 3300036401 | Bacteria | 15053 |
| 940 | Ga0373937_0002894 | 3300036401 | Bacteria | 14333 |
| 941 | Ga0373937_0004569 | 3300036401 | Bacteria | 11745 |
| 942 | Ga0373937_0016270 | 3300036401 | Bacteria | 6601 |
| 943 | Ga0373937_0316107 | 3300036401 | Bacteria | 1477 |
| 944 | Ga0373925_0000762 | 3300037068 | Bacteria | 29631 |
| 945 | Ga0373925_0011459 | 3300037068 | Bacteria | 6418 |
| 946 | Ga0373925_0044686 | 3300037068 | Bacteria | 3290 |
| 947 | Ga0373925_0053724 | 3300037068 | Unclassified | 3012 |
| 948 | Ga0373925_0085342 | 3300037068 | Bacteria | 2407 |
| 949 | Ga0373925_0212877 | 3300037068 | Bacteria | 1540 |
| 950 | Ga0373925_0272102 | 3300037068 | Bacteria | 1363 |
| 951 | Ga0373925_0347378 | 3300037068 | Bacteria | 1204 |
| 952 | Ga0373925_0451110 | 3300037068 | Unclassified | 1053 |
| 953 | Ga0373925_0469260 | 3300037068 | Bacteria | 1032 |
| 954 | Ga0395898_0263372 | 3300037466 | Bacteria | 1644 |
| 955 | Ga0436364_0178301 | 3300037853 | Bacteria | 6943 |
| 956 | Ga0436364_0408279 | 3300037853 | Bacteria | 14480 |
| 957 | Ga0436364_0971922 | 3300037853 | Bacteria | 6651 |
| 958 | Ga0436364_1201673 | 3300037853 | Bacteria | 5895 |
| 959 | Ga0436364_1272981 | 3300037853 | Unclassified | 1297 |
| 960 | Ga0436364_1497633 | 3300037853 | Bacteria | 14473 |
| 961 | Ga0395901_0150281 | 3300038443 | Bacteria | 2448 |
| 962 | Ga0436365_0512859 | 3300039437 | Bacteria | 1915 |
| 963 | Ga0436365_1058523 | 3300039437 | Bacteria | 1166 |
| 964 | Ga0436365_1745652 | 3300039437 | Bacteria | 6996 |
| 965 | Ga0436363_0045077 | 3300039450 | Unclassified | 3839 |
| 966 | Ga0436363_0774504 | 3300039450 | Bacteria | 834 |
| 967 | Ga0436363_1317700 | 3300039450 | Bacteria | 1854 |
| 968 | Ga0439464_0044305 | 3300042439 | Bacteria | 1274 |
| 969 | Ga0451577_0023209 | 3300042876 | Bacteria | 5660 |
| 970 | Ga0466966_0180236 | 3300044684 | Unclassified | 1282 |
| 971 | Ga0453684_0401022 | 3300044712 | Unclassified | 1536 |
| 972 | Ga0451576_0020484 | 3300045051 | Bacteria | 7201 |
| 973 | Ga0451576_0057424 | 3300045051 | Bacteria | 4068 |
| 974 | Ga0451576_0065700 | 3300045051 | Unclassified | 3776 |
| 975 | Ga0451576_0194751 | 3300045051 | Bacteria | 2117 |
| 976 | Ga0451576_0208766 | 3300045051 | Unclassified | 2039 |
| 977 | Ga0466958_0090396 | 3300045836 | Bacteria | 1895 |
| 978 | Ga0495603_0099277 | 3300046455 | Bacteria | 1700 |
| 979 | Ga0495629_0009447 | 3300046459 | Bacteria | 7132 |
| 980 | Ga0495629_0056713 | 3300046459 | Bacteria | 2739 |
| 981 | Ga0495629_0184520 | 3300046459 | Bacteria | 1445 |
| 982 | Ga0495629_0277414 | 3300046459 | Bacteria | 1151 |
| 983 | Ga0495629_0338226 | 3300046459 | Unclassified | 1028 |
| 984 | Ga0495651_0286279 | 3300046462 | Bacteria | 1111 |
| 985 | Ga0495580_0000771 | 3300046472 | Bacteria | 27575 |
| 986 | Ga0495580_0003605 | 3300046472 | Bacteria | 13129 |
| 987 | Ga0495580_0026077 | 3300046472 | Bacteria | 4265 |
| 988 | Ga0495580_0127527 | 3300046472 | Bacteria | 1766 |
| 989 | Ga0495580_0268328 | 3300046472 | Bacteria | 1166 |
| 990 | Ga0495582_0042507 | 3300046473 | Bacteria | 2503 |
| 991 | Ga0495582_0056164 | 3300046473 | Bacteria | 2170 |
| 992 | Ga0495582_0162373 | 3300046473 | Bacteria | 1271 |
| 993 | Ga0495639_0053615 | 3300046475 | Bacteria | 1838 |
| 994 | Ga0495662_0036778 | 3300046476 | Bacteria | 2362 |
| 995 | Ga0495664_0091947 | 3300046477 | Bacteria | 1824 |
| 996 | Ga0495584_0073011 | 3300046491 | Bacteria | 1724 |
| 997 | Ga0495594_0098355 | 3300046499 | Bacteria | 1645 |
| 998 | Ga0495594_0155002 | 3300046499 | Bacteria | 1301 |
| 999 | Ga0495594_0231086 | 3300046499 | Bacteria | 1054 |
| 1000 | Ga0495608_0004305 | 3300046511 | Bacteria | 10197 |
| 1001 | Ga0495608_0105394 | 3300046511 | Bacteria | 1815 |
| 1002 | Ga0495608_0163274 | 3300046511 | Bacteria | 1416 |
| 1003 | Ga0495608_0405121 | 3300046511 | Bacteria | 834 |
| 1004 | Ga0495628_0046355 | 3300046516 | Bacteria | 3453 |
| 1005 | Ga0495628_0119579 | 3300046516 | Bacteria | 2022 |
| 1006 | Ga0495628_0159027 | 3300046516 | Bacteria | 1718 |
| 1007 | Ga0495628_0219415 | 3300046516 | Bacteria | 1428 |
| 1008 | Ga0495630_0004210 | 3300046517 | Bacteria | 10077 |
| 1009 | Ga0495642_0014663 | 3300046528 | Bacteria | 3039 |
| 1010 | Ga0495642_0023888 | 3300046528 | Bacteria | 2416 |
| 1011 | Ga0495652_0034238 | 3300046529 | Bacteria | 4428 |
| 1012 | Ga0495665_0115312 | 3300046531 | Bacteria | 1408 |
| 1013 | Ga0495586_0141346 | 3300046535 | Bacteria | 1351 |
| 1014 | Ga0495587_0001325 | 3300046536 | Bacteria | 16452 |
| 1015 | Ga0495587_0017715 | 3300046536 | Bacteria | 4423 |
| 1016 | Ga0495587_0129094 | 3300046536 | Bacteria | 1445 |
| 1017 | Ga0495598_0040853 | 3300046537 | Bacteria | 1354 |
| 1018 | Ga0495609_0038540 | 3300046538 | Unclassified | 2154 |
| 1019 | Ga0495621_0028633 | 3300046539 | Bacteria | 1895 |
| 1020 | Ga0495621_0029128 | 3300046539 | Bacteria | 1881 |
| 1021 | Ga0495621_0101001 | 3300046539 | Bacteria | 1098 |
| 1022 | Ga0495645_0006385 | 3300046543 | Bacteria | 8182 |
| 1023 | Ga0495645_0026282 | 3300046543 | Bacteria | 4225 |
| 1024 | Ga0495645_0045821 | 3300046543 | Bacteria | 3190 |
| 1025 | Ga0495645_0108987 | 3300046543 | Bacteria | 1961 |
| 1026 | Ga0495633_0077756 | 3300046558 | Bacteria | 1545 |
| 1027 | Ga0495667_0205232 | 3300046559 | Bacteria | 1260 |
| 1028 | Ga0495656_0202141 | 3300046615 | Bacteria | 986 |
| 1029 | Ga0495634_0049275 | 3300046642 | Bacteria | 2833 |
| 1030 | Ga0495634_0172591 | 3300046642 | Bacteria | 1358 |
| 1031 | Ga0495635_0295845 | 3300046663 | Unclassified | 1086 |
| 1032 | Ga0495635_0317550 | 3300046663 | Bacteria | 1043 |
| 1033 | Ga0495635_0338620 | 3300046663 | Bacteria | 1005 |
| 1034 | Ga0495659_0030076 | 3300046664 | Bacteria | 1888 |
| 1035 | Ga0495659_0038486 | 3300046664 | Bacteria | 1698 |
| 1036 | Ga0495599_0033050 | 3300046678 | Bacteria | 3250 |
| 1037 | Ga0495599_0252291 | 3300046678 | Bacteria | 1073 |
| 1038 | Ga0495623_0137651 | 3300046679 | Bacteria | 1456 |
| 1039 | Ga0495623_0166875 | 3300046679 | Bacteria | 1289 |
| 1040 | Ga0495647_0071445 | 3300046681 | Bacteria | 1390 |
| 1041 | Ga0495658_0048935 | 3300046683 | Bacteria | 2386 |
| 1042 | Ga0495658_0076165 | 3300046683 | Bacteria | 1960 |
| 1043 | Ga0495613_0005107 | 3300046689 | Bacteria | 9843 |
| 1044 | Ga0495613_0041186 | 3300046689 | Unclassified | 3421 |
| 1045 | Ga0495613_0088183 | 3300046689 | Bacteria | 2248 |
| 1046 | Ga0495613_0213060 | 3300046689 | Bacteria | 1358 |
| 1047 | Ga0495670_0203205 | 3300046691 | Bacteria | 1050 |
| 1048 | Ga0495600_0263893 | 3300046809 | Bacteria | 1093 |
| 1049 | Ga0495581_0084101 | 3300047315 | Bacteria | 1844 |
| 1050 | Ga0495604_0022036 | 3300047317 | Bacteria | 5086 |
| 1051 | Ga0495604_0078580 | 3300047317 | Bacteria | 2476 |
| 1052 | Ga0495604_0168574 | 3300047317 | Bacteria | 1542 |
| 1053 | Ga0495636_0009861 | 3300047318 | Unclassified | 3762 |
| 1054 | Ga0495674_0037171 | 3300047319 | Bacteria | 4376 |
| 1055 | Ga0495674_0079388 | 3300047319 | Bacteria | 2818 |
| 1056 | Ga0495674_0155939 | 3300047319 | Unclassified | 1913 |
| 1057 | Ga0495674_0198484 | 3300047319 | Bacteria | 1665 |
| 1058 | Ga0495674_0217172 | 3300047319 | Bacteria | 1582 |
| 1059 | Ga0495674_0238138 | 3300047319 | Bacteria | 1500 |
| 1060 | Ga0495674_0285775 | 3300047319 | Bacteria | 1350 |
| 1061 | Ga0495674_0454403 | 3300047319 | Bacteria | 1029 |
| 1062 | Ga0495676_0088008 | 3300047321 | Bacteria | 2331 |
| 1063 | Ga0495680_0046904 | 3300047322 | Bacteria | 3404 |
| 1064 | Ga0495685_022850 | 3300047447 | Bacteria | 2152 |
| 1065 | Ga0495684_0001265 | 3300047471 | Bacteria | 20345 |
| 1066 | Ga0495684_0012461 | 3300047471 | Bacteria | 6554 |
| 1067 | Ga0495684_0036331 | 3300047471 | Unclassified | 3778 |
| 1068 | Ga0495684_0089673 | 3300047471 | Unclassified | 2330 |
| 1069 | Ga0495686_0035823 | 3300047472 | Bacteria | 3187 |
| 1070 | Ga0495602_0004904 | 3300048088 | Bacteria | 14007 |
| 1071 | Ga0495602_0077780 | 3300048088 | Bacteria | 2805 |
| 1072 | Ga0495602_0127546 | 3300048088 | Bacteria | 2035 |
| 1073 | Ga0496100_0036898 | 3300048903 | Bacteria | 3086 |
| 1074 | Ga0496100_0203848 | 3300048903 | Bacteria | 1443 |
| 1075 | Ga0496101_0000265 | 3300048904 | Bacteria | 37211 |
| 1076 | Ga0496101_0105661 | 3300048904 | Bacteria | 2113 |
| 1077 | Ga0496101_0225649 | 3300048904 | Bacteria | 1455 |
| 1078 | Ga0496102_0002617 | 3300048905 | Bacteria | 15301 |
| 1079 | Ga0496102_0254704 | 3300048905 | Bacteria | 1655 |
| 1080 | Ga0496102_0438860 | 3300048905 | Bacteria | 1225 |
| 1081 | Ga0496103_0011791 | 3300048906 | Bacteria | 5185 |
| 1082 | Ga0496104_0004942 | 3300048907 | Bacteria | 11632 |
| 1083 | Ga0496104_0019182 | 3300048907 | Bacteria | 6253 |
| 1084 | Ga0496104_0142928 | 3300048907 | Bacteria | 2299 |
| 1085 | Ga0496104_0194026 | 3300048907 | Bacteria | 1943 |
| 1086 | Ga0496104_0284201 | 3300048907 | Bacteria | 1567 |
| 1087 | Ga0496105_0205897 | 3300048908 | Bacteria | 1605 |
| 1088 | Ga0496106_0218919 | 3300048909 | Bacteria | 1518 |
| 1089 | Ga0496107_0091134 | 3300048910 | Bacteria | 2228 |
| 1090 | Ga0496107_0106462 | 3300048910 | Bacteria | 2060 |
| 1091 | Ga0496108_0022389 | 3300048911 | Bacteria | 5194 |
| 1092 | Ga0496108_0082881 | 3300048911 | Bacteria | 2720 |
| 1093 | Ga0496108_0281663 | 3300048911 | Bacteria | 1447 |
| 1094 | Ga0496108_0495195 | 3300048911 | Bacteria | 1067 |
| 1095 | Ga0496109_0647409 | 3300048912 | Bacteria | 994 |
| 1096 | Ga0496110_0033272 | 3300048913 | Bacteria | 4458 |
| 1097 | Ga0496110_0266725 | 3300048913 | Unclassified | 1559 |
| 1098 | Ga0496110_0638210 | 3300048913 | Unclassified | 964 |
| 1099 | Ga0496112_0051299 | 3300048915 | Bacteria | 4046 |
| 1100 | Ga0496112_0170463 | 3300048915 | Bacteria | 2142 |
| 1101 | Ga0496112_0204062 | 3300048915 | Bacteria | 1935 |
| 1102 | Ga0496112_0315525 | 3300048915 | Bacteria | 1508 |
| 1103 | Ga0496113_0270877 | 3300048916 | Bacteria | 1357 |
| 1104 | Ga0496114_0015693 | 3300048917 | Bacteria | 6094 |
| 1105 | Ga0496114_0114805 | 3300048917 | Bacteria | 2310 |
| 1106 | Ga0496114_0122487 | 3300048917 | Bacteria | 2238 |
| 1107 | Ga0496114_0456491 | 3300048917 | Unclassified | 1131 |
| 1108 | Ga0496114_0531378 | 3300048917 | Bacteria | 1040 |
| 1109 | Ga0496115_0007253 | 3300048918 | Bacteria | 8148 |
| 1110 | Ga0496115_0123316 | 3300048918 | Unclassified | 2133 |
| 1111 | Ga0496115_0203092 | 3300048918 | Bacteria | 1637 |
| 1112 | Ga0496115_0445417 | 3300048918 | Bacteria | 1047 |
| 1113 | Ga0501031_0187919 | 3300049568 | Bacteria | 1349 |
| 1114 | Ga0501033_0017141 | 3300049570 | Bacteria | 5475 |
| 1115 | Ga0501033_0096511 | 3300049570 | Bacteria | 2160 |
| 1116 | Ga0501033_0133453 | 3300049570 | Bacteria | 1797 |
| 1117 | Ga0501034_0008331 | 3300049571 | Bacteria | 10968 |
| 1118 | Ga0501034_0013294 | 3300049571 | Bacteria | 8481 |
| 1119 | Ga0501034_0027792 | 3300049571 | Bacteria | 5752 |
| 1120 | Ga0501036_0027919 | 3300049572 | Bacteria | 4772 |
| 1121 | Ga0501036_0259705 | 3300049572 | Bacteria | 1455 |
| 1122 | Ga0501037_0055512 | 3300049573 | Bacteria | 2896 |
| 1123 | Ga0501038_0150436 | 3300049574 | Bacteria | 1898 |
| 1124 | Ga0501038_0404621 | 3300049574 | Bacteria | 1055 |
| 1125 | Ga0501040_0001451 | 3300049576 | Bacteria | 15024 |
| 1126 | Ga0501041_0005102 | 3300049577 | Bacteria | 7660 |
| 1127 | Ga0501042_0004730 | 3300049578 | Bacteria | 8689 |
| 1128 | Ga0501043_0254361 | 3300049579 | Bacteria | 1352 |
| 1129 | Ga0501046_0004861 | 3300049580 | Bacteria | 12108 |
| 1130 | Ga0501046_0169637 | 3300049580 | Bacteria | 1638 |
| 1131 | Ga0501047_0000576 | 3300049581 | Bacteria | 39085 |
| 1132 | Ga0501047_0013887 | 3300049581 | Bacteria | 7649 |
| 1133 | Ga0501047_0055104 | 3300049581 | Bacteria | 3845 |
| 1134 | Ga0501047_0160960 | 3300049581 | Bacteria | 2116 |
| 1135 | Ga0501047_0328690 | 3300049581 | Unclassified | 1367 |
| 1136 | Ga0501048_0133180 | 3300049582 | Bacteria | 1756 |
| 1137 | Ga0501048_0149663 | 3300049582 | Bacteria | 1651 |
| 1138 | Ga0501068_0018630 | 3300049584 | Bacteria | 4020 |
| 1139 | Ga0501068_0117276 | 3300049584 | Bacteria | 1658 |
| 1140 | Ga0501070_0039651 | 3300049586 | Bacteria | 3928 |
| 1141 | Ga0501071_0212509 | 3300049587 | Bacteria | 1455 |
| 1142 | Ga0501071_0431053 | 3300049587 | Bacteria | 1008 |
| 1143 | Ga0501072_0010360 | 3300049588 | Bacteria | 7104 |
| 1144 | Ga0501072_0018434 | 3300049588 | Bacteria | 5375 |
| 1145 | Ga0501072_0062100 | 3300049588 | Bacteria | 2947 |
| 1146 | Ga0501073_0040027 | 3300049589 | Bacteria | 3319 |
| 1147 | Ga0501073_0107616 | 3300049589 | Bacteria | 1934 |
| 1148 | Ga0501073_0178321 | 3300049589 | Bacteria | 1470 |
| 1149 | Ga0501074_0373712 | 3300049590 | Bacteria | 1011 |
| 1150 | Ga0501075_0002638 | 3300049591 | Bacteria | 11981 |
| 1151 | Ga0501075_0403214 | 3300049591 | Bacteria | 1042 |
| 1152 | Ga0501076_0001642 | 3300049592 | Bacteria | 15089 |
| 1153 | Ga0501076_0401396 | 3300049592 | Bacteria | 1127 |
| 1154 | Ga0501077_0188379 | 3300049593 | Bacteria | 1311 |
| 1155 | Ga0501079_0004650 | 3300049741 | Bacteria | 10169 |
| 1156 | Ga0501080_0000677 | 3300049742 | Bacteria | 27199 |
| 1157 | Ga0501080_0020482 | 3300049742 | Bacteria | 6124 |
| 1158 | Ga0501080_0039210 | 3300049742 | Bacteria | 4421 |
| 1159 | Ga0501080_0286159 | 3300049742 | Bacteria | 1497 |
| 1160 | Ga0501081_0001295 | 3300049743 | Bacteria | 15234 |
| 1161 | Ga0501083_0038294 | 3300049744 | Bacteria | 3260 |
| 1162 | Ga0501035_0016276 | 3300049822 | Bacteria | 6861 |
| 1163 | Ga0501035_0128546 | 3300049822 | Bacteria | 2210 |
| 1164 | Ga0501035_0388589 | 3300049822 | Bacteria | 1163 |
| 1165 | Ga0501044_0001104 | 3300049823 | Bacteria | 32100 |
| 1166 | Ga0501044_0010087 | 3300049823 | Bacteria | 10265 |
| 1167 | Ga0501044_0013798 | 3300049823 | Bacteria | 8732 |
| 1168 | Ga0501044_0016247 | 3300049823 | Bacteria | 7999 |
| 1169 | Ga0501044_0056134 | 3300049823 | Unclassified | 4043 |
| 1170 | Ga0501045_0004406 | 3300049824 | Bacteria | 9716 |
| 1171 | Ga0501045_0149818 | 3300049824 | Bacteria | 1735 |
| 1172 | Ga0501045_0268330 | 3300049824 | Bacteria | 1271 |
| 1173 | nmdc:mga03n38_11295_c1 | 3300050490 | Bacteria | 3321 |
| 1174 | nmdc:mga06z11_144380_c1 | 3300050494 | Bacteria | 1348 |
| 1175 | nmdc:mga05p37_127391_c1 | 3300050507 | Bacteria | 3126 |
| 1176 | nmdc:mga05p37_326993_c1 | 3300050507 | Bacteria | 1812 |
| 1177 | nmdc:mga05p37_329824_c1 | 3300050507 | Bacteria | 1803 |
| 1178 | nmdc:mga05p37_33160_c1 | 3300050507 | Bacteria | 6324 |
| 1179 | nmdc:mga05p37_38883_c1 | 3300050507 | Bacteria | 5836 |
| 1180 | nmdc:mga05p37_4007_c1 | 3300050507 | Bacteria | 17218 |
| 1181 | nmdc:mga05p37_401748_c1 | 3300050507 | Unclassified | 1600 |
| 1182 | nmdc:mga05p37_404966_c1 | 3300050507 | Bacteria | 1592 |
| 1183 | nmdc:mga05p37_406636_c1 | 3300050507 | Bacteria | 1588 |
| 1184 | nmdc:mga05p37_47432_c1 | 3300050507 | Bacteria | 5283 |
| 1185 | nmdc:mga05p37_47724_c1 | 3300050507 | Bacteria | 5266 |
| 1186 | nmdc:mga05p37_55752_c1 | 3300050507 | Bacteria | 4865 |
| 1187 | nmdc:mga05p37_68776_c1 | 3300050507 | Unclassified | 4355 |
| 1188 | nmdc:mga05p37_68999_c1 | 3300050507 | Unclassified | 4348 |
| 1189 | nmdc:mga09592_234650_c1 | 3300050508 | Bacteria | 1589 |
| 1190 | nmdc:mga09592_53824_c1 | 3300050508 | Bacteria | 3399 |
| 1191 | nmdc:mga09592_53835_c1 | 3300050508 | Unclassified | 3399 |
| 1192 | nmdc:mga09592_71329_c1 | 3300050508 | Unclassified | 2949 |
| 1193 | nmdc:mga0qj67_3423_c1 | 3300050509 | Bacteria | 11430 |
| 1194 | nmdc:mga0qj67_5449_c1 | 3300050509 | Bacteria | 9296 |
| 1195 | nmdc:mga06r32_202025_c1 | 3300050510 | Unclassified | 1975 |
| 1196 | nmdc:mga06r32_311689_c1 | 3300050510 | Unclassified | 1559 |
| 1197 | nmdc:mga06r32_42870_c1 | 3300050510 | Bacteria | 4305 |
| 1198 | nmdc:mga06r32_7066_c1 | 3300050510 | Bacteria | 10102 |
| 1199 | nmdc:mga06r32_79019_c1 | 3300050510 | Bacteria | 3199 |
| 1200 | nmdc:mga06r32_8356_c1 | 3300050510 | Bacteria | 9321 |
| 1201 | nmdc:mga08y16_130757_c1 | 3300050511 | Unclassified | 2611 |
| 1202 | nmdc:mga08y16_17948_c1 | 3300050511 | Bacteria | 7454 |
| 1203 | nmdc:mga08y16_192350_c1 | 3300050511 | Bacteria | 2116 |
| 1204 | nmdc:mga08y16_212473_c1 | 3300050511 | Bacteria | 2004 |
| 1205 | nmdc:mga08y16_271660_c1 | 3300050511 | Bacteria | 1750 |
| 1206 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 1207 | nmdc:mga08y16_42960_c1 | 3300050511 | Bacteria | 4735 |
| 1208 | nmdc:mga08y16_42987_c1 | 3300050511 | Bacteria | 4733 |
| 1209 | nmdc:mga08y16_651580_c1 | 3300050511 | Bacteria | 1057 |
| 1210 | nmdc:mga0n895_136171_c1 | 3300050512 | Bacteria | 2483 |
| 1211 | nmdc:mga0n895_13653_c1 | 3300050512 | Bacteria | 7341 |
| 1212 | nmdc:mga0n895_186291_c1 | 3300050512 | Bacteria | 2106 |
| 1213 | nmdc:mga0n895_209109_c1 | 3300050512 | Bacteria | 1982 |
| 1214 | nmdc:mga0n895_21247_c1 | 3300050512 | Bacteria | 6065 |
| 1215 | nmdc:mga0n895_223264_c1 | 3300050512 | Bacteria | 1912 |
| 1216 | nmdc:mga0n895_285268_c1 | 3300050512 | Bacteria | 1674 |
| 1217 | nmdc:mga0n895_327727_c1 | 3300050512 | Bacteria | 1552 |
| 1218 | nmdc:mga0n895_360588_c1 | 3300050512 | Unclassified | 1472 |
| 1219 | nmdc:mga0n895_391990_c1 | 3300050512 | Bacteria | 1405 |
| 1220 | nmdc:mga0n895_47808_c1 | 3300050512 | Bacteria | 4185 |
| 1221 | nmdc:mga0n895_48_c1 | 3300050512 | Bacteria | 73654 |
| 1222 | nmdc:mga0n895_505331_c1 | 3300050512 | Bacteria | 1217 |
| 1223 | nmdc:mga0n895_54857_c1 | 3300050512 | Bacteria | 3921 |
| 1224 | nmdc:mga0n895_649028_c1 | 3300050512 | Unclassified | 1054 |
| 1225 | nmdc:mga0n895_8605_c1 | 3300050512 | Bacteria | 8852 |
| 1226 | nmdc:mga0rr50_172709_c1 | 3300050513 | Bacteria | 1762 |
| 1227 | nmdc:mga0rr50_18_c1 | 3300050513 | Bacteria | 166751 |
| 1228 | nmdc:mga0rr50_270265_c1 | 3300050513 | Bacteria | 1417 |
| 1229 | nmdc:mga0rr50_305211_c1 | 3300050513 | Bacteria | 1332 |
| 1230 | nmdc:mga0rr50_32599_c1 | 3300050513 | Bacteria | 3714 |
| 1231 | nmdc:mga0rr50_327101_c1 | 3300050513 | Bacteria | 1286 |
| 1232 | nmdc:mga0rr50_334367_c1 | 3300050513 | Bacteria | 1272 |
| 1233 | nmdc:mga0rr50_371598_c1 | 3300050513 | Unclassified | 1205 |
| 1234 | nmdc:mga0rr50_381301_c1 | 3300050513 | Bacteria | 1189 |
| 1235 | nmdc:mga0rr50_40311_c1 | 3300050513 | Unclassified | 3394 |
| 1236 | nmdc:mga0rr50_40598_c1 | 3300050513 | Bacteria | 3385 |
| 1237 | nmdc:mga0rr50_453554_c1 | 3300050513 | Bacteria | 1087 |
| 1238 | nmdc:mga0rr50_488547_c1 | 3300050513 | Bacteria | 1046 |
| 1239 | nmdc:mga0rr50_5382_c1 | 3300050513 | Bacteria | 7630 |
| 1240 | nmdc:mga0rr50_713524_c1 | 3300050513 | Bacteria | 856 |
| 1241 | nmdc:mga08x19_143_c1 | 3300050514 | Bacteria | 62934 |
| 1242 | nmdc:mga08x19_174837_c1 | 3300050514 | Bacteria | 1464 |
| 1243 | nmdc:mga08x19_367357_c1 | 3300050514 | Bacteria | 1006 |
| 1244 | nmdc:mga0a205_120493_c1 | 3300050515 | Bacteria | 2523 |
| 1245 | nmdc:mga0a205_182498_c1 | 3300050515 | Unclassified | 1992 |
| 1246 | nmdc:mga0a205_208027_c1 | 3300050515 | Bacteria | 1846 |
| 1247 | nmdc:mga0a205_247261_c1 | 3300050515 | Unclassified | 1664 |
| 1248 | nmdc:mga0a205_260920_c1 | 3300050515 | Unclassified | 1610 |
| 1249 | nmdc:mga0a205_265420_c1 | 3300050515 | Bacteria | 1594 |
| 1250 | nmdc:mga0a205_37628_c1 | 3300050515 | Bacteria | 4653 |
| 1251 | nmdc:mga0a205_4847_c1 | 3300050515 | Bacteria | 12098 |
| 1252 | nmdc:mga0a205_52285_c1 | 3300050515 | Bacteria | 3943 |
| 1253 | nmdc:mga0a205_70329_c1 | 3300050515 | Bacteria | 3379 |
| 1254 | nmdc:mga0a205_85246_c1 | 3300050515 | Bacteria | 3051 |
| 1255 | nmdc:mga0a205_96889_c1 | 3300050515 | Bacteria | 2849 |
| 1256 | Ga0495601_0012733 | 3300053077 | Bacteria | 5047 |
| 1257 | Ga0495601_0075055 | 3300053077 | Bacteria | 2164 |
| 1258 | Ga0495601_0143368 | 3300053077 | Bacteria | 1559 |
| 1259 | Ga0495619_0001690 | 3300053085 | Bacteria | 14594 |
| 1260 | Ga0500595_016237 | 3300053119 | Bacteria | 2777 |
| 1261 | Ga0500652_000019 | 3300053131 | Bacteria | 120149 |
| 1262 | Ga0500636_0018424 | 3300053177 | Bacteria | 4129 |
| 1263 | Ga0501084_0373432 | 3300054114 | Bacteria | 1205 |
| 1264 | Ga0501082_0005140 | 3300060353 | Bacteria | 11391 |
| 1265 | Ga0530510_0038969 | 3300061734 | Bacteria | 3431 |
| 1266 | Ga0373953_0035615 | |||
| 1267 | JGI25406J46586_10000119 | |||
| 1268 | JGI25406J46586_10005975 | |||
| 1269 | Ga0058859_11818552 | |||
| 1270 | Ga0058863_11917217 | |||
| 1271 | Ga0058861_11260298 | |||
| 1272 | Ga0058860_12121912 | |||
| 1273 | Ga0058862_12607417 | |||
| 1274 | Ga0065712_10242818 | |||
| 1275 | Ga0065715_10001683 | |||
| 1276 | Ga0065715_10228106 | |||
| 1277 | Ga0065707_10005960 | |||
| 1278 | Ga0065707_10098319 | |||
| 1279 | Ga0065707_10256145 | |||
| 1280 | Ga0070658_10168557 | |||
| 1281 | Ga0070676_10012701 | |||
| 1282 | Ga0070676_10024880 | |||
| 1283 | Ga0070676_10080790 | |||
| 1284 | Ga0070683_100000003 | |||
| 1285 | Ga0070683_100061543 | |||
| 1286 | Ga0070683_100107191 | |||
| 1287 | Ga0070683_100140613 | |||
| 1288 | Ga0070683_100198932 | |||
| 1289 | Ga0070690_100023683 | |||
| 1290 | Ga0070690_100231062 | |||
| 1291 | Ga0070670_100010911 | |||
| 1292 | Ga0070670_100194535 | |||
| 1293 | Ga0070670_100229889 | |||
| 1294 | Ga0070677_10002416 | |||
| 1295 | Ga0070677_10075317 | |||
| 1296 | Ga0068869_100033702 | |||
| 1297 | Ga0068869_100130032 | |||
| 1298 | Ga0068869_100504095 | |||
| 1299 | Ga0070666_10000425 | |||
| 1300 | Ga0070666_10001250 | |||
| 1301 | Ga0070666_10006737 | |||
| 1302 | Ga0070666_10014622 | |||
| 1303 | Ga0070666_10053199 | |||
| 1304 | Ga0070666_10068703 | |||
| 1305 | Ga0070680_100016531 | |||
| 1306 | Ga0070682_100110235 | |||
| 1307 | Ga0068868_100017351 | |||
| 1308 | Ga0068868_100019353 | |||
| 1309 | Ga0068868_100026769 | |||
| 1310 | Ga0068868_100102997 | |||
| 1311 | Ga0068868_100432475 | |||
| 1312 | Ga0070660_100013374 | |||
| 1313 | Ga0070660_100079605 | |||
| 1314 | Ga0070660_100515219 | |||
| 1315 | Ga0070689_100020029 | |||
| 1316 | Ga0070689_100030902 | |||
| 1317 | Ga0070689_100047269 | |||
| 1318 | Ga0070689_100055601 | |||
| 1319 | Ga0070689_100084488 | |||
| 1320 | Ga0070689_100444668 | |||
| 1321 | Ga0070691_10007935 | |||
| 1322 | Ga0070691_10012595 | |||
| 1323 | Ga0070687_100012661 | |||
| 1324 | Ga0070687_100013402 | |||
| 1325 | Ga0070687_100038203 | |||
| 1326 | Ga0070661_100007019 | |||
| 1327 | Ga0070661_100044735 | |||
| 1328 | Ga0070668_100073197 | |||
| 1329 | Ga0070668_100230204 | |||
| 1330 | Ga0070669_100002792 | |||
| 1331 | Ga0070669_100010531 | |||
| 1332 | Ga0070669_100024037 | |||
| 1333 | Ga0070669_100031975 | |||
| 1334 | Ga0070669_100256598 | |||
| 1335 | Ga0070675_100001488 | |||
| 1336 | Ga0070675_100042270 | |||
| 1337 | Ga0070675_100062365 | |||
| 1338 | Ga0070675_100188459 | |||
| 1339 | Ga0070675_100280275 | |||
| 1340 | Ga0070675_100295559 | |||
| 1341 | Ga0070671_100004399 | |||
| 1342 | Ga0070671_100004706 | |||
| 1343 | Ga0070671_100081316 | |||
| 1344 | Ga0070674_100003670 | |||
| 1345 | Ga0070674_100029420 | |||
| 1346 | Ga0070674_100139600 | |||
| 1347 | Ga0070673_100068478 | |||
| 1348 | Ga0070673_100123135 | |||
| 1349 | Ga0070673_100153675 | |||
| 1350 | Ga0070673_100158260 | |||
| 1351 | Ga0070688_100015938 | |||
| 1352 | Ga0070688_100053675 | |||
| 1353 | Ga0070688_100218979 | |||
| 1354 | Ga0070659_100067799 | |||
| 1355 | Ga0070667_100003388 | |||
| 1356 | Ga0070667_100045080 | |||
| 1357 | Ga0070667_100092577 | |||
| 1358 | Ga0070667_100192714 | |||
| 1359 | Ga0070703_10057257 | |||
| 1360 | Ga0070709_10093290 | |||
| 1361 | Ga0070709_10109666 | |||
| 1362 | Ga0070714_100009111 | |||
| 1363 | Ga0070714_100206452 | |||
| 1364 | Ga0070713_100001622 | |||
| 1365 | Ga0070713_100002857 | |||
| 1366 | Ga0070713_100102671 | |||
| 1367 | Ga0070713_100106740 | |||
| 1368 | Ga0070701_10015238 | |||
| 1369 | Ga0070701_10023753 | |||
| 1370 | Ga0070701_10046287 | |||
| 1371 | Ga0070711_100067047 | |||
| 1372 | Ga0070711_100127601 | |||
| 1373 | Ga0070705_100007521 | |||
| 1374 | Ga0070705_100011019 | |||
| 1375 | Ga0070700_100050592 | |||
| 1376 | Ga0070700_100171759 | |||
| 1377 | Ga0070694_100002259 | |||
| 1378 | Ga0070694_100061191 | |||
| 1379 | Ga0070694_100133560 | |||
| 1380 | Ga0070694_100196867 | |||
| 1381 | Ga0070708_100052221 | |||
| 1382 | Ga0070708_100360243 | |||
| 1383 | Ga0070663_100332451 | |||
| 1384 | Ga0070678_100131873 | |||
| 1385 | Ga0070678_100345810 | |||
| 1386 | Ga0070678_100582231 | |||
| 1387 | Ga0070662_100026566 | |||
| 1388 | Ga0070662_100047164 | |||
| 1389 | Ga0070662_100153790 | |||
| 1390 | Ga0070681_10031838 | |||
| 1391 | Ga0070681_10083225 | |||
| 1392 | Ga0070681_10106266 | |||
| 1393 | Ga0070681_10270347 | |||
| 1394 | Ga0070681_10411811 | |||
| 1395 | Ga0068867_100038870 | |||
| 1396 | Ga0068867_100220084 | |||
| 1397 | Ga0068867_100617348 | |||
| 1398 | Ga0070685_10008639 | |||
| 1399 | Ga0070685_10332208 | |||
| 1400 | Ga0070707_100036513 | |||
| 1401 | Ga0070707_100115866 | |||
| 1402 | Ga0070698_100029222 | |||
| 1403 | Ga0070698_100120781 | |||
| 1404 | Ga0070699_100001327 | |||
| 1405 | Ga0070699_100008993 | |||
| 1406 | Ga0070699_100105270 | |||
| 1407 | Ga0070699_100136495 | |||
| 1408 | Ga0070699_100258468 | |||
| 1409 | Ga0070679_100000302 | |||
| 1410 | Ga0070679_100043673 | |||
| 1411 | Ga0070679_100046043 | |||
| 1412 | Ga0070679_100529536 | |||
| 1413 | Ga0070684_100000014 | |||
| 1414 | Ga0070684_100002999 | |||
| 1415 | Ga0070684_100012985 | |||
| 1416 | Ga0070684_100094925 | |||
| 1417 | Ga0070684_100351087 | |||
| 1418 | Ga0070697_100020675 | |||
| 1419 | Ga0070697_100116941 | |||
| 1420 | Ga0068853_100002146 | |||
| 1421 | Ga0070672_100007627 | |||
| 1422 | Ga0070672_100070432 | |||
| 1423 | Ga0070672_100077832 | |||
| 1424 | Ga0070672_100080430 | |||
| 1425 | Ga0070672_100131831 | |||
| 1426 | Ga0070672_100180056 | |||
| 1427 | Ga0070672_100209187 | |||
| 1428 | Ga0070672_100249078 | |||
| 1429 | Ga0070686_100000149 | |||
| 1430 | Ga0070686_100013516 | |||
| 1431 | Ga0070686_100223620 | |||
| 1432 | Ga0070686_100453832 | |||
| 1433 | Ga0070695_100023341 | |||
| 1434 | Ga0070695_100060209 | |||
| 1435 | Ga0070695_100060895 | |||
| 1436 | Ga0070695_100275229 | |||
| 1437 | Ga0070696_100021367 | |||
| 1438 | Ga0070696_100025110 | |||
| 1439 | Ga0070696_100026932 | |||
| 1440 | Ga0070696_100119566 | |||
| 1441 | Ga0070693_100026839 | |||
| 1442 | Ga0070665_100006507 | |||
| 1443 | Ga0070665_100024170 | |||
| 1444 | Ga0070665_100040388 | |||
| 1445 | Ga0070665_100054433 | |||
| 1446 | Ga0070665_100121382 | |||
| 1447 | Ga0070665_100235929 | |||
| 1448 | Ga0070704_100003359 | |||
| 1449 | Ga0070704_100061746 | |||
| 1450 | Ga0070704_100100767 | |||
| 1451 | Ga0070704_100114264 | |||
| 1452 | Ga0070704_100311448 | |||
| 1453 | Ga0068855_100002984 | |||
| 1454 | Ga0068855_100017262 | |||
| 1455 | Ga0068855_100031217 | |||
| 1456 | Ga0068855_100059840 | |||
| 1457 | Ga0068855_100494631 | |||
| 1458 | Ga0068855_100502014 | |||
| 1459 | Ga0070664_100000492 | |||
| 1460 | Ga0070664_100001335 | |||
| 1461 | Ga0070664_100040409 | |||
| 1462 | Ga0070664_100122511 | |||
| 1463 | Ga0070664_100179807 | |||
| 1464 | Ga0070664_100258120 | |||
| 1465 | Ga0070664_100317916 | |||
| 1466 | Ga0068857_100002613 | |||
| 1467 | Ga0068857_100011187 | |||
| 1468 | Ga0068857_100047722 | |||
| 1469 | Ga0068857_100052484 | |||
| 1470 | Ga0068857_100130673 | |||
| 1471 | Ga0068857_100160266 | |||
| 1472 | Ga0068857_100300944 | |||
| 1473 | Ga0068854_100021164 | |||
| 1474 | Ga0068854_100046159 | |||
| 1475 | Ga0068856_100001937 | |||
| 1476 | Ga0068856_100004199 | |||
| 1477 | Ga0068856_100015788 | |||
| 1478 | Ga0068856_100115313 | |||
| 1479 | Ga0068856_100128318 | |||
| 1480 | Ga0068856_100205807 | |||
| 1481 | Ga0068856_100607880 | |||
| 1482 | Ga0070702_100003201 | |||
| 1483 | Ga0070702_100201444 | |||
| 1484 | Ga0070702_100211549 | |||
| 1485 | Ga0068852_100001781 | |||
| 1486 | Ga0068852_100035743 | |||
| 1487 | Ga0068852_100158401 | |||
| 1488 | Ga0068859_100004134 | |||
| 1489 | Ga0068859_100004521 | |||
| 1490 | Ga0068859_100030564 | |||
| 1491 | Ga0068859_100033211 | |||
| 1492 | Ga0068859_100081354 | |||
| 1493 | Ga0068859_100081997 | |||
| 1494 | Ga0068859_100147305 | |||
| 1495 | Ga0068859_100272424 | |||
| 1496 | Ga0068859_100640873 | |||
| 1497 | Ga0068864_100002489 | |||
| 1498 | Ga0068864_100023269 | |||
| 1499 | Ga0068864_100025597 | |||
| 1500 | Ga0068864_100059439 | |||
| 1501 | Ga0068864_100249290 | |||
| 1502 | Ga0068864_100422580 | |||
| 1503 | Ga0068866_10048247 | |||
| 1504 | Ga0068861_100018284 | |||
| 1505 | Ga0068861_100043183 | |||
| 1506 | Ga0068861_100069471 | |||
| 1507 | Ga0068861_100163980 | |||
| 1508 | Ga0068861_100318858 | |||
| 1509 | Ga0068851_10097203 | |||
| 1510 | Ga0068870_10013371 | |||
| 1511 | Ga0068870_10014953 | |||
| 1512 | Ga0068863_100005664 | |||
| 1513 | Ga0068863_100008318 | |||
| 1514 | Ga0068863_100040394 | |||
| 1515 | Ga0068863_100474395 | |||
| 1516 | Ga0068863_100555617 | |||
| 1517 | Ga0068858_100002905 | |||
| 1518 | Ga0068858_100005100 | |||
| 1519 | Ga0068858_100008332 | |||
| 1520 | Ga0068858_100052419 | |||
| 1521 | Ga0068858_100108057 | |||
| 1522 | Ga0068858_100135568 | |||
| 1523 | Ga0068858_100148751 | |||
| 1524 | Ga0068858_100152695 | |||
| 1525 | Ga0068858_100218074 | |||
| 1526 | Ga0068858_100241234 | |||
| 1527 | Ga0068858_100473576 | |||
| 1528 | Ga0068858_100480116 | |||
| 1529 | Ga0068860_100031160 | |||
| 1530 | Ga0068860_100038063 | |||
| 1531 | Ga0068860_100044555 | |||
| 1532 | Ga0068860_100246495 | |||
| 1533 | Ga0068862_100000840 | |||
| 1534 | Ga0068862_100005392 | |||
| 1535 | Ga0068862_100016263 | |||
| 1536 | Ga0068862_100036118 | |||
| 1537 | Ga0068862_100045111 | |||
| 1538 | Ga0068862_100074584 | |||
| 1539 | Ga0068862_100124832 | |||
| 1540 | Ga0068862_100240398 | |||
| 1541 | Ga0068862_100694614 | |||
| 1542 | Ga0068862_100695032 | |||
| 1543 | Ga0081539_10000017 | |||
| 1544 | Ga0081539_10000285 | |||
| 1545 | Ga0081539_10047920 | |||
| 1546 | Ga0081539_10057486 | |||
| 1547 | Ga0081539_10122253 | |||
| 1548 | Ga0070717_10096581 | |||
| 1549 | Ga0070717_10157115 | |||
| 1550 | Ga0075368_10011931 | |||
| 1551 | Ga0075363_100010441 | |||
| 1552 | Ga0070716_100056446 | |||
| 1553 | Ga0070716_100350595 | |||
| 1554 | Ga0075369_10038930 | |||
| 1555 | Ga0097621_100005426 | |||
| 1556 | Ga0097621_100010218 | |||
| 1557 | Ga0097621_100028334 | |||
| 1558 | Ga0097621_100071850 | |||
| 1559 | Ga0097621_100089762 | |||
| 1560 | Ga0097621_100130326 | |||
| 1561 | Ga0097621_100135694 | |||
| 1562 | Ga0097621_100176074 | |||
| 1563 | Ga0097621_100192714 | |||
| 1564 | Ga0097621_100311238 | |||
| 1565 | Ga0097621_100341509 | |||
| 1566 | Ga0097621_100401340 | |||
| 1567 | Ga0097621_100598170 | |||
| 1568 | Ga0097621_100748161 | |||
| 1569 | Ga0068871_100029054 | |||
| 1570 | Ga0068871_100042327 | |||
| 1571 | Ga0068871_100047644 | |||
| 1572 | Ga0068871_100049292 | |||
| 1573 | Ga0068871_100084470 | |||
| 1574 | Ga0068871_100085655 | |||
| 1575 | Ga0068871_100090586 | |||
| 1576 | Ga0068871_100110220 | |||
| 1577 | Ga0068871_100142932 | |||
| 1578 | Ga0075428_100000056 | |||
| 1579 | Ga0075428_100015436 | |||
| 1580 | Ga0075428_100016708 | |||
| 1581 | Ga0075428_100019016 | |||
| 1582 | Ga0075428_100019500 | |||
| 1583 | Ga0075428_100101266 | |||
| 1584 | Ga0075428_100185876 | |||
| 1585 | Ga0075428_100233308 | |||
| 1586 | Ga0075428_100260483 | |||
| 1587 | Ga0075428_100405430 | |||
| 1588 | Ga0075430_100001665 | |||
| 1589 | Ga0075430_100040576 | |||
| 1590 | Ga0075430_100053941 | |||
| 1591 | Ga0075431_100005129 | |||
| 1592 | Ga0075431_100014576 | |||
| 1593 | Ga0075431_100053866 | |||
| 1594 | Ga0075431_100072135 | |||
| 1595 | Ga0075431_100110346 | |||
| 1596 | Ga0075431_100153962 | |||
| 1597 | Ga0075431_100378490 | |||
| 1598 | Ga0075433_10006669 | |||
| 1599 | Ga0075433_10015777 | |||
| 1600 | Ga0075433_10277688 | |||
| 1601 | Ga0075433_10409953 | |||
| 1602 | Ga0075433_10628909 | |||
| 1603 | Ga0075434_100008968 | |||
| 1604 | Ga0075434_100010775 | |||
| 1605 | Ga0075434_100018968 | |||
| 1606 | Ga0075434_100022212 | |||
| 1607 | Ga0075434_100031745 | |||
| 1608 | Ga0075434_100031834 | |||
| 1609 | Ga0075434_100032945 | |||
| 1610 | Ga0075434_100053344 | |||
| 1611 | Ga0075434_100055569 | |||
| 1612 | Ga0075434_100261397 | |||
| 1613 | Ga0075434_100297381 | |||
| 1614 | Ga0075434_100821008 | |||
| 1615 | Ga0075429_100005206 | |||
| 1616 | Ga0075429_100006221 | |||
| 1617 | Ga0075429_100070194 | |||
| 1618 | Ga0075429_100070915 | |||
| 1619 | Ga0075429_100117368 | |||
| 1620 | Ga0075429_100268238 | |||
| 1621 | Ga0075429_100270228 | |||
| 1622 | Ga0068865_100066595 | |||
| 1623 | Ga0068865_100073886 | |||
| 1624 | Ga0068865_100086615 | |||
| 1625 | Ga0068865_100193177 | |||
| 1626 | Ga0075436_100001549 | |||
| 1627 | Ga0075436_100211917 | |||
| 1628 | Ga0075436_100365852 | |||
| 1629 | Ga0097620_100004134 | |||
| 1630 | Ga0097620_100004521 | |||
| 1631 | Ga0097620_100030564 | |||
| 1632 | Ga0097620_100033210 | |||
| 1633 | Ga0097620_100081361 | |||
| 1634 | Ga0097620_100082001 | |||
| 1635 | Ga0097620_100147305 | |||
| 1636 | Ga0097620_100272427 | |||
| 1637 | Ga0097620_100640828 | |||
| 1638 | Ga0075435_100000010 | |||
| 1639 | Ga0075435_100003072 | |||
| 1640 | Ga0075435_100003595 | |||
| 1641 | Ga0075435_100007095 | |||
| 1642 | Ga0075435_100031895 | |||
| 1643 | Ga0075435_100056213 | |||
| 1644 | Ga0075435_100095310 | |||
| 1645 | Ga0075435_100131640 | |||
| 1646 | Ga0075435_100164768 | |||
| 1647 | Ga0075435_100184670 | |||
| 1648 | Ga0075435_100458917 | |||
| 1649 | Ga0105240_10003771 | |||
| 1650 | Ga0105240_10007340 | |||
| 1651 | Ga0105240_10045239 | |||
| 1652 | Ga0105240_10048104 | |||
| 1653 | Ga0105240_10110389 | |||
| 1654 | Ga0105240_10158316 | |||
| 1655 | Ga0105240_10454561 | |||
| 1656 | Ga0105240_10618847 | |||
| 1657 | Ga0105240_10958827 | |||
| 1658 | Ga0111539_10000002 | |||
| 1659 | Ga0111539_10005233 | |||
| 1660 | Ga0111539_10010564 | |||
| 1661 | Ga0111539_10010813 | |||
| 1662 | Ga0111539_10036295 | |||
| 1663 | Ga0111539_10037657 | |||
| 1664 | Ga0111539_10080094 | |||
| 1665 | Ga0111539_10350141 | |||
| 1666 | Ga0111539_10621840 | |||
| 1667 | Ga0105245_10000947 | |||
| 1668 | Ga0105245_10005502 | |||
| 1669 | Ga0105245_10006166 | |||
| 1670 | Ga0105245_10008147 | |||
| 1671 | Ga0105245_10089627 | |||
| 1672 | Ga0105245_10102648 | |||
| 1673 | Ga0105245_10105997 | |||
| 1674 | Ga0105245_10121187 | |||
| 1675 | Ga0105245_10137756 | |||
| 1676 | Ga0105245_10149288 | |||
| 1677 | Ga0105245_10256690 | |||
| 1678 | Ga0105247_10016166 | |||
| 1679 | Ga0105247_10071535 | |||
| 1680 | Ga0114129_10002802 | |||
| 1681 | Ga0114129_10004604 | |||
| 1682 | Ga0114129_10018430 | |||
| 1683 | Ga0114129_10033579 | |||
| 1684 | Ga0114129_10046527 | |||
| 1685 | Ga0114129_10048496 | |||
| 1686 | Ga0114129_10048880 | |||
| 1687 | Ga0114129_10057309 | |||
| 1688 | Ga0114129_10065314 | |||
| 1689 | Ga0114129_10065470 | |||
| 1690 | Ga0114129_10097308 | |||
| 1691 | Ga0114129_10150757 | |||
| 1692 | Ga0114129_10151640 | |||
| 1693 | Ga0114129_10190346 | |||
| 1694 | Ga0114129_10238897 | |||
| 1695 | Ga0114129_10266368 | |||
| 1696 | Ga0114129_10599768 | |||
| 1697 | Ga0114129_10837141 | |||
| 1698 | Ga0105243_10024153 | |||
| 1699 | Ga0105243_10048536 | |||
| 1700 | Ga0105241_10001247 | |||
| 1701 | Ga0105241_10040992 | |||
| 1702 | Ga0105241_10053952 | |||
| 1703 | Ga0105241_10070832 | |||
| 1704 | Ga0105241_10225951 | |||
| 1705 | Ga0105241_10386439 | |||
| 1706 | Ga0105242_10002034 | |||
| 1707 | Ga0105242_10067925 | |||
| 1708 | Ga0105242_10138527 | |||
| 1709 | Ga0105242_10314848 | |||
| 1710 | Ga0105242_10426204 | |||
| 1711 | Ga0105248_10000732 | |||
| 1712 | Ga0105248_10004514 | |||
| 1713 | Ga0105248_10011483 | |||
| 1714 | Ga0105248_10020051 | |||
| 1715 | Ga0105248_10029385 | |||
| 1716 | Ga0105248_10050486 | |||
| 1717 | Ga0105248_10052260 | |||
| 1718 | Ga0105248_10053042 | |||
| 1719 | Ga0105248_10059938 | |||
| 1720 | Ga0105248_10065126 | |||
| 1721 | Ga0105248_10076703 | |||
| 1722 | Ga0105248_10094858 | |||
| 1723 | Ga0105248_10182136 | |||
| 1724 | Ga0105248_10187783 | |||
| 1725 | Ga0105248_10226971 | |||
| 1726 | Ga0105248_10269216 | |||
| 1727 | Ga0105248_10278253 | |||
| 1728 | Ga0105248_10365662 | |||
| 1729 | Ga0105248_10752451 | |||
| 1730 | Ga0105248_10779011 | |||
| 1731 | Ga0105237_10005644 | |||
| 1732 | Ga0105237_10011307 | |||
| 1733 | Ga0105237_10014420 | |||
| 1734 | Ga0105237_10015435 | |||
| 1735 | Ga0105237_10066658 | |||
| 1736 | Ga0105238_10002827 | |||
| 1737 | Ga0105238_10012423 | |||
| 1738 | Ga0105238_10028958 | |||
| 1739 | Ga0105238_10065680 | |||
| 1740 | Ga0105238_10162867 | |||
| 1741 | Ga0105238_10167970 | |||
| 1742 | Ga0105249_10000823 | |||
| 1743 | Ga0105249_10085317 | |||
| 1744 | Ga0105249_10090363 | |||
| 1745 | Ga0105239_10007060 | |||
| 1746 | Ga0105239_10021625 | |||
| 1747 | Ga0105239_10192899 | |||
| 1748 | Ga0105239_10226954 | |||
| 1749 | Ga0105239_10228268 | |||
| 1750 | Ga0105239_10489206 | |||
| 1751 | Ga0105239_10818561 | |||
| 1752 | Ga0105246_10018784 | |||
| 1753 | Ga0105246_10031268 | |||
| 1754 | Ga0105246_10040295 | |||
| 1755 | Ga0105246_10344619 | |||
| 1756 | Ga0157373_10038552 | |||
| 1757 | Ga0157371_10152094 | |||
| 1758 | Ga0157370_10002040 | |||
| 1759 | Ga0157370_10004725 | |||
| 1760 | Ga0157370_10007265 | |||
| 1761 | Ga0157370_10168440 | |||
| 1762 | Ga0157370_10353347 | |||
| 1763 | Ga0157369_10002554 | |||
| 1764 | Ga0157369_10013404 | |||
| 1765 | Ga0157369_10025201 | |||
| 1766 | Ga0157369_10034298 | |||
| 1767 | Ga0157369_10066560 | |||
| 1768 | Ga0157369_10132585 | |||
| 1769 | Ga0157369_10321202 | |||
| 1770 | Ga0157369_10568733 | |||
| 1771 | Ga0157374_10015334 | |||
| 1772 | Ga0157374_10016451 | |||
| 1773 | Ga0157374_10020467 | |||
| 1774 | Ga0157374_10035463 | |||
| 1775 | Ga0157374_10087838 | |||
| 1776 | Ga0157374_10527156 | |||
| 1777 | Ga0157378_10005441 | |||
| 1778 | Ga0157378_10009756 | |||
| 1779 | Ga0157378_10050722 | |||
| 1780 | Ga0157378_10067391 | |||
| 1781 | Ga0157378_10231845 | |||
| 1782 | Ga0157378_10291065 | |||
| 1783 | Ga0157378_10386674 | |||
| 1784 | Ga0157378_10410116 | |||
| 1785 | Ga0157378_10550282 | |||
| 1786 | Ga0163162_10000523 | |||
| 1787 | Ga0163162_10008601 | |||
| 1788 | Ga0163162_10013410 | |||
| 1789 | Ga0163162_10016225 | |||
| 1790 | Ga0163162_10048770 | |||
| 1791 | Ga0163162_10080122 | |||
| 1792 | Ga0163162_10181237 | |||
| 1793 | Ga0163162_10554270 | |||
| 1794 | Ga0163162_10584113 | |||
| 1795 | Ga0157372_10020520 | |||
| 1796 | Ga0157372_10101349 | |||
| 1797 | Ga0157372_10114613 | |||
| 1798 | Ga0157372_10135551 | |||
| 1799 | Ga0157372_11069439 | |||
| 1800 | Ga0157375_10002834 | |||
| 1801 | Ga0157375_10065990 | |||
| 1802 | Ga0157375_10088975 | |||
| 1803 | Ga0157375_10268882 | |||
| 1804 | Ga0157375_10533902 | |||
| 1805 | Ga0157375_10772588 | |||
| 1806 | Ga0157375_11059228 | |||
| 1807 | Ga0163163_10000519 | |||
| 1808 | Ga0163163_10012292 | |||
| 1809 | Ga0163163_10025838 | |||
| 1810 | Ga0163163_10027913 | |||
| 1811 | Ga0163163_10039336 | |||
| 1812 | Ga0163163_10047478 | |||
| 1813 | Ga0163163_10074324 | |||
| 1814 | Ga0163163_10292684 | |||
| 1815 | Ga0163163_10551027 | |||
| 1816 | Ga0163163_10569450 | |||
| 1817 | Ga0157380_10002501 | |||
| 1818 | Ga0157380_10010757 | |||
| 1819 | Ga0157380_10031559 | |||
| 1820 | Ga0157380_10215357 | |||
| 1821 | Ga0157380_10251604 | |||
| 1822 | Ga0157380_10550328 | |||
| 1823 | Ga0157377_10014582 | |||
| 1824 | Ga0157377_10027036 | |||
| 1825 | Ga0157377_10052001 | |||
| 1826 | Ga0157377_10096921 | |||
| 1827 | Ga0157379_10024368 | |||
| 1828 | Ga0157379_10032183 | |||
| 1829 | Ga0157379_10034436 | |||
| 1830 | Ga0157379_10035809 | |||
| 1831 | Ga0157379_10069607 | |||
| 1832 | Ga0157379_10177376 | |||
| 1833 | Ga0157379_10332657 | |||
| 1834 | Ga0157379_10475349 | |||
| 1835 | Ga0157379_10552911 | |||
| 1836 | Ga0157376_10001464 | |||
| 1837 | Ga0157376_10018430 | |||
| 1838 | Ga0157376_10030077 | |||
| 1839 | Ga0157376_10036034 | |||
| 1840 | Ga0157376_10111007 | |||
| 1841 | Ga0157376_10131246 | |||
| 1842 | Ga0157376_10134695 | |||
| 1843 | Ga0157376_10140026 | |||
| 1844 | Ga0157376_10162452 | |||
| 1845 | Ga0157376_10163472 | |||
| 1846 | Ga0157376_10328337 | |||
| 1847 | Ga0157376_10367418 | |||
| 1848 | Ga0157376_10520827 | |||
| 1849 | Ga0157376_10685225 | |||
| 1850 | Ga0163161_10059162 | |||
| 1851 | Ga0206352_11354533 | |||
| 1852 | Ga0154015_1222796 | |||
| 1853 | Ga0213876_10202830 | |||
| 1854 | Ga0213875_10011417 | |||
| 1855 | Ga0213875_10018482 | |||
| 1856 | Ga0213875_10025438 | |||
| 1857 | Ga0213875_10054213 | |||
| 1858 | Ga0207697_10000251 | |||
| 1859 | Ga0207697_10004674 | |||
| 1860 | Ga0207682_10004064 | |||
| 1861 | Ga0207682_10033729 | |||
| 1862 | Ga0207642_10152192 | |||
| 1863 | Ga0207688_10016882 | |||
| 1864 | Ga0207688_10027862 | |||
| 1865 | Ga0207688_10277646 | |||
| 1866 | Ga0207680_10003712 | |||
| 1867 | Ga0207680_10038400 | |||
| 1868 | Ga0207680_10170274 | |||
| 1869 | Ga0207680_10208439 | |||
| 1870 | Ga0207699_10018329 | |||
| 1871 | Ga0207699_10076098 | |||
| 1872 | Ga0207699_10149616 | |||
| 1873 | Ga0207645_10000804 | |||
| 1874 | Ga0207645_10017281 | |||
| 1875 | Ga0207643_10005115 | |||
| 1876 | Ga0207643_10022431 | |||
| 1877 | Ga0207643_10074668 | |||
| 1878 | Ga0207705_10047827 | |||
| 1879 | Ga0207684_10294329 | |||
| 1880 | Ga0207684_10422770 | |||
| 1881 | Ga0207654_10002296 | |||
| 1882 | Ga0207654_10041480 | |||
| 1883 | Ga0207654_10103783 | |||
| 1884 | Ga0207654_10126426 | |||
| 1885 | Ga0207707_10000469 | |||
| 1886 | Ga0207707_10012066 | |||
| 1887 | Ga0207707_10044280 | |||
| 1888 | Ga0207707_10058030 | |||
| 1889 | Ga0207707_10177976 | |||
| 1890 | Ga0207695_10002673 | |||
| 1891 | Ga0207695_10017159 | |||
| 1892 | Ga0207695_10069924 | |||
| 1893 | Ga0207695_10077984 | |||
| 1894 | Ga0207695_10080223 | |||
| 1895 | Ga0207695_10102855 | |||
| 1896 | Ga0207695_10163172 | |||
| 1897 | Ga0207695_10169693 | |||
| 1898 | Ga0207695_10173796 | |||
| 1899 | Ga0207695_10377002 | |||
| 1900 | Ga0207671_10017277 | |||
| 1901 | Ga0207671_10021931 | |||
| 1902 | Ga0207671_10036388 | |||
| 1903 | Ga0207671_10052496 | |||
| 1904 | Ga0207660_10012897 | |||
| 1905 | Ga0207660_10019519 | |||
| 1906 | Ga0207660_10316966 | |||
| 1907 | Ga0207662_10003470 | |||
| 1908 | Ga0207662_10010254 | |||
| 1909 | Ga0207662_10039592 | |||
| 1910 | Ga0207662_10182555 | |||
| 1911 | Ga0207657_10004759 | |||
| 1912 | Ga0207657_10088541 | |||
| 1913 | Ga0207657_10375185 | |||
| 1914 | Ga0207649_10047194 | |||
| 1915 | Ga0207649_10067064 | |||
| 1916 | Ga0207652_10003282 | |||
| 1917 | Ga0207652_10020903 | |||
| 1918 | Ga0207652_10173993 | |||
| 1919 | Ga0207652_10237024 | |||
| 1920 | Ga0207652_10449403 | |||
| 1921 | Ga0207646_10085333 | |||
| 1922 | Ga0207646_10167566 | |||
| 1923 | Ga0207681_10001189 | |||
| 1924 | Ga0207681_10002783 | |||
| 1925 | Ga0207681_10014104 | |||
| 1926 | Ga0207681_10030400 | |||
| 1927 | Ga0207681_10076646 | |||
| 1928 | Ga0207681_10237119 | |||
| 1929 | Ga0207694_10002185 | |||
| 1930 | Ga0207694_10004422 | |||
| 1931 | Ga0207694_10010532 | |||
| 1932 | Ga0207694_10025618 | |||
| 1933 | Ga0207694_10051810 | |||
| 1934 | Ga0207694_10069761 | |||
| 1935 | Ga0207650_10000510 | |||
| 1936 | Ga0207650_10192535 | |||
| 1937 | Ga0207650_10255919 | |||
| 1938 | Ga0207659_10000406 | |||
| 1939 | Ga0207659_10001544 | |||
| 1940 | Ga0207659_10021429 | |||
| 1941 | Ga0207659_10040497 | |||
| 1942 | Ga0207659_10071013 | |||
| 1943 | Ga0207659_10199160 | |||
| 1944 | Ga0207687_10008146 | |||
| 1945 | Ga0207687_10020100 | |||
| 1946 | Ga0207687_10028830 | |||
| 1947 | Ga0207687_10087112 | |||
| 1948 | Ga0207687_10093899 | |||
| 1949 | Ga0207687_10103150 | |||
| 1950 | Ga0207687_10118133 | |||
| 1951 | Ga0207687_10191354 | |||
| 1952 | Ga0207687_10193413 | |||
| 1953 | Ga0207687_10360949 | |||
| 1954 | Ga0207687_10434738 | |||
| 1955 | Ga0207700_10000647 | |||
| 1956 | Ga0207700_10063912 | |||
| 1957 | Ga0207700_10390856 | |||
| 1958 | Ga0207664_10016657 | |||
| 1959 | Ga0207664_10059041 | |||
| 1960 | Ga0207664_10238272 | |||
| 1961 | Ga0207664_10263842 | |||
| 1962 | Ga0207644_10008275 | |||
| 1963 | Ga0207644_10038363 | |||
| 1964 | Ga0207644_10061465 | |||
| 1965 | Ga0207644_10062961 | |||
| 1966 | Ga0207644_10221293 | |||
| 1967 | Ga0207690_10015894 | |||
| 1968 | Ga0207690_10098485 | |||
| 1969 | Ga0207706_10036652 | |||
| 1970 | Ga0207706_10045911 | |||
| 1971 | Ga0207706_10086552 | |||
| 1972 | Ga0207706_10130953 | |||
| 1973 | Ga0207706_10171870 | |||
| 1974 | Ga0207686_10001173 | |||
| 1975 | Ga0207686_10010878 | |||
| 1976 | Ga0207686_10044969 | |||
| 1977 | Ga0207686_10060332 | |||
| 1978 | Ga0207686_10096020 | |||
| 1979 | Ga0207686_10113719 | |||
| 1980 | Ga0207709_10041625 | |||
| 1981 | Ga0207709_10165569 | |||
| 1982 | Ga0207670_10001976 | |||
| 1983 | Ga0207670_10043533 | |||
| 1984 | Ga0207670_10070524 | |||
| 1985 | Ga0207670_10262870 | |||
| 1986 | Ga0207669_10000834 | |||
| 1987 | Ga0207669_10010564 | |||
| 1988 | Ga0207669_10078011 | |||
| 1989 | Ga0207669_10180958 | |||
| 1990 | Ga0207704_10016397 | |||
| 1991 | Ga0207704_10170130 | |||
| 1992 | Ga0207704_10220204 | |||
| 1993 | Ga0207691_10002846 | |||
| 1994 | Ga0207691_10007867 | |||
| 1995 | Ga0207691_10015722 | |||
| 1996 | Ga0207691_10027418 | |||
| 1997 | Ga0207691_10029846 | |||
| 1998 | Ga0207691_10055709 | |||
| 1999 | Ga0207691_10074840 | |||
| 2000 | Ga0207711_10004826 | |||
| 2001 | Ga0207711_10008634 | |||
| 2002 | Ga0207711_10011678 | |||
| 2003 | Ga0207711_10017341 | |||
| 2004 | Ga0207711_10031262 | |||
| 2005 | Ga0207711_10040080 | |||
| 2006 | Ga0207711_10124129 | |||
| 2007 | Ga0207711_10140317 | |||
| 2008 | Ga0207711_10153260 | |||
| 2009 | Ga0207711_10165265 | |||
| 2010 | Ga0207711_10235959 | |||
| 2011 | Ga0207711_10250000 | |||
| 2012 | Ga0207711_10307037 | |||
| 2013 | Ga0207711_10417827 | |||
| 2014 | Ga0207711_10605107 | |||
| 2015 | Ga0207689_10028011 | |||
| 2016 | Ga0207689_10028147 | |||
| 2017 | Ga0207689_10045229 | |||
| 2018 | Ga0207689_10070739 | |||
| 2019 | Ga0207661_10000014 | |||
| 2020 | Ga0207661_10003445 | |||
| 2021 | Ga0207661_10051668 | |||
| 2022 | Ga0207661_10131293 | |||
| 2023 | Ga0207661_10162110 | |||
| 2024 | Ga0207661_10167815 | |||
| 2025 | Ga0207661_10502444 | |||
| 2026 | Ga0207679_10008015 | |||
| 2027 | Ga0207679_10026100 | |||
| 2028 | Ga0207679_10043006 | |||
| 2029 | Ga0207679_10058493 | |||
| 2030 | Ga0207679_10091233 | |||
| 2031 | Ga0207679_10221065 | |||
| 2032 | Ga0207667_10000682 | |||
| 2033 | Ga0207667_10005221 | |||
| 2034 | Ga0207667_10014682 | |||
| 2035 | Ga0207667_10023929 | |||
| 2036 | Ga0207667_10272111 | |||
| 2037 | Ga0207667_10487076 | |||
| 2038 | Ga0207667_10691963 | |||
| 2039 | Ga0207651_10014979 | |||
| 2040 | Ga0207651_10052352 | |||
| 2041 | Ga0207651_10157069 | |||
| 2042 | Ga0207651_10163968 | |||
| 2043 | Ga0207651_10190054 | |||
| 2044 | Ga0207651_10231764 | |||
| 2045 | Ga0207651_10266721 | |||
| 2046 | Ga0207712_10031512 | |||
| 2047 | Ga0207712_10143758 | |||
| 2048 | Ga0207712_10216910 | |||
| 2049 | Ga0207668_10096930 | |||
| 2050 | Ga0207668_10203514 | |||
| 2051 | Ga0207640_10040764 | |||
| 2052 | Ga0207640_10092541 | |||
| 2053 | Ga0207658_10087645 | |||
| 2054 | Ga0207658_10123421 | |||
| 2055 | Ga0207658_10125042 | |||
| 2056 | Ga0207658_10169281 | |||
| 2057 | Ga0207677_10012852 | |||
| 2058 | Ga0207677_10036784 | |||
| 2059 | Ga0207677_10112647 | |||
| 2060 | Ga0207677_10129705 | |||
| 2061 | Ga0207677_10151753 | |||
| 2062 | Ga0207677_10177838 | |||
| 2063 | Ga0207677_10201256 | |||
| 2064 | Ga0207703_10005810 | |||
| 2065 | Ga0207703_10006792 | |||
| 2066 | Ga0207703_10010459 | |||
| 2067 | Ga0207703_10042382 | |||
| 2068 | Ga0207703_10086190 | |||
| 2069 | Ga0207703_10098044 | |||
| 2070 | Ga0207703_10105486 | |||
| 2071 | Ga0207703_10122403 | |||
| 2072 | Ga0207703_10171140 | |||
| 2073 | Ga0207703_10364836 | |||
| 2074 | Ga0207639_10007173 | |||
| 2075 | Ga0207639_10247590 | |||
| 2076 | Ga0207678_10286078 | |||
| 2077 | Ga0207708_10010013 | |||
| 2078 | Ga0207708_10015215 | |||
| 2079 | Ga0207708_10020342 | |||
| 2080 | Ga0207702_10010003 | |||
| 2081 | Ga0207702_10027031 | |||
| 2082 | Ga0207702_10038722 | |||
| 2083 | Ga0207702_10134529 | |||
| 2084 | Ga0207702_10235584 | |||
| 2085 | Ga0207702_10254628 | |||
| 2086 | Ga0207702_10287600 | |||
| 2087 | Ga0207641_10001693 | |||
| 2088 | Ga0207641_10008647 | |||
| 2089 | Ga0207641_10022405 | |||
| 2090 | Ga0207641_10078131 | |||
| 2091 | Ga0207641_10172170 | |||
| 2092 | Ga0207641_10459548 | |||
| 2093 | Ga0207648_10007406 | |||
| 2094 | Ga0207648_10014545 | |||
| 2095 | Ga0207648_10033812 | |||
| 2096 | Ga0207648_10229747 | |||
| 2097 | Ga0207648_10266198 | |||
| 2098 | Ga0207648_10576949 | |||
| 2099 | Ga0207648_10659308 | |||
| 2100 | Ga0207676_10035657 | |||
| 2101 | Ga0207676_10093582 | |||
| 2102 | Ga0207676_10197404 | |||
| 2103 | Ga0207676_10230271 | |||
| 2104 | Ga0207676_10425512 | |||
| 2105 | Ga0207674_10001168 | |||
| 2106 | Ga0207674_10006848 | |||
| 2107 | Ga0207674_10025411 | |||
| 2108 | Ga0207674_10026109 | |||
| 2109 | Ga0207674_10027367 | |||
| 2110 | Ga0207674_10230386 | |||
| 2111 | Ga0207674_10246667 | |||
| 2112 | Ga0207674_10541482 | |||
| 2113 | Ga0207675_100000903 | |||
| 2114 | Ga0207675_100020152 | |||
| 2115 | Ga0207675_100030141 | |||
| 2116 | Ga0207675_100100885 | |||
| 2117 | Ga0207675_100159237 | |||
| 2118 | Ga0207675_100269909 | |||
| 2119 | Ga0207683_10045566 | |||
| 2120 | Ga0207683_10152651 | |||
| 2121 | Ga0207683_10238272 | |||
| 2122 | Ga0207698_10023487 | |||
| 2123 | Ga0207698_10023937 | |||
| 2124 | Ga0209974_10025430 | |||
| 2125 | Ga0207428_10000004 | |||
| 2126 | Ga0207428_10002859 | |||
| 2127 | Ga0207428_10004898 | |||
| 2128 | Ga0207428_10024613 | |||
| 2129 | Ga0207428_10085152 | |||
| 2130 | Ga0207428_10251830 | |||
| 2131 | Ga0207428_10277431 | |||
| 2132 | Ga0268266_10055756 | |||
| 2133 | Ga0268266_10060920 | |||
| 2134 | Ga0268266_10075877 | |||
| 2135 | Ga0268265_10000073 | |||
| 2136 | Ga0268265_10009325 | |||
| 2137 | Ga0268265_10024774 | |||
| 2138 | Ga0268265_10031751 | |||
| 2139 | Ga0268265_10062450 | |||
| 2140 | Ga0268265_10102499 | |||
| 2141 | Ga0268265_10212088 | |||
| 2142 | Ga0268265_10227380 | |||
| 2143 | Ga0268264_10021749 | |||
| 2144 | Ga0268264_10025089 | |||
| 2145 | Ga0268264_10081631 | |||
| 2146 | Ga0268264_10125913 | |||
| 2147 | Ga0268264_10314559 | |||
| 2148 | Ga0268264_10453985 | |||
| 2149 | Ga0265325_10089588 | |||
| 2150 | Ga0265331_10034626 | |||
| 2151 | Ga0265331_10167585 | |||
| 2152 | Ga0265316_10059019 | |||
| 2153 | Ga0265314_10000282 | |||
| 2154 | Ga0265314_10016083 | |||
| 2155 | Ga0265314_10145280 | |||
| 2156 | Ga0307405_10020590 | |||
| 2157 | Ga0307416_100024955 | |||
| 2158 | Ga0307414_10292512 | |||
| 2159 | Ga0307411_10155755 | |||
| 2160 | Ga0373948_0000450 | |||
| 2161 | Ga0373950_0000380 | |||
| 2162 | Ga0373958_0009516 | |||
| 2163 | Ga0373938_0002084 | |||
| 2164 | Ga0373926_0073966 | |||
| 2165 | Ga0373929_0000150 | |||
| 2166 | Ga0373940_0025734 | |||
| 2167 | Ga0373944_0038200 | |||
| 2168 | Ga0373949_0000545 | |||
| 2169 | Ga0373951_0001989 | |||
| 2170 | Ga0373952_0000564 | |||
| 2171 | Ga0373932_0001009 | |||
| 2172 | Ga0373932_0012441 | |||
| 2173 | Ga0373936_0023516 | |||
| 2174 | Ga0373941_0001769 | |||
| 2175 | Ga0373954_0016180 | |||
| 2176 | Ga0373956_0019596 | |||
| 2177 | Ga0373960_0000414 | |||
| 2178 | Ga0373943_0009153 | |||
| 2179 | Ga0373943_0115028 | |||
| 2180 | Ga0373946_0001957 | |||
| 2181 | Ga0373946_0084807 | |||
| 2182 | Ga0373946_0203278 | |||
| 2183 | Ga0373955_0010717 | |||
| 2184 | Ga0373955_0033486 | |||
| 2185 | Ga0373955_0087911 | |||
| 2186 | Ga0373955_0137629 | |||
| 2187 | Ga0373955_0148216 | |||
| 2188 | Ga0373955_0180283 | |||
| 2189 | Ga0373942_0001464 | |||
| 2190 | Ga0373962_0000549 | |||
| 2191 | Ga0373931_0082874 | |||
| 2192 | Ga0373931_0096874 | |||
| 2193 | Ga0373935_0011426 | |||
| 2194 | Ga0373935_0136733 | |||
| 2195 | Ga0373935_0383354 | |||
| 2196 | Ga0373927_0012421 | |||
| 2197 | Ga0373927_0077234 | |||
| 2198 | Ga0373927_0212399 | |||
| 2199 | Ga0373927_0271469 | |||
| 2200 | Ga0373947_0007354 | |||
| 2201 | Ga0373947_0007636 | |||
| 2202 | Ga0373947_0009077 | |||
| 2203 | Ga0373947_0021219 | |||
| 2204 | Ga0373937_0002587 | |||
| 2205 | Ga0373937_0002894 | |||
| 2206 | Ga0373937_0004569 | |||
| 2207 | Ga0373937_0016270 | |||
| 2208 | Ga0373937_0316107 | |||
| 2209 | Ga0373925_0000762 | |||
| 2210 | Ga0373925_0011459 | |||
| 2211 | Ga0373925_0044686 | |||
| 2212 | Ga0373925_0053724 | |||
| 2213 | Ga0373925_0085342 | |||
| 2214 | Ga0373925_0212877 | |||
| 2215 | Ga0373925_0272102 | |||
| 2216 | Ga0373925_0347378 | |||
| 2217 | Ga0373925_0451110 | |||
| 2218 | Ga0373925_0469260 | |||
| 2219 | Ga0395898_0263372 | |||
| 2220 | Ga0436364_0178301 | |||
| 2221 | Ga0436364_0408279 | |||
| 2222 | Ga0436364_0971922 | |||
| 2223 | Ga0436364_1201673 | |||
| 2224 | Ga0436364_1272981 | |||
| 2225 | Ga0436364_1497633 | |||
| 2226 | Ga0395901_0150281 | |||
| 2227 | Ga0436365_0512859 | |||
| 2228 | Ga0436365_1058523 | |||
| 2229 | Ga0436365_1745652 | |||
| 2230 | Ga0436363_0045077 | |||
| 2231 | Ga0436363_0774504 | |||
| 2232 | Ga0436363_1317700 | |||
| 2233 | Ga0439464_0044305 | |||
| 2234 | Ga0451577_0023209 | |||
| 2235 | Ga0466966_0180236 | |||
| 2236 | Ga0453684_0401022 | |||
| 2237 | Ga0451576_0020484 | |||
| 2238 | Ga0451576_0057424 | |||
| 2239 | Ga0451576_0065700 | |||
| 2240 | Ga0451576_0194751 | |||
| 2241 | Ga0451576_0208766 | |||
| 2242 | Ga0466958_0090396 | |||
| 2243 | Ga0495603_0099277 | |||
| 2244 | Ga0495629_0009447 | |||
| 2245 | Ga0495629_0056713 | |||
| 2246 | Ga0495629_0184520 | |||
| 2247 | Ga0495629_0277414 | |||
| 2248 | Ga0495629_0338226 | |||
| 2249 | Ga0495651_0286279 | |||
| 2250 | Ga0495580_0000771 | |||
| 2251 | Ga0495580_0003605 | |||
| 2252 | Ga0495580_0026077 | |||
| 2253 | Ga0495580_0127527 | |||
| 2254 | Ga0495580_0268328 | |||
| 2255 | Ga0495582_0042507 | |||
| 2256 | Ga0495582_0056164 | |||
| 2257 | Ga0495582_0162373 | |||
| 2258 | Ga0495639_0053615 | |||
| 2259 | Ga0495662_0036778 | |||
| 2260 | Ga0495664_0091947 | |||
| 2261 | Ga0495584_0073011 | |||
| 2262 | Ga0495594_0098355 | |||
| 2263 | Ga0495594_0155002 | |||
| 2264 | Ga0495594_0231086 | |||
| 2265 | Ga0495608_0004305 | |||
| 2266 | Ga0495608_0105394 | |||
| 2267 | Ga0495608_0163274 | |||
| 2268 | Ga0495608_0405121 | |||
| 2269 | Ga0495628_0046355 | |||
| 2270 | Ga0495628_0119579 | |||
| 2271 | Ga0495628_0159027 | |||
| 2272 | Ga0495628_0219415 | |||
| 2273 | Ga0495630_0004210 | |||
| 2274 | Ga0495642_0014663 | |||
| 2275 | Ga0495642_0023888 | |||
| 2276 | Ga0495652_0034238 | |||
| 2277 | Ga0495665_0115312 | |||
| 2278 | Ga0495586_0141346 | |||
| 2279 | Ga0495587_0001325 | |||
| 2280 | Ga0495587_0017715 | |||
| 2281 | Ga0495587_0129094 | |||
| 2282 | Ga0495598_0040853 | |||
| 2283 | Ga0495609_0038540 | |||
| 2284 | Ga0495621_0028633 | |||
| 2285 | Ga0495621_0029128 | |||
| 2286 | Ga0495621_0101001 | |||
| 2287 | Ga0495645_0006385 | |||
| 2288 | Ga0495645_0026282 | |||
| 2289 | Ga0495645_0045821 | |||
| 2290 | Ga0495645_0108987 | |||
| 2291 | Ga0495633_0077756 | |||
| 2292 | Ga0495667_0205232 | |||
| 2293 | Ga0495656_0202141 | |||
| 2294 | Ga0495634_0049275 | |||
| 2295 | Ga0495634_0172591 | |||
| 2296 | Ga0495635_0295845 | |||
| 2297 | Ga0495635_0317550 | |||
| 2298 | Ga0495635_0338620 | |||
| 2299 | Ga0495659_0030076 | |||
| 2300 | Ga0495659_0038486 | |||
| 2301 | Ga0495599_0033050 | |||
| 2302 | Ga0495599_0252291 | |||
| 2303 | Ga0495623_0137651 | |||
| 2304 | Ga0495623_0166875 | |||
| 2305 | Ga0495647_0071445 | |||
| 2306 | Ga0495658_0048935 | |||
| 2307 | Ga0495658_0076165 | |||
| 2308 | Ga0495613_0005107 | |||
| 2309 | Ga0495613_0041186 | |||
| 2310 | Ga0495613_0088183 | |||
| 2311 | Ga0495613_0213060 | |||
| 2312 | Ga0495670_0203205 | |||
| 2313 | Ga0495600_0263893 | |||
| 2314 | Ga0495581_0084101 | |||
| 2315 | Ga0495604_0022036 | |||
| 2316 | Ga0495604_0078580 | |||
| 2317 | Ga0495604_0168574 | |||
| 2318 | Ga0495636_0009861 | |||
| 2319 | Ga0495674_0037171 | |||
| 2320 | Ga0495674_0079388 | |||
| 2321 | Ga0495674_0155939 | |||
| 2322 | Ga0495674_0198484 | |||
| 2323 | Ga0495674_0217172 | |||
| 2324 | Ga0495674_0238138 | |||
| 2325 | Ga0495674_0285775 | |||
| 2326 | Ga0495674_0454403 | |||
| 2327 | Ga0495676_0088008 | |||
| 2328 | Ga0495680_0046904 | |||
| 2329 | Ga0495685_022850 | |||
| 2330 | Ga0495684_0001265 | |||
| 2331 | Ga0495684_0012461 | |||
| 2332 | Ga0495684_0036331 | |||
| 2333 | Ga0495684_0089673 | |||
| 2334 | Ga0495686_0035823 | |||
| 2335 | Ga0495602_0004904 | |||
| 2336 | Ga0495602_0077780 | |||
| 2337 | Ga0495602_0127546 | |||
| 2338 | Ga0496100_0036898 | |||
| 2339 | Ga0496100_0203848 | |||
| 2340 | Ga0496101_0000265 | |||
| 2341 | Ga0496101_0105661 | |||
| 2342 | Ga0496101_0225649 | |||
| 2343 | Ga0496102_0002617 | |||
| 2344 | Ga0496102_0254704 | |||
| 2345 | Ga0496102_0438860 | |||
| 2346 | Ga0496103_0011791 | |||
| 2347 | Ga0496104_0004942 | |||
| 2348 | Ga0496104_0019182 | |||
| 2349 | Ga0496104_0142928 | |||
| 2350 | Ga0496104_0194026 | |||
| 2351 | Ga0496104_0284201 | |||
| 2352 | Ga0496105_0205897 | |||
| 2353 | Ga0496106_0218919 | |||
| 2354 | Ga0496107_0091134 | |||
| 2355 | Ga0496107_0106462 | |||
| 2356 | Ga0496108_0022389 | |||
| 2357 | Ga0496108_0082881 | |||
| 2358 | Ga0496108_0281663 | |||
| 2359 | Ga0496108_0495195 | |||
| 2360 | Ga0496109_0647409 | |||
| 2361 | Ga0496110_0033272 | |||
| 2362 | Ga0496110_0266725 | |||
| 2363 | Ga0496110_0638210 | |||
| 2364 | Ga0496112_0051299 | |||
| 2365 | Ga0496112_0170463 | |||
| 2366 | Ga0496112_0204062 | |||
| 2367 | Ga0496112_0315525 | |||
| 2368 | Ga0496113_0270877 | |||
| 2369 | Ga0496114_0015693 | |||
| 2370 | Ga0496114_0114805 | |||
| 2371 | Ga0496114_0122487 | |||
| 2372 | Ga0496114_0456491 | |||
| 2373 | Ga0496114_0531378 | |||
| 2374 | Ga0496115_0007253 | |||
| 2375 | Ga0496115_0123316 | |||
| 2376 | Ga0496115_0203092 | |||
| 2377 | Ga0496115_0445417 | |||
| 2378 | Ga0501031_0187919 | |||
| 2379 | Ga0501033_0017141 | |||
| 2380 | Ga0501033_0096511 | |||
| 2381 | Ga0501033_0133453 | |||
| 2382 | Ga0501034_0008331 | |||
| 2383 | Ga0501034_0013294 | |||
| 2384 | Ga0501034_0027792 | |||
| 2385 | Ga0501036_0027919 | |||
| 2386 | Ga0501036_0259705 | |||
| 2387 | Ga0501037_0055512 | |||
| 2388 | Ga0501038_0150436 | |||
| 2389 | Ga0501038_0404621 | |||
| 2390 | Ga0501040_0001451 | |||
| 2391 | Ga0501041_0005102 | |||
| 2392 | Ga0501042_0004730 | |||
| 2393 | Ga0501043_0254361 | |||
| 2394 | Ga0501046_0004861 | |||
| 2395 | Ga0501046_0169637 | |||
| 2396 | Ga0501047_0000576 | |||
| 2397 | Ga0501047_0013887 | |||
| 2398 | Ga0501047_0055104 | |||
| 2399 | Ga0501047_0160960 | |||
| 2400 | Ga0501047_0328690 | |||
| 2401 | Ga0501048_0133180 | |||
| 2402 | Ga0501048_0149663 | |||
| 2403 | Ga0501068_0018630 | |||
| 2404 | Ga0501068_0117276 | |||
| 2405 | Ga0501070_0039651 | |||
| 2406 | Ga0501071_0212509 | |||
| 2407 | Ga0501071_0431053 | |||
| 2408 | Ga0501072_0010360 | |||
| 2409 | Ga0501072_0018434 | |||
| 2410 | Ga0501072_0062100 | |||
| 2411 | Ga0501073_0040027 | |||
| 2412 | Ga0501073_0107616 | |||
| 2413 | Ga0501073_0178321 | |||
| 2414 | Ga0501074_0373712 | |||
| 2415 | Ga0501075_0002638 | |||
| 2416 | Ga0501075_0403214 | |||
| 2417 | Ga0501076_0001642 | |||
| 2418 | Ga0501076_0401396 | |||
| 2419 | Ga0501077_0188379 | |||
| 2420 | Ga0501079_0004650 | |||
| 2421 | Ga0501080_0000677 | |||
| 2422 | Ga0501080_0020482 | |||
| 2423 | Ga0501080_0039210 | |||
| 2424 | Ga0501080_0286159 | |||
| 2425 | Ga0501081_0001295 | |||
| 2426 | Ga0501083_0038294 | |||
| 2427 | Ga0501035_0016276 | |||
| 2428 | Ga0501035_0128546 | |||
| 2429 | Ga0501035_0388589 | |||
| 2430 | Ga0501044_0001104 | |||
| 2431 | Ga0501044_0010087 | |||
| 2432 | Ga0501044_0013798 | |||
| 2433 | Ga0501044_0016247 | |||
| 2434 | Ga0501044_0056134 | |||
| 2435 | Ga0501045_0004406 | |||
| 2436 | Ga0501045_0149818 | |||
| 2437 | Ga0501045_0268330 | |||
| 2438 | nmdc:mga03n38_11295_c1 | |||
| 2439 | nmdc:mga06z11_144380_c1 | |||
| 2440 | nmdc:mga05p37_127391_c1 | |||
| 2441 | nmdc:mga05p37_326993_c1 | |||
| 2442 | nmdc:mga05p37_329824_c1 | |||
| 2443 | nmdc:mga05p37_33160_c1 | |||
| 2444 | nmdc:mga05p37_38883_c1 | |||
| 2445 | nmdc:mga05p37_4007_c1 | |||
| 2446 | nmdc:mga05p37_401748_c1 | |||
| 2447 | nmdc:mga05p37_404966_c1 | |||
| 2448 | nmdc:mga05p37_406636_c1 | |||
| 2449 | nmdc:mga05p37_47432_c1 | |||
| 2450 | nmdc:mga05p37_47724_c1 | |||
| 2451 | nmdc:mga05p37_55752_c1 | |||
| 2452 | nmdc:mga05p37_68776_c1 | |||
| 2453 | nmdc:mga05p37_68999_c1 | |||
| 2454 | nmdc:mga09592_234650_c1 | |||
| 2455 | nmdc:mga09592_53824_c1 | |||
| 2456 | nmdc:mga09592_53835_c1 | |||
| 2457 | nmdc:mga09592_71329_c1 | |||
| 2458 | nmdc:mga0qj67_3423_c1 | |||
| 2459 | nmdc:mga0qj67_5449_c1 | |||
| 2460 | nmdc:mga06r32_202025_c1 | |||
| 2461 | nmdc:mga06r32_311689_c1 | |||
| 2462 | nmdc:mga06r32_42870_c1 | |||
| 2463 | nmdc:mga06r32_7066_c1 | |||
| 2464 | nmdc:mga06r32_79019_c1 | |||
| 2465 | nmdc:mga06r32_8356_c1 | |||
| 2466 | nmdc:mga08y16_130757_c1 | |||
| 2467 | nmdc:mga08y16_17948_c1 | |||
| 2468 | nmdc:mga08y16_192350_c1 | |||
| 2469 | nmdc:mga08y16_212473_c1 | |||
| 2470 | nmdc:mga08y16_271660_c1 | |||
| 2471 | nmdc:mga08y16_2_c1 | |||
| 2472 | nmdc:mga08y16_42960_c1 | |||
| 2473 | nmdc:mga08y16_42987_c1 | |||
| 2474 | nmdc:mga08y16_651580_c1 | |||
| 2475 | nmdc:mga0n895_136171_c1 | |||
| 2476 | nmdc:mga0n895_13653_c1 | |||
| 2477 | nmdc:mga0n895_186291_c1 | |||
| 2478 | nmdc:mga0n895_209109_c1 | |||
| 2479 | nmdc:mga0n895_21247_c1 | |||
| 2480 | nmdc:mga0n895_223264_c1 | |||
| 2481 | nmdc:mga0n895_285268_c1 | |||
| 2482 | nmdc:mga0n895_327727_c1 | |||
| 2483 | nmdc:mga0n895_360588_c1 | |||
| 2484 | nmdc:mga0n895_391990_c1 | |||
| 2485 | nmdc:mga0n895_47808_c1 | |||
| 2486 | nmdc:mga0n895_48_c1 | |||
| 2487 | nmdc:mga0n895_505331_c1 | |||
| 2488 | nmdc:mga0n895_54857_c1 | |||
| 2489 | nmdc:mga0n895_649028_c1 | |||
| 2490 | nmdc:mga0n895_8605_c1 | |||
| 2491 | nmdc:mga0rr50_172709_c1 | |||
| 2492 | nmdc:mga0rr50_18_c1 | |||
| 2493 | nmdc:mga0rr50_270265_c1 | |||
| 2494 | nmdc:mga0rr50_305211_c1 | |||
| 2495 | nmdc:mga0rr50_32599_c1 | |||
| 2496 | nmdc:mga0rr50_327101_c1 | |||
| 2497 | nmdc:mga0rr50_334367_c1 | |||
| 2498 | nmdc:mga0rr50_371598_c1 | |||
| 2499 | nmdc:mga0rr50_381301_c1 | |||
| 2500 | nmdc:mga0rr50_40311_c1 | |||
| 2501 | nmdc:mga0rr50_40598_c1 | |||
| 2502 | nmdc:mga0rr50_453554_c1 | |||
| 2503 | nmdc:mga0rr50_488547_c1 | |||
| 2504 | nmdc:mga0rr50_5382_c1 | |||
| 2505 | nmdc:mga0rr50_713524_c1 | |||
| 2506 | nmdc:mga08x19_143_c1 | |||
| 2507 | nmdc:mga08x19_174837_c1 | |||
| 2508 | nmdc:mga08x19_367357_c1 | |||
| 2509 | nmdc:mga0a205_120493_c1 | |||
| 2510 | nmdc:mga0a205_182498_c1 | |||
| 2511 | nmdc:mga0a205_208027_c1 | |||
| 2512 | nmdc:mga0a205_247261_c1 | |||
| 2513 | nmdc:mga0a205_260920_c1 | |||
| 2514 | nmdc:mga0a205_265420_c1 | |||
| 2515 | nmdc:mga0a205_37628_c1 | |||
| 2516 | nmdc:mga0a205_4847_c1 | |||
| 2517 | nmdc:mga0a205_52285_c1 | |||
| 2518 | nmdc:mga0a205_70329_c1 | |||
| 2519 | nmdc:mga0a205_85246_c1 | |||
| 2520 | nmdc:mga0a205_96889_c1 | |||
| 2521 | Ga0495601_0012733 | |||
| 2522 | Ga0495601_0075055 | |||
| 2523 | Ga0495601_0143368 | |||
| 2524 | Ga0495619_0001690 | |||
| 2525 | Ga0500595_016237 | |||
| 2526 | Ga0500652_000019 | |||
| 2527 | Ga0500636_0018424 | |||
| 2528 | Ga0501084_0373432 | |||
| 2529 | Ga0501082_0005140 | |||
| 2530 | Ga0530510_0038969 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.8713 | 45 | 284 |
| 4u2g-assembly1.cif.gz_A | crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution | 0.8618 | 51 | 287 |
| 1zi6-assembly1.cif.gz_A | crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a | 0.8613 | 51 | 287 |
| 1ziy-assembly1.cif.gz_A | crystal structure analysis of the dienelactone hydrolase mutant (c123s) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.9 a | 0.8611 | 51 | 287 |
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.861 | 45 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9193 | 49 | 282 | 3.40.50.1820 |
| af_Q54MZ9_1_255_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9075 | 47 | 286 | 3.40.50.1820 |
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8969 | 49 | 282 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8653 | 45 | 284 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.855 | 45 | 284 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8D1E9-F1-model_v4 | Dienelactone hydrolase | 0.9999 | 75 | 287 |
GO:0016787
|
| AF-A0A3N5P008-F1-model_v4 | Dienelactone hydrolase family protein | 0.9966 | 141 | 287 |
GO:0016787
|
| AF-A0A2V8FJU0-F1-model_v4 | Dienelactone hydrolase | 0.9944 | 102 | 287 |
GO:0016787
|
| AF-A0A2V8D1E9-F1-model_v4 | Dienelactone hydrolase | 0.9906 | 75 | 287 |
GO:0016787
|
| AF-A0A2V8FJU0-F1-model_v4 | Dienelactone hydrolase | 0.9891 | 102 | 287 |
GO:0016787
|