F492295

General Info

Members Datasets Scaffolds Average Seq Length
1260 280 2520 84

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10579497|Ga0157373_105794972
Length 99
Sequence MHEYGVRASAAREGSMETVYDWVSLAIFAGLIVLFLQRSTGERAEKDASLLYYLGAGVGCAVANYFGNHGQHIVAIAILVATVAFIIYFLKPFRFRPGA

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
198 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
199 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
255 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
256 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
257 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
258 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
259 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
260 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
263 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
266 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
267 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
268 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
269 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
273 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
274 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 1.98
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 41.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10579497 3300013100 Unclassified 815
2 MBSR1b_contig_3302548 2162886012 Unclassified 2538
3 MBSR1b_contig_8811798 2162886012 Unclassified 1635
4 JGI24741J21665_1001705 3300001915 Bacteria 6077
5 JGI24741J21665_1018577 3300001915 Unclassified 1110
6 JGI24741J21665_1032167 3300001915 Unclassified 783
7 JGI24740J21852_10002403 3300001979 Bacteria 8507
8 JGI24740J21852_10002753 3300001979 Bacteria 7862
9 JGI24740J21852_10004394 3300001979 Bacteria 6062
10 JGI24740J21852_10037551 3300001979 Unclassified 1494
11 JGI24739J22299_10011726 3300001989 Bacteria 3231
12 JGI24739J22299_10087188 3300001989 Unclassified 953
13 JGI24737J22298_10228638 3300001990 Unclassified 549
14 JGI24735J21928_10002010 3300002067 Bacteria 7153
15 JGI24735J21928_10005515 3300002067 Bacteria 4195
16 JGI24735J21928_10016635 3300002067 Unclassified 2278
17 JGI24738J21930_10081169 3300002075 Unclassified 679
18 JGI24738J21930_10109290 3300002075 Unclassified 595
19 JGI24744J21845_10039746 3300002077 Unclassified 882
20 JGI24033J26618_1002423 3300002155 Unclassified 1910
21 JGI24034J26672_10066758 3300002239 Unclassified 639
22 JGI25406J46586_10068768 3300003203 Bacteria 1118
23 rootH2_10152215 3300003320 Bacteria 1930
24 rootH1_10137416 3300003323 Bacteria 7394
25 rootH1_10287373 3300003323 Bacteria 2090
26 rootH1_10318114 3300003323 Unclassified 1424
27 Ga0065704_10703317 3300005289 Bacteria 560
28 Ga0065712_10074159 3300005290 Unclassified 4163
29 Ga0065712_10457008 3300005290 Bacteria 681
30 Ga0065715_10233102 3300005293 Bacteria 1226
31 Ga0065715_10804293 3300005293 Unclassified 608
32 Ga0070658_10007081 3300005327 Bacteria 9051
33 Ga0070658_10014784 3300005327 Bacteria 6256
34 Ga0070658_10025215 3300005327 Unclassified 4766
35 Ga0070658_10027650 3300005327 Bacteria 4550
36 Ga0070658_10028240 3300005327 Bacteria 4503
37 Ga0070658_10039082 3300005327 Unclassified 3827
38 Ga0070658_10089250 3300005327 Unclassified 2538
39 Ga0070658_10094639 3300005327 Bacteria 2465
40 Ga0070658_10135423 3300005327 Bacteria 2055
41 Ga0070658_10262089 3300005327 Unclassified 1468
42 Ga0070658_10285877 3300005327 Bacteria 1404
43 Ga0070658_10337153 3300005327 Unclassified 1289
44 Ga0070658_10455540 3300005327 Bacteria 1102
45 Ga0070658_10504585 3300005327 Unclassified 1045
46 Ga0070658_10563937 3300005327 Bacteria 986
47 Ga0070658_10657603 3300005327 Unclassified 909
48 Ga0070658_10790105 3300005327 Bacteria 825
49 Ga0070658_10829332 3300005327 Bacteria 803
50 Ga0070658_11002536 3300005327 Bacteria 726
51 Ga0070658_11188891 3300005327 Unclassified 663
52 Ga0070658_11805415 3300005327 Unclassified 529
53 Ga0070658_11826208 3300005327 Unclassified 525
54 Ga0070676_10019977 3300005328 Unclassified 3733
55 Ga0070676_10111754 3300005328 Bacteria 1702
56 Ga0070676_10140170 3300005328 Bacteria 1538
57 Ga0070676_10361489 3300005328 Unclassified 1000
58 Ga0070676_10607658 3300005328 Unclassified 789
59 Ga0070676_10721107 3300005328 Unclassified 730
60 Ga0070676_10867567 3300005328 Bacteria 670
61 Ga0070683_100002629 3300005329 Bacteria 14360
62 Ga0070683_100016104 3300005329 Bacteria 6581
63 Ga0070683_100020068 3300005329 Bacteria 5943
64 Ga0070683_100058817 3300005329 Bacteria 3570
65 Ga0070683_100310149 3300005329 Unclassified 1501
66 Ga0070683_100889463 3300005329 Unclassified 854
67 Ga0070690_100005963 3300005330 Bacteria 6881
68 Ga0070690_100358553 3300005330 Unclassified 1060
69 Ga0070670_100000482 3300005331 Bacteria 32026
70 Ga0070670_100013946 3300005331 Bacteria 6892
71 Ga0070670_100021632 3300005331 Bacteria 5530
72 Ga0070670_100043866 3300005331 Unclassified 3844
73 Ga0070670_100068780 3300005331 Unclassified 3039
74 Ga0070670_100282551 3300005331 Bacteria 1449
75 Ga0070670_100464617 3300005331 Unclassified 1123
76 Ga0070670_101403585 3300005331 Bacteria 640
77 Ga0070670_101677358 3300005331 Unclassified 585
78 Ga0070677_10000655 3300005333 Bacteria 11570
79 Ga0070677_10002714 3300005333 Bacteria 5659
80 Ga0070677_10032154 3300005333 Unclassified 2010
81 Ga0068869_101288944 3300005334 Unclassified 644
82 Ga0070666_10001302 3300005335 Bacteria 15102
83 Ga0070666_10025157 3300005335 Unclassified 3880
84 Ga0070666_10027996 3300005335 Unclassified 3695
85 Ga0070666_10044734 3300005335 Unclassified 2967
86 Ga0070666_10107580 3300005335 Bacteria 1927
87 Ga0070666_10184203 3300005335 Bacteria 1465
88 Ga0070666_10196826 3300005335 Unclassified 1417
89 Ga0070666_10991246 3300005335 Bacteria 623
90 Ga0070680_100020196 3300005336 Bacteria 5286
91 Ga0070680_100035425 3300005336 Bacteria 4029
92 Ga0070680_100065927 3300005336 Bacteria 2968
93 Ga0070680_100067337 3300005336 Bacteria 2937
94 Ga0070680_100152355 3300005336 Bacteria 1941
95 Ga0070680_100260812 3300005336 Unclassified 1466
96 Ga0070682_100044647 3300005337 Unclassified 2745
97 Ga0070682_100307230 3300005337 Unclassified 1166
98 Ga0070682_101477164 3300005337 Unclassified 584
99 Ga0070682_101490639 3300005337 Bacteria 581
100 Ga0068868_100003463 3300005338 Bacteria 10990
101 Ga0068868_100079365 3300005338 Unclassified 2629
102 Ga0068868_100321489 3300005338 Unclassified 1318
103 Ga0068868_101145736 3300005338 Bacteria 717
104 Ga0070660_100003869 3300005339 Bacteria 10336
105 Ga0070660_100006193 3300005339 Bacteria 8277
106 Ga0070660_100007812 3300005339 Bacteria 7459
107 Ga0070660_100011819 3300005339 Bacteria 6220
108 Ga0070660_100019162 3300005339 Bacteria 5009
109 Ga0070660_100029227 3300005339 Unclassified 4129
110 Ga0070660_100058036 3300005339 Unclassified 3000
111 Ga0070660_100084264 3300005339 Bacteria 2498
112 Ga0070660_100085989 3300005339 Unclassified 2474
113 Ga0070660_100116100 3300005339 Bacteria 2134
114 Ga0070660_100200462 3300005339 Bacteria 1619
115 Ga0070660_100211081 3300005339 Bacteria 1576
116 Ga0070660_100250581 3300005339 Unclassified 1444
117 Ga0070660_100349462 3300005339 Bacteria 1217
118 Ga0070660_100357649 3300005339 Unclassified 1203
119 Ga0070660_100404566 3300005339 Bacteria 1129
120 Ga0070660_100533460 3300005339 Bacteria 978
121 Ga0070660_101201879 3300005339 Bacteria 643
122 Ga0070660_101380024 3300005339 Unclassified 598
123 Ga0070691_10008688 3300005341 Bacteria 4649
124 Ga0070687_100255805 3300005343 Bacteria 1090
125 Ga0070687_100574639 3300005343 Unclassified 770
126 Ga0070687_100777092 3300005343 Unclassified 676
127 Ga0070661_100002823 3300005344 Bacteria 11943
128 Ga0070661_100003992 3300005344 Bacteria 10146
129 Ga0070661_100005291 3300005344 Bacteria 8893
130 Ga0070661_100145097 3300005344 Unclassified 1791
131 Ga0070661_100230052 3300005344 Bacteria 1424
132 Ga0070661_100333460 3300005344 Unclassified 1187
133 Ga0070661_100524477 3300005344 Unclassified 950
134 Ga0070661_100605005 3300005344 Unclassified 886
135 Ga0070661_100641574 3300005344 Bacteria 861
136 Ga0070661_101708227 3300005344 Unclassified 533
137 Ga0070692_10020700 3300005345 Bacteria 3191
138 Ga0070668_100153482 3300005347 Unclassified 1864
139 Ga0070668_100246367 3300005347 Bacteria 1482
140 Ga0070668_100398534 3300005347 Bacteria 1175
141 Ga0070668_100775332 3300005347 Unclassified 850
142 Ga0070669_100026431 3300005353 Unclassified 4176
143 Ga0070669_100057008 3300005353 Bacteria 2865
144 Ga0070669_100319587 3300005353 Bacteria 1253
145 Ga0070669_100417486 3300005353 Unclassified 1101
146 Ga0070669_100760040 3300005353 Unclassified 822
147 Ga0070669_101380266 3300005353 Bacteria 611
148 Ga0070675_100000877 3300005354 Bacteria 21384
149 Ga0070675_100002093 3300005354 Bacteria 14774
150 Ga0070675_100002962 3300005354 Bacteria 12815
151 Ga0070675_100055132 3300005354 Bacteria 3271
152 Ga0070675_100506091 3300005354 Unclassified 1089
153 Ga0070675_100938849 3300005354 Bacteria 793
154 Ga0070671_100000585 3300005355 Bacteria 25984
155 Ga0070671_100001443 3300005355 Bacteria 17754
156 Ga0070671_100003827 3300005355 Bacteria 11819
157 Ga0070671_100037502 3300005355 Bacteria 4020
158 Ga0070671_100045653 3300005355 Bacteria 3643
159 Ga0070671_100198879 3300005355 Bacteria 1699
160 Ga0070671_100414843 3300005355 Bacteria 1153
161 Ga0070671_100788285 3300005355 Bacteria 827
162 Ga0070671_101313595 3300005355 Unclassified 638
163 Ga0070674_100018915 3300005356 Unclassified 4365
164 Ga0070674_100027807 3300005356 Unclassified 3709
165 Ga0070674_100088954 3300005356 Unclassified 2224
166 Ga0070674_100186414 3300005356 Bacteria 1593
167 Ga0070674_100202907 3300005356 Unclassified 1532
168 Ga0070674_100586954 3300005356 Bacteria 940
169 Ga0070673_100002199 3300005364 Bacteria 11788
170 Ga0070673_100004985 3300005364 Bacteria 8465
171 Ga0070673_100100294 3300005364 Unclassified 2383
172 Ga0070673_100169667 3300005364 Unclassified 1861
173 Ga0070673_100280464 3300005364 Unclassified 1461
174 Ga0070673_100289168 3300005364 Bacteria 1440
175 Ga0070673_100526690 3300005364 Unclassified 1071
176 Ga0070673_100741086 3300005364 Unclassified 904
177 Ga0070688_100209641 3300005365 Unclassified 1367
178 Ga0070688_100932801 3300005365 Unclassified 686
179 Ga0070659_100007018 3300005366 Bacteria 8158
180 Ga0070659_100009371 3300005366 Bacteria 7190
181 Ga0070659_100012487 3300005366 Bacteria 6298
182 Ga0070659_100149201 3300005366 Unclassified 1907
183 Ga0070659_100201016 3300005366 Bacteria 1640
184 Ga0070659_100204822 3300005366 Unclassified 1625
185 Ga0070659_100297752 3300005366 Unclassified 1344
186 Ga0070659_100389812 3300005366 Unclassified 1174
187 Ga0070659_100436863 3300005366 Unclassified 1108
188 Ga0070659_100495630 3300005366 Bacteria 1041
189 Ga0070659_100743518 3300005366 Unclassified 850
190 Ga0070659_100904091 3300005366 Unclassified 772
191 Ga0070667_100003311 3300005367 Bacteria 13770
192 Ga0070667_100011143 3300005367 Bacteria 7437
193 Ga0070667_100081475 3300005367 Bacteria 2770
194 Ga0070667_100148128 3300005367 Unclassified 2060
195 Ga0070667_100226411 3300005367 Bacteria 1666
196 Ga0070667_101995516 3300005367 Unclassified 546
197 Ga0070709_11446384 3300005434 Unclassified 557
198 Ga0070714_100002190 3300005435 Bacteria 14377
199 Ga0070714_100156329 3300005435 Unclassified 2059
200 Ga0070714_100522566 3300005435 Unclassified 1134
201 Ga0070713_100123284 3300005436 Unclassified 2276
202 Ga0070713_100182722 3300005436 Bacteria 1885
203 Ga0070710_10709972 3300005437 Bacteria 710
204 Ga0070663_100013674 3300005455 Bacteria 5185
205 Ga0070663_100029040 3300005455 Unclassified 3773
206 Ga0070663_100030458 3300005455 Bacteria 3698
207 Ga0070663_100060216 3300005455 Unclassified 2730
208 Ga0070663_100158790 3300005455 Bacteria 1739
209 Ga0070663_100381878 3300005455 Unclassified 1147
210 Ga0070663_100389397 3300005455 Unclassified 1137
211 Ga0070663_100600895 3300005455 Bacteria 925
212 Ga0070663_101114702 3300005455 Unclassified 690
213 Ga0070678_100011216 3300005456 Bacteria 5518
214 Ga0070678_100036951 3300005456 Unclassified 3424
215 Ga0070678_100061154 3300005456 Unclassified 2775
216 Ga0070678_100085251 3300005456 Bacteria 2407
217 Ga0070678_100129322 3300005456 Bacteria 2004
218 Ga0070662_100002711 3300005457 Bacteria 10938
219 Ga0070662_100012833 3300005457 Bacteria 5566
220 Ga0070662_100036289 3300005457 Bacteria 3486
221 Ga0070662_100037197 3300005457 Unclassified 3450
222 Ga0070662_100040541 3300005457 Unclassified 3316
223 Ga0070662_100057498 3300005457 Unclassified 2826
224 Ga0070662_100064145 3300005457 Unclassified 2689
225 Ga0070662_100072696 3300005457 Bacteria 2540
226 Ga0070662_100083530 3300005457 Bacteria 2384
227 Ga0070662_100431494 3300005457 Unclassified 1091
228 Ga0070662_100518413 3300005457 Unclassified 996
229 Ga0070662_100950230 3300005457 Bacteria 735
230 Ga0070681_10078161 3300005458 Unclassified 3266
231 Ga0070681_10080144 3300005458 Bacteria 3221
232 Ga0070681_10595551 3300005458 Unclassified 1020
233 Ga0070681_10887088 3300005458 Bacteria 810
234 Ga0068867_100024122 3300005459 Bacteria 4359
235 Ga0070685_10123203 3300005466 Bacteria 1612
236 Ga0070679_100008241 3300005530 Bacteria 9802
237 Ga0070679_100042382 3300005530 Bacteria 4532
238 Ga0070679_100112132 3300005530 Bacteria 2713
239 Ga0070679_100251990 3300005530 Bacteria 1721
240 Ga0070679_100348106 3300005530 Bacteria 1430
241 Ga0070679_101511352 3300005530 Unclassified 618
242 Ga0070684_100004092 3300005535 Bacteria 11038
243 Ga0070684_100010106 3300005535 Bacteria 7464
244 Ga0070684_102036218 3300005535 Unclassified 542
245 Ga0068853_100027959 3300005539 Bacteria 4742
246 Ga0068853_100038172 3300005539 Bacteria 4090
247 Ga0068853_100060076 3300005539 Bacteria 3284
248 Ga0068853_100193223 3300005539 Unclassified 1850
249 Ga0068853_100232433 3300005539 Bacteria 1687
250 Ga0068853_100345729 3300005539 Bacteria 1383
251 Ga0068853_100464042 3300005539 Bacteria 1192
252 Ga0068853_100552289 3300005539 Bacteria 1091
253 Ga0070672_100001022 3300005543 Bacteria 17006
254 Ga0070672_100031012 3300005543 Unclassified 4021
255 Ga0070672_100117629 3300005543 Unclassified 2173
256 Ga0070672_100195481 3300005543 Bacteria 1690
257 Ga0070672_100280164 3300005543 Unclassified 1409
258 Ga0070672_101200708 3300005543 Unclassified 676
259 Ga0070672_101311295 3300005543 Unclassified 646
260 Ga0070672_101706427 3300005543 Archaea 566
261 Ga0070686_100028862 3300005544 Bacteria 3368
262 Ga0070686_101840102 3300005544 Unclassified 516
263 Ga0070693_100678160 3300005547 Unclassified 752
264 Ga0070665_100001865 3300005548 Bacteria 23913
265 Ga0070665_100028113 3300005548 Bacteria 5663
266 Ga0070665_100032641 3300005548 Bacteria 5240
267 Ga0070665_100087241 3300005548 Bacteria 3125
268 Ga0070665_100583356 3300005548 Unclassified 1131
269 Ga0068855_100005824 3300005563 Bacteria 15041
270 Ga0068855_100006659 3300005563 Bacteria 14033
271 Ga0068855_100014977 3300005563 Bacteria 9340
272 Ga0068855_100017060 3300005563 Bacteria 8734
273 Ga0068855_100019199 3300005563 Bacteria 8215
274 Ga0068855_100030983 3300005563 Bacteria 6392
275 Ga0068855_100153618 3300005563 Bacteria 2616
276 Ga0068855_100199319 3300005563 Unclassified 2254
277 Ga0068855_100827417 3300005563 Bacteria 982
278 Ga0068855_102186743 3300005563 Unclassified 556
279 Ga0070664_100000161 3300005564 Bacteria 46245
280 Ga0070664_100011435 3300005564 Bacteria 7203
281 Ga0070664_100012603 3300005564 Bacteria 6880
282 Ga0070664_100025357 3300005564 Bacteria 4913
283 Ga0070664_100027281 3300005564 Bacteria 4745
284 Ga0070664_100033439 3300005564 Bacteria 4306
285 Ga0070664_100035666 3300005564 Bacteria 4176
286 Ga0070664_100040030 3300005564 Unclassified 3951
287 Ga0070664_100079788 3300005564 Unclassified 2818
288 Ga0070664_100086527 3300005564 Unclassified 2708
289 Ga0070664_100139337 3300005564 Unclassified 2135
290 Ga0070664_100324564 3300005564 Bacteria 1395
291 Ga0070664_101415136 3300005564 Unclassified 657
292 Ga0068857_100038222 3300005577 Unclassified 4250
293 Ga0068857_100112004 3300005577 Unclassified 2453
294 Ga0068857_100565073 3300005577 Unclassified 1073
295 Ga0068857_100742428 3300005577 Unclassified 935
296 Ga0068857_100991465 3300005577 Unclassified 808
297 Ga0068857_101404784 3300005577 Bacteria 679
298 Ga0068857_101896344 3300005577 Bacteria 584
299 Ga0068857_102535135 3300005577 Bacteria 503
300 Ga0068854_100005714 3300005578 Bacteria 7860
301 Ga0068854_100012828 3300005578 Bacteria 5489
302 Ga0068854_100029291 3300005578 Bacteria 3811
303 Ga0068854_100056333 3300005578 Unclassified 2833
304 Ga0068854_100098300 3300005578 Bacteria 2190
305 Ga0068854_100102309 3300005578 Unclassified 2149
306 Ga0068854_100318604 3300005578 Unclassified 1263
307 Ga0068854_100377526 3300005578 Bacteria 1167
308 Ga0068854_100421048 3300005578 Unclassified 1109
309 Ga0068854_100694711 3300005578 Bacteria 878
310 Ga0068854_100714767 3300005578 Bacteria 866
311 Ga0068854_100995084 3300005578 Bacteria 742
312 Ga0068854_102012318 3300005578 Bacteria 532
313 Ga0068856_100010684 3300005614 Bacteria 8919
314 Ga0068856_100023749 3300005614 Bacteria 5963
315 Ga0068856_100069827 3300005614 Bacteria 3474
316 Ga0068856_100086906 3300005614 Bacteria 3108
317 Ga0068856_100122888 3300005614 Bacteria 2598
318 Ga0068856_100294342 3300005614 Bacteria 1640
319 Ga0068856_100313488 3300005614 Bacteria 1586
320 Ga0068856_100660129 3300005614 Bacteria 1066
321 Ga0068856_100973202 3300005614 Unclassified 867
322 Ga0068856_102141843 3300005614 Unclassified 569
323 Ga0068852_100007810 3300005616 Bacteria 7833
324 Ga0068852_100037574 3300005616 Bacteria 4061
325 Ga0068852_100310345 3300005616 Unclassified 1529
326 Ga0068852_100340190 3300005616 Unclassified 1462
327 Ga0068852_100383304 3300005616 Bacteria 1379
328 Ga0068852_100595345 3300005616 Unclassified 1109
329 Ga0068852_100601875 3300005616 Unclassified 1103
330 Ga0068852_100610103 3300005616 Unclassified 1096
331 Ga0068852_100701692 3300005616 Bacteria 1022
332 Ga0068852_100766724 3300005616 Bacteria 977
333 Ga0068864_100048368 3300005618 Unclassified 3656
334 Ga0068864_100055197 3300005618 Bacteria 3429
335 Ga0068864_100107289 3300005618 Unclassified 2484
336 Ga0068864_100134729 3300005618 Unclassified 2223
337 Ga0068864_100210423 3300005618 Bacteria 1790
338 Ga0068866_10014997 3300005718 Bacteria 3435
339 Ga0068866_11128671 3300005718 Unclassified 563
340 Ga0068861_102209833 3300005719 Bacteria 551
341 Ga0068851_10008666 3300005834 Bacteria 4709
342 Ga0068851_10293038 3300005834 Unclassified 933
343 Ga0068851_10474672 3300005834 Bacteria 747
344 Ga0068851_10996528 3300005834 Bacteria 528
345 Ga0068870_10066866 3300005840 Unclassified 1948
346 Ga0068870_10147998 3300005840 Bacteria 1380
347 Ga0068863_100068000 3300005841 Bacteria 3370
348 Ga0068863_100265535 3300005841 Bacteria 1660
349 Ga0068863_101193801 3300005841 Unclassified 767
350 Ga0068858_100028249 3300005842 Bacteria 5212
351 Ga0068858_100070725 3300005842 Unclassified 3234
352 Ga0068858_100096630 3300005842 Bacteria 2753
353 Ga0068860_100235618 3300005843 Unclassified 1779
354 Ga0068860_102573477 3300005843 Unclassified 528
355 Ga0068862_100013008 3300005844 Bacteria 6883
356 Ga0068862_101925253 3300005844 Bacteria 601
357 Ga0068862_102205946 3300005844 Unclassified 562
358 Ga0081539_10017819 3300005985 Unclassified 4961
359 Ga0081539_10101652 3300005985 Unclassified 1464
360 Ga0070717_10168661 3300006028 Bacteria 1903
361 Ga0070716_100433488 3300006173 Bacteria 954
362 Ga0097621_100013198 3300006237 Bacteria 6146
363 Ga0097621_100030868 3300006237 Bacteria 4246
364 Ga0097621_100142185 3300006237 Unclassified 2051
365 Ga0097621_101949070 3300006237 Unclassified 561
366 Ga0075370_10092536 3300006353 Bacteria 1745
367 Ga0068871_100156692 3300006358 Bacteria 1945
368 Ga0068871_101915736 3300006358 Unclassified 564
369 Ga0068865_100010945 3300006881 Bacteria 5662
370 Ga0068865_100561897 3300006881 Bacteria 959
371 Ga0105240_10007329 3300009093 Bacteria 16052
372 Ga0105240_10035738 3300009093 Bacteria 6400
373 Ga0105240_10089677 3300009093 Bacteria 3760
374 Ga0105240_10154718 3300009093 Unclassified 2728
375 Ga0105240_10180308 3300009093 Unclassified 2493
376 Ga0105240_10285403 3300009093 Bacteria 1895
377 Ga0105240_10656568 3300009093 Bacteria 1149
378 Ga0105240_10887209 3300009093 Bacteria 960
379 Ga0105240_11019602 3300009093 Unclassified 884
380 Ga0105240_11676647 3300009093 Bacteria 664
381 Ga0105245_10006582 3300009098 Bacteria 10199
382 Ga0105245_10131844 3300009098 Bacteria 2345
383 Ga0105243_10578656 3300009148 Bacteria 1077
384 Ga0105241_10060359 3300009174 Bacteria 2917
385 Ga0105241_10080050 3300009174 Unclassified 2556
386 Ga0105241_10113178 3300009174 Bacteria 2175
387 Ga0105241_10229420 3300009174 Bacteria 1564
388 Ga0105241_10796755 3300009174 Unclassified 870
389 Ga0105241_11194130 3300009174 Unclassified 720
390 Ga0105242_10462264 3300009176 Bacteria 1199
391 Ga0105248_10000864 3300009177 Bacteria 34121
392 Ga0105248_10001731 3300009177 Bacteria 24252
393 Ga0105248_10002120 3300009177 Bacteria 21948
394 Ga0105248_10021840 3300009177 Bacteria 7092
395 Ga0105248_10030620 3300009177 Bacteria 6009
396 Ga0105248_10079884 3300009177 Bacteria 3676
397 Ga0105248_10082992 3300009177 Unclassified 3605
398 Ga0105248_10828402 3300009177 Unclassified 1044
399 Ga0105248_12700656 3300009177 Unclassified 566
400 Ga0105237_10013112 3300009545 Bacteria 8701
401 Ga0105237_10042170 3300009545 Bacteria 4603
402 Ga0105237_10209755 3300009545 Unclassified 1948
403 Ga0105237_10354299 3300009545 Unclassified 1472
404 Ga0105238_10013299 3300009551 Bacteria 8304
405 Ga0105238_10089551 3300009551 Unclassified 3064
406 Ga0105238_10093369 3300009551 Bacteria 2997
407 Ga0105238_10193517 3300009551 Bacteria 2009
408 Ga0105238_10259665 3300009551 Bacteria 1716
409 Ga0105238_10615945 3300009551 Unclassified 1094
410 Ga0105238_11063869 3300009551 Bacteria 831
411 Ga0105238_12794189 3300009551 Unclassified 525
412 Ga0105239_10042499 3300010375 Bacteria 4981
413 Ga0105239_10062032 3300010375 Bacteria 4103
414 Ga0105239_10335496 3300010375 Unclassified 1706
415 Ga0105239_11178768 3300010375 Bacteria 882
416 Ga0105239_12621882 3300010375 Bacteria 588
417 Ga0105246_11305892 3300011119 Unclassified 673
418 Ga0105246_11542445 3300011119 Unclassified 625
419 Ga0157327_1031828 3300012512 Unclassified 663
420 Ga0157373_10004072 3300013100 Bacteria 11014
421 Ga0157373_10025010 3300013100 Unclassified 4323
422 Ga0157373_10032853 3300013100 Bacteria 3734
423 Ga0157373_10108143 3300013100 Bacteria 1955
424 Ga0157373_10108334 3300013100 Bacteria 1953
425 Ga0157373_11116607 3300013100 Unclassified 592
426 Ga0157373_11489794 3300013100 Unclassified 516
427 Ga0157371_10008598 3300013102 Bacteria 8109
428 Ga0157371_10021331 3300013102 Bacteria 4756
429 Ga0157371_10075192 3300013102 Bacteria 2392
430 Ga0157371_10110816 3300013102 Unclassified 1948
431 Ga0157371_10192956 3300013102 Bacteria 1459
432 Ga0157371_10274329 3300013102 Bacteria 1217
433 Ga0157371_10466016 3300013102 Unclassified 930
434 Ga0157371_10652844 3300013102 Archaea 785
435 Ga0157371_11127438 3300013102 Unclassified 602
436 Ga0157371_11130328 3300013102 Unclassified 602
437 Ga0157371_11480414 3300013102 Unclassified 529
438 Ga0157370_10022730 3300013104 Bacteria 6240
439 Ga0157370_10029233 3300013104 Bacteria 5413
440 Ga0157370_10046619 3300013104 Bacteria 4156
441 Ga0157370_10077871 3300013104 Unclassified 3123
442 Ga0157370_10127572 3300013104 Bacteria 2375
443 Ga0157370_11493376 3300013104 Unclassified 608
444 Ga0157369_10002126 3300013105 Bacteria 23887
445 Ga0157369_10046305 3300013105 Bacteria 4727
446 Ga0157369_10071353 3300013105 Unclassified 3729
447 Ga0157369_10103523 3300013105 Unclassified 3032
448 Ga0157369_10146583 3300013105 Unclassified 2496
449 Ga0157369_10210256 3300013105 Unclassified 2039
450 Ga0157369_10409536 3300013105 Unclassified 1406
451 Ga0157369_10429264 3300013105 Unclassified 1370
452 Ga0157369_10433642 3300013105 Bacteria 1362
453 Ga0157369_10504388 3300013105 Bacteria 1252
454 Ga0157369_10915450 3300013105 Bacteria 899
455 Ga0157369_11485173 3300013105 Unclassified 690
456 Ga0157369_12521741 3300013105 Unclassified 520
457 Ga0157374_10002028 3300013296 Bacteria 17001
458 Ga0157374_10004774 3300013296 Bacteria 11366
459 Ga0157374_10024050 3300013296 Bacteria 5457
460 Ga0157374_10057816 3300013296 Bacteria 3623
461 Ga0157374_10155157 3300013296 Bacteria 2228
462 Ga0157374_10826482 3300013296 Unclassified 943
463 Ga0157374_11076011 3300013296 Bacteria 824
464 Ga0157374_12428840 3300013296 Bacteria 551
465 Ga0157378_10036398 3300013297 Bacteria 4356
466 Ga0157378_10090576 3300013297 Bacteria 2779
467 Ga0163162_10025893 3300013306 Bacteria 5797
468 Ga0163162_10066915 3300013306 Unclassified 3643
469 Ga0163162_10539646 3300013306 Unclassified 1295
470 Ga0163162_11027206 3300013306 Bacteria 932
471 Ga0163162_13041912 3300013306 Bacteria 539
472 Ga0157372_10001798 3300013307 Bacteria 23289
473 Ga0157372_10012759 3300013307 Bacteria 8952
474 Ga0157372_10099622 3300013307 Unclassified 3315
475 Ga0157372_10630340 3300013307 Unclassified 1249
476 Ga0157372_10774827 3300013307 Bacteria 1115
477 Ga0157372_10817891 3300013307 Unclassified 1082
478 Ga0157372_11041598 3300013307 Unclassified 947
479 Ga0157372_11256231 3300013307 Unclassified 855
480 Ga0157372_11816624 3300013307 Unclassified 701
481 Ga0157372_11846839 3300013307 Unclassified 695
482 Ga0157372_12002374 3300013307 Bacteria 666
483 Ga0157372_12081974 3300013307 Unclassified 652
484 Ga0157375_10011719 3300013308 Bacteria 7750
485 Ga0157375_10108944 3300013308 Bacteria 2865
486 Ga0157375_10221272 3300013308 Bacteria 2051
487 Ga0157375_10347590 3300013308 Bacteria 1649
488 Ga0157375_11201673 3300013308 Unclassified 889
489 Ga0163163_10074390 3300014325 Unclassified 3389
490 Ga0163163_10676210 3300014325 Bacteria 1096
491 Ga0157380_10007497 3300014326 Bacteria 7748
492 Ga0157380_11764076 3300014326 Bacteria 677
493 Ga0157380_12527150 3300014326 Unclassified 579
494 Ga0182008_10351042 3300014497 Unclassified 782
495 Ga0182008_10546518 3300014497 Unclassified 643
496 Ga0157377_10271907 3300014745 Bacteria 1107
497 Ga0157377_10702284 3300014745 Unclassified 734
498 Ga0157379_10041194 3300014968 Bacteria 4123
499 Ga0157379_10483332 3300014968 Unclassified 1146
500 Ga0157376_11241678 3300014969 Bacteria 774
501 Ga0163161_10118710 3300017792 Unclassified 1985
502 Ga0163161_10415265 3300017792 Bacteria 1081
503 Ga0163161_11647803 3300017792 Bacteria 567
504 Ga0207697_10012516 3300025315 Unclassified 3556
505 Ga0207697_10045168 3300025315 Unclassified 1813
506 Ga0207697_10089469 3300025315 Unclassified 1304
507 Ga0207697_10499895 3300025315 Unclassified 537
508 Ga0207656_10021640 3300025321 Unclassified 2572
509 Ga0207656_10087368 3300025321 Bacteria 1410
510 Ga0207656_10483109 3300025321 Bacteria 628
511 Ga0207682_10001230 3300025893 Bacteria 11840
512 Ga0207682_10007931 3300025893 Bacteria 4215
513 Ga0207682_10068272 3300025893 Unclassified 1502
514 Ga0207642_10855423 3300025899 Unclassified 581
515 Ga0207688_10147199 3300025901 Unclassified 1389
516 Ga0207688_10238143 3300025901 Bacteria 1100
517 Ga0207688_10851529 3300025901 Unclassified 577
518 Ga0207680_10000843 3300025903 Bacteria 14479
519 Ga0207680_10016580 3300025903 Unclassified 3872
520 Ga0207680_10032318 3300025903 Bacteria 2974
521 Ga0207680_10044499 3300025903 Unclassified 2611
522 Ga0207680_10095562 3300025903 Bacteria 1899
523 Ga0207680_11020729 3300025903 Bacteria 592
524 Ga0207647_10000652 3300025904 Bacteria 27131
525 Ga0207647_10000953 3300025904 Bacteria 22378
526 Ga0207647_10008914 3300025904 Bacteria 7154
527 Ga0207647_10023651 3300025904 Unclassified 4060
528 Ga0207647_10058917 3300025904 Unclassified 2351
529 Ga0207647_10396093 3300025904 Bacteria 778
530 Ga0207699_10393274 3300025906 Unclassified 986
531 Ga0207645_10133599 3300025907 Bacteria 1616
532 Ga0207645_10301283 3300025907 Unclassified 1067
533 Ga0207645_10427540 3300025907 Bacteria 893
534 Ga0207645_10628190 3300025907 Bacteria 730
535 Ga0207643_10335423 3300025908 Unclassified 947
536 Ga0207705_10002169 3300025909 Bacteria 15185
537 Ga0207705_10002376 3300025909 Bacteria 14545
538 Ga0207705_10004357 3300025909 Bacteria 10702
539 Ga0207705_10005306 3300025909 Bacteria 9641
540 Ga0207705_10013606 3300025909 Bacteria 5873
541 Ga0207705_10020054 3300025909 Bacteria 4780
542 Ga0207705_10025714 3300025909 Unclassified 4200
543 Ga0207705_10034432 3300025909 Unclassified 3621
544 Ga0207705_10077537 3300025909 Unclassified 2417
545 Ga0207705_10106569 3300025909 Bacteria 2067
546 Ga0207705_10136260 3300025909 Bacteria 1831
547 Ga0207705_10158997 3300025909 Archaea 1697
548 Ga0207705_10170369 3300025909 Bacteria 1639
549 Ga0207705_10272363 3300025909 Bacteria 1295
550 Ga0207705_10617693 3300025909 Unclassified 843
551 Ga0207705_10711469 3300025909 Bacteria 781
552 Ga0207705_10718704 3300025909 Unclassified 776
553 Ga0207705_10797406 3300025909 Bacteria 733
554 Ga0207654_10085871 3300025911 Bacteria 1906
555 Ga0207654_10124014 3300025911 Bacteria 1626
556 Ga0207654_10265092 3300025911 Bacteria 1157
557 Ga0207654_10511632 3300025911 Unclassified 849
558 Ga0207707_10060239 3300025912 Unclassified 3303
559 Ga0207707_10147684 3300025912 Bacteria 2055
560 Ga0207707_10363576 3300025912 Bacteria 1246
561 Ga0207707_10832342 3300025912 Unclassified 767
562 Ga0207707_11006606 3300025912 Unclassified 684
563 Ga0207695_10003885 3300025913 Bacteria 20689
564 Ga0207695_10025814 3300025913 Bacteria 6567
565 Ga0207695_10104104 3300025913 Unclassified 2828
566 Ga0207695_10148138 3300025913 Bacteria 2289
567 Ga0207695_10354453 3300025913 Bacteria 1354
568 Ga0207695_10577047 3300025913 Unclassified 1006
569 Ga0207695_11244673 3300025913 Bacteria 624
570 Ga0207695_11271890 3300025913 Bacteria 616
571 Ga0207671_10044197 3300025914 Bacteria 3294
572 Ga0207671_10190695 3300025914 Bacteria 1598
573 Ga0207671_10274523 3300025914 Bacteria 1329
574 Ga0207671_10771793 3300025914 Bacteria 763
575 Ga0207693_10243812 3300025915 Bacteria 1411
576 Ga0207660_10018117 3300025917 Bacteria 4690
577 Ga0207660_10049838 3300025917 Bacteria 2971
578 Ga0207660_10127398 3300025917 Bacteria 1935
579 Ga0207660_10188865 3300025917 Bacteria 1603
580 Ga0207660_10401201 3300025917 Unclassified 1104
581 Ga0207660_10444678 3300025917 Unclassified 1048
582 Ga0207662_10186164 3300025918 Unclassified 1338
583 Ga0207662_10942420 3300025918 Unclassified 612
584 Ga0207657_10004145 3300025919 Bacteria 15365
585 Ga0207657_10007353 3300025919 Bacteria 11299
586 Ga0207657_10007984 3300025919 Bacteria 10789
587 Ga0207657_10017538 3300025919 Bacteria 6860
588 Ga0207657_10019117 3300025919 Bacteria 6516
589 Ga0207657_10032686 3300025919 Unclassified 4697
590 Ga0207657_10034506 3300025919 Bacteria 4548
591 Ga0207657_10088734 3300025919 Unclassified 2584
592 Ga0207657_10112994 3300025919 Bacteria 2241
593 Ga0207657_10149655 3300025919 Bacteria 1902
594 Ga0207657_10192117 3300025919 Bacteria 1646
595 Ga0207657_10197517 3300025919 Bacteria 1620
596 Ga0207657_10313620 3300025919 Bacteria 1241
597 Ga0207657_10496921 3300025919 Bacteria 956
598 Ga0207657_10568831 3300025919 Unclassified 885
599 Ga0207657_10571386 3300025919 Bacteria 883
600 Ga0207649_10002353 3300025920 Bacteria 10593
601 Ga0207649_10142148 3300025920 Bacteria 1644
602 Ga0207649_10143038 3300025920 Unclassified 1639
603 Ga0207649_10254084 3300025920 Bacteria 1267
604 Ga0207649_10473279 3300025920 Bacteria 949
605 Ga0207649_10561696 3300025920 Unclassified 874
606 Ga0207649_10567596 3300025920 Unclassified 870
607 Ga0207649_10783070 3300025920 Unclassified 744
608 Ga0207649_10960406 3300025920 Unclassified 671
609 Ga0207649_11137797 3300025920 Unclassified 616
610 Ga0207649_11270236 3300025920 Bacteria 582
611 Ga0207652_10010377 3300025921 Bacteria 7500
612 Ga0207652_10041592 3300025921 Bacteria 3908
613 Ga0207652_10041801 3300025921 Bacteria 3899
614 Ga0207652_10413623 3300025921 Bacteria 1216
615 Ga0207681_10018237 3300025923 Unclassified 4420
616 Ga0207681_10067967 3300025923 Bacteria 2473
617 Ga0207681_10110061 3300025923 Unclassified 2002
618 Ga0207681_10304359 3300025923 Unclassified 1262
619 Ga0207681_10861736 3300025923 Bacteria 758
620 Ga0207694_10066176 3300025924 Bacteria 2819
621 Ga0207694_10137148 3300025924 Bacteria 1966
622 Ga0207694_10228626 3300025924 Bacteria 1519
623 Ga0207694_10309723 3300025924 Bacteria 1301
624 Ga0207694_10352310 3300025924 Unclassified 1219
625 Ga0207694_10783744 3300025924 Unclassified 805
626 Ga0207694_11018332 3300025924 Bacteria 701
627 Ga0207650_10003792 3300025925 Bacteria 10337
628 Ga0207650_10011538 3300025925 Bacteria 6085
629 Ga0207650_10051214 3300025925 Unclassified 3055
630 Ga0207650_10122032 3300025925 Unclassified 2030
631 Ga0207650_10235009 3300025925 Bacteria 1480
632 Ga0207650_10360608 3300025925 Bacteria 1197
633 Ga0207650_10752773 3300025925 Bacteria 824
634 Ga0207659_10001593 3300025926 Bacteria 13460
635 Ga0207659_10003287 3300025926 Bacteria 9674
636 Ga0207659_10032465 3300025926 Unclassified 3584
637 Ga0207659_10200693 3300025926 Bacteria 1593
638 Ga0207687_10036959 3300025927 Unclassified 3329
639 Ga0207687_10848187 3300025927 Unclassified 780
640 Ga0207700_10803648 3300025928 Unclassified 841
641 Ga0207664_10100493 3300025929 Unclassified 2388
642 Ga0207664_10173347 3300025929 Unclassified 1848
643 Ga0207664_10368641 3300025929 Unclassified 1273
644 Ga0207664_10852238 3300025929 Bacteria 819
645 Ga0207644_10000110 3300025931 Bacteria 60867
646 Ga0207644_10002765 3300025931 Bacteria 11299
647 Ga0207644_10003194 3300025931 Bacteria 10553
648 Ga0207644_10039149 3300025931 Unclassified 3344
649 Ga0207644_10054894 3300025931 Unclassified 2870
650 Ga0207644_10127923 3300025931 Bacteria 1941
651 Ga0207644_10193081 3300025931 Bacteria 1602
652 Ga0207644_10567626 3300025931 Unclassified 940
653 Ga0207644_11284047 3300025931 Unclassified 615
654 Ga0207690_10002722 3300025932 Bacteria 10672
655 Ga0207690_10003887 3300025932 Bacteria 8831
656 Ga0207690_10016417 3300025932 Bacteria 4503
657 Ga0207690_10029863 3300025932 Unclassified 3470
658 Ga0207690_10037846 3300025932 Unclassified 3135
659 Ga0207690_10074186 3300025932 Unclassified 2356
660 Ga0207690_10075092 3300025932 Bacteria 2343
661 Ga0207690_10144553 3300025932 Bacteria 1757
662 Ga0207690_10569438 3300025932 Unclassified 922
663 Ga0207690_10667564 3300025932 Unclassified 853
664 Ga0207690_10770253 3300025932 Bacteria 794
665 Ga0207690_10781415 3300025932 Unclassified 788
666 Ga0207690_10989438 3300025932 Bacteria 699
667 Ga0207706_10004761 3300025933 Bacteria 12707
668 Ga0207706_10009871 3300025933 Bacteria 8758
669 Ga0207706_10012365 3300025933 Bacteria 7777
670 Ga0207706_10014818 3300025933 Bacteria 7058
671 Ga0207706_10019367 3300025933 Bacteria 6121
672 Ga0207706_10032192 3300025933 Unclassified 4670
673 Ga0207706_10034788 3300025933 Unclassified 4482
674 Ga0207706_10047655 3300025933 Unclassified 3791
675 Ga0207706_10083056 3300025933 Bacteria 2816
676 Ga0207706_10113880 3300025933 Bacteria 2379
677 Ga0207706_10306961 3300025933 Unclassified 1382
678 Ga0207706_10530432 3300025933 Bacteria 1015
679 Ga0207686_10444342 3300025934 Bacteria 996
680 Ga0207669_10033950 3300025937 Bacteria 2885
681 Ga0207669_10038283 3300025937 Bacteria 2760
682 Ga0207669_10070291 3300025937 Unclassified 2194
683 Ga0207669_10765486 3300025937 Unclassified 798
684 Ga0207669_11352899 3300025937 Unclassified 606
685 Ga0207669_11422892 3300025937 Unclassified 590
686 Ga0207704_10024242 3300025938 Bacteria 3286
687 Ga0207704_10037485 3300025938 Bacteria 2801
688 Ga0207665_10479873 3300025939 Bacteria 958
689 Ga0207691_10022111 3300025940 Bacteria 6000
690 Ga0207691_10022416 3300025940 Bacteria 5956
691 Ga0207691_10050820 3300025940 Unclassified 3793
692 Ga0207691_10072823 3300025940 Bacteria 3099
693 Ga0207691_10157751 3300025940 Unclassified 1992
694 Ga0207691_10310303 3300025940 Unclassified 1354
695 Ga0207691_10532847 3300025940 Bacteria 996
696 Ga0207691_10702394 3300025940 Unclassified 853
697 Ga0207691_10745571 3300025940 Unclassified 825
698 Ga0207691_11733841 3300025940 Unclassified 505
699 Ga0207711_10001548 3300025941 Bacteria 21289
700 Ga0207711_10005517 3300025941 Bacteria 10698
701 Ga0207711_10014822 3300025941 Bacteria 6477
702 Ga0207711_10042595 3300025941 Unclassified 3868
703 Ga0207711_10389684 3300025941 Bacteria 1293
704 Ga0207711_10441872 3300025941 Unclassified 1210
705 Ga0207711_10664495 3300025941 Unclassified 972
706 Ga0207661_10001486 3300025944 Bacteria 15865
707 Ga0207661_10055571 3300025944 Bacteria 3176
708 Ga0207661_10130596 3300025944 Bacteria 2151
709 Ga0207661_10623629 3300025944 Bacteria 990
710 Ga0207679_10024893 3300025945 Bacteria 4109
711 Ga0207679_10038329 3300025945 Unclassified 3414
712 Ga0207679_10040138 3300025945 Bacteria 3348
713 Ga0207679_10054031 3300025945 Unclassified 2955
714 Ga0207679_10065791 3300025945 Bacteria 2714
715 Ga0207679_10125806 3300025945 Unclassified 2048
716 Ga0207679_10129361 3300025945 Unclassified 2023
717 Ga0207679_10404071 3300025945 Bacteria 1202
718 Ga0207679_10836391 3300025945 Bacteria 840
719 Ga0207679_10945356 3300025945 Bacteria 789
720 Ga0207679_11246801 3300025945 Unclassified 682
721 Ga0207679_11340108 3300025945 Unclassified 657
722 Ga0207679_12143552 3300025945 Unclassified 507
723 Ga0207667_10004629 3300025949 Bacteria 16877
724 Ga0207667_10005094 3300025949 Bacteria 16049
725 Ga0207667_10005521 3300025949 Bacteria 15429
726 Ga0207667_10012704 3300025949 Bacteria 9677
727 Ga0207667_10034059 3300025949 Bacteria 5472
728 Ga0207667_10128631 3300025949 Bacteria 2609
729 Ga0207667_10182001 3300025949 Bacteria 2158
730 Ga0207667_10261591 3300025949 Bacteria 1769
731 Ga0207667_10304220 3300025949 Unclassified 1629
732 Ga0207667_11395191 3300025949 Unclassified 674
733 Ga0207651_10002266 3300025960 Bacteria 9135
734 Ga0207651_10008091 3300025960 Bacteria 5650
735 Ga0207651_10035123 3300025960 Unclassified 3255
736 Ga0207651_10084260 3300025960 Bacteria 2302
737 Ga0207651_10663112 3300025960 Unclassified 916
738 Ga0207651_10708872 3300025960 Unclassified 887
739 Ga0207651_11466213 3300025960 Unclassified 614
740 Ga0207668_10145843 3300025972 Unclassified 1826
741 Ga0207668_10299866 3300025972 Bacteria 1326
742 Ga0207668_10353521 3300025972 Unclassified 1229
743 Ga0207668_10573723 3300025972 Bacteria 980
744 Ga0207668_12103968 3300025972 Bacteria 508
745 Ga0207640_10018770 3300025981 Bacteria 4070
746 Ga0207640_10051287 3300025981 Bacteria 2681
747 Ga0207640_10051945 3300025981 Unclassified 2667
748 Ga0207640_10060038 3300025981 Unclassified 2512
749 Ga0207640_10081168 3300025981 Bacteria 2216
750 Ga0207640_10221142 3300025981 Bacteria 1450
751 Ga0207640_10352606 3300025981 Bacteria 1183
752 Ga0207640_10439439 3300025981 Unclassified 1072
753 Ga0207640_11108509 3300025981 Unclassified 700
754 Ga0207658_10002182 3300025986 Bacteria 14559
755 Ga0207658_10067481 3300025986 Unclassified 2694
756 Ga0207658_10119661 3300025986 Bacteria 2097
757 Ga0207658_10304657 3300025986 Unclassified 1374
758 Ga0207658_11279023 3300025986 Unclassified 671
759 Ga0207658_11501120 3300025986 Unclassified 616
760 Ga0207677_10022272 3300026023 Bacteria 3891
761 Ga0207677_10080550 3300026023 Unclassified 2333
762 Ga0207677_10262959 3300026023 Bacteria 1407
763 Ga0207677_10892843 3300026023 Unclassified 801
764 Ga0207677_11070677 3300026023 Bacteria 734
765 Ga0207703_10003041 3300026035 Bacteria 14194
766 Ga0207703_10091420 3300026035 Unclassified 2560
767 Ga0207639_10015848 3300026041 Bacteria 5322
768 Ga0207639_10112796 3300026041 Unclassified 2219
769 Ga0207639_10199104 3300026041 Bacteria 1716
770 Ga0207639_10561876 3300026041 Unclassified 1048
771 Ga0207639_10804321 3300026041 Unclassified 876
772 Ga0207639_11014851 3300026041 Unclassified 777
773 Ga0207639_11229069 3300026041 Bacteria 703
774 Ga0207678_10003264 3300026067 Bacteria 14641
775 Ga0207678_10007874 3300026067 Bacteria 9399
776 Ga0207678_10043699 3300026067 Bacteria 3876
777 Ga0207678_10043857 3300026067 Bacteria 3869
778 Ga0207678_10045372 3300026067 Unclassified 3801
779 Ga0207678_10165052 3300026067 Bacteria 1891
780 Ga0207678_10202659 3300026067 Bacteria 1697
781 Ga0207678_10897148 3300026067 Bacteria 784
782 Ga0207678_10944390 3300026067 Bacteria 763
783 Ga0207708_10330176 3300026075 Unclassified 1247
784 Ga0207702_10005931 3300026078 Bacteria 10614
785 Ga0207702_10019425 3300026078 Bacteria 5622
786 Ga0207702_10028283 3300026078 Unclassified 4659
787 Ga0207702_10057850 3300026078 Unclassified 3297
788 Ga0207702_10399174 3300026078 Bacteria 1326
789 Ga0207702_10498285 3300026078 Bacteria 1187
790 Ga0207702_10749986 3300026078 Unclassified 964
791 Ga0207702_11086882 3300026078 Bacteria 794
792 Ga0207702_11490335 3300026078 Bacteria 670
793 Ga0207702_11603136 3300026078 Bacteria 644
794 Ga0207702_12037067 3300026078 Unclassified 564
795 Ga0207641_10047089 3300026088 Bacteria 3636
796 Ga0207641_10231936 3300026088 Bacteria 1716
797 Ga0207641_10694208 3300026088 Unclassified 1002
798 Ga0207648_10113898 3300026089 Bacteria 2376
799 Ga0207648_10962750 3300026089 Bacteria 799
800 Ga0207676_10007954 3300026095 Bacteria 7539
801 Ga0207676_10029636 3300026095 Unclassified 4100
802 Ga0207676_10425382 3300026095 Unclassified 1246
803 Ga0207676_10578554 3300026095 Bacteria 1076
804 Ga0207674_10002992 3300026116 Bacteria 20959
805 Ga0207674_10006901 3300026116 Bacteria 13309
806 Ga0207674_10007460 3300026116 Bacteria 12748
807 Ga0207674_10089833 3300026116 Bacteria 3064
808 Ga0207674_10139885 3300026116 Bacteria 2381
809 Ga0207674_10204176 3300026116 Bacteria 1926
810 Ga0207674_10291925 3300026116 Bacteria 1579
811 Ga0207674_10630182 3300026116 Unclassified 1035
812 Ga0207674_10732962 3300026116 Bacteria 954
813 Ga0207675_101285357 3300026118 Bacteria 752
814 Ga0207683_10002536 3300026121 Bacteria 15941
815 Ga0207683_10014754 3300026121 Bacteria 6651
816 Ga0207683_10021162 3300026121 Bacteria 5567
817 Ga0207683_10116927 3300026121 Bacteria 2391
818 Ga0207683_10237416 3300026121 Unclassified 1663
819 Ga0207683_10251601 3300026121 Unclassified 1612
820 Ga0207698_10004870 3300026142 Bacteria 8229
821 Ga0207698_10007964 3300026142 Bacteria 6676
822 Ga0207698_10083860 3300026142 Bacteria 2581
823 Ga0207698_10194732 3300026142 Bacteria 1809
824 Ga0207698_10464781 3300026142 Bacteria 1224
825 Ga0207698_10514293 3300026142 Unclassified 1167
826 Ga0207698_10523119 3300026142 Unclassified 1158
827 Ga0207698_10555414 3300026142 Bacteria 1126
828 Ga0207698_10595876 3300026142 Unclassified 1089
829 Ga0207698_10718565 3300026142 Unclassified 995
830 Ga0207698_10817923 3300026142 Unclassified 935
831 Ga0207698_10881322 3300026142 Bacteria 901
832 Ga0207698_11405912 3300026142 Bacteria 713
833 Ga0207698_11541493 3300026142 Unclassified 680
834 Ga0207698_12502896 3300026142 Bacteria 526
835 Ga0209983_1080621 3300027665 Bacteria 729
836 Ga0209971_1151775 3300027682 Bacteria 571
837 Ga0209974_10027288 3300027876 Bacteria 1889
838 Ga0268266_10074634 3300028379 Plasmid 2945
839 Ga0268266_10078254 3300028379 Bacteria 2877
840 Ga0268266_10137132 3300028379 Unclassified 2192
841 Ga0268266_10494576 3300028379 Unclassified 1167
842 Ga0268265_10255037 3300028380 Unclassified 1556
843 Ga0268265_11686756 3300028380 Bacteria 639
844 Ga0268264_10136842 3300028381 Unclassified 2179
845 Ga0268264_11941799 3300028381 Unclassified 598
846 Ga0265338_10436948 3300028800 Unclassified 928
847 Ga0316182_1322975 3300030745 Bacteria 924
848 Ga0265339_10135005 3300031249 Bacteria 1259
849 Ga0265316_10171239 3300031344 Unclassified 1620
850 Ga0307408_100005547 3300031548 Bacteria 8429
851 Ga0307408_100039022 3300031548 Unclassified 3354
852 Ga0307408_100055763 3300031548 Bacteria 2863
853 Ga0307408_100063445 3300031548 Unclassified 2703
854 Ga0307408_100150625 3300031548 Bacteria 1836
855 Ga0307408_100215759 3300031548 Unclassified 1562
856 Ga0307408_100672391 3300031548 Bacteria 928
857 Ga0307408_101034771 3300031548 Unclassified 758
858 Ga0307408_101088740 3300031548 Bacteria 741
859 Ga0307408_101474684 3300031548 Unclassified 643
860 Ga0307408_101829045 3300031548 Bacteria 581
861 Ga0307405_10009275 3300031731 Bacteria 5036
862 Ga0307405_10020576 3300031731 Unclassified 3690
863 Ga0307405_10030471 3300031731 Bacteria 3164
864 Ga0307405_10081898 3300031731 Unclassified 2111
865 Ga0307405_10159774 3300031731 Unclassified 1594
866 Ga0307405_10460912 3300031731 Bacteria 1010
867 Ga0307405_10828057 3300031731 Bacteria 777
868 Ga0307405_11013064 3300031731 Unclassified 709
869 Ga0307405_11724838 3300031731 Bacteria 555
870 Ga0307405_11873184 3300031731 Unclassified 534
871 Ga0307413_10020129 3300031824 Bacteria 3541
872 Ga0307413_10028933 3300031824 Unclassified 3093
873 Ga0307413_10047089 3300031824 Bacteria 2569
874 Ga0307413_10103921 3300031824 Unclassified 1885
875 Ga0307413_10126567 3300031824 Bacteria 1741
876 Ga0307413_10318179 3300031824 Unclassified 1187
877 Ga0307413_10341626 3300031824 Unclassified 1152
878 Ga0307413_10587183 3300031824 Bacteria 910
879 Ga0307413_10711187 3300031824 Unclassified 835
880 Ga0307410_10001568 3300031852 Bacteria 10450
881 Ga0307410_10011884 3300031852 Bacteria 5004
882 Ga0307410_10018254 3300031852 Bacteria 4236
883 Ga0307410_10025365 3300031852 Bacteria 3719
884 Ga0307410_10044486 3300031852 Unclassified 2950
885 Ga0307410_10156468 3300031852 Bacteria 1703
886 Ga0307410_10180811 3300031852 Unclassified 1596
887 Ga0307410_10344942 3300031852 Bacteria 1188
888 Ga0307410_11232592 3300031852 Bacteria 652
889 Ga0307410_11810211 3300031852 Unclassified 542
890 Ga0326468_10025345 3300031889 Unclassified 745
891 Ga0307406_10021903 3300031901 Bacteria 3786
892 Ga0307406_10052039 3300031901 Bacteria 2603
893 Ga0307406_10101412 3300031901 Unclassified 1961
894 Ga0307406_10159369 3300031901 Bacteria 1620
895 Ga0307406_10200298 3300031901 Bacteria 1469
896 Ga0307406_10619401 3300031901 Unclassified 895
897 Ga0307406_10667324 3300031901 Bacteria 865
898 Ga0307406_10763084 3300031901 Bacteria 813
899 Ga0307407_10002341 3300031903 Bacteria 7377
900 Ga0307407_10003187 3300031903 Bacteria 6651
901 Ga0307407_10080043 3300031903 Bacteria 1973
902 Ga0307407_10179170 3300031903 Bacteria 1403
903 Ga0307407_10278766 3300031903 Bacteria 1157
904 Ga0307407_10317988 3300031903 Bacteria 1091
905 Ga0307407_10420475 3300031903 Bacteria 963
906 Ga0307407_10688881 3300031903 Bacteria 769
907 Ga0307407_10773385 3300031903 Unclassified 728
908 Ga0307412_10008883 3300031911 Bacteria 5756
909 Ga0307412_10063658 3300031911 Bacteria 2489
910 Ga0307412_10066033 3300031911 Unclassified 2451
911 Ga0307412_10092627 3300031911 Bacteria 2118
912 Ga0307412_10110723 3300031911 Unclassified 1960
913 Ga0307412_10175878 3300031911 Bacteria 1605
914 Ga0307412_10190467 3300031911 Bacteria 1550
915 Ga0307412_10367095 3300031911 Bacteria 1161
916 Ga0307412_10606972 3300031911 Unclassified 927
917 Ga0307412_10782994 3300031911 Bacteria 826
918 Ga0307412_10844219 3300031911 Unclassified 798
919 Ga0307412_11755316 3300031911 Bacteria 570
920 Ga0307409_100004859 3300031995 Bacteria 7636
921 Ga0307409_100007942 3300031995 Bacteria 6393
922 Ga0307409_100016188 3300031995 Bacteria 4925
923 Ga0307409_100033400 3300031995 Bacteria 3743
924 Ga0307409_100108881 3300031995 Bacteria 2318
925 Ga0307409_100121297 3300031995 Bacteria 2214
926 Ga0307409_100137083 3300031995 Bacteria 2102
927 Ga0307409_100178720 3300031995 Unclassified 1876
928 Ga0307409_100340576 3300031995 Bacteria 1411
929 Ga0307409_100797773 3300031995 Unclassified 951
930 Ga0307409_100988614 3300031995 Bacteria 859
931 Ga0307409_101404400 3300031995 Bacteria 724
932 Ga0307416_100005056 3300032002 Bacteria 8040
933 Ga0307416_100008626 3300032002 Bacteria 6597
934 Ga0307416_100009112 3300032002 Bacteria 6468
935 Ga0307416_100023233 3300032002 Bacteria 4495
936 Ga0307416_100054225 3300032002 Bacteria 3222
937 Ga0307416_100079034 3300032002 Unclassified 2770
938 Ga0307416_100145705 3300032002 Bacteria 2162
939 Ga0307416_100161728 3300032002 Unclassified 2070
940 Ga0307416_100372770 3300032002 Unclassified 1454
941 Ga0307416_100443931 3300032002 Bacteria 1348
942 Ga0307416_100475550 3300032002 Bacteria 1308
943 Ga0307416_100521990 3300032002 Bacteria 1256
944 Ga0307416_100641203 3300032002 Bacteria 1146
945 Ga0307416_100968289 3300032002 Unclassified 953
946 Ga0307416_100970226 3300032002 Bacteria 952
947 Ga0307416_102435801 3300032002 Unclassified 622
948 Ga0307414_10007981 3300032004 Bacteria 5979
949 Ga0307414_10026446 3300032004 Bacteria 3735
950 Ga0307414_10071441 3300032004 Bacteria 2503
951 Ga0307414_10083573 3300032004 Unclassified 2345
952 Ga0307414_10250593 3300032004 Bacteria 1472
953 Ga0307414_10427765 3300032004 Unclassified 1156
954 Ga0307414_10453661 3300032004 Bacteria 1125
955 Ga0307414_10522523 3300032004 Bacteria 1054
956 Ga0307414_10895573 3300032004 Unclassified 813
957 Ga0307414_11066125 3300032004 Unclassified 745
958 Ga0307414_11113119 3300032004 Bacteria 729
959 Ga0307414_11131863 3300032004 Unclassified 723
960 Ga0307414_11345458 3300032004 Unclassified 663
961 Ga0307414_11557633 3300032004 Unclassified 615
962 Ga0307411_10003367 3300032005 Bacteria 7404
963 Ga0307411_10005225 3300032005 Bacteria 6356
964 Ga0307411_10015557 3300032005 Unclassified 4278
965 Ga0307411_10027219 3300032005 Unclassified 3455
966 Ga0307411_10074530 3300032005 Unclassified 2313
967 Ga0307411_10112517 3300032005 Unclassified 1951
968 Ga0307411_10181216 3300032005 Bacteria 1599
969 Ga0307411_10289444 3300032005 Bacteria 1308
970 Ga0307411_10442295 3300032005 Bacteria 1085
971 Ga0307411_10891694 3300032005 Unclassified 789
972 Ga0307411_10919008 3300032005 Unclassified 778
973 Ga0307411_11319163 3300032005 Bacteria 658
974 Ga0307411_11500223 3300032005 Unclassified 619
975 Ga0307415_100006068 3300032126 Bacteria 6479
976 Ga0307415_100008308 3300032126 Bacteria 5746
977 Ga0307415_100009900 3300032126 Bacteria 5373
978 Ga0307415_100012346 3300032126 Bacteria 4936
979 Ga0307415_100018520 3300032126 Bacteria 4208
980 Ga0307415_100022724 3300032126 Unclassified 3877
981 Ga0307415_100050004 3300032126 Bacteria 2830
982 Ga0307415_100079700 3300032126 Bacteria 2334
983 Ga0307415_100122117 3300032126 Bacteria 1955
984 Ga0373933_0865287 3300035724 Unclassified 595
985 Ga0395899_0000274 3300037312 Bacteria 67210
986 Ga0395899_0002381 3300037312 Bacteria 15277
987 Ga0395899_0012400 3300037312 Bacteria 6529
988 Ga0395899_0014700 3300037312 Bacteria 5973
989 Ga0395899_0045490 3300037312 Bacteria 3270
990 Ga0395899_0054314 3300037312 Bacteria 2964
991 Ga0395899_0063719 3300037312 Plasmid 2711
992 Ga0395899_0079007 3300037312 Unclassified 2397
993 Ga0395899_0147584 3300037312 Bacteria 1669
994 Ga0395899_0191971 3300037312 Unclassified 1429
995 Ga0395899_0274081 3300037312 Unclassified 1150
996 Ga0395899_0282706 3300037312 Unclassified 1128
997 Ga0395899_0310779 3300037312 Bacteria 1064
998 Ga0395899_0486468 3300037312 Unclassified 803
999 Ga0395899_0598541 3300037312 Unclassified 702
1000 Ga0395899_0613657 3300037312 Bacteria 691
1001 Ga0395899_0623125 3300037312 Bacteria 685
1002 Ga0395899_0990106 3300037312 Unclassified 508
1003 Ga0395900_0000595 3300037418 Bacteria 49632
1004 Ga0395900_0004150 3300037418 Bacteria 15419
1005 Ga0395900_0009492 3300037418 Bacteria 9975
1006 Ga0395900_0021697 3300037418 Bacteria 6566
1007 Ga0395900_0032009 3300037418 Bacteria 5406
1008 Ga0395900_0051312 3300037418 Bacteria 4249
1009 Ga0395900_0061474 3300037418 Unclassified 3861
1010 Ga0395900_0069099 3300037418 Bacteria 3630
1011 Ga0395900_0089208 3300037418 Unclassified 3170
1012 Ga0395900_0094415 3300037418 Unclassified 3072
1013 Ga0395900_0112993 3300037418 Unclassified 2788
1014 Ga0395900_0128824 3300037418 Unclassified 2594
1015 Ga0395900_0132958 3300037418 Bacteria 2549
1016 Ga0395900_0166847 3300037418 Bacteria 2243
1017 Ga0395900_0203915 3300037418 Bacteria 1999
1018 Ga0395900_0227571 3300037418 Unclassified 1877
1019 Ga0395900_0261101 3300037418 Bacteria 1730
1020 Ga0395900_0299401 3300037418 Bacteria 1595
1021 Ga0395900_0314767 3300037418 Bacteria 1547
1022 Ga0395900_0331042 3300037418 Bacteria 1501
1023 Ga0395900_0371279 3300037418 Unclassified 1400
1024 Ga0395900_0373622 3300037418 Bacteria 1395
1025 Ga0395900_0395668 3300037418 Bacteria 1347
1026 Ga0395900_0421488 3300037418 Bacteria 1295
1027 Ga0395900_0486684 3300037418 Unclassified 1186
1028 Ga0395900_0573213 3300037418 Unclassified 1071
1029 Ga0395900_0594178 3300037418 Unclassified 1048
1030 Ga0395900_0635141 3300037418 Bacteria 1005
1031 Ga0395900_0650941 3300037418 Unclassified 990
1032 Ga0395900_0810782 3300037418 Unclassified 863
1033 Ga0395900_0878936 3300037418 Unclassified 820
1034 Ga0395900_0996329 3300037418 Bacteria 758
1035 Ga0395900_1280108 3300037418 Unclassified 647
1036 Ga0395900_1611493 3300037418 Unclassified 560
1037 Ga0395900_1631453 3300037418 Unclassified 556
1038 Ga0395900_1658055 3300037418 Unclassified 550
1039 Ga0395900_1662829 3300037418 Unclassified 549
1040 Ga0395898_0005114 3300037466 Bacteria 14209
1041 Ga0395898_0006829 3300037466 Bacteria 12138
1042 Ga0395898_0017744 3300037466 Bacteria 7263
1043 Ga0395898_0020380 3300037466 Bacteria 6733
1044 Ga0395898_0024914 3300037466 Bacteria 6031
1045 Ga0395898_0026720 3300037466 Bacteria 5802
1046 Ga0395898_0034810 3300037466 Bacteria 5013
1047 Ga0395898_0055067 3300037466 Bacteria 3879
1048 Ga0395898_0062738 3300037466 Bacteria 3608
1049 Ga0395898_0064370 3300037466 Bacteria 3556
1050 Ga0395898_0127100 3300037466 Bacteria 2442
1051 Ga0395898_0161732 3300037466 Unclassified 2141
1052 Ga0395898_0205883 3300037466 Unclassified 1877
1053 Ga0395898_0242652 3300037466 Bacteria 1718
1054 Ga0395898_0288722 3300037466 Unclassified 1565
1055 Ga0395898_0827875 3300037466 Unclassified 865
1056 Ga0395898_1043458 3300037466 Unclassified 752
1057 Ga0395898_1106341 3300037466 Bacteria 725
1058 Ga0395898_1768746 3300037466 Unclassified 540
1059 Ga0395898_1795613 3300037466 Bacteria 534
1060 Ga0395905_0000575 3300037471 Bacteria 49664
1061 Ga0395905_0002328 3300037471 Bacteria 21216
1062 Ga0395905_0003746 3300037471 Bacteria 16115
1063 Ga0395905_0006198 3300037471 Bacteria 12067
1064 Ga0395905_0010952 3300037471 Bacteria 8777
1065 Ga0395905_0011179 3300037471 Bacteria 8679
1066 Ga0395905_0020706 3300037471 Bacteria 6228
1067 Ga0395905_0023907 3300037471 Bacteria 5769
1068 Ga0395905_0025512 3300037471 Bacteria 5574
1069 Ga0395905_0031595 3300037471 Unclassified 4984
1070 Ga0395905_0034430 3300037471 Unclassified 4756
1071 Ga0395905_0036398 3300037471 Bacteria 4622
1072 Ga0395905_0045310 3300037471 Unclassified 4125
1073 Ga0395905_0055245 3300037471 Unclassified 3716
1074 Ga0395905_0064924 3300037471 Bacteria 3417
1075 Ga0395905_0091485 3300037471 Bacteria 2852
1076 Ga0395905_0111933 3300037471 Unclassified 2563
1077 Ga0395905_0121272 3300037471 Bacteria 2457
1078 Ga0395905_0129395 3300037471 Bacteria 2374
1079 Ga0395905_0137976 3300037471 Bacteria 2294
1080 Ga0395905_0184151 3300037471 Unclassified 1960
1081 Ga0395905_0224309 3300037471 Unclassified 1758
1082 Ga0395905_0234800 3300037471 Bacteria 1714
1083 Ga0395905_0268877 3300037471 Bacteria 1590
1084 Ga0395905_0309714 3300037471 Bacteria 1467
1085 Ga0395905_0380127 3300037471 Bacteria 1306
1086 Ga0395905_0439830 3300037471 Unclassified 1201
1087 Ga0395905_0532218 3300037471 Bacteria 1076
1088 Ga0395905_0567976 3300037471 Bacteria 1036
1089 Ga0395905_1080686 3300037471 Unclassified 705
1090 Ga0395905_1403264 3300037471 Unclassified 602
1091 Ga0395905_1703258 3300037471 Unclassified 536
1092 Ga0395901_0001391 3300038443 Bacteria 25281
1093 Ga0395901_0003881 3300038443 Bacteria 15029
1094 Ga0395901_0004508 3300038443 Bacteria 14046
1095 Ga0395901_0005012 3300038443 Bacteria 13368
1096 Ga0395901_0005682 3300038443 Bacteria 12622
1097 Ga0395901_0014443 3300038443 Bacteria 8036
1098 Ga0395901_0023949 3300038443 Bacteria 6263
1099 Ga0395901_0031335 3300038443 Bacteria 5483
1100 Ga0395901_0034344 3300038443 Bacteria 5237
1101 Ga0395901_0034381 3300038443 Bacteria 5234
1102 Ga0395901_0036892 3300038443 Bacteria 5053
1103 Ga0395901_0037861 3300038443 Unclassified 4987
1104 Ga0395901_0116974 3300038443 Unclassified 2801
1105 Ga0395901_0132967 3300038443 Unclassified 2614
1106 Ga0395901_0219510 3300038443 Bacteria 1987
1107 Ga0395901_0309422 3300038443 Bacteria 1636
1108 Ga0395901_0396393 3300038443 Unclassified 1418
1109 Ga0395901_0437559 3300038443 Unclassified 1339
1110 Ga0395901_0555126 3300038443 Bacteria 1163
1111 Ga0395901_0574277 3300038443 Bacteria 1140
1112 Ga0395901_0623278 3300038443 Bacteria 1085
1113 Ga0395901_0634961 3300038443 Bacteria 1073
1114 Ga0395901_0659236 3300038443 Bacteria 1049
1115 Ga0395901_0831040 3300038443 Unclassified 910
1116 Ga0395901_0878926 3300038443 Unclassified 879
1117 Ga0395901_1144632 3300038443 Unclassified 746
1118 Ga0395901_1250855 3300038443 Bacteria 706
1119 Ga0395901_1262653 3300038443 Unclassified 702
1120 Ga0395901_1468921 3300038443 Unclassified 638
1121 Ga0395901_1721376 3300038443 Unclassified 578
1122 Ga0436365_0736792 3300039437 Bacteria 14837
1123 Ga0436365_0774065 3300039437 Unclassified 638
1124 Ga0436363_0542870 3300039450 Unclassified 1830
1125 Ga0436362_0401320 3300039453 Unclassified 524
1126 Ga0451798_0883369 3300041458 Unclassified 574
1127 Ga0451845_0093183 3300041501 Unclassified 658
1128 Ga0439445_0109023 3300042004 Unclassified 789
1129 Ga0439448_0003296 3300042005 Bacteria 4464
1130 Ga0439448_0352572 3300042005 Bacteria 525
1131 Ga0439432_123679 3300042006 Unclassified 765
1132 Ga0439449_0105076 3300042007 Bacteria 1045
1133 Ga0439452_139586 3300042010 Unclassified 512
1134 Ga0439455_0129337 3300042012 Unclassified 711
1135 Ga0450920_014143 3300042122 Bacteria 1507
1136 Ga0439458_0000082 3300042157 Bacteria 17715
1137 Ga0466972_0042978 3300044658 Unclassified 2195
1138 Ga0466972_0361720 3300044658 Unclassified 679
1139 Ga0466965_0774859 3300044683 Bacteria 554
1140 Ga0466966_0045888 3300044684 Bacteria 2792
1141 Ga0466966_0226970 3300044684 Unclassified 1127
1142 Ga0466966_0591890 3300044684 Unclassified 668
1143 Ga0466961_0032451 3300044693 Unclassified 3356
1144 Ga0466961_0122345 3300044693 Bacteria 1633
1145 Ga0466961_0564414 3300044693 Unclassified 685
1146 Ga0466963_0191332 3300044694 Bacteria 1429
1147 Ga0466963_0202006 3300044694 Bacteria 1390
1148 Ga0466963_0304280 3300044694 Bacteria 1121
1149 Ga0466963_0320705 3300044694 Unclassified 1090
1150 Ga0466963_0492386 3300044694 Bacteria 865
1151 Ga0453684_0973996 3300044712 Bacteria 904
1152 Ga0466971_0012442 3300044719 Bacteria 3730
1153 Ga0466971_0350897 3300044719 Unclassified 714
1154 Ga0466970_0037992 3300044765 Bacteria 2554
1155 Ga0466970_0354545 3300044765 Bacteria 833
1156 Ga0466970_0629636 3300044765 Bacteria 623
1157 Ga0466957_0019065 3300044842 Unclassified 4034
1158 Ga0466957_0469993 3300044842 Unclassified 869
1159 Ga0466957_0754840 3300044842 Bacteria 689
1160 Ga0466957_0979015 3300044842 Unclassified 607
1161 Ga0466957_1147276 3300044842 Unclassified 561
1162 Ga0466957_1254086 3300044842 Unclassified 537
1163 Ga0466960_0070364 3300044901 Bacteria 1740
1164 Ga0466959_0007425 3300045049 Bacteria 7689
1165 Ga0466959_0031930 3300045049 Unclassified 3898
1166 Ga0466959_0303826 3300045049 Unclassified 1092
1167 Ga0466959_0700351 3300045049 Bacteria 679
1168 Ga0466959_0781340 3300045049 Unclassified 639
1169 Ga0466959_0974987 3300045049 Bacteria 565
1170 Ga0466958_0014628 3300045836 Bacteria 4480
1171 Ga0466958_0066871 3300045836 Bacteria 2195
1172 Ga0466958_0190920 3300045836 Bacteria 1302
1173 Ga0466958_0225463 3300045836 Bacteria 1196
1174 Ga0466958_0284637 3300045836 Bacteria 1060
1175 Ga0466958_0324106 3300045836 Unclassified 990
1176 Ga0466967_0132311 3300045976 Bacteria 2317
1177 Ga0466967_0139830 3300045976 Unclassified 2254
1178 Ga0466967_0180776 3300045976 Unclassified 1989
1179 Ga0466967_2088876 3300045976 Unclassified 563
1180 Ga0495580_0733381 3300046472 Unclassified 645
1181 Ga0495585_0330632 3300046492 Bacteria 744
1182 Ga0495620_0051741 3300046515 Bacteria 1747
1183 Ga0495643_0035553 3300046522 Unclassified 2743
1184 Ga0495663_0066716 3300046525 Unclassified 1140
1185 Ga0495598_0144965 3300046537 Unclassified 824
1186 Ga0495598_0300676 3300046537 Bacteria 607
1187 Ga0495621_0014694 3300046539 Unclassified 2483
1188 Ga0495597_0229925 3300046542 Unclassified 734
1189 Ga0495633_0304744 3300046558 Unclassified 723
1190 Ga0495668_0024802 3300046616 Bacteria 3410
1191 Ga0495669_0001241 3300046684 Bacteria 10595
1192 Ga0495669_0010849 3300046684 Bacteria 3857
1193 Ga0495669_0533461 3300046684 Bacteria 571
1194 Ga0495670_0050424 3300046691 Unclassified 2083
1195 Ga0495680_0963749 3300047322 Unclassified 547
1196 Ga0495687_196894 3300047443 Unclassified 643
1197 Ga0495677_0021289 3300047445 Unclassified 2350
1198 Ga0495677_0301144 3300047445 Bacteria 631
1199 Ga0495602_0417670 3300048088 Unclassified 953
1200 Ga0496100_0096807 3300048903 Bacteria 2025
1201 Ga0496101_0023068 3300048904 Bacteria 4294
1202 Ga0496101_1605422 3300048904 Unclassified 505
1203 Ga0496107_0166859 3300048910 Unclassified 1633
1204 Ga0496108_0231364 3300048911 Bacteria 1607
1205 Ga0496108_0362431 3300048911 Unclassified 1265
1206 Ga0496108_0456533 3300048911 Unclassified 1116
1207 Ga0496108_0846647 3300048911 Unclassified 787
1208 Ga0496109_0037881 3300048912 Bacteria 4358
1209 Ga0496109_0172543 3300048912 Bacteria 2029
1210 Ga0496109_0331685 3300048912 Bacteria 1436
1211 Ga0496109_1822904 3300048912 Unclassified 541
1212 Ga0496110_0003415 3300048913 Bacteria 12149
1213 Ga0496110_0038741 3300048913 Unclassified 4149
1214 Ga0496111_0045856 3300048914 Unclassified 3146
1215 Ga0496111_0172451 3300048914 Bacteria 1607
1216 Ga0496111_0193719 3300048914 Unclassified 1511
1217 Ga0496112_0052100 3300048915 Bacteria 4016
1218 Ga0496112_0076194 3300048915 Unclassified 3317
1219 Ga0496112_0088102 3300048915 Unclassified 3072
1220 Ga0496113_0378992 3300048916 Bacteria 1135
1221 Ga0496114_0000006 3300048917 Bacteria 472921
1222 Ga0496114_0329602 3300048917 Unclassified 1349
1223 Ga0496115_0040388 3300048918 Unclassified 3709
1224 Ga0501033_0007786 3300049570 Bacteria 8299
1225 Ga0501034_0512577 3300049571 Bacteria 1112
1226 Ga0501037_0309062 3300049573 Unclassified 1096
1227 Ga0501038_0428397 3300049574 Unclassified 1020
1228 Ga0501043_0655793 3300049579 Unclassified 770
1229 Ga0501047_0083530 3300049581 Unclassified 3069
1230 Ga0501069_0297965 3300049585 Unclassified 945
1231 Ga0501202_077640 3300049652 Bacteria 775
1232 Ga0501207_008383 3300049654 Unclassified 1493
1233 Ga0501209_052778 3300049656 Bacteria 1114
1234 Ga0501209_144547 3300049656 Unclassified 714
1235 Ga0501216_082991 3300049660 Bacteria 681
1236 Ga0501216_162071 3300049660 Unclassified 537
1237 Ga0501235_001852 3300049669 Bacteria 4524
1238 Ga0501239_002286 3300049672 Unclassified 1726
1239 Ga0501240_099622 3300049673 Unclassified 558
1240 Ga0501249_004971 3300049679 Bacteria 2712
1241 Ga0501249_027414 3300049679 Unclassified 1260
1242 Ga0501257_064775 3300049686 Bacteria 927
1243 Ga0501221_009292 3300049704 Bacteria 1723
1244 Ga0501080_0755275 3300049742 Bacteria 855
1245 Ga0501232_013604 3300049757 Unclassified 965
1246 Ga0501262_003659 3300049759 Unclassified 1771
1247 Ga0501263_011872 3300049760 Unclassified 1086
1248 Ga0501270_075996 3300049767 Unclassified 659
1249 Ga0501279_026914 3300049775 Unclassified 841
1250 Ga0501035_0574197 3300049822 Unclassified 921
1251 Ga0501044_0050423 3300049823 Unclassified 4294
1252 Ga0501212_041352 3300049851 Unclassified 763
1253 Ga0500643_000008 3300053087 Bacteria 457931
1254 Ga0500556_0207686 3300053104 Bacteria 773
1255 Ga0500568_0092573 3300053139 Bacteria 1139
1256 Ga0500616_0003431 3300053153 Bacteria 12107
1257 Ga0500645_094592 3300053730 Unclassified 846
1258 Ga0590071_084186 3300059421 Bacteria 792
1259 Ga0590077_148725 3300059426 Unclassified 560
1260 Ga0466962_0079769 3300061719 Bacteria 1565
1261 Ga0157373_10579497
1262 MBSR1b_contig_3302548
1263 MBSR1b_contig_8811798
1264 JGI24741J21665_1001705
1265 JGI24741J21665_1018577
1266 JGI24741J21665_1032167
1267 JGI24740J21852_10002403
1268 JGI24740J21852_10002753
1269 JGI24740J21852_10004394
1270 JGI24740J21852_10037551
1271 JGI24739J22299_10011726
1272 JGI24739J22299_10087188
1273 JGI24737J22298_10228638
1274 JGI24735J21928_10002010
1275 JGI24735J21928_10005515
1276 JGI24735J21928_10016635
1277 JGI24738J21930_10081169
1278 JGI24738J21930_10109290
1279 JGI24744J21845_10039746
1280 JGI24033J26618_1002423
1281 JGI24034J26672_10066758
1282 JGI25406J46586_10068768
1283 rootH2_10152215
1284 rootH1_10137416
1285 rootH1_10287373
1286 rootH1_10318114
1287 Ga0065704_10703317
1288 Ga0065712_10074159
1289 Ga0065712_10457008
1290 Ga0065715_10233102
1291 Ga0065715_10804293
1292 Ga0070658_10007081
1293 Ga0070658_10014784
1294 Ga0070658_10025215
1295 Ga0070658_10027650
1296 Ga0070658_10028240
1297 Ga0070658_10039082
1298 Ga0070658_10089250
1299 Ga0070658_10094639
1300 Ga0070658_10135423
1301 Ga0070658_10262089
1302 Ga0070658_10285877
1303 Ga0070658_10337153
1304 Ga0070658_10455540
1305 Ga0070658_10504585
1306 Ga0070658_10563937
1307 Ga0070658_10657603
1308 Ga0070658_10790105
1309 Ga0070658_10829332
1310 Ga0070658_11002536
1311 Ga0070658_11188891
1312 Ga0070658_11805415
1313 Ga0070658_11826208
1314 Ga0070676_10019977
1315 Ga0070676_10111754
1316 Ga0070676_10140170
1317 Ga0070676_10361489
1318 Ga0070676_10607658
1319 Ga0070676_10721107
1320 Ga0070676_10867567
1321 Ga0070683_100002629
1322 Ga0070683_100016104
1323 Ga0070683_100020068
1324 Ga0070683_100058817
1325 Ga0070683_100310149
1326 Ga0070683_100889463
1327 Ga0070690_100005963
1328 Ga0070690_100358553
1329 Ga0070670_100000482
1330 Ga0070670_100013946
1331 Ga0070670_100021632
1332 Ga0070670_100043866
1333 Ga0070670_100068780
1334 Ga0070670_100282551
1335 Ga0070670_100464617
1336 Ga0070670_101403585
1337 Ga0070670_101677358
1338 Ga0070677_10000655
1339 Ga0070677_10002714
1340 Ga0070677_10032154
1341 Ga0068869_101288944
1342 Ga0070666_10001302
1343 Ga0070666_10025157
1344 Ga0070666_10027996
1345 Ga0070666_10044734
1346 Ga0070666_10107580
1347 Ga0070666_10184203
1348 Ga0070666_10196826
1349 Ga0070666_10991246
1350 Ga0070680_100020196
1351 Ga0070680_100035425
1352 Ga0070680_100065927
1353 Ga0070680_100067337
1354 Ga0070680_100152355
1355 Ga0070680_100260812
1356 Ga0070682_100044647
1357 Ga0070682_100307230
1358 Ga0070682_101477164
1359 Ga0070682_101490639
1360 Ga0068868_100003463
1361 Ga0068868_100079365
1362 Ga0068868_100321489
1363 Ga0068868_101145736
1364 Ga0070660_100003869
1365 Ga0070660_100006193
1366 Ga0070660_100007812
1367 Ga0070660_100011819
1368 Ga0070660_100019162
1369 Ga0070660_100029227
1370 Ga0070660_100058036
1371 Ga0070660_100084264
1372 Ga0070660_100085989
1373 Ga0070660_100116100
1374 Ga0070660_100200462
1375 Ga0070660_100211081
1376 Ga0070660_100250581
1377 Ga0070660_100349462
1378 Ga0070660_100357649
1379 Ga0070660_100404566
1380 Ga0070660_100533460
1381 Ga0070660_101201879
1382 Ga0070660_101380024
1383 Ga0070691_10008688
1384 Ga0070687_100255805
1385 Ga0070687_100574639
1386 Ga0070687_100777092
1387 Ga0070661_100002823
1388 Ga0070661_100003992
1389 Ga0070661_100005291
1390 Ga0070661_100145097
1391 Ga0070661_100230052
1392 Ga0070661_100333460
1393 Ga0070661_100524477
1394 Ga0070661_100605005
1395 Ga0070661_100641574
1396 Ga0070661_101708227
1397 Ga0070692_10020700
1398 Ga0070668_100153482
1399 Ga0070668_100246367
1400 Ga0070668_100398534
1401 Ga0070668_100775332
1402 Ga0070669_100026431
1403 Ga0070669_100057008
1404 Ga0070669_100319587
1405 Ga0070669_100417486
1406 Ga0070669_100760040
1407 Ga0070669_101380266
1408 Ga0070675_100000877
1409 Ga0070675_100002093
1410 Ga0070675_100002962
1411 Ga0070675_100055132
1412 Ga0070675_100506091
1413 Ga0070675_100938849
1414 Ga0070671_100000585
1415 Ga0070671_100001443
1416 Ga0070671_100003827
1417 Ga0070671_100037502
1418 Ga0070671_100045653
1419 Ga0070671_100198879
1420 Ga0070671_100414843
1421 Ga0070671_100788285
1422 Ga0070671_101313595
1423 Ga0070674_100018915
1424 Ga0070674_100027807
1425 Ga0070674_100088954
1426 Ga0070674_100186414
1427 Ga0070674_100202907
1428 Ga0070674_100586954
1429 Ga0070673_100002199
1430 Ga0070673_100004985
1431 Ga0070673_100100294
1432 Ga0070673_100169667
1433 Ga0070673_100280464
1434 Ga0070673_100289168
1435 Ga0070673_100526690
1436 Ga0070673_100741086
1437 Ga0070688_100209641
1438 Ga0070688_100932801
1439 Ga0070659_100007018
1440 Ga0070659_100009371
1441 Ga0070659_100012487
1442 Ga0070659_100149201
1443 Ga0070659_100201016
1444 Ga0070659_100204822
1445 Ga0070659_100297752
1446 Ga0070659_100389812
1447 Ga0070659_100436863
1448 Ga0070659_100495630
1449 Ga0070659_100743518
1450 Ga0070659_100904091
1451 Ga0070667_100003311
1452 Ga0070667_100011143
1453 Ga0070667_100081475
1454 Ga0070667_100148128
1455 Ga0070667_100226411
1456 Ga0070667_101995516
1457 Ga0070709_11446384
1458 Ga0070714_100002190
1459 Ga0070714_100156329
1460 Ga0070714_100522566
1461 Ga0070713_100123284
1462 Ga0070713_100182722
1463 Ga0070710_10709972
1464 Ga0070663_100013674
1465 Ga0070663_100029040
1466 Ga0070663_100030458
1467 Ga0070663_100060216
1468 Ga0070663_100158790
1469 Ga0070663_100381878
1470 Ga0070663_100389397
1471 Ga0070663_100600895
1472 Ga0070663_101114702
1473 Ga0070678_100011216
1474 Ga0070678_100036951
1475 Ga0070678_100061154
1476 Ga0070678_100085251
1477 Ga0070678_100129322
1478 Ga0070662_100002711
1479 Ga0070662_100012833
1480 Ga0070662_100036289
1481 Ga0070662_100037197
1482 Ga0070662_100040541
1483 Ga0070662_100057498
1484 Ga0070662_100064145
1485 Ga0070662_100072696
1486 Ga0070662_100083530
1487 Ga0070662_100431494
1488 Ga0070662_100518413
1489 Ga0070662_100950230
1490 Ga0070681_10078161
1491 Ga0070681_10080144
1492 Ga0070681_10595551
1493 Ga0070681_10887088
1494 Ga0068867_100024122
1495 Ga0070685_10123203
1496 Ga0070679_100008241
1497 Ga0070679_100042382
1498 Ga0070679_100112132
1499 Ga0070679_100251990
1500 Ga0070679_100348106
1501 Ga0070679_101511352
1502 Ga0070684_100004092
1503 Ga0070684_100010106
1504 Ga0070684_102036218
1505 Ga0068853_100027959
1506 Ga0068853_100038172
1507 Ga0068853_100060076
1508 Ga0068853_100193223
1509 Ga0068853_100232433
1510 Ga0068853_100345729
1511 Ga0068853_100464042
1512 Ga0068853_100552289
1513 Ga0070672_100001022
1514 Ga0070672_100031012
1515 Ga0070672_100117629
1516 Ga0070672_100195481
1517 Ga0070672_100280164
1518 Ga0070672_101200708
1519 Ga0070672_101311295
1520 Ga0070672_101706427
1521 Ga0070686_100028862
1522 Ga0070686_101840102
1523 Ga0070693_100678160
1524 Ga0070665_100001865
1525 Ga0070665_100028113
1526 Ga0070665_100032641
1527 Ga0070665_100087241
1528 Ga0070665_100583356
1529 Ga0068855_100005824
1530 Ga0068855_100006659
1531 Ga0068855_100014977
1532 Ga0068855_100017060
1533 Ga0068855_100019199
1534 Ga0068855_100030983
1535 Ga0068855_100153618
1536 Ga0068855_100199319
1537 Ga0068855_100827417
1538 Ga0068855_102186743
1539 Ga0070664_100000161
1540 Ga0070664_100011435
1541 Ga0070664_100012603
1542 Ga0070664_100025357
1543 Ga0070664_100027281
1544 Ga0070664_100033439
1545 Ga0070664_100035666
1546 Ga0070664_100040030
1547 Ga0070664_100079788
1548 Ga0070664_100086527
1549 Ga0070664_100139337
1550 Ga0070664_100324564
1551 Ga0070664_101415136
1552 Ga0068857_100038222
1553 Ga0068857_100112004
1554 Ga0068857_100565073
1555 Ga0068857_100742428
1556 Ga0068857_100991465
1557 Ga0068857_101404784
1558 Ga0068857_101896344
1559 Ga0068857_102535135
1560 Ga0068854_100005714
1561 Ga0068854_100012828
1562 Ga0068854_100029291
1563 Ga0068854_100056333
1564 Ga0068854_100098300
1565 Ga0068854_100102309
1566 Ga0068854_100318604
1567 Ga0068854_100377526
1568 Ga0068854_100421048
1569 Ga0068854_100694711
1570 Ga0068854_100714767
1571 Ga0068854_100995084
1572 Ga0068854_102012318
1573 Ga0068856_100010684
1574 Ga0068856_100023749
1575 Ga0068856_100069827
1576 Ga0068856_100086906
1577 Ga0068856_100122888
1578 Ga0068856_100294342
1579 Ga0068856_100313488
1580 Ga0068856_100660129
1581 Ga0068856_100973202
1582 Ga0068856_102141843
1583 Ga0068852_100007810
1584 Ga0068852_100037574
1585 Ga0068852_100310345
1586 Ga0068852_100340190
1587 Ga0068852_100383304
1588 Ga0068852_100595345
1589 Ga0068852_100601875
1590 Ga0068852_100610103
1591 Ga0068852_100701692
1592 Ga0068852_100766724
1593 Ga0068864_100048368
1594 Ga0068864_100055197
1595 Ga0068864_100107289
1596 Ga0068864_100134729
1597 Ga0068864_100210423
1598 Ga0068866_10014997
1599 Ga0068866_11128671
1600 Ga0068861_102209833
1601 Ga0068851_10008666
1602 Ga0068851_10293038
1603 Ga0068851_10474672
1604 Ga0068851_10996528
1605 Ga0068870_10066866
1606 Ga0068870_10147998
1607 Ga0068863_100068000
1608 Ga0068863_100265535
1609 Ga0068863_101193801
1610 Ga0068858_100028249
1611 Ga0068858_100070725
1612 Ga0068858_100096630
1613 Ga0068860_100235618
1614 Ga0068860_102573477
1615 Ga0068862_100013008
1616 Ga0068862_101925253
1617 Ga0068862_102205946
1618 Ga0081539_10017819
1619 Ga0081539_10101652
1620 Ga0070717_10168661
1621 Ga0070716_100433488
1622 Ga0097621_100013198
1623 Ga0097621_100030868
1624 Ga0097621_100142185
1625 Ga0097621_101949070
1626 Ga0075370_10092536
1627 Ga0068871_100156692
1628 Ga0068871_101915736
1629 Ga0068865_100010945
1630 Ga0068865_100561897
1631 Ga0105240_10007329
1632 Ga0105240_10035738
1633 Ga0105240_10089677
1634 Ga0105240_10154718
1635 Ga0105240_10180308
1636 Ga0105240_10285403
1637 Ga0105240_10656568
1638 Ga0105240_10887209
1639 Ga0105240_11019602
1640 Ga0105240_11676647
1641 Ga0105245_10006582
1642 Ga0105245_10131844
1643 Ga0105243_10578656
1644 Ga0105241_10060359
1645 Ga0105241_10080050
1646 Ga0105241_10113178
1647 Ga0105241_10229420
1648 Ga0105241_10796755
1649 Ga0105241_11194130
1650 Ga0105242_10462264
1651 Ga0105248_10000864
1652 Ga0105248_10001731
1653 Ga0105248_10002120
1654 Ga0105248_10021840
1655 Ga0105248_10030620
1656 Ga0105248_10079884
1657 Ga0105248_10082992
1658 Ga0105248_10828402
1659 Ga0105248_12700656
1660 Ga0105237_10013112
1661 Ga0105237_10042170
1662 Ga0105237_10209755
1663 Ga0105237_10354299
1664 Ga0105238_10013299
1665 Ga0105238_10089551
1666 Ga0105238_10093369
1667 Ga0105238_10193517
1668 Ga0105238_10259665
1669 Ga0105238_10615945
1670 Ga0105238_11063869
1671 Ga0105238_12794189
1672 Ga0105239_10042499
1673 Ga0105239_10062032
1674 Ga0105239_10335496
1675 Ga0105239_11178768
1676 Ga0105239_12621882
1677 Ga0105246_11305892
1678 Ga0105246_11542445
1679 Ga0157327_1031828
1680 Ga0157373_10004072
1681 Ga0157373_10025010
1682 Ga0157373_10032853
1683 Ga0157373_10108143
1684 Ga0157373_10108334
1685 Ga0157373_11116607
1686 Ga0157373_11489794
1687 Ga0157371_10008598
1688 Ga0157371_10021331
1689 Ga0157371_10075192
1690 Ga0157371_10110816
1691 Ga0157371_10192956
1692 Ga0157371_10274329
1693 Ga0157371_10466016
1694 Ga0157371_10652844
1695 Ga0157371_11127438
1696 Ga0157371_11130328
1697 Ga0157371_11480414
1698 Ga0157370_10022730
1699 Ga0157370_10029233
1700 Ga0157370_10046619
1701 Ga0157370_10077871
1702 Ga0157370_10127572
1703 Ga0157370_11493376
1704 Ga0157369_10002126
1705 Ga0157369_10046305
1706 Ga0157369_10071353
1707 Ga0157369_10103523
1708 Ga0157369_10146583
1709 Ga0157369_10210256
1710 Ga0157369_10409536
1711 Ga0157369_10429264
1712 Ga0157369_10433642
1713 Ga0157369_10504388
1714 Ga0157369_10915450
1715 Ga0157369_11485173
1716 Ga0157369_12521741
1717 Ga0157374_10002028
1718 Ga0157374_10004774
1719 Ga0157374_10024050
1720 Ga0157374_10057816
1721 Ga0157374_10155157
1722 Ga0157374_10826482
1723 Ga0157374_11076011
1724 Ga0157374_12428840
1725 Ga0157378_10036398
1726 Ga0157378_10090576
1727 Ga0163162_10025893
1728 Ga0163162_10066915
1729 Ga0163162_10539646
1730 Ga0163162_11027206
1731 Ga0163162_13041912
1732 Ga0157372_10001798
1733 Ga0157372_10012759
1734 Ga0157372_10099622
1735 Ga0157372_10630340
1736 Ga0157372_10774827
1737 Ga0157372_10817891
1738 Ga0157372_11041598
1739 Ga0157372_11256231
1740 Ga0157372_11816624
1741 Ga0157372_11846839
1742 Ga0157372_12002374
1743 Ga0157372_12081974
1744 Ga0157375_10011719
1745 Ga0157375_10108944
1746 Ga0157375_10221272
1747 Ga0157375_10347590
1748 Ga0157375_11201673
1749 Ga0163163_10074390
1750 Ga0163163_10676210
1751 Ga0157380_10007497
1752 Ga0157380_11764076
1753 Ga0157380_12527150
1754 Ga0182008_10351042
1755 Ga0182008_10546518
1756 Ga0157377_10271907
1757 Ga0157377_10702284
1758 Ga0157379_10041194
1759 Ga0157379_10483332
1760 Ga0157376_11241678
1761 Ga0163161_10118710
1762 Ga0163161_10415265
1763 Ga0163161_11647803
1764 Ga0207697_10012516
1765 Ga0207697_10045168
1766 Ga0207697_10089469
1767 Ga0207697_10499895
1768 Ga0207656_10021640
1769 Ga0207656_10087368
1770 Ga0207656_10483109
1771 Ga0207682_10001230
1772 Ga0207682_10007931
1773 Ga0207682_10068272
1774 Ga0207642_10855423
1775 Ga0207688_10147199
1776 Ga0207688_10238143
1777 Ga0207688_10851529
1778 Ga0207680_10000843
1779 Ga0207680_10016580
1780 Ga0207680_10032318
1781 Ga0207680_10044499
1782 Ga0207680_10095562
1783 Ga0207680_11020729
1784 Ga0207647_10000652
1785 Ga0207647_10000953
1786 Ga0207647_10008914
1787 Ga0207647_10023651
1788 Ga0207647_10058917
1789 Ga0207647_10396093
1790 Ga0207699_10393274
1791 Ga0207645_10133599
1792 Ga0207645_10301283
1793 Ga0207645_10427540
1794 Ga0207645_10628190
1795 Ga0207643_10335423
1796 Ga0207705_10002169
1797 Ga0207705_10002376
1798 Ga0207705_10004357
1799 Ga0207705_10005306
1800 Ga0207705_10013606
1801 Ga0207705_10020054
1802 Ga0207705_10025714
1803 Ga0207705_10034432
1804 Ga0207705_10077537
1805 Ga0207705_10106569
1806 Ga0207705_10136260
1807 Ga0207705_10158997
1808 Ga0207705_10170369
1809 Ga0207705_10272363
1810 Ga0207705_10617693
1811 Ga0207705_10711469
1812 Ga0207705_10718704
1813 Ga0207705_10797406
1814 Ga0207654_10085871
1815 Ga0207654_10124014
1816 Ga0207654_10265092
1817 Ga0207654_10511632
1818 Ga0207707_10060239
1819 Ga0207707_10147684
1820 Ga0207707_10363576
1821 Ga0207707_10832342
1822 Ga0207707_11006606
1823 Ga0207695_10003885
1824 Ga0207695_10025814
1825 Ga0207695_10104104
1826 Ga0207695_10148138
1827 Ga0207695_10354453
1828 Ga0207695_10577047
1829 Ga0207695_11244673
1830 Ga0207695_11271890
1831 Ga0207671_10044197
1832 Ga0207671_10190695
1833 Ga0207671_10274523
1834 Ga0207671_10771793
1835 Ga0207693_10243812
1836 Ga0207660_10018117
1837 Ga0207660_10049838
1838 Ga0207660_10127398
1839 Ga0207660_10188865
1840 Ga0207660_10401201
1841 Ga0207660_10444678
1842 Ga0207662_10186164
1843 Ga0207662_10942420
1844 Ga0207657_10004145
1845 Ga0207657_10007353
1846 Ga0207657_10007984
1847 Ga0207657_10017538
1848 Ga0207657_10019117
1849 Ga0207657_10032686
1850 Ga0207657_10034506
1851 Ga0207657_10088734
1852 Ga0207657_10112994
1853 Ga0207657_10149655
1854 Ga0207657_10192117
1855 Ga0207657_10197517
1856 Ga0207657_10313620
1857 Ga0207657_10496921
1858 Ga0207657_10568831
1859 Ga0207657_10571386
1860 Ga0207649_10002353
1861 Ga0207649_10142148
1862 Ga0207649_10143038
1863 Ga0207649_10254084
1864 Ga0207649_10473279
1865 Ga0207649_10561696
1866 Ga0207649_10567596
1867 Ga0207649_10783070
1868 Ga0207649_10960406
1869 Ga0207649_11137797
1870 Ga0207649_11270236
1871 Ga0207652_10010377
1872 Ga0207652_10041592
1873 Ga0207652_10041801
1874 Ga0207652_10413623
1875 Ga0207681_10018237
1876 Ga0207681_10067967
1877 Ga0207681_10110061
1878 Ga0207681_10304359
1879 Ga0207681_10861736
1880 Ga0207694_10066176
1881 Ga0207694_10137148
1882 Ga0207694_10228626
1883 Ga0207694_10309723
1884 Ga0207694_10352310
1885 Ga0207694_10783744
1886 Ga0207694_11018332
1887 Ga0207650_10003792
1888 Ga0207650_10011538
1889 Ga0207650_10051214
1890 Ga0207650_10122032
1891 Ga0207650_10235009
1892 Ga0207650_10360608
1893 Ga0207650_10752773
1894 Ga0207659_10001593
1895 Ga0207659_10003287
1896 Ga0207659_10032465
1897 Ga0207659_10200693
1898 Ga0207687_10036959
1899 Ga0207687_10848187
1900 Ga0207700_10803648
1901 Ga0207664_10100493
1902 Ga0207664_10173347
1903 Ga0207664_10368641
1904 Ga0207664_10852238
1905 Ga0207644_10000110
1906 Ga0207644_10002765
1907 Ga0207644_10003194
1908 Ga0207644_10039149
1909 Ga0207644_10054894
1910 Ga0207644_10127923
1911 Ga0207644_10193081
1912 Ga0207644_10567626
1913 Ga0207644_11284047
1914 Ga0207690_10002722
1915 Ga0207690_10003887
1916 Ga0207690_10016417
1917 Ga0207690_10029863
1918 Ga0207690_10037846
1919 Ga0207690_10074186
1920 Ga0207690_10075092
1921 Ga0207690_10144553
1922 Ga0207690_10569438
1923 Ga0207690_10667564
1924 Ga0207690_10770253
1925 Ga0207690_10781415
1926 Ga0207690_10989438
1927 Ga0207706_10004761
1928 Ga0207706_10009871
1929 Ga0207706_10012365
1930 Ga0207706_10014818
1931 Ga0207706_10019367
1932 Ga0207706_10032192
1933 Ga0207706_10034788
1934 Ga0207706_10047655
1935 Ga0207706_10083056
1936 Ga0207706_10113880
1937 Ga0207706_10306961
1938 Ga0207706_10530432
1939 Ga0207686_10444342
1940 Ga0207669_10033950
1941 Ga0207669_10038283
1942 Ga0207669_10070291
1943 Ga0207669_10765486
1944 Ga0207669_11352899
1945 Ga0207669_11422892
1946 Ga0207704_10024242
1947 Ga0207704_10037485
1948 Ga0207665_10479873
1949 Ga0207691_10022111
1950 Ga0207691_10022416
1951 Ga0207691_10050820
1952 Ga0207691_10072823
1953 Ga0207691_10157751
1954 Ga0207691_10310303
1955 Ga0207691_10532847
1956 Ga0207691_10702394
1957 Ga0207691_10745571
1958 Ga0207691_11733841
1959 Ga0207711_10001548
1960 Ga0207711_10005517
1961 Ga0207711_10014822
1962 Ga0207711_10042595
1963 Ga0207711_10389684
1964 Ga0207711_10441872
1965 Ga0207711_10664495
1966 Ga0207661_10001486
1967 Ga0207661_10055571
1968 Ga0207661_10130596
1969 Ga0207661_10623629
1970 Ga0207679_10024893
1971 Ga0207679_10038329
1972 Ga0207679_10040138
1973 Ga0207679_10054031
1974 Ga0207679_10065791
1975 Ga0207679_10125806
1976 Ga0207679_10129361
1977 Ga0207679_10404071
1978 Ga0207679_10836391
1979 Ga0207679_10945356
1980 Ga0207679_11246801
1981 Ga0207679_11340108
1982 Ga0207679_12143552
1983 Ga0207667_10004629
1984 Ga0207667_10005094
1985 Ga0207667_10005521
1986 Ga0207667_10012704
1987 Ga0207667_10034059
1988 Ga0207667_10128631
1989 Ga0207667_10182001
1990 Ga0207667_10261591
1991 Ga0207667_10304220
1992 Ga0207667_11395191
1993 Ga0207651_10002266
1994 Ga0207651_10008091
1995 Ga0207651_10035123
1996 Ga0207651_10084260
1997 Ga0207651_10663112
1998 Ga0207651_10708872
1999 Ga0207651_11466213
2000 Ga0207668_10145843
2001 Ga0207668_10299866
2002 Ga0207668_10353521
2003 Ga0207668_10573723
2004 Ga0207668_12103968
2005 Ga0207640_10018770
2006 Ga0207640_10051287
2007 Ga0207640_10051945
2008 Ga0207640_10060038
2009 Ga0207640_10081168
2010 Ga0207640_10221142
2011 Ga0207640_10352606
2012 Ga0207640_10439439
2013 Ga0207640_11108509
2014 Ga0207658_10002182
2015 Ga0207658_10067481
2016 Ga0207658_10119661
2017 Ga0207658_10304657
2018 Ga0207658_11279023
2019 Ga0207658_11501120
2020 Ga0207677_10022272
2021 Ga0207677_10080550
2022 Ga0207677_10262959
2023 Ga0207677_10892843
2024 Ga0207677_11070677
2025 Ga0207703_10003041
2026 Ga0207703_10091420
2027 Ga0207639_10015848
2028 Ga0207639_10112796
2029 Ga0207639_10199104
2030 Ga0207639_10561876
2031 Ga0207639_10804321
2032 Ga0207639_11014851
2033 Ga0207639_11229069
2034 Ga0207678_10003264
2035 Ga0207678_10007874
2036 Ga0207678_10043699
2037 Ga0207678_10043857
2038 Ga0207678_10045372
2039 Ga0207678_10165052
2040 Ga0207678_10202659
2041 Ga0207678_10897148
2042 Ga0207678_10944390
2043 Ga0207708_10330176
2044 Ga0207702_10005931
2045 Ga0207702_10019425
2046 Ga0207702_10028283
2047 Ga0207702_10057850
2048 Ga0207702_10399174
2049 Ga0207702_10498285
2050 Ga0207702_10749986
2051 Ga0207702_11086882
2052 Ga0207702_11490335
2053 Ga0207702_11603136
2054 Ga0207702_12037067
2055 Ga0207641_10047089
2056 Ga0207641_10231936
2057 Ga0207641_10694208
2058 Ga0207648_10113898
2059 Ga0207648_10962750
2060 Ga0207676_10007954
2061 Ga0207676_10029636
2062 Ga0207676_10425382
2063 Ga0207676_10578554
2064 Ga0207674_10002992
2065 Ga0207674_10006901
2066 Ga0207674_10007460
2067 Ga0207674_10089833
2068 Ga0207674_10139885
2069 Ga0207674_10204176
2070 Ga0207674_10291925
2071 Ga0207674_10630182
2072 Ga0207674_10732962
2073 Ga0207675_101285357
2074 Ga0207683_10002536
2075 Ga0207683_10014754
2076 Ga0207683_10021162
2077 Ga0207683_10116927
2078 Ga0207683_10237416
2079 Ga0207683_10251601
2080 Ga0207698_10004870
2081 Ga0207698_10007964
2082 Ga0207698_10083860
2083 Ga0207698_10194732
2084 Ga0207698_10464781
2085 Ga0207698_10514293
2086 Ga0207698_10523119
2087 Ga0207698_10555414
2088 Ga0207698_10595876
2089 Ga0207698_10718565
2090 Ga0207698_10817923
2091 Ga0207698_10881322
2092 Ga0207698_11405912
2093 Ga0207698_11541493
2094 Ga0207698_12502896
2095 Ga0209983_1080621
2096 Ga0209971_1151775
2097 Ga0209974_10027288
2098 Ga0268266_10074634
2099 Ga0268266_10078254
2100 Ga0268266_10137132
2101 Ga0268266_10494576
2102 Ga0268265_10255037
2103 Ga0268265_11686756
2104 Ga0268264_10136842
2105 Ga0268264_11941799
2106 Ga0265338_10436948
2107 Ga0316182_1322975
2108 Ga0265339_10135005
2109 Ga0265316_10171239
2110 Ga0307408_100005547
2111 Ga0307408_100039022
2112 Ga0307408_100055763
2113 Ga0307408_100063445
2114 Ga0307408_100150625
2115 Ga0307408_100215759
2116 Ga0307408_100672391
2117 Ga0307408_101034771
2118 Ga0307408_101088740
2119 Ga0307408_101474684
2120 Ga0307408_101829045
2121 Ga0307405_10009275
2122 Ga0307405_10020576
2123 Ga0307405_10030471
2124 Ga0307405_10081898
2125 Ga0307405_10159774
2126 Ga0307405_10460912
2127 Ga0307405_10828057
2128 Ga0307405_11013064
2129 Ga0307405_11724838
2130 Ga0307405_11873184
2131 Ga0307413_10020129
2132 Ga0307413_10028933
2133 Ga0307413_10047089
2134 Ga0307413_10103921
2135 Ga0307413_10126567
2136 Ga0307413_10318179
2137 Ga0307413_10341626
2138 Ga0307413_10587183
2139 Ga0307413_10711187
2140 Ga0307410_10001568
2141 Ga0307410_10011884
2142 Ga0307410_10018254
2143 Ga0307410_10025365
2144 Ga0307410_10044486
2145 Ga0307410_10156468
2146 Ga0307410_10180811
2147 Ga0307410_10344942
2148 Ga0307410_11232592
2149 Ga0307410_11810211
2150 Ga0326468_10025345
2151 Ga0307406_10021903
2152 Ga0307406_10052039
2153 Ga0307406_10101412
2154 Ga0307406_10159369
2155 Ga0307406_10200298
2156 Ga0307406_10619401
2157 Ga0307406_10667324
2158 Ga0307406_10763084
2159 Ga0307407_10002341
2160 Ga0307407_10003187
2161 Ga0307407_10080043
2162 Ga0307407_10179170
2163 Ga0307407_10278766
2164 Ga0307407_10317988
2165 Ga0307407_10420475
2166 Ga0307407_10688881
2167 Ga0307407_10773385
2168 Ga0307412_10008883
2169 Ga0307412_10063658
2170 Ga0307412_10066033
2171 Ga0307412_10092627
2172 Ga0307412_10110723
2173 Ga0307412_10175878
2174 Ga0307412_10190467
2175 Ga0307412_10367095
2176 Ga0307412_10606972
2177 Ga0307412_10782994
2178 Ga0307412_10844219
2179 Ga0307412_11755316
2180 Ga0307409_100004859
2181 Ga0307409_100007942
2182 Ga0307409_100016188
2183 Ga0307409_100033400
2184 Ga0307409_100108881
2185 Ga0307409_100121297
2186 Ga0307409_100137083
2187 Ga0307409_100178720
2188 Ga0307409_100340576
2189 Ga0307409_100797773
2190 Ga0307409_100988614
2191 Ga0307409_101404400
2192 Ga0307416_100005056
2193 Ga0307416_100008626
2194 Ga0307416_100009112
2195 Ga0307416_100023233
2196 Ga0307416_100054225
2197 Ga0307416_100079034
2198 Ga0307416_100145705
2199 Ga0307416_100161728
2200 Ga0307416_100372770
2201 Ga0307416_100443931
2202 Ga0307416_100475550
2203 Ga0307416_100521990
2204 Ga0307416_100641203
2205 Ga0307416_100968289
2206 Ga0307416_100970226
2207 Ga0307416_102435801
2208 Ga0307414_10007981
2209 Ga0307414_10026446
2210 Ga0307414_10071441
2211 Ga0307414_10083573
2212 Ga0307414_10250593
2213 Ga0307414_10427765
2214 Ga0307414_10453661
2215 Ga0307414_10522523
2216 Ga0307414_10895573
2217 Ga0307414_11066125
2218 Ga0307414_11113119
2219 Ga0307414_11131863
2220 Ga0307414_11345458
2221 Ga0307414_11557633
2222 Ga0307411_10003367
2223 Ga0307411_10005225
2224 Ga0307411_10015557
2225 Ga0307411_10027219
2226 Ga0307411_10074530
2227 Ga0307411_10112517
2228 Ga0307411_10181216
2229 Ga0307411_10289444
2230 Ga0307411_10442295
2231 Ga0307411_10891694
2232 Ga0307411_10919008
2233 Ga0307411_11319163
2234 Ga0307411_11500223
2235 Ga0307415_100006068
2236 Ga0307415_100008308
2237 Ga0307415_100009900
2238 Ga0307415_100012346
2239 Ga0307415_100018520
2240 Ga0307415_100022724
2241 Ga0307415_100050004
2242 Ga0307415_100079700
2243 Ga0307415_100122117
2244 Ga0373933_0865287
2245 Ga0395899_0000274
2246 Ga0395899_0002381
2247 Ga0395899_0012400
2248 Ga0395899_0014700
2249 Ga0395899_0045490
2250 Ga0395899_0054314
2251 Ga0395899_0063719
2252 Ga0395899_0079007
2253 Ga0395899_0147584
2254 Ga0395899_0191971
2255 Ga0395899_0274081
2256 Ga0395899_0282706
2257 Ga0395899_0310779
2258 Ga0395899_0486468
2259 Ga0395899_0598541
2260 Ga0395899_0613657
2261 Ga0395899_0623125
2262 Ga0395899_0990106
2263 Ga0395900_0000595
2264 Ga0395900_0004150
2265 Ga0395900_0009492
2266 Ga0395900_0021697
2267 Ga0395900_0032009
2268 Ga0395900_0051312
2269 Ga0395900_0061474
2270 Ga0395900_0069099
2271 Ga0395900_0089208
2272 Ga0395900_0094415
2273 Ga0395900_0112993
2274 Ga0395900_0128824
2275 Ga0395900_0132958
2276 Ga0395900_0166847
2277 Ga0395900_0203915
2278 Ga0395900_0227571
2279 Ga0395900_0261101
2280 Ga0395900_0299401
2281 Ga0395900_0314767
2282 Ga0395900_0331042
2283 Ga0395900_0371279
2284 Ga0395900_0373622
2285 Ga0395900_0395668
2286 Ga0395900_0421488
2287 Ga0395900_0486684
2288 Ga0395900_0573213
2289 Ga0395900_0594178
2290 Ga0395900_0635141
2291 Ga0395900_0650941
2292 Ga0395900_0810782
2293 Ga0395900_0878936
2294 Ga0395900_0996329
2295 Ga0395900_1280108
2296 Ga0395900_1611493
2297 Ga0395900_1631453
2298 Ga0395900_1658055
2299 Ga0395900_1662829
2300 Ga0395898_0005114
2301 Ga0395898_0006829
2302 Ga0395898_0017744
2303 Ga0395898_0020380
2304 Ga0395898_0024914
2305 Ga0395898_0026720
2306 Ga0395898_0034810
2307 Ga0395898_0055067
2308 Ga0395898_0062738
2309 Ga0395898_0064370
2310 Ga0395898_0127100
2311 Ga0395898_0161732
2312 Ga0395898_0205883
2313 Ga0395898_0242652
2314 Ga0395898_0288722
2315 Ga0395898_0827875
2316 Ga0395898_1043458
2317 Ga0395898_1106341
2318 Ga0395898_1768746
2319 Ga0395898_1795613
2320 Ga0395905_0000575
2321 Ga0395905_0002328
2322 Ga0395905_0003746
2323 Ga0395905_0006198
2324 Ga0395905_0010952
2325 Ga0395905_0011179
2326 Ga0395905_0020706
2327 Ga0395905_0023907
2328 Ga0395905_0025512
2329 Ga0395905_0031595
2330 Ga0395905_0034430
2331 Ga0395905_0036398
2332 Ga0395905_0045310
2333 Ga0395905_0055245
2334 Ga0395905_0064924
2335 Ga0395905_0091485
2336 Ga0395905_0111933
2337 Ga0395905_0121272
2338 Ga0395905_0129395
2339 Ga0395905_0137976
2340 Ga0395905_0184151
2341 Ga0395905_0224309
2342 Ga0395905_0234800
2343 Ga0395905_0268877
2344 Ga0395905_0309714
2345 Ga0395905_0380127
2346 Ga0395905_0439830
2347 Ga0395905_0532218
2348 Ga0395905_0567976
2349 Ga0395905_1080686
2350 Ga0395905_1403264
2351 Ga0395905_1703258
2352 Ga0395901_0001391
2353 Ga0395901_0003881
2354 Ga0395901_0004508
2355 Ga0395901_0005012
2356 Ga0395901_0005682
2357 Ga0395901_0014443
2358 Ga0395901_0023949
2359 Ga0395901_0031335
2360 Ga0395901_0034344
2361 Ga0395901_0034381
2362 Ga0395901_0036892
2363 Ga0395901_0037861
2364 Ga0395901_0116974
2365 Ga0395901_0132967
2366 Ga0395901_0219510
2367 Ga0395901_0309422
2368 Ga0395901_0396393
2369 Ga0395901_0437559
2370 Ga0395901_0555126
2371 Ga0395901_0574277
2372 Ga0395901_0623278
2373 Ga0395901_0634961
2374 Ga0395901_0659236
2375 Ga0395901_0831040
2376 Ga0395901_0878926
2377 Ga0395901_1144632
2378 Ga0395901_1250855
2379 Ga0395901_1262653
2380 Ga0395901_1468921
2381 Ga0395901_1721376
2382 Ga0436365_0736792
2383 Ga0436365_0774065
2384 Ga0436363_0542870
2385 Ga0436362_0401320
2386 Ga0451798_0883369
2387 Ga0451845_0093183
2388 Ga0439445_0109023
2389 Ga0439448_0003296
2390 Ga0439448_0352572
2391 Ga0439432_123679
2392 Ga0439449_0105076
2393 Ga0439452_139586
2394 Ga0439455_0129337
2395 Ga0450920_014143
2396 Ga0439458_0000082
2397 Ga0466972_0042978
2398 Ga0466972_0361720
2399 Ga0466965_0774859
2400 Ga0466966_0045888
2401 Ga0466966_0226970
2402 Ga0466966_0591890
2403 Ga0466961_0032451
2404 Ga0466961_0122345
2405 Ga0466961_0564414
2406 Ga0466963_0191332
2407 Ga0466963_0202006
2408 Ga0466963_0304280
2409 Ga0466963_0320705
2410 Ga0466963_0492386
2411 Ga0453684_0973996
2412 Ga0466971_0012442
2413 Ga0466971_0350897
2414 Ga0466970_0037992
2415 Ga0466970_0354545
2416 Ga0466970_0629636
2417 Ga0466957_0019065
2418 Ga0466957_0469993
2419 Ga0466957_0754840
2420 Ga0466957_0979015
2421 Ga0466957_1147276
2422 Ga0466957_1254086
2423 Ga0466960_0070364
2424 Ga0466959_0007425
2425 Ga0466959_0031930
2426 Ga0466959_0303826
2427 Ga0466959_0700351
2428 Ga0466959_0781340
2429 Ga0466959_0974987
2430 Ga0466958_0014628
2431 Ga0466958_0066871
2432 Ga0466958_0190920
2433 Ga0466958_0225463
2434 Ga0466958_0284637
2435 Ga0466958_0324106
2436 Ga0466967_0132311
2437 Ga0466967_0139830
2438 Ga0466967_0180776
2439 Ga0466967_2088876
2440 Ga0495580_0733381
2441 Ga0495585_0330632
2442 Ga0495620_0051741
2443 Ga0495643_0035553
2444 Ga0495663_0066716
2445 Ga0495598_0144965
2446 Ga0495598_0300676
2447 Ga0495621_0014694
2448 Ga0495597_0229925
2449 Ga0495633_0304744
2450 Ga0495668_0024802
2451 Ga0495669_0001241
2452 Ga0495669_0010849
2453 Ga0495669_0533461
2454 Ga0495670_0050424
2455 Ga0495680_0963749
2456 Ga0495687_196894
2457 Ga0495677_0021289
2458 Ga0495677_0301144
2459 Ga0495602_0417670
2460 Ga0496100_0096807
2461 Ga0496101_0023068
2462 Ga0496101_1605422
2463 Ga0496107_0166859
2464 Ga0496108_0231364
2465 Ga0496108_0362431
2466 Ga0496108_0456533
2467 Ga0496108_0846647
2468 Ga0496109_0037881
2469 Ga0496109_0172543
2470 Ga0496109_0331685
2471 Ga0496109_1822904
2472 Ga0496110_0003415
2473 Ga0496110_0038741
2474 Ga0496111_0045856
2475 Ga0496111_0172451
2476 Ga0496111_0193719
2477 Ga0496112_0052100
2478 Ga0496112_0076194
2479 Ga0496112_0088102
2480 Ga0496113_0378992
2481 Ga0496114_0000006
2482 Ga0496114_0329602
2483 Ga0496115_0040388
2484 Ga0501033_0007786
2485 Ga0501034_0512577
2486 Ga0501037_0309062
2487 Ga0501038_0428397
2488 Ga0501043_0655793
2489 Ga0501047_0083530
2490 Ga0501069_0297965
2491 Ga0501202_077640
2492 Ga0501207_008383
2493 Ga0501209_052778
2494 Ga0501209_144547
2495 Ga0501216_082991
2496 Ga0501216_162071
2497 Ga0501235_001852
2498 Ga0501239_002286
2499 Ga0501240_099622
2500 Ga0501249_004971
2501 Ga0501249_027414
2502 Ga0501257_064775
2503 Ga0501221_009292
2504 Ga0501080_0755275
2505 Ga0501232_013604
2506 Ga0501262_003659
2507 Ga0501263_011872
2508 Ga0501270_075996
2509 Ga0501279_026914
2510 Ga0501035_0574197
2511 Ga0501044_0050423
2512 Ga0501212_041352
2513 Ga0500643_000008
2514 Ga0500556_0207686
2515 Ga0500568_0092573
2516 Ga0500616_0003431
2517 Ga0500645_094592
2518 Ga0590071_084186
2519 Ga0590077_148725
2520 Ga0466962_0079769

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i08-assembly1.cif.gz_E the glic pentameric ligand-gated ion channel mutant e243c-i201w 0.7869 35 77
7rww-assembly1.cif.gz_A crystal structure of a zn-bound ridc1 variant 0.7671 25 77
6ot9-assembly1.cif.gz_C bimetallic dodecameric cage design 1 (bmc1) from cytochrome cb562 0.742 25 77
3m79-assembly2.cif.gz_E a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces crystallized in the presence of cu(ii) and zn(ii) 0.7402 24 77
3m4c-assembly1.cif.gz_B a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase 0.7387 25 77
ID Description Score Start End Superfamily
3v1dD00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.8693 38 77 4.10.860.20
3v1dA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.8681 38 77 4.10.860.20
3v1dG00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.867 38 77 4.10.860.20
af_A0A1D6PNQ4_16_492_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7849 8 74 3.40.50.1820
af_O76618_188_603_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7702 2 72 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1H8HYP3-F1-model_v4 Uncharacterized protein 0.9492 1 81 GO:0016020
AF-A0A3A1P9H1-F1-model_v4 Uncharacterized protein 0.9458 1 82 GO:0016020
AF-A0A3A1P9H1-F1-model_v4 Uncharacterized protein 0.9344 1 82 GO:0016020
AF-A0A3S2VS45-F1-model_v4 Uncharacterized protein 0.9306 1 82 GO:0016020
AF-A0A7Z0APF6-F1-model_v4 deleted 0.9281 1 82

Map