F492295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1260 | 280 | 2520 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10579497|Ga0157373_105794972 |
| Length | 99 |
| Sequence | MHEYGVRASAAREGSMETVYDWVSLAIFAGLIVLFLQRSTGERAEKDASLLYYLGAGVGCAVANYFGNHGQHIVAIAILVATVAFIIYFLKPFRFRPGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 173 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 199 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 200 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 204 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 205 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 206 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 255 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 256 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 257 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 258 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 263 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 266 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 268 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 273 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 274 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 276 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 277 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 278 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 1.98 |
| Rhizosphere | 96.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 41.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157373_10579497 | 3300013100 | Unclassified | 815 |
| 2 | MBSR1b_contig_3302548 | 2162886012 | Unclassified | 2538 |
| 3 | MBSR1b_contig_8811798 | 2162886012 | Unclassified | 1635 |
| 4 | JGI24741J21665_1001705 | 3300001915 | Bacteria | 6077 |
| 5 | JGI24741J21665_1018577 | 3300001915 | Unclassified | 1110 |
| 6 | JGI24741J21665_1032167 | 3300001915 | Unclassified | 783 |
| 7 | JGI24740J21852_10002403 | 3300001979 | Bacteria | 8507 |
| 8 | JGI24740J21852_10002753 | 3300001979 | Bacteria | 7862 |
| 9 | JGI24740J21852_10004394 | 3300001979 | Bacteria | 6062 |
| 10 | JGI24740J21852_10037551 | 3300001979 | Unclassified | 1494 |
| 11 | JGI24739J22299_10011726 | 3300001989 | Bacteria | 3231 |
| 12 | JGI24739J22299_10087188 | 3300001989 | Unclassified | 953 |
| 13 | JGI24737J22298_10228638 | 3300001990 | Unclassified | 549 |
| 14 | JGI24735J21928_10002010 | 3300002067 | Bacteria | 7153 |
| 15 | JGI24735J21928_10005515 | 3300002067 | Bacteria | 4195 |
| 16 | JGI24735J21928_10016635 | 3300002067 | Unclassified | 2278 |
| 17 | JGI24738J21930_10081169 | 3300002075 | Unclassified | 679 |
| 18 | JGI24738J21930_10109290 | 3300002075 | Unclassified | 595 |
| 19 | JGI24744J21845_10039746 | 3300002077 | Unclassified | 882 |
| 20 | JGI24033J26618_1002423 | 3300002155 | Unclassified | 1910 |
| 21 | JGI24034J26672_10066758 | 3300002239 | Unclassified | 639 |
| 22 | JGI25406J46586_10068768 | 3300003203 | Bacteria | 1118 |
| 23 | rootH2_10152215 | 3300003320 | Bacteria | 1930 |
| 24 | rootH1_10137416 | 3300003323 | Bacteria | 7394 |
| 25 | rootH1_10287373 | 3300003323 | Bacteria | 2090 |
| 26 | rootH1_10318114 | 3300003323 | Unclassified | 1424 |
| 27 | Ga0065704_10703317 | 3300005289 | Bacteria | 560 |
| 28 | Ga0065712_10074159 | 3300005290 | Unclassified | 4163 |
| 29 | Ga0065712_10457008 | 3300005290 | Bacteria | 681 |
| 30 | Ga0065715_10233102 | 3300005293 | Bacteria | 1226 |
| 31 | Ga0065715_10804293 | 3300005293 | Unclassified | 608 |
| 32 | Ga0070658_10007081 | 3300005327 | Bacteria | 9051 |
| 33 | Ga0070658_10014784 | 3300005327 | Bacteria | 6256 |
| 34 | Ga0070658_10025215 | 3300005327 | Unclassified | 4766 |
| 35 | Ga0070658_10027650 | 3300005327 | Bacteria | 4550 |
| 36 | Ga0070658_10028240 | 3300005327 | Bacteria | 4503 |
| 37 | Ga0070658_10039082 | 3300005327 | Unclassified | 3827 |
| 38 | Ga0070658_10089250 | 3300005327 | Unclassified | 2538 |
| 39 | Ga0070658_10094639 | 3300005327 | Bacteria | 2465 |
| 40 | Ga0070658_10135423 | 3300005327 | Bacteria | 2055 |
| 41 | Ga0070658_10262089 | 3300005327 | Unclassified | 1468 |
| 42 | Ga0070658_10285877 | 3300005327 | Bacteria | 1404 |
| 43 | Ga0070658_10337153 | 3300005327 | Unclassified | 1289 |
| 44 | Ga0070658_10455540 | 3300005327 | Bacteria | 1102 |
| 45 | Ga0070658_10504585 | 3300005327 | Unclassified | 1045 |
| 46 | Ga0070658_10563937 | 3300005327 | Bacteria | 986 |
| 47 | Ga0070658_10657603 | 3300005327 | Unclassified | 909 |
| 48 | Ga0070658_10790105 | 3300005327 | Bacteria | 825 |
| 49 | Ga0070658_10829332 | 3300005327 | Bacteria | 803 |
| 50 | Ga0070658_11002536 | 3300005327 | Bacteria | 726 |
| 51 | Ga0070658_11188891 | 3300005327 | Unclassified | 663 |
| 52 | Ga0070658_11805415 | 3300005327 | Unclassified | 529 |
| 53 | Ga0070658_11826208 | 3300005327 | Unclassified | 525 |
| 54 | Ga0070676_10019977 | 3300005328 | Unclassified | 3733 |
| 55 | Ga0070676_10111754 | 3300005328 | Bacteria | 1702 |
| 56 | Ga0070676_10140170 | 3300005328 | Bacteria | 1538 |
| 57 | Ga0070676_10361489 | 3300005328 | Unclassified | 1000 |
| 58 | Ga0070676_10607658 | 3300005328 | Unclassified | 789 |
| 59 | Ga0070676_10721107 | 3300005328 | Unclassified | 730 |
| 60 | Ga0070676_10867567 | 3300005328 | Bacteria | 670 |
| 61 | Ga0070683_100002629 | 3300005329 | Bacteria | 14360 |
| 62 | Ga0070683_100016104 | 3300005329 | Bacteria | 6581 |
| 63 | Ga0070683_100020068 | 3300005329 | Bacteria | 5943 |
| 64 | Ga0070683_100058817 | 3300005329 | Bacteria | 3570 |
| 65 | Ga0070683_100310149 | 3300005329 | Unclassified | 1501 |
| 66 | Ga0070683_100889463 | 3300005329 | Unclassified | 854 |
| 67 | Ga0070690_100005963 | 3300005330 | Bacteria | 6881 |
| 68 | Ga0070690_100358553 | 3300005330 | Unclassified | 1060 |
| 69 | Ga0070670_100000482 | 3300005331 | Bacteria | 32026 |
| 70 | Ga0070670_100013946 | 3300005331 | Bacteria | 6892 |
| 71 | Ga0070670_100021632 | 3300005331 | Bacteria | 5530 |
| 72 | Ga0070670_100043866 | 3300005331 | Unclassified | 3844 |
| 73 | Ga0070670_100068780 | 3300005331 | Unclassified | 3039 |
| 74 | Ga0070670_100282551 | 3300005331 | Bacteria | 1449 |
| 75 | Ga0070670_100464617 | 3300005331 | Unclassified | 1123 |
| 76 | Ga0070670_101403585 | 3300005331 | Bacteria | 640 |
| 77 | Ga0070670_101677358 | 3300005331 | Unclassified | 585 |
| 78 | Ga0070677_10000655 | 3300005333 | Bacteria | 11570 |
| 79 | Ga0070677_10002714 | 3300005333 | Bacteria | 5659 |
| 80 | Ga0070677_10032154 | 3300005333 | Unclassified | 2010 |
| 81 | Ga0068869_101288944 | 3300005334 | Unclassified | 644 |
| 82 | Ga0070666_10001302 | 3300005335 | Bacteria | 15102 |
| 83 | Ga0070666_10025157 | 3300005335 | Unclassified | 3880 |
| 84 | Ga0070666_10027996 | 3300005335 | Unclassified | 3695 |
| 85 | Ga0070666_10044734 | 3300005335 | Unclassified | 2967 |
| 86 | Ga0070666_10107580 | 3300005335 | Bacteria | 1927 |
| 87 | Ga0070666_10184203 | 3300005335 | Bacteria | 1465 |
| 88 | Ga0070666_10196826 | 3300005335 | Unclassified | 1417 |
| 89 | Ga0070666_10991246 | 3300005335 | Bacteria | 623 |
| 90 | Ga0070680_100020196 | 3300005336 | Bacteria | 5286 |
| 91 | Ga0070680_100035425 | 3300005336 | Bacteria | 4029 |
| 92 | Ga0070680_100065927 | 3300005336 | Bacteria | 2968 |
| 93 | Ga0070680_100067337 | 3300005336 | Bacteria | 2937 |
| 94 | Ga0070680_100152355 | 3300005336 | Bacteria | 1941 |
| 95 | Ga0070680_100260812 | 3300005336 | Unclassified | 1466 |
| 96 | Ga0070682_100044647 | 3300005337 | Unclassified | 2745 |
| 97 | Ga0070682_100307230 | 3300005337 | Unclassified | 1166 |
| 98 | Ga0070682_101477164 | 3300005337 | Unclassified | 584 |
| 99 | Ga0070682_101490639 | 3300005337 | Bacteria | 581 |
| 100 | Ga0068868_100003463 | 3300005338 | Bacteria | 10990 |
| 101 | Ga0068868_100079365 | 3300005338 | Unclassified | 2629 |
| 102 | Ga0068868_100321489 | 3300005338 | Unclassified | 1318 |
| 103 | Ga0068868_101145736 | 3300005338 | Bacteria | 717 |
| 104 | Ga0070660_100003869 | 3300005339 | Bacteria | 10336 |
| 105 | Ga0070660_100006193 | 3300005339 | Bacteria | 8277 |
| 106 | Ga0070660_100007812 | 3300005339 | Bacteria | 7459 |
| 107 | Ga0070660_100011819 | 3300005339 | Bacteria | 6220 |
| 108 | Ga0070660_100019162 | 3300005339 | Bacteria | 5009 |
| 109 | Ga0070660_100029227 | 3300005339 | Unclassified | 4129 |
| 110 | Ga0070660_100058036 | 3300005339 | Unclassified | 3000 |
| 111 | Ga0070660_100084264 | 3300005339 | Bacteria | 2498 |
| 112 | Ga0070660_100085989 | 3300005339 | Unclassified | 2474 |
| 113 | Ga0070660_100116100 | 3300005339 | Bacteria | 2134 |
| 114 | Ga0070660_100200462 | 3300005339 | Bacteria | 1619 |
| 115 | Ga0070660_100211081 | 3300005339 | Bacteria | 1576 |
| 116 | Ga0070660_100250581 | 3300005339 | Unclassified | 1444 |
| 117 | Ga0070660_100349462 | 3300005339 | Bacteria | 1217 |
| 118 | Ga0070660_100357649 | 3300005339 | Unclassified | 1203 |
| 119 | Ga0070660_100404566 | 3300005339 | Bacteria | 1129 |
| 120 | Ga0070660_100533460 | 3300005339 | Bacteria | 978 |
| 121 | Ga0070660_101201879 | 3300005339 | Bacteria | 643 |
| 122 | Ga0070660_101380024 | 3300005339 | Unclassified | 598 |
| 123 | Ga0070691_10008688 | 3300005341 | Bacteria | 4649 |
| 124 | Ga0070687_100255805 | 3300005343 | Bacteria | 1090 |
| 125 | Ga0070687_100574639 | 3300005343 | Unclassified | 770 |
| 126 | Ga0070687_100777092 | 3300005343 | Unclassified | 676 |
| 127 | Ga0070661_100002823 | 3300005344 | Bacteria | 11943 |
| 128 | Ga0070661_100003992 | 3300005344 | Bacteria | 10146 |
| 129 | Ga0070661_100005291 | 3300005344 | Bacteria | 8893 |
| 130 | Ga0070661_100145097 | 3300005344 | Unclassified | 1791 |
| 131 | Ga0070661_100230052 | 3300005344 | Bacteria | 1424 |
| 132 | Ga0070661_100333460 | 3300005344 | Unclassified | 1187 |
| 133 | Ga0070661_100524477 | 3300005344 | Unclassified | 950 |
| 134 | Ga0070661_100605005 | 3300005344 | Unclassified | 886 |
| 135 | Ga0070661_100641574 | 3300005344 | Bacteria | 861 |
| 136 | Ga0070661_101708227 | 3300005344 | Unclassified | 533 |
| 137 | Ga0070692_10020700 | 3300005345 | Bacteria | 3191 |
| 138 | Ga0070668_100153482 | 3300005347 | Unclassified | 1864 |
| 139 | Ga0070668_100246367 | 3300005347 | Bacteria | 1482 |
| 140 | Ga0070668_100398534 | 3300005347 | Bacteria | 1175 |
| 141 | Ga0070668_100775332 | 3300005347 | Unclassified | 850 |
| 142 | Ga0070669_100026431 | 3300005353 | Unclassified | 4176 |
| 143 | Ga0070669_100057008 | 3300005353 | Bacteria | 2865 |
| 144 | Ga0070669_100319587 | 3300005353 | Bacteria | 1253 |
| 145 | Ga0070669_100417486 | 3300005353 | Unclassified | 1101 |
| 146 | Ga0070669_100760040 | 3300005353 | Unclassified | 822 |
| 147 | Ga0070669_101380266 | 3300005353 | Bacteria | 611 |
| 148 | Ga0070675_100000877 | 3300005354 | Bacteria | 21384 |
| 149 | Ga0070675_100002093 | 3300005354 | Bacteria | 14774 |
| 150 | Ga0070675_100002962 | 3300005354 | Bacteria | 12815 |
| 151 | Ga0070675_100055132 | 3300005354 | Bacteria | 3271 |
| 152 | Ga0070675_100506091 | 3300005354 | Unclassified | 1089 |
| 153 | Ga0070675_100938849 | 3300005354 | Bacteria | 793 |
| 154 | Ga0070671_100000585 | 3300005355 | Bacteria | 25984 |
| 155 | Ga0070671_100001443 | 3300005355 | Bacteria | 17754 |
| 156 | Ga0070671_100003827 | 3300005355 | Bacteria | 11819 |
| 157 | Ga0070671_100037502 | 3300005355 | Bacteria | 4020 |
| 158 | Ga0070671_100045653 | 3300005355 | Bacteria | 3643 |
| 159 | Ga0070671_100198879 | 3300005355 | Bacteria | 1699 |
| 160 | Ga0070671_100414843 | 3300005355 | Bacteria | 1153 |
| 161 | Ga0070671_100788285 | 3300005355 | Bacteria | 827 |
| 162 | Ga0070671_101313595 | 3300005355 | Unclassified | 638 |
| 163 | Ga0070674_100018915 | 3300005356 | Unclassified | 4365 |
| 164 | Ga0070674_100027807 | 3300005356 | Unclassified | 3709 |
| 165 | Ga0070674_100088954 | 3300005356 | Unclassified | 2224 |
| 166 | Ga0070674_100186414 | 3300005356 | Bacteria | 1593 |
| 167 | Ga0070674_100202907 | 3300005356 | Unclassified | 1532 |
| 168 | Ga0070674_100586954 | 3300005356 | Bacteria | 940 |
| 169 | Ga0070673_100002199 | 3300005364 | Bacteria | 11788 |
| 170 | Ga0070673_100004985 | 3300005364 | Bacteria | 8465 |
| 171 | Ga0070673_100100294 | 3300005364 | Unclassified | 2383 |
| 172 | Ga0070673_100169667 | 3300005364 | Unclassified | 1861 |
| 173 | Ga0070673_100280464 | 3300005364 | Unclassified | 1461 |
| 174 | Ga0070673_100289168 | 3300005364 | Bacteria | 1440 |
| 175 | Ga0070673_100526690 | 3300005364 | Unclassified | 1071 |
| 176 | Ga0070673_100741086 | 3300005364 | Unclassified | 904 |
| 177 | Ga0070688_100209641 | 3300005365 | Unclassified | 1367 |
| 178 | Ga0070688_100932801 | 3300005365 | Unclassified | 686 |
| 179 | Ga0070659_100007018 | 3300005366 | Bacteria | 8158 |
| 180 | Ga0070659_100009371 | 3300005366 | Bacteria | 7190 |
| 181 | Ga0070659_100012487 | 3300005366 | Bacteria | 6298 |
| 182 | Ga0070659_100149201 | 3300005366 | Unclassified | 1907 |
| 183 | Ga0070659_100201016 | 3300005366 | Bacteria | 1640 |
| 184 | Ga0070659_100204822 | 3300005366 | Unclassified | 1625 |
| 185 | Ga0070659_100297752 | 3300005366 | Unclassified | 1344 |
| 186 | Ga0070659_100389812 | 3300005366 | Unclassified | 1174 |
| 187 | Ga0070659_100436863 | 3300005366 | Unclassified | 1108 |
| 188 | Ga0070659_100495630 | 3300005366 | Bacteria | 1041 |
| 189 | Ga0070659_100743518 | 3300005366 | Unclassified | 850 |
| 190 | Ga0070659_100904091 | 3300005366 | Unclassified | 772 |
| 191 | Ga0070667_100003311 | 3300005367 | Bacteria | 13770 |
| 192 | Ga0070667_100011143 | 3300005367 | Bacteria | 7437 |
| 193 | Ga0070667_100081475 | 3300005367 | Bacteria | 2770 |
| 194 | Ga0070667_100148128 | 3300005367 | Unclassified | 2060 |
| 195 | Ga0070667_100226411 | 3300005367 | Bacteria | 1666 |
| 196 | Ga0070667_101995516 | 3300005367 | Unclassified | 546 |
| 197 | Ga0070709_11446384 | 3300005434 | Unclassified | 557 |
| 198 | Ga0070714_100002190 | 3300005435 | Bacteria | 14377 |
| 199 | Ga0070714_100156329 | 3300005435 | Unclassified | 2059 |
| 200 | Ga0070714_100522566 | 3300005435 | Unclassified | 1134 |
| 201 | Ga0070713_100123284 | 3300005436 | Unclassified | 2276 |
| 202 | Ga0070713_100182722 | 3300005436 | Bacteria | 1885 |
| 203 | Ga0070710_10709972 | 3300005437 | Bacteria | 710 |
| 204 | Ga0070663_100013674 | 3300005455 | Bacteria | 5185 |
| 205 | Ga0070663_100029040 | 3300005455 | Unclassified | 3773 |
| 206 | Ga0070663_100030458 | 3300005455 | Bacteria | 3698 |
| 207 | Ga0070663_100060216 | 3300005455 | Unclassified | 2730 |
| 208 | Ga0070663_100158790 | 3300005455 | Bacteria | 1739 |
| 209 | Ga0070663_100381878 | 3300005455 | Unclassified | 1147 |
| 210 | Ga0070663_100389397 | 3300005455 | Unclassified | 1137 |
| 211 | Ga0070663_100600895 | 3300005455 | Bacteria | 925 |
| 212 | Ga0070663_101114702 | 3300005455 | Unclassified | 690 |
| 213 | Ga0070678_100011216 | 3300005456 | Bacteria | 5518 |
| 214 | Ga0070678_100036951 | 3300005456 | Unclassified | 3424 |
| 215 | Ga0070678_100061154 | 3300005456 | Unclassified | 2775 |
| 216 | Ga0070678_100085251 | 3300005456 | Bacteria | 2407 |
| 217 | Ga0070678_100129322 | 3300005456 | Bacteria | 2004 |
| 218 | Ga0070662_100002711 | 3300005457 | Bacteria | 10938 |
| 219 | Ga0070662_100012833 | 3300005457 | Bacteria | 5566 |
| 220 | Ga0070662_100036289 | 3300005457 | Bacteria | 3486 |
| 221 | Ga0070662_100037197 | 3300005457 | Unclassified | 3450 |
| 222 | Ga0070662_100040541 | 3300005457 | Unclassified | 3316 |
| 223 | Ga0070662_100057498 | 3300005457 | Unclassified | 2826 |
| 224 | Ga0070662_100064145 | 3300005457 | Unclassified | 2689 |
| 225 | Ga0070662_100072696 | 3300005457 | Bacteria | 2540 |
| 226 | Ga0070662_100083530 | 3300005457 | Bacteria | 2384 |
| 227 | Ga0070662_100431494 | 3300005457 | Unclassified | 1091 |
| 228 | Ga0070662_100518413 | 3300005457 | Unclassified | 996 |
| 229 | Ga0070662_100950230 | 3300005457 | Bacteria | 735 |
| 230 | Ga0070681_10078161 | 3300005458 | Unclassified | 3266 |
| 231 | Ga0070681_10080144 | 3300005458 | Bacteria | 3221 |
| 232 | Ga0070681_10595551 | 3300005458 | Unclassified | 1020 |
| 233 | Ga0070681_10887088 | 3300005458 | Bacteria | 810 |
| 234 | Ga0068867_100024122 | 3300005459 | Bacteria | 4359 |
| 235 | Ga0070685_10123203 | 3300005466 | Bacteria | 1612 |
| 236 | Ga0070679_100008241 | 3300005530 | Bacteria | 9802 |
| 237 | Ga0070679_100042382 | 3300005530 | Bacteria | 4532 |
| 238 | Ga0070679_100112132 | 3300005530 | Bacteria | 2713 |
| 239 | Ga0070679_100251990 | 3300005530 | Bacteria | 1721 |
| 240 | Ga0070679_100348106 | 3300005530 | Bacteria | 1430 |
| 241 | Ga0070679_101511352 | 3300005530 | Unclassified | 618 |
| 242 | Ga0070684_100004092 | 3300005535 | Bacteria | 11038 |
| 243 | Ga0070684_100010106 | 3300005535 | Bacteria | 7464 |
| 244 | Ga0070684_102036218 | 3300005535 | Unclassified | 542 |
| 245 | Ga0068853_100027959 | 3300005539 | Bacteria | 4742 |
| 246 | Ga0068853_100038172 | 3300005539 | Bacteria | 4090 |
| 247 | Ga0068853_100060076 | 3300005539 | Bacteria | 3284 |
| 248 | Ga0068853_100193223 | 3300005539 | Unclassified | 1850 |
| 249 | Ga0068853_100232433 | 3300005539 | Bacteria | 1687 |
| 250 | Ga0068853_100345729 | 3300005539 | Bacteria | 1383 |
| 251 | Ga0068853_100464042 | 3300005539 | Bacteria | 1192 |
| 252 | Ga0068853_100552289 | 3300005539 | Bacteria | 1091 |
| 253 | Ga0070672_100001022 | 3300005543 | Bacteria | 17006 |
| 254 | Ga0070672_100031012 | 3300005543 | Unclassified | 4021 |
| 255 | Ga0070672_100117629 | 3300005543 | Unclassified | 2173 |
| 256 | Ga0070672_100195481 | 3300005543 | Bacteria | 1690 |
| 257 | Ga0070672_100280164 | 3300005543 | Unclassified | 1409 |
| 258 | Ga0070672_101200708 | 3300005543 | Unclassified | 676 |
| 259 | Ga0070672_101311295 | 3300005543 | Unclassified | 646 |
| 260 | Ga0070672_101706427 | 3300005543 | Archaea | 566 |
| 261 | Ga0070686_100028862 | 3300005544 | Bacteria | 3368 |
| 262 | Ga0070686_101840102 | 3300005544 | Unclassified | 516 |
| 263 | Ga0070693_100678160 | 3300005547 | Unclassified | 752 |
| 264 | Ga0070665_100001865 | 3300005548 | Bacteria | 23913 |
| 265 | Ga0070665_100028113 | 3300005548 | Bacteria | 5663 |
| 266 | Ga0070665_100032641 | 3300005548 | Bacteria | 5240 |
| 267 | Ga0070665_100087241 | 3300005548 | Bacteria | 3125 |
| 268 | Ga0070665_100583356 | 3300005548 | Unclassified | 1131 |
| 269 | Ga0068855_100005824 | 3300005563 | Bacteria | 15041 |
| 270 | Ga0068855_100006659 | 3300005563 | Bacteria | 14033 |
| 271 | Ga0068855_100014977 | 3300005563 | Bacteria | 9340 |
| 272 | Ga0068855_100017060 | 3300005563 | Bacteria | 8734 |
| 273 | Ga0068855_100019199 | 3300005563 | Bacteria | 8215 |
| 274 | Ga0068855_100030983 | 3300005563 | Bacteria | 6392 |
| 275 | Ga0068855_100153618 | 3300005563 | Bacteria | 2616 |
| 276 | Ga0068855_100199319 | 3300005563 | Unclassified | 2254 |
| 277 | Ga0068855_100827417 | 3300005563 | Bacteria | 982 |
| 278 | Ga0068855_102186743 | 3300005563 | Unclassified | 556 |
| 279 | Ga0070664_100000161 | 3300005564 | Bacteria | 46245 |
| 280 | Ga0070664_100011435 | 3300005564 | Bacteria | 7203 |
| 281 | Ga0070664_100012603 | 3300005564 | Bacteria | 6880 |
| 282 | Ga0070664_100025357 | 3300005564 | Bacteria | 4913 |
| 283 | Ga0070664_100027281 | 3300005564 | Bacteria | 4745 |
| 284 | Ga0070664_100033439 | 3300005564 | Bacteria | 4306 |
| 285 | Ga0070664_100035666 | 3300005564 | Bacteria | 4176 |
| 286 | Ga0070664_100040030 | 3300005564 | Unclassified | 3951 |
| 287 | Ga0070664_100079788 | 3300005564 | Unclassified | 2818 |
| 288 | Ga0070664_100086527 | 3300005564 | Unclassified | 2708 |
| 289 | Ga0070664_100139337 | 3300005564 | Unclassified | 2135 |
| 290 | Ga0070664_100324564 | 3300005564 | Bacteria | 1395 |
| 291 | Ga0070664_101415136 | 3300005564 | Unclassified | 657 |
| 292 | Ga0068857_100038222 | 3300005577 | Unclassified | 4250 |
| 293 | Ga0068857_100112004 | 3300005577 | Unclassified | 2453 |
| 294 | Ga0068857_100565073 | 3300005577 | Unclassified | 1073 |
| 295 | Ga0068857_100742428 | 3300005577 | Unclassified | 935 |
| 296 | Ga0068857_100991465 | 3300005577 | Unclassified | 808 |
| 297 | Ga0068857_101404784 | 3300005577 | Bacteria | 679 |
| 298 | Ga0068857_101896344 | 3300005577 | Bacteria | 584 |
| 299 | Ga0068857_102535135 | 3300005577 | Bacteria | 503 |
| 300 | Ga0068854_100005714 | 3300005578 | Bacteria | 7860 |
| 301 | Ga0068854_100012828 | 3300005578 | Bacteria | 5489 |
| 302 | Ga0068854_100029291 | 3300005578 | Bacteria | 3811 |
| 303 | Ga0068854_100056333 | 3300005578 | Unclassified | 2833 |
| 304 | Ga0068854_100098300 | 3300005578 | Bacteria | 2190 |
| 305 | Ga0068854_100102309 | 3300005578 | Unclassified | 2149 |
| 306 | Ga0068854_100318604 | 3300005578 | Unclassified | 1263 |
| 307 | Ga0068854_100377526 | 3300005578 | Bacteria | 1167 |
| 308 | Ga0068854_100421048 | 3300005578 | Unclassified | 1109 |
| 309 | Ga0068854_100694711 | 3300005578 | Bacteria | 878 |
| 310 | Ga0068854_100714767 | 3300005578 | Bacteria | 866 |
| 311 | Ga0068854_100995084 | 3300005578 | Bacteria | 742 |
| 312 | Ga0068854_102012318 | 3300005578 | Bacteria | 532 |
| 313 | Ga0068856_100010684 | 3300005614 | Bacteria | 8919 |
| 314 | Ga0068856_100023749 | 3300005614 | Bacteria | 5963 |
| 315 | Ga0068856_100069827 | 3300005614 | Bacteria | 3474 |
| 316 | Ga0068856_100086906 | 3300005614 | Bacteria | 3108 |
| 317 | Ga0068856_100122888 | 3300005614 | Bacteria | 2598 |
| 318 | Ga0068856_100294342 | 3300005614 | Bacteria | 1640 |
| 319 | Ga0068856_100313488 | 3300005614 | Bacteria | 1586 |
| 320 | Ga0068856_100660129 | 3300005614 | Bacteria | 1066 |
| 321 | Ga0068856_100973202 | 3300005614 | Unclassified | 867 |
| 322 | Ga0068856_102141843 | 3300005614 | Unclassified | 569 |
| 323 | Ga0068852_100007810 | 3300005616 | Bacteria | 7833 |
| 324 | Ga0068852_100037574 | 3300005616 | Bacteria | 4061 |
| 325 | Ga0068852_100310345 | 3300005616 | Unclassified | 1529 |
| 326 | Ga0068852_100340190 | 3300005616 | Unclassified | 1462 |
| 327 | Ga0068852_100383304 | 3300005616 | Bacteria | 1379 |
| 328 | Ga0068852_100595345 | 3300005616 | Unclassified | 1109 |
| 329 | Ga0068852_100601875 | 3300005616 | Unclassified | 1103 |
| 330 | Ga0068852_100610103 | 3300005616 | Unclassified | 1096 |
| 331 | Ga0068852_100701692 | 3300005616 | Bacteria | 1022 |
| 332 | Ga0068852_100766724 | 3300005616 | Bacteria | 977 |
| 333 | Ga0068864_100048368 | 3300005618 | Unclassified | 3656 |
| 334 | Ga0068864_100055197 | 3300005618 | Bacteria | 3429 |
| 335 | Ga0068864_100107289 | 3300005618 | Unclassified | 2484 |
| 336 | Ga0068864_100134729 | 3300005618 | Unclassified | 2223 |
| 337 | Ga0068864_100210423 | 3300005618 | Bacteria | 1790 |
| 338 | Ga0068866_10014997 | 3300005718 | Bacteria | 3435 |
| 339 | Ga0068866_11128671 | 3300005718 | Unclassified | 563 |
| 340 | Ga0068861_102209833 | 3300005719 | Bacteria | 551 |
| 341 | Ga0068851_10008666 | 3300005834 | Bacteria | 4709 |
| 342 | Ga0068851_10293038 | 3300005834 | Unclassified | 933 |
| 343 | Ga0068851_10474672 | 3300005834 | Bacteria | 747 |
| 344 | Ga0068851_10996528 | 3300005834 | Bacteria | 528 |
| 345 | Ga0068870_10066866 | 3300005840 | Unclassified | 1948 |
| 346 | Ga0068870_10147998 | 3300005840 | Bacteria | 1380 |
| 347 | Ga0068863_100068000 | 3300005841 | Bacteria | 3370 |
| 348 | Ga0068863_100265535 | 3300005841 | Bacteria | 1660 |
| 349 | Ga0068863_101193801 | 3300005841 | Unclassified | 767 |
| 350 | Ga0068858_100028249 | 3300005842 | Bacteria | 5212 |
| 351 | Ga0068858_100070725 | 3300005842 | Unclassified | 3234 |
| 352 | Ga0068858_100096630 | 3300005842 | Bacteria | 2753 |
| 353 | Ga0068860_100235618 | 3300005843 | Unclassified | 1779 |
| 354 | Ga0068860_102573477 | 3300005843 | Unclassified | 528 |
| 355 | Ga0068862_100013008 | 3300005844 | Bacteria | 6883 |
| 356 | Ga0068862_101925253 | 3300005844 | Bacteria | 601 |
| 357 | Ga0068862_102205946 | 3300005844 | Unclassified | 562 |
| 358 | Ga0081539_10017819 | 3300005985 | Unclassified | 4961 |
| 359 | Ga0081539_10101652 | 3300005985 | Unclassified | 1464 |
| 360 | Ga0070717_10168661 | 3300006028 | Bacteria | 1903 |
| 361 | Ga0070716_100433488 | 3300006173 | Bacteria | 954 |
| 362 | Ga0097621_100013198 | 3300006237 | Bacteria | 6146 |
| 363 | Ga0097621_100030868 | 3300006237 | Bacteria | 4246 |
| 364 | Ga0097621_100142185 | 3300006237 | Unclassified | 2051 |
| 365 | Ga0097621_101949070 | 3300006237 | Unclassified | 561 |
| 366 | Ga0075370_10092536 | 3300006353 | Bacteria | 1745 |
| 367 | Ga0068871_100156692 | 3300006358 | Bacteria | 1945 |
| 368 | Ga0068871_101915736 | 3300006358 | Unclassified | 564 |
| 369 | Ga0068865_100010945 | 3300006881 | Bacteria | 5662 |
| 370 | Ga0068865_100561897 | 3300006881 | Bacteria | 959 |
| 371 | Ga0105240_10007329 | 3300009093 | Bacteria | 16052 |
| 372 | Ga0105240_10035738 | 3300009093 | Bacteria | 6400 |
| 373 | Ga0105240_10089677 | 3300009093 | Bacteria | 3760 |
| 374 | Ga0105240_10154718 | 3300009093 | Unclassified | 2728 |
| 375 | Ga0105240_10180308 | 3300009093 | Unclassified | 2493 |
| 376 | Ga0105240_10285403 | 3300009093 | Bacteria | 1895 |
| 377 | Ga0105240_10656568 | 3300009093 | Bacteria | 1149 |
| 378 | Ga0105240_10887209 | 3300009093 | Bacteria | 960 |
| 379 | Ga0105240_11019602 | 3300009093 | Unclassified | 884 |
| 380 | Ga0105240_11676647 | 3300009093 | Bacteria | 664 |
| 381 | Ga0105245_10006582 | 3300009098 | Bacteria | 10199 |
| 382 | Ga0105245_10131844 | 3300009098 | Bacteria | 2345 |
| 383 | Ga0105243_10578656 | 3300009148 | Bacteria | 1077 |
| 384 | Ga0105241_10060359 | 3300009174 | Bacteria | 2917 |
| 385 | Ga0105241_10080050 | 3300009174 | Unclassified | 2556 |
| 386 | Ga0105241_10113178 | 3300009174 | Bacteria | 2175 |
| 387 | Ga0105241_10229420 | 3300009174 | Bacteria | 1564 |
| 388 | Ga0105241_10796755 | 3300009174 | Unclassified | 870 |
| 389 | Ga0105241_11194130 | 3300009174 | Unclassified | 720 |
| 390 | Ga0105242_10462264 | 3300009176 | Bacteria | 1199 |
| 391 | Ga0105248_10000864 | 3300009177 | Bacteria | 34121 |
| 392 | Ga0105248_10001731 | 3300009177 | Bacteria | 24252 |
| 393 | Ga0105248_10002120 | 3300009177 | Bacteria | 21948 |
| 394 | Ga0105248_10021840 | 3300009177 | Bacteria | 7092 |
| 395 | Ga0105248_10030620 | 3300009177 | Bacteria | 6009 |
| 396 | Ga0105248_10079884 | 3300009177 | Bacteria | 3676 |
| 397 | Ga0105248_10082992 | 3300009177 | Unclassified | 3605 |
| 398 | Ga0105248_10828402 | 3300009177 | Unclassified | 1044 |
| 399 | Ga0105248_12700656 | 3300009177 | Unclassified | 566 |
| 400 | Ga0105237_10013112 | 3300009545 | Bacteria | 8701 |
| 401 | Ga0105237_10042170 | 3300009545 | Bacteria | 4603 |
| 402 | Ga0105237_10209755 | 3300009545 | Unclassified | 1948 |
| 403 | Ga0105237_10354299 | 3300009545 | Unclassified | 1472 |
| 404 | Ga0105238_10013299 | 3300009551 | Bacteria | 8304 |
| 405 | Ga0105238_10089551 | 3300009551 | Unclassified | 3064 |
| 406 | Ga0105238_10093369 | 3300009551 | Bacteria | 2997 |
| 407 | Ga0105238_10193517 | 3300009551 | Bacteria | 2009 |
| 408 | Ga0105238_10259665 | 3300009551 | Bacteria | 1716 |
| 409 | Ga0105238_10615945 | 3300009551 | Unclassified | 1094 |
| 410 | Ga0105238_11063869 | 3300009551 | Bacteria | 831 |
| 411 | Ga0105238_12794189 | 3300009551 | Unclassified | 525 |
| 412 | Ga0105239_10042499 | 3300010375 | Bacteria | 4981 |
| 413 | Ga0105239_10062032 | 3300010375 | Bacteria | 4103 |
| 414 | Ga0105239_10335496 | 3300010375 | Unclassified | 1706 |
| 415 | Ga0105239_11178768 | 3300010375 | Bacteria | 882 |
| 416 | Ga0105239_12621882 | 3300010375 | Bacteria | 588 |
| 417 | Ga0105246_11305892 | 3300011119 | Unclassified | 673 |
| 418 | Ga0105246_11542445 | 3300011119 | Unclassified | 625 |
| 419 | Ga0157327_1031828 | 3300012512 | Unclassified | 663 |
| 420 | Ga0157373_10004072 | 3300013100 | Bacteria | 11014 |
| 421 | Ga0157373_10025010 | 3300013100 | Unclassified | 4323 |
| 422 | Ga0157373_10032853 | 3300013100 | Bacteria | 3734 |
| 423 | Ga0157373_10108143 | 3300013100 | Bacteria | 1955 |
| 424 | Ga0157373_10108334 | 3300013100 | Bacteria | 1953 |
| 425 | Ga0157373_11116607 | 3300013100 | Unclassified | 592 |
| 426 | Ga0157373_11489794 | 3300013100 | Unclassified | 516 |
| 427 | Ga0157371_10008598 | 3300013102 | Bacteria | 8109 |
| 428 | Ga0157371_10021331 | 3300013102 | Bacteria | 4756 |
| 429 | Ga0157371_10075192 | 3300013102 | Bacteria | 2392 |
| 430 | Ga0157371_10110816 | 3300013102 | Unclassified | 1948 |
| 431 | Ga0157371_10192956 | 3300013102 | Bacteria | 1459 |
| 432 | Ga0157371_10274329 | 3300013102 | Bacteria | 1217 |
| 433 | Ga0157371_10466016 | 3300013102 | Unclassified | 930 |
| 434 | Ga0157371_10652844 | 3300013102 | Archaea | 785 |
| 435 | Ga0157371_11127438 | 3300013102 | Unclassified | 602 |
| 436 | Ga0157371_11130328 | 3300013102 | Unclassified | 602 |
| 437 | Ga0157371_11480414 | 3300013102 | Unclassified | 529 |
| 438 | Ga0157370_10022730 | 3300013104 | Bacteria | 6240 |
| 439 | Ga0157370_10029233 | 3300013104 | Bacteria | 5413 |
| 440 | Ga0157370_10046619 | 3300013104 | Bacteria | 4156 |
| 441 | Ga0157370_10077871 | 3300013104 | Unclassified | 3123 |
| 442 | Ga0157370_10127572 | 3300013104 | Bacteria | 2375 |
| 443 | Ga0157370_11493376 | 3300013104 | Unclassified | 608 |
| 444 | Ga0157369_10002126 | 3300013105 | Bacteria | 23887 |
| 445 | Ga0157369_10046305 | 3300013105 | Bacteria | 4727 |
| 446 | Ga0157369_10071353 | 3300013105 | Unclassified | 3729 |
| 447 | Ga0157369_10103523 | 3300013105 | Unclassified | 3032 |
| 448 | Ga0157369_10146583 | 3300013105 | Unclassified | 2496 |
| 449 | Ga0157369_10210256 | 3300013105 | Unclassified | 2039 |
| 450 | Ga0157369_10409536 | 3300013105 | Unclassified | 1406 |
| 451 | Ga0157369_10429264 | 3300013105 | Unclassified | 1370 |
| 452 | Ga0157369_10433642 | 3300013105 | Bacteria | 1362 |
| 453 | Ga0157369_10504388 | 3300013105 | Bacteria | 1252 |
| 454 | Ga0157369_10915450 | 3300013105 | Bacteria | 899 |
| 455 | Ga0157369_11485173 | 3300013105 | Unclassified | 690 |
| 456 | Ga0157369_12521741 | 3300013105 | Unclassified | 520 |
| 457 | Ga0157374_10002028 | 3300013296 | Bacteria | 17001 |
| 458 | Ga0157374_10004774 | 3300013296 | Bacteria | 11366 |
| 459 | Ga0157374_10024050 | 3300013296 | Bacteria | 5457 |
| 460 | Ga0157374_10057816 | 3300013296 | Bacteria | 3623 |
| 461 | Ga0157374_10155157 | 3300013296 | Bacteria | 2228 |
| 462 | Ga0157374_10826482 | 3300013296 | Unclassified | 943 |
| 463 | Ga0157374_11076011 | 3300013296 | Bacteria | 824 |
| 464 | Ga0157374_12428840 | 3300013296 | Bacteria | 551 |
| 465 | Ga0157378_10036398 | 3300013297 | Bacteria | 4356 |
| 466 | Ga0157378_10090576 | 3300013297 | Bacteria | 2779 |
| 467 | Ga0163162_10025893 | 3300013306 | Bacteria | 5797 |
| 468 | Ga0163162_10066915 | 3300013306 | Unclassified | 3643 |
| 469 | Ga0163162_10539646 | 3300013306 | Unclassified | 1295 |
| 470 | Ga0163162_11027206 | 3300013306 | Bacteria | 932 |
| 471 | Ga0163162_13041912 | 3300013306 | Bacteria | 539 |
| 472 | Ga0157372_10001798 | 3300013307 | Bacteria | 23289 |
| 473 | Ga0157372_10012759 | 3300013307 | Bacteria | 8952 |
| 474 | Ga0157372_10099622 | 3300013307 | Unclassified | 3315 |
| 475 | Ga0157372_10630340 | 3300013307 | Unclassified | 1249 |
| 476 | Ga0157372_10774827 | 3300013307 | Bacteria | 1115 |
| 477 | Ga0157372_10817891 | 3300013307 | Unclassified | 1082 |
| 478 | Ga0157372_11041598 | 3300013307 | Unclassified | 947 |
| 479 | Ga0157372_11256231 | 3300013307 | Unclassified | 855 |
| 480 | Ga0157372_11816624 | 3300013307 | Unclassified | 701 |
| 481 | Ga0157372_11846839 | 3300013307 | Unclassified | 695 |
| 482 | Ga0157372_12002374 | 3300013307 | Bacteria | 666 |
| 483 | Ga0157372_12081974 | 3300013307 | Unclassified | 652 |
| 484 | Ga0157375_10011719 | 3300013308 | Bacteria | 7750 |
| 485 | Ga0157375_10108944 | 3300013308 | Bacteria | 2865 |
| 486 | Ga0157375_10221272 | 3300013308 | Bacteria | 2051 |
| 487 | Ga0157375_10347590 | 3300013308 | Bacteria | 1649 |
| 488 | Ga0157375_11201673 | 3300013308 | Unclassified | 889 |
| 489 | Ga0163163_10074390 | 3300014325 | Unclassified | 3389 |
| 490 | Ga0163163_10676210 | 3300014325 | Bacteria | 1096 |
| 491 | Ga0157380_10007497 | 3300014326 | Bacteria | 7748 |
| 492 | Ga0157380_11764076 | 3300014326 | Bacteria | 677 |
| 493 | Ga0157380_12527150 | 3300014326 | Unclassified | 579 |
| 494 | Ga0182008_10351042 | 3300014497 | Unclassified | 782 |
| 495 | Ga0182008_10546518 | 3300014497 | Unclassified | 643 |
| 496 | Ga0157377_10271907 | 3300014745 | Bacteria | 1107 |
| 497 | Ga0157377_10702284 | 3300014745 | Unclassified | 734 |
| 498 | Ga0157379_10041194 | 3300014968 | Bacteria | 4123 |
| 499 | Ga0157379_10483332 | 3300014968 | Unclassified | 1146 |
| 500 | Ga0157376_11241678 | 3300014969 | Bacteria | 774 |
| 501 | Ga0163161_10118710 | 3300017792 | Unclassified | 1985 |
| 502 | Ga0163161_10415265 | 3300017792 | Bacteria | 1081 |
| 503 | Ga0163161_11647803 | 3300017792 | Bacteria | 567 |
| 504 | Ga0207697_10012516 | 3300025315 | Unclassified | 3556 |
| 505 | Ga0207697_10045168 | 3300025315 | Unclassified | 1813 |
| 506 | Ga0207697_10089469 | 3300025315 | Unclassified | 1304 |
| 507 | Ga0207697_10499895 | 3300025315 | Unclassified | 537 |
| 508 | Ga0207656_10021640 | 3300025321 | Unclassified | 2572 |
| 509 | Ga0207656_10087368 | 3300025321 | Bacteria | 1410 |
| 510 | Ga0207656_10483109 | 3300025321 | Bacteria | 628 |
| 511 | Ga0207682_10001230 | 3300025893 | Bacteria | 11840 |
| 512 | Ga0207682_10007931 | 3300025893 | Bacteria | 4215 |
| 513 | Ga0207682_10068272 | 3300025893 | Unclassified | 1502 |
| 514 | Ga0207642_10855423 | 3300025899 | Unclassified | 581 |
| 515 | Ga0207688_10147199 | 3300025901 | Unclassified | 1389 |
| 516 | Ga0207688_10238143 | 3300025901 | Bacteria | 1100 |
| 517 | Ga0207688_10851529 | 3300025901 | Unclassified | 577 |
| 518 | Ga0207680_10000843 | 3300025903 | Bacteria | 14479 |
| 519 | Ga0207680_10016580 | 3300025903 | Unclassified | 3872 |
| 520 | Ga0207680_10032318 | 3300025903 | Bacteria | 2974 |
| 521 | Ga0207680_10044499 | 3300025903 | Unclassified | 2611 |
| 522 | Ga0207680_10095562 | 3300025903 | Bacteria | 1899 |
| 523 | Ga0207680_11020729 | 3300025903 | Bacteria | 592 |
| 524 | Ga0207647_10000652 | 3300025904 | Bacteria | 27131 |
| 525 | Ga0207647_10000953 | 3300025904 | Bacteria | 22378 |
| 526 | Ga0207647_10008914 | 3300025904 | Bacteria | 7154 |
| 527 | Ga0207647_10023651 | 3300025904 | Unclassified | 4060 |
| 528 | Ga0207647_10058917 | 3300025904 | Unclassified | 2351 |
| 529 | Ga0207647_10396093 | 3300025904 | Bacteria | 778 |
| 530 | Ga0207699_10393274 | 3300025906 | Unclassified | 986 |
| 531 | Ga0207645_10133599 | 3300025907 | Bacteria | 1616 |
| 532 | Ga0207645_10301283 | 3300025907 | Unclassified | 1067 |
| 533 | Ga0207645_10427540 | 3300025907 | Bacteria | 893 |
| 534 | Ga0207645_10628190 | 3300025907 | Bacteria | 730 |
| 535 | Ga0207643_10335423 | 3300025908 | Unclassified | 947 |
| 536 | Ga0207705_10002169 | 3300025909 | Bacteria | 15185 |
| 537 | Ga0207705_10002376 | 3300025909 | Bacteria | 14545 |
| 538 | Ga0207705_10004357 | 3300025909 | Bacteria | 10702 |
| 539 | Ga0207705_10005306 | 3300025909 | Bacteria | 9641 |
| 540 | Ga0207705_10013606 | 3300025909 | Bacteria | 5873 |
| 541 | Ga0207705_10020054 | 3300025909 | Bacteria | 4780 |
| 542 | Ga0207705_10025714 | 3300025909 | Unclassified | 4200 |
| 543 | Ga0207705_10034432 | 3300025909 | Unclassified | 3621 |
| 544 | Ga0207705_10077537 | 3300025909 | Unclassified | 2417 |
| 545 | Ga0207705_10106569 | 3300025909 | Bacteria | 2067 |
| 546 | Ga0207705_10136260 | 3300025909 | Bacteria | 1831 |
| 547 | Ga0207705_10158997 | 3300025909 | Archaea | 1697 |
| 548 | Ga0207705_10170369 | 3300025909 | Bacteria | 1639 |
| 549 | Ga0207705_10272363 | 3300025909 | Bacteria | 1295 |
| 550 | Ga0207705_10617693 | 3300025909 | Unclassified | 843 |
| 551 | Ga0207705_10711469 | 3300025909 | Bacteria | 781 |
| 552 | Ga0207705_10718704 | 3300025909 | Unclassified | 776 |
| 553 | Ga0207705_10797406 | 3300025909 | Bacteria | 733 |
| 554 | Ga0207654_10085871 | 3300025911 | Bacteria | 1906 |
| 555 | Ga0207654_10124014 | 3300025911 | Bacteria | 1626 |
| 556 | Ga0207654_10265092 | 3300025911 | Bacteria | 1157 |
| 557 | Ga0207654_10511632 | 3300025911 | Unclassified | 849 |
| 558 | Ga0207707_10060239 | 3300025912 | Unclassified | 3303 |
| 559 | Ga0207707_10147684 | 3300025912 | Bacteria | 2055 |
| 560 | Ga0207707_10363576 | 3300025912 | Bacteria | 1246 |
| 561 | Ga0207707_10832342 | 3300025912 | Unclassified | 767 |
| 562 | Ga0207707_11006606 | 3300025912 | Unclassified | 684 |
| 563 | Ga0207695_10003885 | 3300025913 | Bacteria | 20689 |
| 564 | Ga0207695_10025814 | 3300025913 | Bacteria | 6567 |
| 565 | Ga0207695_10104104 | 3300025913 | Unclassified | 2828 |
| 566 | Ga0207695_10148138 | 3300025913 | Bacteria | 2289 |
| 567 | Ga0207695_10354453 | 3300025913 | Bacteria | 1354 |
| 568 | Ga0207695_10577047 | 3300025913 | Unclassified | 1006 |
| 569 | Ga0207695_11244673 | 3300025913 | Bacteria | 624 |
| 570 | Ga0207695_11271890 | 3300025913 | Bacteria | 616 |
| 571 | Ga0207671_10044197 | 3300025914 | Bacteria | 3294 |
| 572 | Ga0207671_10190695 | 3300025914 | Bacteria | 1598 |
| 573 | Ga0207671_10274523 | 3300025914 | Bacteria | 1329 |
| 574 | Ga0207671_10771793 | 3300025914 | Bacteria | 763 |
| 575 | Ga0207693_10243812 | 3300025915 | Bacteria | 1411 |
| 576 | Ga0207660_10018117 | 3300025917 | Bacteria | 4690 |
| 577 | Ga0207660_10049838 | 3300025917 | Bacteria | 2971 |
| 578 | Ga0207660_10127398 | 3300025917 | Bacteria | 1935 |
| 579 | Ga0207660_10188865 | 3300025917 | Bacteria | 1603 |
| 580 | Ga0207660_10401201 | 3300025917 | Unclassified | 1104 |
| 581 | Ga0207660_10444678 | 3300025917 | Unclassified | 1048 |
| 582 | Ga0207662_10186164 | 3300025918 | Unclassified | 1338 |
| 583 | Ga0207662_10942420 | 3300025918 | Unclassified | 612 |
| 584 | Ga0207657_10004145 | 3300025919 | Bacteria | 15365 |
| 585 | Ga0207657_10007353 | 3300025919 | Bacteria | 11299 |
| 586 | Ga0207657_10007984 | 3300025919 | Bacteria | 10789 |
| 587 | Ga0207657_10017538 | 3300025919 | Bacteria | 6860 |
| 588 | Ga0207657_10019117 | 3300025919 | Bacteria | 6516 |
| 589 | Ga0207657_10032686 | 3300025919 | Unclassified | 4697 |
| 590 | Ga0207657_10034506 | 3300025919 | Bacteria | 4548 |
| 591 | Ga0207657_10088734 | 3300025919 | Unclassified | 2584 |
| 592 | Ga0207657_10112994 | 3300025919 | Bacteria | 2241 |
| 593 | Ga0207657_10149655 | 3300025919 | Bacteria | 1902 |
| 594 | Ga0207657_10192117 | 3300025919 | Bacteria | 1646 |
| 595 | Ga0207657_10197517 | 3300025919 | Bacteria | 1620 |
| 596 | Ga0207657_10313620 | 3300025919 | Bacteria | 1241 |
| 597 | Ga0207657_10496921 | 3300025919 | Bacteria | 956 |
| 598 | Ga0207657_10568831 | 3300025919 | Unclassified | 885 |
| 599 | Ga0207657_10571386 | 3300025919 | Bacteria | 883 |
| 600 | Ga0207649_10002353 | 3300025920 | Bacteria | 10593 |
| 601 | Ga0207649_10142148 | 3300025920 | Bacteria | 1644 |
| 602 | Ga0207649_10143038 | 3300025920 | Unclassified | 1639 |
| 603 | Ga0207649_10254084 | 3300025920 | Bacteria | 1267 |
| 604 | Ga0207649_10473279 | 3300025920 | Bacteria | 949 |
| 605 | Ga0207649_10561696 | 3300025920 | Unclassified | 874 |
| 606 | Ga0207649_10567596 | 3300025920 | Unclassified | 870 |
| 607 | Ga0207649_10783070 | 3300025920 | Unclassified | 744 |
| 608 | Ga0207649_10960406 | 3300025920 | Unclassified | 671 |
| 609 | Ga0207649_11137797 | 3300025920 | Unclassified | 616 |
| 610 | Ga0207649_11270236 | 3300025920 | Bacteria | 582 |
| 611 | Ga0207652_10010377 | 3300025921 | Bacteria | 7500 |
| 612 | Ga0207652_10041592 | 3300025921 | Bacteria | 3908 |
| 613 | Ga0207652_10041801 | 3300025921 | Bacteria | 3899 |
| 614 | Ga0207652_10413623 | 3300025921 | Bacteria | 1216 |
| 615 | Ga0207681_10018237 | 3300025923 | Unclassified | 4420 |
| 616 | Ga0207681_10067967 | 3300025923 | Bacteria | 2473 |
| 617 | Ga0207681_10110061 | 3300025923 | Unclassified | 2002 |
| 618 | Ga0207681_10304359 | 3300025923 | Unclassified | 1262 |
| 619 | Ga0207681_10861736 | 3300025923 | Bacteria | 758 |
| 620 | Ga0207694_10066176 | 3300025924 | Bacteria | 2819 |
| 621 | Ga0207694_10137148 | 3300025924 | Bacteria | 1966 |
| 622 | Ga0207694_10228626 | 3300025924 | Bacteria | 1519 |
| 623 | Ga0207694_10309723 | 3300025924 | Bacteria | 1301 |
| 624 | Ga0207694_10352310 | 3300025924 | Unclassified | 1219 |
| 625 | Ga0207694_10783744 | 3300025924 | Unclassified | 805 |
| 626 | Ga0207694_11018332 | 3300025924 | Bacteria | 701 |
| 627 | Ga0207650_10003792 | 3300025925 | Bacteria | 10337 |
| 628 | Ga0207650_10011538 | 3300025925 | Bacteria | 6085 |
| 629 | Ga0207650_10051214 | 3300025925 | Unclassified | 3055 |
| 630 | Ga0207650_10122032 | 3300025925 | Unclassified | 2030 |
| 631 | Ga0207650_10235009 | 3300025925 | Bacteria | 1480 |
| 632 | Ga0207650_10360608 | 3300025925 | Bacteria | 1197 |
| 633 | Ga0207650_10752773 | 3300025925 | Bacteria | 824 |
| 634 | Ga0207659_10001593 | 3300025926 | Bacteria | 13460 |
| 635 | Ga0207659_10003287 | 3300025926 | Bacteria | 9674 |
| 636 | Ga0207659_10032465 | 3300025926 | Unclassified | 3584 |
| 637 | Ga0207659_10200693 | 3300025926 | Bacteria | 1593 |
| 638 | Ga0207687_10036959 | 3300025927 | Unclassified | 3329 |
| 639 | Ga0207687_10848187 | 3300025927 | Unclassified | 780 |
| 640 | Ga0207700_10803648 | 3300025928 | Unclassified | 841 |
| 641 | Ga0207664_10100493 | 3300025929 | Unclassified | 2388 |
| 642 | Ga0207664_10173347 | 3300025929 | Unclassified | 1848 |
| 643 | Ga0207664_10368641 | 3300025929 | Unclassified | 1273 |
| 644 | Ga0207664_10852238 | 3300025929 | Bacteria | 819 |
| 645 | Ga0207644_10000110 | 3300025931 | Bacteria | 60867 |
| 646 | Ga0207644_10002765 | 3300025931 | Bacteria | 11299 |
| 647 | Ga0207644_10003194 | 3300025931 | Bacteria | 10553 |
| 648 | Ga0207644_10039149 | 3300025931 | Unclassified | 3344 |
| 649 | Ga0207644_10054894 | 3300025931 | Unclassified | 2870 |
| 650 | Ga0207644_10127923 | 3300025931 | Bacteria | 1941 |
| 651 | Ga0207644_10193081 | 3300025931 | Bacteria | 1602 |
| 652 | Ga0207644_10567626 | 3300025931 | Unclassified | 940 |
| 653 | Ga0207644_11284047 | 3300025931 | Unclassified | 615 |
| 654 | Ga0207690_10002722 | 3300025932 | Bacteria | 10672 |
| 655 | Ga0207690_10003887 | 3300025932 | Bacteria | 8831 |
| 656 | Ga0207690_10016417 | 3300025932 | Bacteria | 4503 |
| 657 | Ga0207690_10029863 | 3300025932 | Unclassified | 3470 |
| 658 | Ga0207690_10037846 | 3300025932 | Unclassified | 3135 |
| 659 | Ga0207690_10074186 | 3300025932 | Unclassified | 2356 |
| 660 | Ga0207690_10075092 | 3300025932 | Bacteria | 2343 |
| 661 | Ga0207690_10144553 | 3300025932 | Bacteria | 1757 |
| 662 | Ga0207690_10569438 | 3300025932 | Unclassified | 922 |
| 663 | Ga0207690_10667564 | 3300025932 | Unclassified | 853 |
| 664 | Ga0207690_10770253 | 3300025932 | Bacteria | 794 |
| 665 | Ga0207690_10781415 | 3300025932 | Unclassified | 788 |
| 666 | Ga0207690_10989438 | 3300025932 | Bacteria | 699 |
| 667 | Ga0207706_10004761 | 3300025933 | Bacteria | 12707 |
| 668 | Ga0207706_10009871 | 3300025933 | Bacteria | 8758 |
| 669 | Ga0207706_10012365 | 3300025933 | Bacteria | 7777 |
| 670 | Ga0207706_10014818 | 3300025933 | Bacteria | 7058 |
| 671 | Ga0207706_10019367 | 3300025933 | Bacteria | 6121 |
| 672 | Ga0207706_10032192 | 3300025933 | Unclassified | 4670 |
| 673 | Ga0207706_10034788 | 3300025933 | Unclassified | 4482 |
| 674 | Ga0207706_10047655 | 3300025933 | Unclassified | 3791 |
| 675 | Ga0207706_10083056 | 3300025933 | Bacteria | 2816 |
| 676 | Ga0207706_10113880 | 3300025933 | Bacteria | 2379 |
| 677 | Ga0207706_10306961 | 3300025933 | Unclassified | 1382 |
| 678 | Ga0207706_10530432 | 3300025933 | Bacteria | 1015 |
| 679 | Ga0207686_10444342 | 3300025934 | Bacteria | 996 |
| 680 | Ga0207669_10033950 | 3300025937 | Bacteria | 2885 |
| 681 | Ga0207669_10038283 | 3300025937 | Bacteria | 2760 |
| 682 | Ga0207669_10070291 | 3300025937 | Unclassified | 2194 |
| 683 | Ga0207669_10765486 | 3300025937 | Unclassified | 798 |
| 684 | Ga0207669_11352899 | 3300025937 | Unclassified | 606 |
| 685 | Ga0207669_11422892 | 3300025937 | Unclassified | 590 |
| 686 | Ga0207704_10024242 | 3300025938 | Bacteria | 3286 |
| 687 | Ga0207704_10037485 | 3300025938 | Bacteria | 2801 |
| 688 | Ga0207665_10479873 | 3300025939 | Bacteria | 958 |
| 689 | Ga0207691_10022111 | 3300025940 | Bacteria | 6000 |
| 690 | Ga0207691_10022416 | 3300025940 | Bacteria | 5956 |
| 691 | Ga0207691_10050820 | 3300025940 | Unclassified | 3793 |
| 692 | Ga0207691_10072823 | 3300025940 | Bacteria | 3099 |
| 693 | Ga0207691_10157751 | 3300025940 | Unclassified | 1992 |
| 694 | Ga0207691_10310303 | 3300025940 | Unclassified | 1354 |
| 695 | Ga0207691_10532847 | 3300025940 | Bacteria | 996 |
| 696 | Ga0207691_10702394 | 3300025940 | Unclassified | 853 |
| 697 | Ga0207691_10745571 | 3300025940 | Unclassified | 825 |
| 698 | Ga0207691_11733841 | 3300025940 | Unclassified | 505 |
| 699 | Ga0207711_10001548 | 3300025941 | Bacteria | 21289 |
| 700 | Ga0207711_10005517 | 3300025941 | Bacteria | 10698 |
| 701 | Ga0207711_10014822 | 3300025941 | Bacteria | 6477 |
| 702 | Ga0207711_10042595 | 3300025941 | Unclassified | 3868 |
| 703 | Ga0207711_10389684 | 3300025941 | Bacteria | 1293 |
| 704 | Ga0207711_10441872 | 3300025941 | Unclassified | 1210 |
| 705 | Ga0207711_10664495 | 3300025941 | Unclassified | 972 |
| 706 | Ga0207661_10001486 | 3300025944 | Bacteria | 15865 |
| 707 | Ga0207661_10055571 | 3300025944 | Bacteria | 3176 |
| 708 | Ga0207661_10130596 | 3300025944 | Bacteria | 2151 |
| 709 | Ga0207661_10623629 | 3300025944 | Bacteria | 990 |
| 710 | Ga0207679_10024893 | 3300025945 | Bacteria | 4109 |
| 711 | Ga0207679_10038329 | 3300025945 | Unclassified | 3414 |
| 712 | Ga0207679_10040138 | 3300025945 | Bacteria | 3348 |
| 713 | Ga0207679_10054031 | 3300025945 | Unclassified | 2955 |
| 714 | Ga0207679_10065791 | 3300025945 | Bacteria | 2714 |
| 715 | Ga0207679_10125806 | 3300025945 | Unclassified | 2048 |
| 716 | Ga0207679_10129361 | 3300025945 | Unclassified | 2023 |
| 717 | Ga0207679_10404071 | 3300025945 | Bacteria | 1202 |
| 718 | Ga0207679_10836391 | 3300025945 | Bacteria | 840 |
| 719 | Ga0207679_10945356 | 3300025945 | Bacteria | 789 |
| 720 | Ga0207679_11246801 | 3300025945 | Unclassified | 682 |
| 721 | Ga0207679_11340108 | 3300025945 | Unclassified | 657 |
| 722 | Ga0207679_12143552 | 3300025945 | Unclassified | 507 |
| 723 | Ga0207667_10004629 | 3300025949 | Bacteria | 16877 |
| 724 | Ga0207667_10005094 | 3300025949 | Bacteria | 16049 |
| 725 | Ga0207667_10005521 | 3300025949 | Bacteria | 15429 |
| 726 | Ga0207667_10012704 | 3300025949 | Bacteria | 9677 |
| 727 | Ga0207667_10034059 | 3300025949 | Bacteria | 5472 |
| 728 | Ga0207667_10128631 | 3300025949 | Bacteria | 2609 |
| 729 | Ga0207667_10182001 | 3300025949 | Bacteria | 2158 |
| 730 | Ga0207667_10261591 | 3300025949 | Bacteria | 1769 |
| 731 | Ga0207667_10304220 | 3300025949 | Unclassified | 1629 |
| 732 | Ga0207667_11395191 | 3300025949 | Unclassified | 674 |
| 733 | Ga0207651_10002266 | 3300025960 | Bacteria | 9135 |
| 734 | Ga0207651_10008091 | 3300025960 | Bacteria | 5650 |
| 735 | Ga0207651_10035123 | 3300025960 | Unclassified | 3255 |
| 736 | Ga0207651_10084260 | 3300025960 | Bacteria | 2302 |
| 737 | Ga0207651_10663112 | 3300025960 | Unclassified | 916 |
| 738 | Ga0207651_10708872 | 3300025960 | Unclassified | 887 |
| 739 | Ga0207651_11466213 | 3300025960 | Unclassified | 614 |
| 740 | Ga0207668_10145843 | 3300025972 | Unclassified | 1826 |
| 741 | Ga0207668_10299866 | 3300025972 | Bacteria | 1326 |
| 742 | Ga0207668_10353521 | 3300025972 | Unclassified | 1229 |
| 743 | Ga0207668_10573723 | 3300025972 | Bacteria | 980 |
| 744 | Ga0207668_12103968 | 3300025972 | Bacteria | 508 |
| 745 | Ga0207640_10018770 | 3300025981 | Bacteria | 4070 |
| 746 | Ga0207640_10051287 | 3300025981 | Bacteria | 2681 |
| 747 | Ga0207640_10051945 | 3300025981 | Unclassified | 2667 |
| 748 | Ga0207640_10060038 | 3300025981 | Unclassified | 2512 |
| 749 | Ga0207640_10081168 | 3300025981 | Bacteria | 2216 |
| 750 | Ga0207640_10221142 | 3300025981 | Bacteria | 1450 |
| 751 | Ga0207640_10352606 | 3300025981 | Bacteria | 1183 |
| 752 | Ga0207640_10439439 | 3300025981 | Unclassified | 1072 |
| 753 | Ga0207640_11108509 | 3300025981 | Unclassified | 700 |
| 754 | Ga0207658_10002182 | 3300025986 | Bacteria | 14559 |
| 755 | Ga0207658_10067481 | 3300025986 | Unclassified | 2694 |
| 756 | Ga0207658_10119661 | 3300025986 | Bacteria | 2097 |
| 757 | Ga0207658_10304657 | 3300025986 | Unclassified | 1374 |
| 758 | Ga0207658_11279023 | 3300025986 | Unclassified | 671 |
| 759 | Ga0207658_11501120 | 3300025986 | Unclassified | 616 |
| 760 | Ga0207677_10022272 | 3300026023 | Bacteria | 3891 |
| 761 | Ga0207677_10080550 | 3300026023 | Unclassified | 2333 |
| 762 | Ga0207677_10262959 | 3300026023 | Bacteria | 1407 |
| 763 | Ga0207677_10892843 | 3300026023 | Unclassified | 801 |
| 764 | Ga0207677_11070677 | 3300026023 | Bacteria | 734 |
| 765 | Ga0207703_10003041 | 3300026035 | Bacteria | 14194 |
| 766 | Ga0207703_10091420 | 3300026035 | Unclassified | 2560 |
| 767 | Ga0207639_10015848 | 3300026041 | Bacteria | 5322 |
| 768 | Ga0207639_10112796 | 3300026041 | Unclassified | 2219 |
| 769 | Ga0207639_10199104 | 3300026041 | Bacteria | 1716 |
| 770 | Ga0207639_10561876 | 3300026041 | Unclassified | 1048 |
| 771 | Ga0207639_10804321 | 3300026041 | Unclassified | 876 |
| 772 | Ga0207639_11014851 | 3300026041 | Unclassified | 777 |
| 773 | Ga0207639_11229069 | 3300026041 | Bacteria | 703 |
| 774 | Ga0207678_10003264 | 3300026067 | Bacteria | 14641 |
| 775 | Ga0207678_10007874 | 3300026067 | Bacteria | 9399 |
| 776 | Ga0207678_10043699 | 3300026067 | Bacteria | 3876 |
| 777 | Ga0207678_10043857 | 3300026067 | Bacteria | 3869 |
| 778 | Ga0207678_10045372 | 3300026067 | Unclassified | 3801 |
| 779 | Ga0207678_10165052 | 3300026067 | Bacteria | 1891 |
| 780 | Ga0207678_10202659 | 3300026067 | Bacteria | 1697 |
| 781 | Ga0207678_10897148 | 3300026067 | Bacteria | 784 |
| 782 | Ga0207678_10944390 | 3300026067 | Bacteria | 763 |
| 783 | Ga0207708_10330176 | 3300026075 | Unclassified | 1247 |
| 784 | Ga0207702_10005931 | 3300026078 | Bacteria | 10614 |
| 785 | Ga0207702_10019425 | 3300026078 | Bacteria | 5622 |
| 786 | Ga0207702_10028283 | 3300026078 | Unclassified | 4659 |
| 787 | Ga0207702_10057850 | 3300026078 | Unclassified | 3297 |
| 788 | Ga0207702_10399174 | 3300026078 | Bacteria | 1326 |
| 789 | Ga0207702_10498285 | 3300026078 | Bacteria | 1187 |
| 790 | Ga0207702_10749986 | 3300026078 | Unclassified | 964 |
| 791 | Ga0207702_11086882 | 3300026078 | Bacteria | 794 |
| 792 | Ga0207702_11490335 | 3300026078 | Bacteria | 670 |
| 793 | Ga0207702_11603136 | 3300026078 | Bacteria | 644 |
| 794 | Ga0207702_12037067 | 3300026078 | Unclassified | 564 |
| 795 | Ga0207641_10047089 | 3300026088 | Bacteria | 3636 |
| 796 | Ga0207641_10231936 | 3300026088 | Bacteria | 1716 |
| 797 | Ga0207641_10694208 | 3300026088 | Unclassified | 1002 |
| 798 | Ga0207648_10113898 | 3300026089 | Bacteria | 2376 |
| 799 | Ga0207648_10962750 | 3300026089 | Bacteria | 799 |
| 800 | Ga0207676_10007954 | 3300026095 | Bacteria | 7539 |
| 801 | Ga0207676_10029636 | 3300026095 | Unclassified | 4100 |
| 802 | Ga0207676_10425382 | 3300026095 | Unclassified | 1246 |
| 803 | Ga0207676_10578554 | 3300026095 | Bacteria | 1076 |
| 804 | Ga0207674_10002992 | 3300026116 | Bacteria | 20959 |
| 805 | Ga0207674_10006901 | 3300026116 | Bacteria | 13309 |
| 806 | Ga0207674_10007460 | 3300026116 | Bacteria | 12748 |
| 807 | Ga0207674_10089833 | 3300026116 | Bacteria | 3064 |
| 808 | Ga0207674_10139885 | 3300026116 | Bacteria | 2381 |
| 809 | Ga0207674_10204176 | 3300026116 | Bacteria | 1926 |
| 810 | Ga0207674_10291925 | 3300026116 | Bacteria | 1579 |
| 811 | Ga0207674_10630182 | 3300026116 | Unclassified | 1035 |
| 812 | Ga0207674_10732962 | 3300026116 | Bacteria | 954 |
| 813 | Ga0207675_101285357 | 3300026118 | Bacteria | 752 |
| 814 | Ga0207683_10002536 | 3300026121 | Bacteria | 15941 |
| 815 | Ga0207683_10014754 | 3300026121 | Bacteria | 6651 |
| 816 | Ga0207683_10021162 | 3300026121 | Bacteria | 5567 |
| 817 | Ga0207683_10116927 | 3300026121 | Bacteria | 2391 |
| 818 | Ga0207683_10237416 | 3300026121 | Unclassified | 1663 |
| 819 | Ga0207683_10251601 | 3300026121 | Unclassified | 1612 |
| 820 | Ga0207698_10004870 | 3300026142 | Bacteria | 8229 |
| 821 | Ga0207698_10007964 | 3300026142 | Bacteria | 6676 |
| 822 | Ga0207698_10083860 | 3300026142 | Bacteria | 2581 |
| 823 | Ga0207698_10194732 | 3300026142 | Bacteria | 1809 |
| 824 | Ga0207698_10464781 | 3300026142 | Bacteria | 1224 |
| 825 | Ga0207698_10514293 | 3300026142 | Unclassified | 1167 |
| 826 | Ga0207698_10523119 | 3300026142 | Unclassified | 1158 |
| 827 | Ga0207698_10555414 | 3300026142 | Bacteria | 1126 |
| 828 | Ga0207698_10595876 | 3300026142 | Unclassified | 1089 |
| 829 | Ga0207698_10718565 | 3300026142 | Unclassified | 995 |
| 830 | Ga0207698_10817923 | 3300026142 | Unclassified | 935 |
| 831 | Ga0207698_10881322 | 3300026142 | Bacteria | 901 |
| 832 | Ga0207698_11405912 | 3300026142 | Bacteria | 713 |
| 833 | Ga0207698_11541493 | 3300026142 | Unclassified | 680 |
| 834 | Ga0207698_12502896 | 3300026142 | Bacteria | 526 |
| 835 | Ga0209983_1080621 | 3300027665 | Bacteria | 729 |
| 836 | Ga0209971_1151775 | 3300027682 | Bacteria | 571 |
| 837 | Ga0209974_10027288 | 3300027876 | Bacteria | 1889 |
| 838 | Ga0268266_10074634 | 3300028379 | Plasmid | 2945 |
| 839 | Ga0268266_10078254 | 3300028379 | Bacteria | 2877 |
| 840 | Ga0268266_10137132 | 3300028379 | Unclassified | 2192 |
| 841 | Ga0268266_10494576 | 3300028379 | Unclassified | 1167 |
| 842 | Ga0268265_10255037 | 3300028380 | Unclassified | 1556 |
| 843 | Ga0268265_11686756 | 3300028380 | Bacteria | 639 |
| 844 | Ga0268264_10136842 | 3300028381 | Unclassified | 2179 |
| 845 | Ga0268264_11941799 | 3300028381 | Unclassified | 598 |
| 846 | Ga0265338_10436948 | 3300028800 | Unclassified | 928 |
| 847 | Ga0316182_1322975 | 3300030745 | Bacteria | 924 |
| 848 | Ga0265339_10135005 | 3300031249 | Bacteria | 1259 |
| 849 | Ga0265316_10171239 | 3300031344 | Unclassified | 1620 |
| 850 | Ga0307408_100005547 | 3300031548 | Bacteria | 8429 |
| 851 | Ga0307408_100039022 | 3300031548 | Unclassified | 3354 |
| 852 | Ga0307408_100055763 | 3300031548 | Bacteria | 2863 |
| 853 | Ga0307408_100063445 | 3300031548 | Unclassified | 2703 |
| 854 | Ga0307408_100150625 | 3300031548 | Bacteria | 1836 |
| 855 | Ga0307408_100215759 | 3300031548 | Unclassified | 1562 |
| 856 | Ga0307408_100672391 | 3300031548 | Bacteria | 928 |
| 857 | Ga0307408_101034771 | 3300031548 | Unclassified | 758 |
| 858 | Ga0307408_101088740 | 3300031548 | Bacteria | 741 |
| 859 | Ga0307408_101474684 | 3300031548 | Unclassified | 643 |
| 860 | Ga0307408_101829045 | 3300031548 | Bacteria | 581 |
| 861 | Ga0307405_10009275 | 3300031731 | Bacteria | 5036 |
| 862 | Ga0307405_10020576 | 3300031731 | Unclassified | 3690 |
| 863 | Ga0307405_10030471 | 3300031731 | Bacteria | 3164 |
| 864 | Ga0307405_10081898 | 3300031731 | Unclassified | 2111 |
| 865 | Ga0307405_10159774 | 3300031731 | Unclassified | 1594 |
| 866 | Ga0307405_10460912 | 3300031731 | Bacteria | 1010 |
| 867 | Ga0307405_10828057 | 3300031731 | Bacteria | 777 |
| 868 | Ga0307405_11013064 | 3300031731 | Unclassified | 709 |
| 869 | Ga0307405_11724838 | 3300031731 | Bacteria | 555 |
| 870 | Ga0307405_11873184 | 3300031731 | Unclassified | 534 |
| 871 | Ga0307413_10020129 | 3300031824 | Bacteria | 3541 |
| 872 | Ga0307413_10028933 | 3300031824 | Unclassified | 3093 |
| 873 | Ga0307413_10047089 | 3300031824 | Bacteria | 2569 |
| 874 | Ga0307413_10103921 | 3300031824 | Unclassified | 1885 |
| 875 | Ga0307413_10126567 | 3300031824 | Bacteria | 1741 |
| 876 | Ga0307413_10318179 | 3300031824 | Unclassified | 1187 |
| 877 | Ga0307413_10341626 | 3300031824 | Unclassified | 1152 |
| 878 | Ga0307413_10587183 | 3300031824 | Bacteria | 910 |
| 879 | Ga0307413_10711187 | 3300031824 | Unclassified | 835 |
| 880 | Ga0307410_10001568 | 3300031852 | Bacteria | 10450 |
| 881 | Ga0307410_10011884 | 3300031852 | Bacteria | 5004 |
| 882 | Ga0307410_10018254 | 3300031852 | Bacteria | 4236 |
| 883 | Ga0307410_10025365 | 3300031852 | Bacteria | 3719 |
| 884 | Ga0307410_10044486 | 3300031852 | Unclassified | 2950 |
| 885 | Ga0307410_10156468 | 3300031852 | Bacteria | 1703 |
| 886 | Ga0307410_10180811 | 3300031852 | Unclassified | 1596 |
| 887 | Ga0307410_10344942 | 3300031852 | Bacteria | 1188 |
| 888 | Ga0307410_11232592 | 3300031852 | Bacteria | 652 |
| 889 | Ga0307410_11810211 | 3300031852 | Unclassified | 542 |
| 890 | Ga0326468_10025345 | 3300031889 | Unclassified | 745 |
| 891 | Ga0307406_10021903 | 3300031901 | Bacteria | 3786 |
| 892 | Ga0307406_10052039 | 3300031901 | Bacteria | 2603 |
| 893 | Ga0307406_10101412 | 3300031901 | Unclassified | 1961 |
| 894 | Ga0307406_10159369 | 3300031901 | Bacteria | 1620 |
| 895 | Ga0307406_10200298 | 3300031901 | Bacteria | 1469 |
| 896 | Ga0307406_10619401 | 3300031901 | Unclassified | 895 |
| 897 | Ga0307406_10667324 | 3300031901 | Bacteria | 865 |
| 898 | Ga0307406_10763084 | 3300031901 | Bacteria | 813 |
| 899 | Ga0307407_10002341 | 3300031903 | Bacteria | 7377 |
| 900 | Ga0307407_10003187 | 3300031903 | Bacteria | 6651 |
| 901 | Ga0307407_10080043 | 3300031903 | Bacteria | 1973 |
| 902 | Ga0307407_10179170 | 3300031903 | Bacteria | 1403 |
| 903 | Ga0307407_10278766 | 3300031903 | Bacteria | 1157 |
| 904 | Ga0307407_10317988 | 3300031903 | Bacteria | 1091 |
| 905 | Ga0307407_10420475 | 3300031903 | Bacteria | 963 |
| 906 | Ga0307407_10688881 | 3300031903 | Bacteria | 769 |
| 907 | Ga0307407_10773385 | 3300031903 | Unclassified | 728 |
| 908 | Ga0307412_10008883 | 3300031911 | Bacteria | 5756 |
| 909 | Ga0307412_10063658 | 3300031911 | Bacteria | 2489 |
| 910 | Ga0307412_10066033 | 3300031911 | Unclassified | 2451 |
| 911 | Ga0307412_10092627 | 3300031911 | Bacteria | 2118 |
| 912 | Ga0307412_10110723 | 3300031911 | Unclassified | 1960 |
| 913 | Ga0307412_10175878 | 3300031911 | Bacteria | 1605 |
| 914 | Ga0307412_10190467 | 3300031911 | Bacteria | 1550 |
| 915 | Ga0307412_10367095 | 3300031911 | Bacteria | 1161 |
| 916 | Ga0307412_10606972 | 3300031911 | Unclassified | 927 |
| 917 | Ga0307412_10782994 | 3300031911 | Bacteria | 826 |
| 918 | Ga0307412_10844219 | 3300031911 | Unclassified | 798 |
| 919 | Ga0307412_11755316 | 3300031911 | Bacteria | 570 |
| 920 | Ga0307409_100004859 | 3300031995 | Bacteria | 7636 |
| 921 | Ga0307409_100007942 | 3300031995 | Bacteria | 6393 |
| 922 | Ga0307409_100016188 | 3300031995 | Bacteria | 4925 |
| 923 | Ga0307409_100033400 | 3300031995 | Bacteria | 3743 |
| 924 | Ga0307409_100108881 | 3300031995 | Bacteria | 2318 |
| 925 | Ga0307409_100121297 | 3300031995 | Bacteria | 2214 |
| 926 | Ga0307409_100137083 | 3300031995 | Bacteria | 2102 |
| 927 | Ga0307409_100178720 | 3300031995 | Unclassified | 1876 |
| 928 | Ga0307409_100340576 | 3300031995 | Bacteria | 1411 |
| 929 | Ga0307409_100797773 | 3300031995 | Unclassified | 951 |
| 930 | Ga0307409_100988614 | 3300031995 | Bacteria | 859 |
| 931 | Ga0307409_101404400 | 3300031995 | Bacteria | 724 |
| 932 | Ga0307416_100005056 | 3300032002 | Bacteria | 8040 |
| 933 | Ga0307416_100008626 | 3300032002 | Bacteria | 6597 |
| 934 | Ga0307416_100009112 | 3300032002 | Bacteria | 6468 |
| 935 | Ga0307416_100023233 | 3300032002 | Bacteria | 4495 |
| 936 | Ga0307416_100054225 | 3300032002 | Bacteria | 3222 |
| 937 | Ga0307416_100079034 | 3300032002 | Unclassified | 2770 |
| 938 | Ga0307416_100145705 | 3300032002 | Bacteria | 2162 |
| 939 | Ga0307416_100161728 | 3300032002 | Unclassified | 2070 |
| 940 | Ga0307416_100372770 | 3300032002 | Unclassified | 1454 |
| 941 | Ga0307416_100443931 | 3300032002 | Bacteria | 1348 |
| 942 | Ga0307416_100475550 | 3300032002 | Bacteria | 1308 |
| 943 | Ga0307416_100521990 | 3300032002 | Bacteria | 1256 |
| 944 | Ga0307416_100641203 | 3300032002 | Bacteria | 1146 |
| 945 | Ga0307416_100968289 | 3300032002 | Unclassified | 953 |
| 946 | Ga0307416_100970226 | 3300032002 | Bacteria | 952 |
| 947 | Ga0307416_102435801 | 3300032002 | Unclassified | 622 |
| 948 | Ga0307414_10007981 | 3300032004 | Bacteria | 5979 |
| 949 | Ga0307414_10026446 | 3300032004 | Bacteria | 3735 |
| 950 | Ga0307414_10071441 | 3300032004 | Bacteria | 2503 |
| 951 | Ga0307414_10083573 | 3300032004 | Unclassified | 2345 |
| 952 | Ga0307414_10250593 | 3300032004 | Bacteria | 1472 |
| 953 | Ga0307414_10427765 | 3300032004 | Unclassified | 1156 |
| 954 | Ga0307414_10453661 | 3300032004 | Bacteria | 1125 |
| 955 | Ga0307414_10522523 | 3300032004 | Bacteria | 1054 |
| 956 | Ga0307414_10895573 | 3300032004 | Unclassified | 813 |
| 957 | Ga0307414_11066125 | 3300032004 | Unclassified | 745 |
| 958 | Ga0307414_11113119 | 3300032004 | Bacteria | 729 |
| 959 | Ga0307414_11131863 | 3300032004 | Unclassified | 723 |
| 960 | Ga0307414_11345458 | 3300032004 | Unclassified | 663 |
| 961 | Ga0307414_11557633 | 3300032004 | Unclassified | 615 |
| 962 | Ga0307411_10003367 | 3300032005 | Bacteria | 7404 |
| 963 | Ga0307411_10005225 | 3300032005 | Bacteria | 6356 |
| 964 | Ga0307411_10015557 | 3300032005 | Unclassified | 4278 |
| 965 | Ga0307411_10027219 | 3300032005 | Unclassified | 3455 |
| 966 | Ga0307411_10074530 | 3300032005 | Unclassified | 2313 |
| 967 | Ga0307411_10112517 | 3300032005 | Unclassified | 1951 |
| 968 | Ga0307411_10181216 | 3300032005 | Bacteria | 1599 |
| 969 | Ga0307411_10289444 | 3300032005 | Bacteria | 1308 |
| 970 | Ga0307411_10442295 | 3300032005 | Bacteria | 1085 |
| 971 | Ga0307411_10891694 | 3300032005 | Unclassified | 789 |
| 972 | Ga0307411_10919008 | 3300032005 | Unclassified | 778 |
| 973 | Ga0307411_11319163 | 3300032005 | Bacteria | 658 |
| 974 | Ga0307411_11500223 | 3300032005 | Unclassified | 619 |
| 975 | Ga0307415_100006068 | 3300032126 | Bacteria | 6479 |
| 976 | Ga0307415_100008308 | 3300032126 | Bacteria | 5746 |
| 977 | Ga0307415_100009900 | 3300032126 | Bacteria | 5373 |
| 978 | Ga0307415_100012346 | 3300032126 | Bacteria | 4936 |
| 979 | Ga0307415_100018520 | 3300032126 | Bacteria | 4208 |
| 980 | Ga0307415_100022724 | 3300032126 | Unclassified | 3877 |
| 981 | Ga0307415_100050004 | 3300032126 | Bacteria | 2830 |
| 982 | Ga0307415_100079700 | 3300032126 | Bacteria | 2334 |
| 983 | Ga0307415_100122117 | 3300032126 | Bacteria | 1955 |
| 984 | Ga0373933_0865287 | 3300035724 | Unclassified | 595 |
| 985 | Ga0395899_0000274 | 3300037312 | Bacteria | 67210 |
| 986 | Ga0395899_0002381 | 3300037312 | Bacteria | 15277 |
| 987 | Ga0395899_0012400 | 3300037312 | Bacteria | 6529 |
| 988 | Ga0395899_0014700 | 3300037312 | Bacteria | 5973 |
| 989 | Ga0395899_0045490 | 3300037312 | Bacteria | 3270 |
| 990 | Ga0395899_0054314 | 3300037312 | Bacteria | 2964 |
| 991 | Ga0395899_0063719 | 3300037312 | Plasmid | 2711 |
| 992 | Ga0395899_0079007 | 3300037312 | Unclassified | 2397 |
| 993 | Ga0395899_0147584 | 3300037312 | Bacteria | 1669 |
| 994 | Ga0395899_0191971 | 3300037312 | Unclassified | 1429 |
| 995 | Ga0395899_0274081 | 3300037312 | Unclassified | 1150 |
| 996 | Ga0395899_0282706 | 3300037312 | Unclassified | 1128 |
| 997 | Ga0395899_0310779 | 3300037312 | Bacteria | 1064 |
| 998 | Ga0395899_0486468 | 3300037312 | Unclassified | 803 |
| 999 | Ga0395899_0598541 | 3300037312 | Unclassified | 702 |
| 1000 | Ga0395899_0613657 | 3300037312 | Bacteria | 691 |
| 1001 | Ga0395899_0623125 | 3300037312 | Bacteria | 685 |
| 1002 | Ga0395899_0990106 | 3300037312 | Unclassified | 508 |
| 1003 | Ga0395900_0000595 | 3300037418 | Bacteria | 49632 |
| 1004 | Ga0395900_0004150 | 3300037418 | Bacteria | 15419 |
| 1005 | Ga0395900_0009492 | 3300037418 | Bacteria | 9975 |
| 1006 | Ga0395900_0021697 | 3300037418 | Bacteria | 6566 |
| 1007 | Ga0395900_0032009 | 3300037418 | Bacteria | 5406 |
| 1008 | Ga0395900_0051312 | 3300037418 | Bacteria | 4249 |
| 1009 | Ga0395900_0061474 | 3300037418 | Unclassified | 3861 |
| 1010 | Ga0395900_0069099 | 3300037418 | Bacteria | 3630 |
| 1011 | Ga0395900_0089208 | 3300037418 | Unclassified | 3170 |
| 1012 | Ga0395900_0094415 | 3300037418 | Unclassified | 3072 |
| 1013 | Ga0395900_0112993 | 3300037418 | Unclassified | 2788 |
| 1014 | Ga0395900_0128824 | 3300037418 | Unclassified | 2594 |
| 1015 | Ga0395900_0132958 | 3300037418 | Bacteria | 2549 |
| 1016 | Ga0395900_0166847 | 3300037418 | Bacteria | 2243 |
| 1017 | Ga0395900_0203915 | 3300037418 | Bacteria | 1999 |
| 1018 | Ga0395900_0227571 | 3300037418 | Unclassified | 1877 |
| 1019 | Ga0395900_0261101 | 3300037418 | Bacteria | 1730 |
| 1020 | Ga0395900_0299401 | 3300037418 | Bacteria | 1595 |
| 1021 | Ga0395900_0314767 | 3300037418 | Bacteria | 1547 |
| 1022 | Ga0395900_0331042 | 3300037418 | Bacteria | 1501 |
| 1023 | Ga0395900_0371279 | 3300037418 | Unclassified | 1400 |
| 1024 | Ga0395900_0373622 | 3300037418 | Bacteria | 1395 |
| 1025 | Ga0395900_0395668 | 3300037418 | Bacteria | 1347 |
| 1026 | Ga0395900_0421488 | 3300037418 | Bacteria | 1295 |
| 1027 | Ga0395900_0486684 | 3300037418 | Unclassified | 1186 |
| 1028 | Ga0395900_0573213 | 3300037418 | Unclassified | 1071 |
| 1029 | Ga0395900_0594178 | 3300037418 | Unclassified | 1048 |
| 1030 | Ga0395900_0635141 | 3300037418 | Bacteria | 1005 |
| 1031 | Ga0395900_0650941 | 3300037418 | Unclassified | 990 |
| 1032 | Ga0395900_0810782 | 3300037418 | Unclassified | 863 |
| 1033 | Ga0395900_0878936 | 3300037418 | Unclassified | 820 |
| 1034 | Ga0395900_0996329 | 3300037418 | Bacteria | 758 |
| 1035 | Ga0395900_1280108 | 3300037418 | Unclassified | 647 |
| 1036 | Ga0395900_1611493 | 3300037418 | Unclassified | 560 |
| 1037 | Ga0395900_1631453 | 3300037418 | Unclassified | 556 |
| 1038 | Ga0395900_1658055 | 3300037418 | Unclassified | 550 |
| 1039 | Ga0395900_1662829 | 3300037418 | Unclassified | 549 |
| 1040 | Ga0395898_0005114 | 3300037466 | Bacteria | 14209 |
| 1041 | Ga0395898_0006829 | 3300037466 | Bacteria | 12138 |
| 1042 | Ga0395898_0017744 | 3300037466 | Bacteria | 7263 |
| 1043 | Ga0395898_0020380 | 3300037466 | Bacteria | 6733 |
| 1044 | Ga0395898_0024914 | 3300037466 | Bacteria | 6031 |
| 1045 | Ga0395898_0026720 | 3300037466 | Bacteria | 5802 |
| 1046 | Ga0395898_0034810 | 3300037466 | Bacteria | 5013 |
| 1047 | Ga0395898_0055067 | 3300037466 | Bacteria | 3879 |
| 1048 | Ga0395898_0062738 | 3300037466 | Bacteria | 3608 |
| 1049 | Ga0395898_0064370 | 3300037466 | Bacteria | 3556 |
| 1050 | Ga0395898_0127100 | 3300037466 | Bacteria | 2442 |
| 1051 | Ga0395898_0161732 | 3300037466 | Unclassified | 2141 |
| 1052 | Ga0395898_0205883 | 3300037466 | Unclassified | 1877 |
| 1053 | Ga0395898_0242652 | 3300037466 | Bacteria | 1718 |
| 1054 | Ga0395898_0288722 | 3300037466 | Unclassified | 1565 |
| 1055 | Ga0395898_0827875 | 3300037466 | Unclassified | 865 |
| 1056 | Ga0395898_1043458 | 3300037466 | Unclassified | 752 |
| 1057 | Ga0395898_1106341 | 3300037466 | Bacteria | 725 |
| 1058 | Ga0395898_1768746 | 3300037466 | Unclassified | 540 |
| 1059 | Ga0395898_1795613 | 3300037466 | Bacteria | 534 |
| 1060 | Ga0395905_0000575 | 3300037471 | Bacteria | 49664 |
| 1061 | Ga0395905_0002328 | 3300037471 | Bacteria | 21216 |
| 1062 | Ga0395905_0003746 | 3300037471 | Bacteria | 16115 |
| 1063 | Ga0395905_0006198 | 3300037471 | Bacteria | 12067 |
| 1064 | Ga0395905_0010952 | 3300037471 | Bacteria | 8777 |
| 1065 | Ga0395905_0011179 | 3300037471 | Bacteria | 8679 |
| 1066 | Ga0395905_0020706 | 3300037471 | Bacteria | 6228 |
| 1067 | Ga0395905_0023907 | 3300037471 | Bacteria | 5769 |
| 1068 | Ga0395905_0025512 | 3300037471 | Bacteria | 5574 |
| 1069 | Ga0395905_0031595 | 3300037471 | Unclassified | 4984 |
| 1070 | Ga0395905_0034430 | 3300037471 | Unclassified | 4756 |
| 1071 | Ga0395905_0036398 | 3300037471 | Bacteria | 4622 |
| 1072 | Ga0395905_0045310 | 3300037471 | Unclassified | 4125 |
| 1073 | Ga0395905_0055245 | 3300037471 | Unclassified | 3716 |
| 1074 | Ga0395905_0064924 | 3300037471 | Bacteria | 3417 |
| 1075 | Ga0395905_0091485 | 3300037471 | Bacteria | 2852 |
| 1076 | Ga0395905_0111933 | 3300037471 | Unclassified | 2563 |
| 1077 | Ga0395905_0121272 | 3300037471 | Bacteria | 2457 |
| 1078 | Ga0395905_0129395 | 3300037471 | Bacteria | 2374 |
| 1079 | Ga0395905_0137976 | 3300037471 | Bacteria | 2294 |
| 1080 | Ga0395905_0184151 | 3300037471 | Unclassified | 1960 |
| 1081 | Ga0395905_0224309 | 3300037471 | Unclassified | 1758 |
| 1082 | Ga0395905_0234800 | 3300037471 | Bacteria | 1714 |
| 1083 | Ga0395905_0268877 | 3300037471 | Bacteria | 1590 |
| 1084 | Ga0395905_0309714 | 3300037471 | Bacteria | 1467 |
| 1085 | Ga0395905_0380127 | 3300037471 | Bacteria | 1306 |
| 1086 | Ga0395905_0439830 | 3300037471 | Unclassified | 1201 |
| 1087 | Ga0395905_0532218 | 3300037471 | Bacteria | 1076 |
| 1088 | Ga0395905_0567976 | 3300037471 | Bacteria | 1036 |
| 1089 | Ga0395905_1080686 | 3300037471 | Unclassified | 705 |
| 1090 | Ga0395905_1403264 | 3300037471 | Unclassified | 602 |
| 1091 | Ga0395905_1703258 | 3300037471 | Unclassified | 536 |
| 1092 | Ga0395901_0001391 | 3300038443 | Bacteria | 25281 |
| 1093 | Ga0395901_0003881 | 3300038443 | Bacteria | 15029 |
| 1094 | Ga0395901_0004508 | 3300038443 | Bacteria | 14046 |
| 1095 | Ga0395901_0005012 | 3300038443 | Bacteria | 13368 |
| 1096 | Ga0395901_0005682 | 3300038443 | Bacteria | 12622 |
| 1097 | Ga0395901_0014443 | 3300038443 | Bacteria | 8036 |
| 1098 | Ga0395901_0023949 | 3300038443 | Bacteria | 6263 |
| 1099 | Ga0395901_0031335 | 3300038443 | Bacteria | 5483 |
| 1100 | Ga0395901_0034344 | 3300038443 | Bacteria | 5237 |
| 1101 | Ga0395901_0034381 | 3300038443 | Bacteria | 5234 |
| 1102 | Ga0395901_0036892 | 3300038443 | Bacteria | 5053 |
| 1103 | Ga0395901_0037861 | 3300038443 | Unclassified | 4987 |
| 1104 | Ga0395901_0116974 | 3300038443 | Unclassified | 2801 |
| 1105 | Ga0395901_0132967 | 3300038443 | Unclassified | 2614 |
| 1106 | Ga0395901_0219510 | 3300038443 | Bacteria | 1987 |
| 1107 | Ga0395901_0309422 | 3300038443 | Bacteria | 1636 |
| 1108 | Ga0395901_0396393 | 3300038443 | Unclassified | 1418 |
| 1109 | Ga0395901_0437559 | 3300038443 | Unclassified | 1339 |
| 1110 | Ga0395901_0555126 | 3300038443 | Bacteria | 1163 |
| 1111 | Ga0395901_0574277 | 3300038443 | Bacteria | 1140 |
| 1112 | Ga0395901_0623278 | 3300038443 | Bacteria | 1085 |
| 1113 | Ga0395901_0634961 | 3300038443 | Bacteria | 1073 |
| 1114 | Ga0395901_0659236 | 3300038443 | Bacteria | 1049 |
| 1115 | Ga0395901_0831040 | 3300038443 | Unclassified | 910 |
| 1116 | Ga0395901_0878926 | 3300038443 | Unclassified | 879 |
| 1117 | Ga0395901_1144632 | 3300038443 | Unclassified | 746 |
| 1118 | Ga0395901_1250855 | 3300038443 | Bacteria | 706 |
| 1119 | Ga0395901_1262653 | 3300038443 | Unclassified | 702 |
| 1120 | Ga0395901_1468921 | 3300038443 | Unclassified | 638 |
| 1121 | Ga0395901_1721376 | 3300038443 | Unclassified | 578 |
| 1122 | Ga0436365_0736792 | 3300039437 | Bacteria | 14837 |
| 1123 | Ga0436365_0774065 | 3300039437 | Unclassified | 638 |
| 1124 | Ga0436363_0542870 | 3300039450 | Unclassified | 1830 |
| 1125 | Ga0436362_0401320 | 3300039453 | Unclassified | 524 |
| 1126 | Ga0451798_0883369 | 3300041458 | Unclassified | 574 |
| 1127 | Ga0451845_0093183 | 3300041501 | Unclassified | 658 |
| 1128 | Ga0439445_0109023 | 3300042004 | Unclassified | 789 |
| 1129 | Ga0439448_0003296 | 3300042005 | Bacteria | 4464 |
| 1130 | Ga0439448_0352572 | 3300042005 | Bacteria | 525 |
| 1131 | Ga0439432_123679 | 3300042006 | Unclassified | 765 |
| 1132 | Ga0439449_0105076 | 3300042007 | Bacteria | 1045 |
| 1133 | Ga0439452_139586 | 3300042010 | Unclassified | 512 |
| 1134 | Ga0439455_0129337 | 3300042012 | Unclassified | 711 |
| 1135 | Ga0450920_014143 | 3300042122 | Bacteria | 1507 |
| 1136 | Ga0439458_0000082 | 3300042157 | Bacteria | 17715 |
| 1137 | Ga0466972_0042978 | 3300044658 | Unclassified | 2195 |
| 1138 | Ga0466972_0361720 | 3300044658 | Unclassified | 679 |
| 1139 | Ga0466965_0774859 | 3300044683 | Bacteria | 554 |
| 1140 | Ga0466966_0045888 | 3300044684 | Bacteria | 2792 |
| 1141 | Ga0466966_0226970 | 3300044684 | Unclassified | 1127 |
| 1142 | Ga0466966_0591890 | 3300044684 | Unclassified | 668 |
| 1143 | Ga0466961_0032451 | 3300044693 | Unclassified | 3356 |
| 1144 | Ga0466961_0122345 | 3300044693 | Bacteria | 1633 |
| 1145 | Ga0466961_0564414 | 3300044693 | Unclassified | 685 |
| 1146 | Ga0466963_0191332 | 3300044694 | Bacteria | 1429 |
| 1147 | Ga0466963_0202006 | 3300044694 | Bacteria | 1390 |
| 1148 | Ga0466963_0304280 | 3300044694 | Bacteria | 1121 |
| 1149 | Ga0466963_0320705 | 3300044694 | Unclassified | 1090 |
| 1150 | Ga0466963_0492386 | 3300044694 | Bacteria | 865 |
| 1151 | Ga0453684_0973996 | 3300044712 | Bacteria | 904 |
| 1152 | Ga0466971_0012442 | 3300044719 | Bacteria | 3730 |
| 1153 | Ga0466971_0350897 | 3300044719 | Unclassified | 714 |
| 1154 | Ga0466970_0037992 | 3300044765 | Bacteria | 2554 |
| 1155 | Ga0466970_0354545 | 3300044765 | Bacteria | 833 |
| 1156 | Ga0466970_0629636 | 3300044765 | Bacteria | 623 |
| 1157 | Ga0466957_0019065 | 3300044842 | Unclassified | 4034 |
| 1158 | Ga0466957_0469993 | 3300044842 | Unclassified | 869 |
| 1159 | Ga0466957_0754840 | 3300044842 | Bacteria | 689 |
| 1160 | Ga0466957_0979015 | 3300044842 | Unclassified | 607 |
| 1161 | Ga0466957_1147276 | 3300044842 | Unclassified | 561 |
| 1162 | Ga0466957_1254086 | 3300044842 | Unclassified | 537 |
| 1163 | Ga0466960_0070364 | 3300044901 | Bacteria | 1740 |
| 1164 | Ga0466959_0007425 | 3300045049 | Bacteria | 7689 |
| 1165 | Ga0466959_0031930 | 3300045049 | Unclassified | 3898 |
| 1166 | Ga0466959_0303826 | 3300045049 | Unclassified | 1092 |
| 1167 | Ga0466959_0700351 | 3300045049 | Bacteria | 679 |
| 1168 | Ga0466959_0781340 | 3300045049 | Unclassified | 639 |
| 1169 | Ga0466959_0974987 | 3300045049 | Bacteria | 565 |
| 1170 | Ga0466958_0014628 | 3300045836 | Bacteria | 4480 |
| 1171 | Ga0466958_0066871 | 3300045836 | Bacteria | 2195 |
| 1172 | Ga0466958_0190920 | 3300045836 | Bacteria | 1302 |
| 1173 | Ga0466958_0225463 | 3300045836 | Bacteria | 1196 |
| 1174 | Ga0466958_0284637 | 3300045836 | Bacteria | 1060 |
| 1175 | Ga0466958_0324106 | 3300045836 | Unclassified | 990 |
| 1176 | Ga0466967_0132311 | 3300045976 | Bacteria | 2317 |
| 1177 | Ga0466967_0139830 | 3300045976 | Unclassified | 2254 |
| 1178 | Ga0466967_0180776 | 3300045976 | Unclassified | 1989 |
| 1179 | Ga0466967_2088876 | 3300045976 | Unclassified | 563 |
| 1180 | Ga0495580_0733381 | 3300046472 | Unclassified | 645 |
| 1181 | Ga0495585_0330632 | 3300046492 | Bacteria | 744 |
| 1182 | Ga0495620_0051741 | 3300046515 | Bacteria | 1747 |
| 1183 | Ga0495643_0035553 | 3300046522 | Unclassified | 2743 |
| 1184 | Ga0495663_0066716 | 3300046525 | Unclassified | 1140 |
| 1185 | Ga0495598_0144965 | 3300046537 | Unclassified | 824 |
| 1186 | Ga0495598_0300676 | 3300046537 | Bacteria | 607 |
| 1187 | Ga0495621_0014694 | 3300046539 | Unclassified | 2483 |
| 1188 | Ga0495597_0229925 | 3300046542 | Unclassified | 734 |
| 1189 | Ga0495633_0304744 | 3300046558 | Unclassified | 723 |
| 1190 | Ga0495668_0024802 | 3300046616 | Bacteria | 3410 |
| 1191 | Ga0495669_0001241 | 3300046684 | Bacteria | 10595 |
| 1192 | Ga0495669_0010849 | 3300046684 | Bacteria | 3857 |
| 1193 | Ga0495669_0533461 | 3300046684 | Bacteria | 571 |
| 1194 | Ga0495670_0050424 | 3300046691 | Unclassified | 2083 |
| 1195 | Ga0495680_0963749 | 3300047322 | Unclassified | 547 |
| 1196 | Ga0495687_196894 | 3300047443 | Unclassified | 643 |
| 1197 | Ga0495677_0021289 | 3300047445 | Unclassified | 2350 |
| 1198 | Ga0495677_0301144 | 3300047445 | Bacteria | 631 |
| 1199 | Ga0495602_0417670 | 3300048088 | Unclassified | 953 |
| 1200 | Ga0496100_0096807 | 3300048903 | Bacteria | 2025 |
| 1201 | Ga0496101_0023068 | 3300048904 | Bacteria | 4294 |
| 1202 | Ga0496101_1605422 | 3300048904 | Unclassified | 505 |
| 1203 | Ga0496107_0166859 | 3300048910 | Unclassified | 1633 |
| 1204 | Ga0496108_0231364 | 3300048911 | Bacteria | 1607 |
| 1205 | Ga0496108_0362431 | 3300048911 | Unclassified | 1265 |
| 1206 | Ga0496108_0456533 | 3300048911 | Unclassified | 1116 |
| 1207 | Ga0496108_0846647 | 3300048911 | Unclassified | 787 |
| 1208 | Ga0496109_0037881 | 3300048912 | Bacteria | 4358 |
| 1209 | Ga0496109_0172543 | 3300048912 | Bacteria | 2029 |
| 1210 | Ga0496109_0331685 | 3300048912 | Bacteria | 1436 |
| 1211 | Ga0496109_1822904 | 3300048912 | Unclassified | 541 |
| 1212 | Ga0496110_0003415 | 3300048913 | Bacteria | 12149 |
| 1213 | Ga0496110_0038741 | 3300048913 | Unclassified | 4149 |
| 1214 | Ga0496111_0045856 | 3300048914 | Unclassified | 3146 |
| 1215 | Ga0496111_0172451 | 3300048914 | Bacteria | 1607 |
| 1216 | Ga0496111_0193719 | 3300048914 | Unclassified | 1511 |
| 1217 | Ga0496112_0052100 | 3300048915 | Bacteria | 4016 |
| 1218 | Ga0496112_0076194 | 3300048915 | Unclassified | 3317 |
| 1219 | Ga0496112_0088102 | 3300048915 | Unclassified | 3072 |
| 1220 | Ga0496113_0378992 | 3300048916 | Bacteria | 1135 |
| 1221 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 1222 | Ga0496114_0329602 | 3300048917 | Unclassified | 1349 |
| 1223 | Ga0496115_0040388 | 3300048918 | Unclassified | 3709 |
| 1224 | Ga0501033_0007786 | 3300049570 | Bacteria | 8299 |
| 1225 | Ga0501034_0512577 | 3300049571 | Bacteria | 1112 |
| 1226 | Ga0501037_0309062 | 3300049573 | Unclassified | 1096 |
| 1227 | Ga0501038_0428397 | 3300049574 | Unclassified | 1020 |
| 1228 | Ga0501043_0655793 | 3300049579 | Unclassified | 770 |
| 1229 | Ga0501047_0083530 | 3300049581 | Unclassified | 3069 |
| 1230 | Ga0501069_0297965 | 3300049585 | Unclassified | 945 |
| 1231 | Ga0501202_077640 | 3300049652 | Bacteria | 775 |
| 1232 | Ga0501207_008383 | 3300049654 | Unclassified | 1493 |
| 1233 | Ga0501209_052778 | 3300049656 | Bacteria | 1114 |
| 1234 | Ga0501209_144547 | 3300049656 | Unclassified | 714 |
| 1235 | Ga0501216_082991 | 3300049660 | Bacteria | 681 |
| 1236 | Ga0501216_162071 | 3300049660 | Unclassified | 537 |
| 1237 | Ga0501235_001852 | 3300049669 | Bacteria | 4524 |
| 1238 | Ga0501239_002286 | 3300049672 | Unclassified | 1726 |
| 1239 | Ga0501240_099622 | 3300049673 | Unclassified | 558 |
| 1240 | Ga0501249_004971 | 3300049679 | Bacteria | 2712 |
| 1241 | Ga0501249_027414 | 3300049679 | Unclassified | 1260 |
| 1242 | Ga0501257_064775 | 3300049686 | Bacteria | 927 |
| 1243 | Ga0501221_009292 | 3300049704 | Bacteria | 1723 |
| 1244 | Ga0501080_0755275 | 3300049742 | Bacteria | 855 |
| 1245 | Ga0501232_013604 | 3300049757 | Unclassified | 965 |
| 1246 | Ga0501262_003659 | 3300049759 | Unclassified | 1771 |
| 1247 | Ga0501263_011872 | 3300049760 | Unclassified | 1086 |
| 1248 | Ga0501270_075996 | 3300049767 | Unclassified | 659 |
| 1249 | Ga0501279_026914 | 3300049775 | Unclassified | 841 |
| 1250 | Ga0501035_0574197 | 3300049822 | Unclassified | 921 |
| 1251 | Ga0501044_0050423 | 3300049823 | Unclassified | 4294 |
| 1252 | Ga0501212_041352 | 3300049851 | Unclassified | 763 |
| 1253 | Ga0500643_000008 | 3300053087 | Bacteria | 457931 |
| 1254 | Ga0500556_0207686 | 3300053104 | Bacteria | 773 |
| 1255 | Ga0500568_0092573 | 3300053139 | Bacteria | 1139 |
| 1256 | Ga0500616_0003431 | 3300053153 | Bacteria | 12107 |
| 1257 | Ga0500645_094592 | 3300053730 | Unclassified | 846 |
| 1258 | Ga0590071_084186 | 3300059421 | Bacteria | 792 |
| 1259 | Ga0590077_148725 | 3300059426 | Unclassified | 560 |
| 1260 | Ga0466962_0079769 | 3300061719 | Bacteria | 1565 |
| 1261 | Ga0157373_10579497 | |||
| 1262 | MBSR1b_contig_3302548 | |||
| 1263 | MBSR1b_contig_8811798 | |||
| 1264 | JGI24741J21665_1001705 | |||
| 1265 | JGI24741J21665_1018577 | |||
| 1266 | JGI24741J21665_1032167 | |||
| 1267 | JGI24740J21852_10002403 | |||
| 1268 | JGI24740J21852_10002753 | |||
| 1269 | JGI24740J21852_10004394 | |||
| 1270 | JGI24740J21852_10037551 | |||
| 1271 | JGI24739J22299_10011726 | |||
| 1272 | JGI24739J22299_10087188 | |||
| 1273 | JGI24737J22298_10228638 | |||
| 1274 | JGI24735J21928_10002010 | |||
| 1275 | JGI24735J21928_10005515 | |||
| 1276 | JGI24735J21928_10016635 | |||
| 1277 | JGI24738J21930_10081169 | |||
| 1278 | JGI24738J21930_10109290 | |||
| 1279 | JGI24744J21845_10039746 | |||
| 1280 | JGI24033J26618_1002423 | |||
| 1281 | JGI24034J26672_10066758 | |||
| 1282 | JGI25406J46586_10068768 | |||
| 1283 | rootH2_10152215 | |||
| 1284 | rootH1_10137416 | |||
| 1285 | rootH1_10287373 | |||
| 1286 | rootH1_10318114 | |||
| 1287 | Ga0065704_10703317 | |||
| 1288 | Ga0065712_10074159 | |||
| 1289 | Ga0065712_10457008 | |||
| 1290 | Ga0065715_10233102 | |||
| 1291 | Ga0065715_10804293 | |||
| 1292 | Ga0070658_10007081 | |||
| 1293 | Ga0070658_10014784 | |||
| 1294 | Ga0070658_10025215 | |||
| 1295 | Ga0070658_10027650 | |||
| 1296 | Ga0070658_10028240 | |||
| 1297 | Ga0070658_10039082 | |||
| 1298 | Ga0070658_10089250 | |||
| 1299 | Ga0070658_10094639 | |||
| 1300 | Ga0070658_10135423 | |||
| 1301 | Ga0070658_10262089 | |||
| 1302 | Ga0070658_10285877 | |||
| 1303 | Ga0070658_10337153 | |||
| 1304 | Ga0070658_10455540 | |||
| 1305 | Ga0070658_10504585 | |||
| 1306 | Ga0070658_10563937 | |||
| 1307 | Ga0070658_10657603 | |||
| 1308 | Ga0070658_10790105 | |||
| 1309 | Ga0070658_10829332 | |||
| 1310 | Ga0070658_11002536 | |||
| 1311 | Ga0070658_11188891 | |||
| 1312 | Ga0070658_11805415 | |||
| 1313 | Ga0070658_11826208 | |||
| 1314 | Ga0070676_10019977 | |||
| 1315 | Ga0070676_10111754 | |||
| 1316 | Ga0070676_10140170 | |||
| 1317 | Ga0070676_10361489 | |||
| 1318 | Ga0070676_10607658 | |||
| 1319 | Ga0070676_10721107 | |||
| 1320 | Ga0070676_10867567 | |||
| 1321 | Ga0070683_100002629 | |||
| 1322 | Ga0070683_100016104 | |||
| 1323 | Ga0070683_100020068 | |||
| 1324 | Ga0070683_100058817 | |||
| 1325 | Ga0070683_100310149 | |||
| 1326 | Ga0070683_100889463 | |||
| 1327 | Ga0070690_100005963 | |||
| 1328 | Ga0070690_100358553 | |||
| 1329 | Ga0070670_100000482 | |||
| 1330 | Ga0070670_100013946 | |||
| 1331 | Ga0070670_100021632 | |||
| 1332 | Ga0070670_100043866 | |||
| 1333 | Ga0070670_100068780 | |||
| 1334 | Ga0070670_100282551 | |||
| 1335 | Ga0070670_100464617 | |||
| 1336 | Ga0070670_101403585 | |||
| 1337 | Ga0070670_101677358 | |||
| 1338 | Ga0070677_10000655 | |||
| 1339 | Ga0070677_10002714 | |||
| 1340 | Ga0070677_10032154 | |||
| 1341 | Ga0068869_101288944 | |||
| 1342 | Ga0070666_10001302 | |||
| 1343 | Ga0070666_10025157 | |||
| 1344 | Ga0070666_10027996 | |||
| 1345 | Ga0070666_10044734 | |||
| 1346 | Ga0070666_10107580 | |||
| 1347 | Ga0070666_10184203 | |||
| 1348 | Ga0070666_10196826 | |||
| 1349 | Ga0070666_10991246 | |||
| 1350 | Ga0070680_100020196 | |||
| 1351 | Ga0070680_100035425 | |||
| 1352 | Ga0070680_100065927 | |||
| 1353 | Ga0070680_100067337 | |||
| 1354 | Ga0070680_100152355 | |||
| 1355 | Ga0070680_100260812 | |||
| 1356 | Ga0070682_100044647 | |||
| 1357 | Ga0070682_100307230 | |||
| 1358 | Ga0070682_101477164 | |||
| 1359 | Ga0070682_101490639 | |||
| 1360 | Ga0068868_100003463 | |||
| 1361 | Ga0068868_100079365 | |||
| 1362 | Ga0068868_100321489 | |||
| 1363 | Ga0068868_101145736 | |||
| 1364 | Ga0070660_100003869 | |||
| 1365 | Ga0070660_100006193 | |||
| 1366 | Ga0070660_100007812 | |||
| 1367 | Ga0070660_100011819 | |||
| 1368 | Ga0070660_100019162 | |||
| 1369 | Ga0070660_100029227 | |||
| 1370 | Ga0070660_100058036 | |||
| 1371 | Ga0070660_100084264 | |||
| 1372 | Ga0070660_100085989 | |||
| 1373 | Ga0070660_100116100 | |||
| 1374 | Ga0070660_100200462 | |||
| 1375 | Ga0070660_100211081 | |||
| 1376 | Ga0070660_100250581 | |||
| 1377 | Ga0070660_100349462 | |||
| 1378 | Ga0070660_100357649 | |||
| 1379 | Ga0070660_100404566 | |||
| 1380 | Ga0070660_100533460 | |||
| 1381 | Ga0070660_101201879 | |||
| 1382 | Ga0070660_101380024 | |||
| 1383 | Ga0070691_10008688 | |||
| 1384 | Ga0070687_100255805 | |||
| 1385 | Ga0070687_100574639 | |||
| 1386 | Ga0070687_100777092 | |||
| 1387 | Ga0070661_100002823 | |||
| 1388 | Ga0070661_100003992 | |||
| 1389 | Ga0070661_100005291 | |||
| 1390 | Ga0070661_100145097 | |||
| 1391 | Ga0070661_100230052 | |||
| 1392 | Ga0070661_100333460 | |||
| 1393 | Ga0070661_100524477 | |||
| 1394 | Ga0070661_100605005 | |||
| 1395 | Ga0070661_100641574 | |||
| 1396 | Ga0070661_101708227 | |||
| 1397 | Ga0070692_10020700 | |||
| 1398 | Ga0070668_100153482 | |||
| 1399 | Ga0070668_100246367 | |||
| 1400 | Ga0070668_100398534 | |||
| 1401 | Ga0070668_100775332 | |||
| 1402 | Ga0070669_100026431 | |||
| 1403 | Ga0070669_100057008 | |||
| 1404 | Ga0070669_100319587 | |||
| 1405 | Ga0070669_100417486 | |||
| 1406 | Ga0070669_100760040 | |||
| 1407 | Ga0070669_101380266 | |||
| 1408 | Ga0070675_100000877 | |||
| 1409 | Ga0070675_100002093 | |||
| 1410 | Ga0070675_100002962 | |||
| 1411 | Ga0070675_100055132 | |||
| 1412 | Ga0070675_100506091 | |||
| 1413 | Ga0070675_100938849 | |||
| 1414 | Ga0070671_100000585 | |||
| 1415 | Ga0070671_100001443 | |||
| 1416 | Ga0070671_100003827 | |||
| 1417 | Ga0070671_100037502 | |||
| 1418 | Ga0070671_100045653 | |||
| 1419 | Ga0070671_100198879 | |||
| 1420 | Ga0070671_100414843 | |||
| 1421 | Ga0070671_100788285 | |||
| 1422 | Ga0070671_101313595 | |||
| 1423 | Ga0070674_100018915 | |||
| 1424 | Ga0070674_100027807 | |||
| 1425 | Ga0070674_100088954 | |||
| 1426 | Ga0070674_100186414 | |||
| 1427 | Ga0070674_100202907 | |||
| 1428 | Ga0070674_100586954 | |||
| 1429 | Ga0070673_100002199 | |||
| 1430 | Ga0070673_100004985 | |||
| 1431 | Ga0070673_100100294 | |||
| 1432 | Ga0070673_100169667 | |||
| 1433 | Ga0070673_100280464 | |||
| 1434 | Ga0070673_100289168 | |||
| 1435 | Ga0070673_100526690 | |||
| 1436 | Ga0070673_100741086 | |||
| 1437 | Ga0070688_100209641 | |||
| 1438 | Ga0070688_100932801 | |||
| 1439 | Ga0070659_100007018 | |||
| 1440 | Ga0070659_100009371 | |||
| 1441 | Ga0070659_100012487 | |||
| 1442 | Ga0070659_100149201 | |||
| 1443 | Ga0070659_100201016 | |||
| 1444 | Ga0070659_100204822 | |||
| 1445 | Ga0070659_100297752 | |||
| 1446 | Ga0070659_100389812 | |||
| 1447 | Ga0070659_100436863 | |||
| 1448 | Ga0070659_100495630 | |||
| 1449 | Ga0070659_100743518 | |||
| 1450 | Ga0070659_100904091 | |||
| 1451 | Ga0070667_100003311 | |||
| 1452 | Ga0070667_100011143 | |||
| 1453 | Ga0070667_100081475 | |||
| 1454 | Ga0070667_100148128 | |||
| 1455 | Ga0070667_100226411 | |||
| 1456 | Ga0070667_101995516 | |||
| 1457 | Ga0070709_11446384 | |||
| 1458 | Ga0070714_100002190 | |||
| 1459 | Ga0070714_100156329 | |||
| 1460 | Ga0070714_100522566 | |||
| 1461 | Ga0070713_100123284 | |||
| 1462 | Ga0070713_100182722 | |||
| 1463 | Ga0070710_10709972 | |||
| 1464 | Ga0070663_100013674 | |||
| 1465 | Ga0070663_100029040 | |||
| 1466 | Ga0070663_100030458 | |||
| 1467 | Ga0070663_100060216 | |||
| 1468 | Ga0070663_100158790 | |||
| 1469 | Ga0070663_100381878 | |||
| 1470 | Ga0070663_100389397 | |||
| 1471 | Ga0070663_100600895 | |||
| 1472 | Ga0070663_101114702 | |||
| 1473 | Ga0070678_100011216 | |||
| 1474 | Ga0070678_100036951 | |||
| 1475 | Ga0070678_100061154 | |||
| 1476 | Ga0070678_100085251 | |||
| 1477 | Ga0070678_100129322 | |||
| 1478 | Ga0070662_100002711 | |||
| 1479 | Ga0070662_100012833 | |||
| 1480 | Ga0070662_100036289 | |||
| 1481 | Ga0070662_100037197 | |||
| 1482 | Ga0070662_100040541 | |||
| 1483 | Ga0070662_100057498 | |||
| 1484 | Ga0070662_100064145 | |||
| 1485 | Ga0070662_100072696 | |||
| 1486 | Ga0070662_100083530 | |||
| 1487 | Ga0070662_100431494 | |||
| 1488 | Ga0070662_100518413 | |||
| 1489 | Ga0070662_100950230 | |||
| 1490 | Ga0070681_10078161 | |||
| 1491 | Ga0070681_10080144 | |||
| 1492 | Ga0070681_10595551 | |||
| 1493 | Ga0070681_10887088 | |||
| 1494 | Ga0068867_100024122 | |||
| 1495 | Ga0070685_10123203 | |||
| 1496 | Ga0070679_100008241 | |||
| 1497 | Ga0070679_100042382 | |||
| 1498 | Ga0070679_100112132 | |||
| 1499 | Ga0070679_100251990 | |||
| 1500 | Ga0070679_100348106 | |||
| 1501 | Ga0070679_101511352 | |||
| 1502 | Ga0070684_100004092 | |||
| 1503 | Ga0070684_100010106 | |||
| 1504 | Ga0070684_102036218 | |||
| 1505 | Ga0068853_100027959 | |||
| 1506 | Ga0068853_100038172 | |||
| 1507 | Ga0068853_100060076 | |||
| 1508 | Ga0068853_100193223 | |||
| 1509 | Ga0068853_100232433 | |||
| 1510 | Ga0068853_100345729 | |||
| 1511 | Ga0068853_100464042 | |||
| 1512 | Ga0068853_100552289 | |||
| 1513 | Ga0070672_100001022 | |||
| 1514 | Ga0070672_100031012 | |||
| 1515 | Ga0070672_100117629 | |||
| 1516 | Ga0070672_100195481 | |||
| 1517 | Ga0070672_100280164 | |||
| 1518 | Ga0070672_101200708 | |||
| 1519 | Ga0070672_101311295 | |||
| 1520 | Ga0070672_101706427 | |||
| 1521 | Ga0070686_100028862 | |||
| 1522 | Ga0070686_101840102 | |||
| 1523 | Ga0070693_100678160 | |||
| 1524 | Ga0070665_100001865 | |||
| 1525 | Ga0070665_100028113 | |||
| 1526 | Ga0070665_100032641 | |||
| 1527 | Ga0070665_100087241 | |||
| 1528 | Ga0070665_100583356 | |||
| 1529 | Ga0068855_100005824 | |||
| 1530 | Ga0068855_100006659 | |||
| 1531 | Ga0068855_100014977 | |||
| 1532 | Ga0068855_100017060 | |||
| 1533 | Ga0068855_100019199 | |||
| 1534 | Ga0068855_100030983 | |||
| 1535 | Ga0068855_100153618 | |||
| 1536 | Ga0068855_100199319 | |||
| 1537 | Ga0068855_100827417 | |||
| 1538 | Ga0068855_102186743 | |||
| 1539 | Ga0070664_100000161 | |||
| 1540 | Ga0070664_100011435 | |||
| 1541 | Ga0070664_100012603 | |||
| 1542 | Ga0070664_100025357 | |||
| 1543 | Ga0070664_100027281 | |||
| 1544 | Ga0070664_100033439 | |||
| 1545 | Ga0070664_100035666 | |||
| 1546 | Ga0070664_100040030 | |||
| 1547 | Ga0070664_100079788 | |||
| 1548 | Ga0070664_100086527 | |||
| 1549 | Ga0070664_100139337 | |||
| 1550 | Ga0070664_100324564 | |||
| 1551 | Ga0070664_101415136 | |||
| 1552 | Ga0068857_100038222 | |||
| 1553 | Ga0068857_100112004 | |||
| 1554 | Ga0068857_100565073 | |||
| 1555 | Ga0068857_100742428 | |||
| 1556 | Ga0068857_100991465 | |||
| 1557 | Ga0068857_101404784 | |||
| 1558 | Ga0068857_101896344 | |||
| 1559 | Ga0068857_102535135 | |||
| 1560 | Ga0068854_100005714 | |||
| 1561 | Ga0068854_100012828 | |||
| 1562 | Ga0068854_100029291 | |||
| 1563 | Ga0068854_100056333 | |||
| 1564 | Ga0068854_100098300 | |||
| 1565 | Ga0068854_100102309 | |||
| 1566 | Ga0068854_100318604 | |||
| 1567 | Ga0068854_100377526 | |||
| 1568 | Ga0068854_100421048 | |||
| 1569 | Ga0068854_100694711 | |||
| 1570 | Ga0068854_100714767 | |||
| 1571 | Ga0068854_100995084 | |||
| 1572 | Ga0068854_102012318 | |||
| 1573 | Ga0068856_100010684 | |||
| 1574 | Ga0068856_100023749 | |||
| 1575 | Ga0068856_100069827 | |||
| 1576 | Ga0068856_100086906 | |||
| 1577 | Ga0068856_100122888 | |||
| 1578 | Ga0068856_100294342 | |||
| 1579 | Ga0068856_100313488 | |||
| 1580 | Ga0068856_100660129 | |||
| 1581 | Ga0068856_100973202 | |||
| 1582 | Ga0068856_102141843 | |||
| 1583 | Ga0068852_100007810 | |||
| 1584 | Ga0068852_100037574 | |||
| 1585 | Ga0068852_100310345 | |||
| 1586 | Ga0068852_100340190 | |||
| 1587 | Ga0068852_100383304 | |||
| 1588 | Ga0068852_100595345 | |||
| 1589 | Ga0068852_100601875 | |||
| 1590 | Ga0068852_100610103 | |||
| 1591 | Ga0068852_100701692 | |||
| 1592 | Ga0068852_100766724 | |||
| 1593 | Ga0068864_100048368 | |||
| 1594 | Ga0068864_100055197 | |||
| 1595 | Ga0068864_100107289 | |||
| 1596 | Ga0068864_100134729 | |||
| 1597 | Ga0068864_100210423 | |||
| 1598 | Ga0068866_10014997 | |||
| 1599 | Ga0068866_11128671 | |||
| 1600 | Ga0068861_102209833 | |||
| 1601 | Ga0068851_10008666 | |||
| 1602 | Ga0068851_10293038 | |||
| 1603 | Ga0068851_10474672 | |||
| 1604 | Ga0068851_10996528 | |||
| 1605 | Ga0068870_10066866 | |||
| 1606 | Ga0068870_10147998 | |||
| 1607 | Ga0068863_100068000 | |||
| 1608 | Ga0068863_100265535 | |||
| 1609 | Ga0068863_101193801 | |||
| 1610 | Ga0068858_100028249 | |||
| 1611 | Ga0068858_100070725 | |||
| 1612 | Ga0068858_100096630 | |||
| 1613 | Ga0068860_100235618 | |||
| 1614 | Ga0068860_102573477 | |||
| 1615 | Ga0068862_100013008 | |||
| 1616 | Ga0068862_101925253 | |||
| 1617 | Ga0068862_102205946 | |||
| 1618 | Ga0081539_10017819 | |||
| 1619 | Ga0081539_10101652 | |||
| 1620 | Ga0070717_10168661 | |||
| 1621 | Ga0070716_100433488 | |||
| 1622 | Ga0097621_100013198 | |||
| 1623 | Ga0097621_100030868 | |||
| 1624 | Ga0097621_100142185 | |||
| 1625 | Ga0097621_101949070 | |||
| 1626 | Ga0075370_10092536 | |||
| 1627 | Ga0068871_100156692 | |||
| 1628 | Ga0068871_101915736 | |||
| 1629 | Ga0068865_100010945 | |||
| 1630 | Ga0068865_100561897 | |||
| 1631 | Ga0105240_10007329 | |||
| 1632 | Ga0105240_10035738 | |||
| 1633 | Ga0105240_10089677 | |||
| 1634 | Ga0105240_10154718 | |||
| 1635 | Ga0105240_10180308 | |||
| 1636 | Ga0105240_10285403 | |||
| 1637 | Ga0105240_10656568 | |||
| 1638 | Ga0105240_10887209 | |||
| 1639 | Ga0105240_11019602 | |||
| 1640 | Ga0105240_11676647 | |||
| 1641 | Ga0105245_10006582 | |||
| 1642 | Ga0105245_10131844 | |||
| 1643 | Ga0105243_10578656 | |||
| 1644 | Ga0105241_10060359 | |||
| 1645 | Ga0105241_10080050 | |||
| 1646 | Ga0105241_10113178 | |||
| 1647 | Ga0105241_10229420 | |||
| 1648 | Ga0105241_10796755 | |||
| 1649 | Ga0105241_11194130 | |||
| 1650 | Ga0105242_10462264 | |||
| 1651 | Ga0105248_10000864 | |||
| 1652 | Ga0105248_10001731 | |||
| 1653 | Ga0105248_10002120 | |||
| 1654 | Ga0105248_10021840 | |||
| 1655 | Ga0105248_10030620 | |||
| 1656 | Ga0105248_10079884 | |||
| 1657 | Ga0105248_10082992 | |||
| 1658 | Ga0105248_10828402 | |||
| 1659 | Ga0105248_12700656 | |||
| 1660 | Ga0105237_10013112 | |||
| 1661 | Ga0105237_10042170 | |||
| 1662 | Ga0105237_10209755 | |||
| 1663 | Ga0105237_10354299 | |||
| 1664 | Ga0105238_10013299 | |||
| 1665 | Ga0105238_10089551 | |||
| 1666 | Ga0105238_10093369 | |||
| 1667 | Ga0105238_10193517 | |||
| 1668 | Ga0105238_10259665 | |||
| 1669 | Ga0105238_10615945 | |||
| 1670 | Ga0105238_11063869 | |||
| 1671 | Ga0105238_12794189 | |||
| 1672 | Ga0105239_10042499 | |||
| 1673 | Ga0105239_10062032 | |||
| 1674 | Ga0105239_10335496 | |||
| 1675 | Ga0105239_11178768 | |||
| 1676 | Ga0105239_12621882 | |||
| 1677 | Ga0105246_11305892 | |||
| 1678 | Ga0105246_11542445 | |||
| 1679 | Ga0157327_1031828 | |||
| 1680 | Ga0157373_10004072 | |||
| 1681 | Ga0157373_10025010 | |||
| 1682 | Ga0157373_10032853 | |||
| 1683 | Ga0157373_10108143 | |||
| 1684 | Ga0157373_10108334 | |||
| 1685 | Ga0157373_11116607 | |||
| 1686 | Ga0157373_11489794 | |||
| 1687 | Ga0157371_10008598 | |||
| 1688 | Ga0157371_10021331 | |||
| 1689 | Ga0157371_10075192 | |||
| 1690 | Ga0157371_10110816 | |||
| 1691 | Ga0157371_10192956 | |||
| 1692 | Ga0157371_10274329 | |||
| 1693 | Ga0157371_10466016 | |||
| 1694 | Ga0157371_10652844 | |||
| 1695 | Ga0157371_11127438 | |||
| 1696 | Ga0157371_11130328 | |||
| 1697 | Ga0157371_11480414 | |||
| 1698 | Ga0157370_10022730 | |||
| 1699 | Ga0157370_10029233 | |||
| 1700 | Ga0157370_10046619 | |||
| 1701 | Ga0157370_10077871 | |||
| 1702 | Ga0157370_10127572 | |||
| 1703 | Ga0157370_11493376 | |||
| 1704 | Ga0157369_10002126 | |||
| 1705 | Ga0157369_10046305 | |||
| 1706 | Ga0157369_10071353 | |||
| 1707 | Ga0157369_10103523 | |||
| 1708 | Ga0157369_10146583 | |||
| 1709 | Ga0157369_10210256 | |||
| 1710 | Ga0157369_10409536 | |||
| 1711 | Ga0157369_10429264 | |||
| 1712 | Ga0157369_10433642 | |||
| 1713 | Ga0157369_10504388 | |||
| 1714 | Ga0157369_10915450 | |||
| 1715 | Ga0157369_11485173 | |||
| 1716 | Ga0157369_12521741 | |||
| 1717 | Ga0157374_10002028 | |||
| 1718 | Ga0157374_10004774 | |||
| 1719 | Ga0157374_10024050 | |||
| 1720 | Ga0157374_10057816 | |||
| 1721 | Ga0157374_10155157 | |||
| 1722 | Ga0157374_10826482 | |||
| 1723 | Ga0157374_11076011 | |||
| 1724 | Ga0157374_12428840 | |||
| 1725 | Ga0157378_10036398 | |||
| 1726 | Ga0157378_10090576 | |||
| 1727 | Ga0163162_10025893 | |||
| 1728 | Ga0163162_10066915 | |||
| 1729 | Ga0163162_10539646 | |||
| 1730 | Ga0163162_11027206 | |||
| 1731 | Ga0163162_13041912 | |||
| 1732 | Ga0157372_10001798 | |||
| 1733 | Ga0157372_10012759 | |||
| 1734 | Ga0157372_10099622 | |||
| 1735 | Ga0157372_10630340 | |||
| 1736 | Ga0157372_10774827 | |||
| 1737 | Ga0157372_10817891 | |||
| 1738 | Ga0157372_11041598 | |||
| 1739 | Ga0157372_11256231 | |||
| 1740 | Ga0157372_11816624 | |||
| 1741 | Ga0157372_11846839 | |||
| 1742 | Ga0157372_12002374 | |||
| 1743 | Ga0157372_12081974 | |||
| 1744 | Ga0157375_10011719 | |||
| 1745 | Ga0157375_10108944 | |||
| 1746 | Ga0157375_10221272 | |||
| 1747 | Ga0157375_10347590 | |||
| 1748 | Ga0157375_11201673 | |||
| 1749 | Ga0163163_10074390 | |||
| 1750 | Ga0163163_10676210 | |||
| 1751 | Ga0157380_10007497 | |||
| 1752 | Ga0157380_11764076 | |||
| 1753 | Ga0157380_12527150 | |||
| 1754 | Ga0182008_10351042 | |||
| 1755 | Ga0182008_10546518 | |||
| 1756 | Ga0157377_10271907 | |||
| 1757 | Ga0157377_10702284 | |||
| 1758 | Ga0157379_10041194 | |||
| 1759 | Ga0157379_10483332 | |||
| 1760 | Ga0157376_11241678 | |||
| 1761 | Ga0163161_10118710 | |||
| 1762 | Ga0163161_10415265 | |||
| 1763 | Ga0163161_11647803 | |||
| 1764 | Ga0207697_10012516 | |||
| 1765 | Ga0207697_10045168 | |||
| 1766 | Ga0207697_10089469 | |||
| 1767 | Ga0207697_10499895 | |||
| 1768 | Ga0207656_10021640 | |||
| 1769 | Ga0207656_10087368 | |||
| 1770 | Ga0207656_10483109 | |||
| 1771 | Ga0207682_10001230 | |||
| 1772 | Ga0207682_10007931 | |||
| 1773 | Ga0207682_10068272 | |||
| 1774 | Ga0207642_10855423 | |||
| 1775 | Ga0207688_10147199 | |||
| 1776 | Ga0207688_10238143 | |||
| 1777 | Ga0207688_10851529 | |||
| 1778 | Ga0207680_10000843 | |||
| 1779 | Ga0207680_10016580 | |||
| 1780 | Ga0207680_10032318 | |||
| 1781 | Ga0207680_10044499 | |||
| 1782 | Ga0207680_10095562 | |||
| 1783 | Ga0207680_11020729 | |||
| 1784 | Ga0207647_10000652 | |||
| 1785 | Ga0207647_10000953 | |||
| 1786 | Ga0207647_10008914 | |||
| 1787 | Ga0207647_10023651 | |||
| 1788 | Ga0207647_10058917 | |||
| 1789 | Ga0207647_10396093 | |||
| 1790 | Ga0207699_10393274 | |||
| 1791 | Ga0207645_10133599 | |||
| 1792 | Ga0207645_10301283 | |||
| 1793 | Ga0207645_10427540 | |||
| 1794 | Ga0207645_10628190 | |||
| 1795 | Ga0207643_10335423 | |||
| 1796 | Ga0207705_10002169 | |||
| 1797 | Ga0207705_10002376 | |||
| 1798 | Ga0207705_10004357 | |||
| 1799 | Ga0207705_10005306 | |||
| 1800 | Ga0207705_10013606 | |||
| 1801 | Ga0207705_10020054 | |||
| 1802 | Ga0207705_10025714 | |||
| 1803 | Ga0207705_10034432 | |||
| 1804 | Ga0207705_10077537 | |||
| 1805 | Ga0207705_10106569 | |||
| 1806 | Ga0207705_10136260 | |||
| 1807 | Ga0207705_10158997 | |||
| 1808 | Ga0207705_10170369 | |||
| 1809 | Ga0207705_10272363 | |||
| 1810 | Ga0207705_10617693 | |||
| 1811 | Ga0207705_10711469 | |||
| 1812 | Ga0207705_10718704 | |||
| 1813 | Ga0207705_10797406 | |||
| 1814 | Ga0207654_10085871 | |||
| 1815 | Ga0207654_10124014 | |||
| 1816 | Ga0207654_10265092 | |||
| 1817 | Ga0207654_10511632 | |||
| 1818 | Ga0207707_10060239 | |||
| 1819 | Ga0207707_10147684 | |||
| 1820 | Ga0207707_10363576 | |||
| 1821 | Ga0207707_10832342 | |||
| 1822 | Ga0207707_11006606 | |||
| 1823 | Ga0207695_10003885 | |||
| 1824 | Ga0207695_10025814 | |||
| 1825 | Ga0207695_10104104 | |||
| 1826 | Ga0207695_10148138 | |||
| 1827 | Ga0207695_10354453 | |||
| 1828 | Ga0207695_10577047 | |||
| 1829 | Ga0207695_11244673 | |||
| 1830 | Ga0207695_11271890 | |||
| 1831 | Ga0207671_10044197 | |||
| 1832 | Ga0207671_10190695 | |||
| 1833 | Ga0207671_10274523 | |||
| 1834 | Ga0207671_10771793 | |||
| 1835 | Ga0207693_10243812 | |||
| 1836 | Ga0207660_10018117 | |||
| 1837 | Ga0207660_10049838 | |||
| 1838 | Ga0207660_10127398 | |||
| 1839 | Ga0207660_10188865 | |||
| 1840 | Ga0207660_10401201 | |||
| 1841 | Ga0207660_10444678 | |||
| 1842 | Ga0207662_10186164 | |||
| 1843 | Ga0207662_10942420 | |||
| 1844 | Ga0207657_10004145 | |||
| 1845 | Ga0207657_10007353 | |||
| 1846 | Ga0207657_10007984 | |||
| 1847 | Ga0207657_10017538 | |||
| 1848 | Ga0207657_10019117 | |||
| 1849 | Ga0207657_10032686 | |||
| 1850 | Ga0207657_10034506 | |||
| 1851 | Ga0207657_10088734 | |||
| 1852 | Ga0207657_10112994 | |||
| 1853 | Ga0207657_10149655 | |||
| 1854 | Ga0207657_10192117 | |||
| 1855 | Ga0207657_10197517 | |||
| 1856 | Ga0207657_10313620 | |||
| 1857 | Ga0207657_10496921 | |||
| 1858 | Ga0207657_10568831 | |||
| 1859 | Ga0207657_10571386 | |||
| 1860 | Ga0207649_10002353 | |||
| 1861 | Ga0207649_10142148 | |||
| 1862 | Ga0207649_10143038 | |||
| 1863 | Ga0207649_10254084 | |||
| 1864 | Ga0207649_10473279 | |||
| 1865 | Ga0207649_10561696 | |||
| 1866 | Ga0207649_10567596 | |||
| 1867 | Ga0207649_10783070 | |||
| 1868 | Ga0207649_10960406 | |||
| 1869 | Ga0207649_11137797 | |||
| 1870 | Ga0207649_11270236 | |||
| 1871 | Ga0207652_10010377 | |||
| 1872 | Ga0207652_10041592 | |||
| 1873 | Ga0207652_10041801 | |||
| 1874 | Ga0207652_10413623 | |||
| 1875 | Ga0207681_10018237 | |||
| 1876 | Ga0207681_10067967 | |||
| 1877 | Ga0207681_10110061 | |||
| 1878 | Ga0207681_10304359 | |||
| 1879 | Ga0207681_10861736 | |||
| 1880 | Ga0207694_10066176 | |||
| 1881 | Ga0207694_10137148 | |||
| 1882 | Ga0207694_10228626 | |||
| 1883 | Ga0207694_10309723 | |||
| 1884 | Ga0207694_10352310 | |||
| 1885 | Ga0207694_10783744 | |||
| 1886 | Ga0207694_11018332 | |||
| 1887 | Ga0207650_10003792 | |||
| 1888 | Ga0207650_10011538 | |||
| 1889 | Ga0207650_10051214 | |||
| 1890 | Ga0207650_10122032 | |||
| 1891 | Ga0207650_10235009 | |||
| 1892 | Ga0207650_10360608 | |||
| 1893 | Ga0207650_10752773 | |||
| 1894 | Ga0207659_10001593 | |||
| 1895 | Ga0207659_10003287 | |||
| 1896 | Ga0207659_10032465 | |||
| 1897 | Ga0207659_10200693 | |||
| 1898 | Ga0207687_10036959 | |||
| 1899 | Ga0207687_10848187 | |||
| 1900 | Ga0207700_10803648 | |||
| 1901 | Ga0207664_10100493 | |||
| 1902 | Ga0207664_10173347 | |||
| 1903 | Ga0207664_10368641 | |||
| 1904 | Ga0207664_10852238 | |||
| 1905 | Ga0207644_10000110 | |||
| 1906 | Ga0207644_10002765 | |||
| 1907 | Ga0207644_10003194 | |||
| 1908 | Ga0207644_10039149 | |||
| 1909 | Ga0207644_10054894 | |||
| 1910 | Ga0207644_10127923 | |||
| 1911 | Ga0207644_10193081 | |||
| 1912 | Ga0207644_10567626 | |||
| 1913 | Ga0207644_11284047 | |||
| 1914 | Ga0207690_10002722 | |||
| 1915 | Ga0207690_10003887 | |||
| 1916 | Ga0207690_10016417 | |||
| 1917 | Ga0207690_10029863 | |||
| 1918 | Ga0207690_10037846 | |||
| 1919 | Ga0207690_10074186 | |||
| 1920 | Ga0207690_10075092 | |||
| 1921 | Ga0207690_10144553 | |||
| 1922 | Ga0207690_10569438 | |||
| 1923 | Ga0207690_10667564 | |||
| 1924 | Ga0207690_10770253 | |||
| 1925 | Ga0207690_10781415 | |||
| 1926 | Ga0207690_10989438 | |||
| 1927 | Ga0207706_10004761 | |||
| 1928 | Ga0207706_10009871 | |||
| 1929 | Ga0207706_10012365 | |||
| 1930 | Ga0207706_10014818 | |||
| 1931 | Ga0207706_10019367 | |||
| 1932 | Ga0207706_10032192 | |||
| 1933 | Ga0207706_10034788 | |||
| 1934 | Ga0207706_10047655 | |||
| 1935 | Ga0207706_10083056 | |||
| 1936 | Ga0207706_10113880 | |||
| 1937 | Ga0207706_10306961 | |||
| 1938 | Ga0207706_10530432 | |||
| 1939 | Ga0207686_10444342 | |||
| 1940 | Ga0207669_10033950 | |||
| 1941 | Ga0207669_10038283 | |||
| 1942 | Ga0207669_10070291 | |||
| 1943 | Ga0207669_10765486 | |||
| 1944 | Ga0207669_11352899 | |||
| 1945 | Ga0207669_11422892 | |||
| 1946 | Ga0207704_10024242 | |||
| 1947 | Ga0207704_10037485 | |||
| 1948 | Ga0207665_10479873 | |||
| 1949 | Ga0207691_10022111 | |||
| 1950 | Ga0207691_10022416 | |||
| 1951 | Ga0207691_10050820 | |||
| 1952 | Ga0207691_10072823 | |||
| 1953 | Ga0207691_10157751 | |||
| 1954 | Ga0207691_10310303 | |||
| 1955 | Ga0207691_10532847 | |||
| 1956 | Ga0207691_10702394 | |||
| 1957 | Ga0207691_10745571 | |||
| 1958 | Ga0207691_11733841 | |||
| 1959 | Ga0207711_10001548 | |||
| 1960 | Ga0207711_10005517 | |||
| 1961 | Ga0207711_10014822 | |||
| 1962 | Ga0207711_10042595 | |||
| 1963 | Ga0207711_10389684 | |||
| 1964 | Ga0207711_10441872 | |||
| 1965 | Ga0207711_10664495 | |||
| 1966 | Ga0207661_10001486 | |||
| 1967 | Ga0207661_10055571 | |||
| 1968 | Ga0207661_10130596 | |||
| 1969 | Ga0207661_10623629 | |||
| 1970 | Ga0207679_10024893 | |||
| 1971 | Ga0207679_10038329 | |||
| 1972 | Ga0207679_10040138 | |||
| 1973 | Ga0207679_10054031 | |||
| 1974 | Ga0207679_10065791 | |||
| 1975 | Ga0207679_10125806 | |||
| 1976 | Ga0207679_10129361 | |||
| 1977 | Ga0207679_10404071 | |||
| 1978 | Ga0207679_10836391 | |||
| 1979 | Ga0207679_10945356 | |||
| 1980 | Ga0207679_11246801 | |||
| 1981 | Ga0207679_11340108 | |||
| 1982 | Ga0207679_12143552 | |||
| 1983 | Ga0207667_10004629 | |||
| 1984 | Ga0207667_10005094 | |||
| 1985 | Ga0207667_10005521 | |||
| 1986 | Ga0207667_10012704 | |||
| 1987 | Ga0207667_10034059 | |||
| 1988 | Ga0207667_10128631 | |||
| 1989 | Ga0207667_10182001 | |||
| 1990 | Ga0207667_10261591 | |||
| 1991 | Ga0207667_10304220 | |||
| 1992 | Ga0207667_11395191 | |||
| 1993 | Ga0207651_10002266 | |||
| 1994 | Ga0207651_10008091 | |||
| 1995 | Ga0207651_10035123 | |||
| 1996 | Ga0207651_10084260 | |||
| 1997 | Ga0207651_10663112 | |||
| 1998 | Ga0207651_10708872 | |||
| 1999 | Ga0207651_11466213 | |||
| 2000 | Ga0207668_10145843 | |||
| 2001 | Ga0207668_10299866 | |||
| 2002 | Ga0207668_10353521 | |||
| 2003 | Ga0207668_10573723 | |||
| 2004 | Ga0207668_12103968 | |||
| 2005 | Ga0207640_10018770 | |||
| 2006 | Ga0207640_10051287 | |||
| 2007 | Ga0207640_10051945 | |||
| 2008 | Ga0207640_10060038 | |||
| 2009 | Ga0207640_10081168 | |||
| 2010 | Ga0207640_10221142 | |||
| 2011 | Ga0207640_10352606 | |||
| 2012 | Ga0207640_10439439 | |||
| 2013 | Ga0207640_11108509 | |||
| 2014 | Ga0207658_10002182 | |||
| 2015 | Ga0207658_10067481 | |||
| 2016 | Ga0207658_10119661 | |||
| 2017 | Ga0207658_10304657 | |||
| 2018 | Ga0207658_11279023 | |||
| 2019 | Ga0207658_11501120 | |||
| 2020 | Ga0207677_10022272 | |||
| 2021 | Ga0207677_10080550 | |||
| 2022 | Ga0207677_10262959 | |||
| 2023 | Ga0207677_10892843 | |||
| 2024 | Ga0207677_11070677 | |||
| 2025 | Ga0207703_10003041 | |||
| 2026 | Ga0207703_10091420 | |||
| 2027 | Ga0207639_10015848 | |||
| 2028 | Ga0207639_10112796 | |||
| 2029 | Ga0207639_10199104 | |||
| 2030 | Ga0207639_10561876 | |||
| 2031 | Ga0207639_10804321 | |||
| 2032 | Ga0207639_11014851 | |||
| 2033 | Ga0207639_11229069 | |||
| 2034 | Ga0207678_10003264 | |||
| 2035 | Ga0207678_10007874 | |||
| 2036 | Ga0207678_10043699 | |||
| 2037 | Ga0207678_10043857 | |||
| 2038 | Ga0207678_10045372 | |||
| 2039 | Ga0207678_10165052 | |||
| 2040 | Ga0207678_10202659 | |||
| 2041 | Ga0207678_10897148 | |||
| 2042 | Ga0207678_10944390 | |||
| 2043 | Ga0207708_10330176 | |||
| 2044 | Ga0207702_10005931 | |||
| 2045 | Ga0207702_10019425 | |||
| 2046 | Ga0207702_10028283 | |||
| 2047 | Ga0207702_10057850 | |||
| 2048 | Ga0207702_10399174 | |||
| 2049 | Ga0207702_10498285 | |||
| 2050 | Ga0207702_10749986 | |||
| 2051 | Ga0207702_11086882 | |||
| 2052 | Ga0207702_11490335 | |||
| 2053 | Ga0207702_11603136 | |||
| 2054 | Ga0207702_12037067 | |||
| 2055 | Ga0207641_10047089 | |||
| 2056 | Ga0207641_10231936 | |||
| 2057 | Ga0207641_10694208 | |||
| 2058 | Ga0207648_10113898 | |||
| 2059 | Ga0207648_10962750 | |||
| 2060 | Ga0207676_10007954 | |||
| 2061 | Ga0207676_10029636 | |||
| 2062 | Ga0207676_10425382 | |||
| 2063 | Ga0207676_10578554 | |||
| 2064 | Ga0207674_10002992 | |||
| 2065 | Ga0207674_10006901 | |||
| 2066 | Ga0207674_10007460 | |||
| 2067 | Ga0207674_10089833 | |||
| 2068 | Ga0207674_10139885 | |||
| 2069 | Ga0207674_10204176 | |||
| 2070 | Ga0207674_10291925 | |||
| 2071 | Ga0207674_10630182 | |||
| 2072 | Ga0207674_10732962 | |||
| 2073 | Ga0207675_101285357 | |||
| 2074 | Ga0207683_10002536 | |||
| 2075 | Ga0207683_10014754 | |||
| 2076 | Ga0207683_10021162 | |||
| 2077 | Ga0207683_10116927 | |||
| 2078 | Ga0207683_10237416 | |||
| 2079 | Ga0207683_10251601 | |||
| 2080 | Ga0207698_10004870 | |||
| 2081 | Ga0207698_10007964 | |||
| 2082 | Ga0207698_10083860 | |||
| 2083 | Ga0207698_10194732 | |||
| 2084 | Ga0207698_10464781 | |||
| 2085 | Ga0207698_10514293 | |||
| 2086 | Ga0207698_10523119 | |||
| 2087 | Ga0207698_10555414 | |||
| 2088 | Ga0207698_10595876 | |||
| 2089 | Ga0207698_10718565 | |||
| 2090 | Ga0207698_10817923 | |||
| 2091 | Ga0207698_10881322 | |||
| 2092 | Ga0207698_11405912 | |||
| 2093 | Ga0207698_11541493 | |||
| 2094 | Ga0207698_12502896 | |||
| 2095 | Ga0209983_1080621 | |||
| 2096 | Ga0209971_1151775 | |||
| 2097 | Ga0209974_10027288 | |||
| 2098 | Ga0268266_10074634 | |||
| 2099 | Ga0268266_10078254 | |||
| 2100 | Ga0268266_10137132 | |||
| 2101 | Ga0268266_10494576 | |||
| 2102 | Ga0268265_10255037 | |||
| 2103 | Ga0268265_11686756 | |||
| 2104 | Ga0268264_10136842 | |||
| 2105 | Ga0268264_11941799 | |||
| 2106 | Ga0265338_10436948 | |||
| 2107 | Ga0316182_1322975 | |||
| 2108 | Ga0265339_10135005 | |||
| 2109 | Ga0265316_10171239 | |||
| 2110 | Ga0307408_100005547 | |||
| 2111 | Ga0307408_100039022 | |||
| 2112 | Ga0307408_100055763 | |||
| 2113 | Ga0307408_100063445 | |||
| 2114 | Ga0307408_100150625 | |||
| 2115 | Ga0307408_100215759 | |||
| 2116 | Ga0307408_100672391 | |||
| 2117 | Ga0307408_101034771 | |||
| 2118 | Ga0307408_101088740 | |||
| 2119 | Ga0307408_101474684 | |||
| 2120 | Ga0307408_101829045 | |||
| 2121 | Ga0307405_10009275 | |||
| 2122 | Ga0307405_10020576 | |||
| 2123 | Ga0307405_10030471 | |||
| 2124 | Ga0307405_10081898 | |||
| 2125 | Ga0307405_10159774 | |||
| 2126 | Ga0307405_10460912 | |||
| 2127 | Ga0307405_10828057 | |||
| 2128 | Ga0307405_11013064 | |||
| 2129 | Ga0307405_11724838 | |||
| 2130 | Ga0307405_11873184 | |||
| 2131 | Ga0307413_10020129 | |||
| 2132 | Ga0307413_10028933 | |||
| 2133 | Ga0307413_10047089 | |||
| 2134 | Ga0307413_10103921 | |||
| 2135 | Ga0307413_10126567 | |||
| 2136 | Ga0307413_10318179 | |||
| 2137 | Ga0307413_10341626 | |||
| 2138 | Ga0307413_10587183 | |||
| 2139 | Ga0307413_10711187 | |||
| 2140 | Ga0307410_10001568 | |||
| 2141 | Ga0307410_10011884 | |||
| 2142 | Ga0307410_10018254 | |||
| 2143 | Ga0307410_10025365 | |||
| 2144 | Ga0307410_10044486 | |||
| 2145 | Ga0307410_10156468 | |||
| 2146 | Ga0307410_10180811 | |||
| 2147 | Ga0307410_10344942 | |||
| 2148 | Ga0307410_11232592 | |||
| 2149 | Ga0307410_11810211 | |||
| 2150 | Ga0326468_10025345 | |||
| 2151 | Ga0307406_10021903 | |||
| 2152 | Ga0307406_10052039 | |||
| 2153 | Ga0307406_10101412 | |||
| 2154 | Ga0307406_10159369 | |||
| 2155 | Ga0307406_10200298 | |||
| 2156 | Ga0307406_10619401 | |||
| 2157 | Ga0307406_10667324 | |||
| 2158 | Ga0307406_10763084 | |||
| 2159 | Ga0307407_10002341 | |||
| 2160 | Ga0307407_10003187 | |||
| 2161 | Ga0307407_10080043 | |||
| 2162 | Ga0307407_10179170 | |||
| 2163 | Ga0307407_10278766 | |||
| 2164 | Ga0307407_10317988 | |||
| 2165 | Ga0307407_10420475 | |||
| 2166 | Ga0307407_10688881 | |||
| 2167 | Ga0307407_10773385 | |||
| 2168 | Ga0307412_10008883 | |||
| 2169 | Ga0307412_10063658 | |||
| 2170 | Ga0307412_10066033 | |||
| 2171 | Ga0307412_10092627 | |||
| 2172 | Ga0307412_10110723 | |||
| 2173 | Ga0307412_10175878 | |||
| 2174 | Ga0307412_10190467 | |||
| 2175 | Ga0307412_10367095 | |||
| 2176 | Ga0307412_10606972 | |||
| 2177 | Ga0307412_10782994 | |||
| 2178 | Ga0307412_10844219 | |||
| 2179 | Ga0307412_11755316 | |||
| 2180 | Ga0307409_100004859 | |||
| 2181 | Ga0307409_100007942 | |||
| 2182 | Ga0307409_100016188 | |||
| 2183 | Ga0307409_100033400 | |||
| 2184 | Ga0307409_100108881 | |||
| 2185 | Ga0307409_100121297 | |||
| 2186 | Ga0307409_100137083 | |||
| 2187 | Ga0307409_100178720 | |||
| 2188 | Ga0307409_100340576 | |||
| 2189 | Ga0307409_100797773 | |||
| 2190 | Ga0307409_100988614 | |||
| 2191 | Ga0307409_101404400 | |||
| 2192 | Ga0307416_100005056 | |||
| 2193 | Ga0307416_100008626 | |||
| 2194 | Ga0307416_100009112 | |||
| 2195 | Ga0307416_100023233 | |||
| 2196 | Ga0307416_100054225 | |||
| 2197 | Ga0307416_100079034 | |||
| 2198 | Ga0307416_100145705 | |||
| 2199 | Ga0307416_100161728 | |||
| 2200 | Ga0307416_100372770 | |||
| 2201 | Ga0307416_100443931 | |||
| 2202 | Ga0307416_100475550 | |||
| 2203 | Ga0307416_100521990 | |||
| 2204 | Ga0307416_100641203 | |||
| 2205 | Ga0307416_100968289 | |||
| 2206 | Ga0307416_100970226 | |||
| 2207 | Ga0307416_102435801 | |||
| 2208 | Ga0307414_10007981 | |||
| 2209 | Ga0307414_10026446 | |||
| 2210 | Ga0307414_10071441 | |||
| 2211 | Ga0307414_10083573 | |||
| 2212 | Ga0307414_10250593 | |||
| 2213 | Ga0307414_10427765 | |||
| 2214 | Ga0307414_10453661 | |||
| 2215 | Ga0307414_10522523 | |||
| 2216 | Ga0307414_10895573 | |||
| 2217 | Ga0307414_11066125 | |||
| 2218 | Ga0307414_11113119 | |||
| 2219 | Ga0307414_11131863 | |||
| 2220 | Ga0307414_11345458 | |||
| 2221 | Ga0307414_11557633 | |||
| 2222 | Ga0307411_10003367 | |||
| 2223 | Ga0307411_10005225 | |||
| 2224 | Ga0307411_10015557 | |||
| 2225 | Ga0307411_10027219 | |||
| 2226 | Ga0307411_10074530 | |||
| 2227 | Ga0307411_10112517 | |||
| 2228 | Ga0307411_10181216 | |||
| 2229 | Ga0307411_10289444 | |||
| 2230 | Ga0307411_10442295 | |||
| 2231 | Ga0307411_10891694 | |||
| 2232 | Ga0307411_10919008 | |||
| 2233 | Ga0307411_11319163 | |||
| 2234 | Ga0307411_11500223 | |||
| 2235 | Ga0307415_100006068 | |||
| 2236 | Ga0307415_100008308 | |||
| 2237 | Ga0307415_100009900 | |||
| 2238 | Ga0307415_100012346 | |||
| 2239 | Ga0307415_100018520 | |||
| 2240 | Ga0307415_100022724 | |||
| 2241 | Ga0307415_100050004 | |||
| 2242 | Ga0307415_100079700 | |||
| 2243 | Ga0307415_100122117 | |||
| 2244 | Ga0373933_0865287 | |||
| 2245 | Ga0395899_0000274 | |||
| 2246 | Ga0395899_0002381 | |||
| 2247 | Ga0395899_0012400 | |||
| 2248 | Ga0395899_0014700 | |||
| 2249 | Ga0395899_0045490 | |||
| 2250 | Ga0395899_0054314 | |||
| 2251 | Ga0395899_0063719 | |||
| 2252 | Ga0395899_0079007 | |||
| 2253 | Ga0395899_0147584 | |||
| 2254 | Ga0395899_0191971 | |||
| 2255 | Ga0395899_0274081 | |||
| 2256 | Ga0395899_0282706 | |||
| 2257 | Ga0395899_0310779 | |||
| 2258 | Ga0395899_0486468 | |||
| 2259 | Ga0395899_0598541 | |||
| 2260 | Ga0395899_0613657 | |||
| 2261 | Ga0395899_0623125 | |||
| 2262 | Ga0395899_0990106 | |||
| 2263 | Ga0395900_0000595 | |||
| 2264 | Ga0395900_0004150 | |||
| 2265 | Ga0395900_0009492 | |||
| 2266 | Ga0395900_0021697 | |||
| 2267 | Ga0395900_0032009 | |||
| 2268 | Ga0395900_0051312 | |||
| 2269 | Ga0395900_0061474 | |||
| 2270 | Ga0395900_0069099 | |||
| 2271 | Ga0395900_0089208 | |||
| 2272 | Ga0395900_0094415 | |||
| 2273 | Ga0395900_0112993 | |||
| 2274 | Ga0395900_0128824 | |||
| 2275 | Ga0395900_0132958 | |||
| 2276 | Ga0395900_0166847 | |||
| 2277 | Ga0395900_0203915 | |||
| 2278 | Ga0395900_0227571 | |||
| 2279 | Ga0395900_0261101 | |||
| 2280 | Ga0395900_0299401 | |||
| 2281 | Ga0395900_0314767 | |||
| 2282 | Ga0395900_0331042 | |||
| 2283 | Ga0395900_0371279 | |||
| 2284 | Ga0395900_0373622 | |||
| 2285 | Ga0395900_0395668 | |||
| 2286 | Ga0395900_0421488 | |||
| 2287 | Ga0395900_0486684 | |||
| 2288 | Ga0395900_0573213 | |||
| 2289 | Ga0395900_0594178 | |||
| 2290 | Ga0395900_0635141 | |||
| 2291 | Ga0395900_0650941 | |||
| 2292 | Ga0395900_0810782 | |||
| 2293 | Ga0395900_0878936 | |||
| 2294 | Ga0395900_0996329 | |||
| 2295 | Ga0395900_1280108 | |||
| 2296 | Ga0395900_1611493 | |||
| 2297 | Ga0395900_1631453 | |||
| 2298 | Ga0395900_1658055 | |||
| 2299 | Ga0395900_1662829 | |||
| 2300 | Ga0395898_0005114 | |||
| 2301 | Ga0395898_0006829 | |||
| 2302 | Ga0395898_0017744 | |||
| 2303 | Ga0395898_0020380 | |||
| 2304 | Ga0395898_0024914 | |||
| 2305 | Ga0395898_0026720 | |||
| 2306 | Ga0395898_0034810 | |||
| 2307 | Ga0395898_0055067 | |||
| 2308 | Ga0395898_0062738 | |||
| 2309 | Ga0395898_0064370 | |||
| 2310 | Ga0395898_0127100 | |||
| 2311 | Ga0395898_0161732 | |||
| 2312 | Ga0395898_0205883 | |||
| 2313 | Ga0395898_0242652 | |||
| 2314 | Ga0395898_0288722 | |||
| 2315 | Ga0395898_0827875 | |||
| 2316 | Ga0395898_1043458 | |||
| 2317 | Ga0395898_1106341 | |||
| 2318 | Ga0395898_1768746 | |||
| 2319 | Ga0395898_1795613 | |||
| 2320 | Ga0395905_0000575 | |||
| 2321 | Ga0395905_0002328 | |||
| 2322 | Ga0395905_0003746 | |||
| 2323 | Ga0395905_0006198 | |||
| 2324 | Ga0395905_0010952 | |||
| 2325 | Ga0395905_0011179 | |||
| 2326 | Ga0395905_0020706 | |||
| 2327 | Ga0395905_0023907 | |||
| 2328 | Ga0395905_0025512 | |||
| 2329 | Ga0395905_0031595 | |||
| 2330 | Ga0395905_0034430 | |||
| 2331 | Ga0395905_0036398 | |||
| 2332 | Ga0395905_0045310 | |||
| 2333 | Ga0395905_0055245 | |||
| 2334 | Ga0395905_0064924 | |||
| 2335 | Ga0395905_0091485 | |||
| 2336 | Ga0395905_0111933 | |||
| 2337 | Ga0395905_0121272 | |||
| 2338 | Ga0395905_0129395 | |||
| 2339 | Ga0395905_0137976 | |||
| 2340 | Ga0395905_0184151 | |||
| 2341 | Ga0395905_0224309 | |||
| 2342 | Ga0395905_0234800 | |||
| 2343 | Ga0395905_0268877 | |||
| 2344 | Ga0395905_0309714 | |||
| 2345 | Ga0395905_0380127 | |||
| 2346 | Ga0395905_0439830 | |||
| 2347 | Ga0395905_0532218 | |||
| 2348 | Ga0395905_0567976 | |||
| 2349 | Ga0395905_1080686 | |||
| 2350 | Ga0395905_1403264 | |||
| 2351 | Ga0395905_1703258 | |||
| 2352 | Ga0395901_0001391 | |||
| 2353 | Ga0395901_0003881 | |||
| 2354 | Ga0395901_0004508 | |||
| 2355 | Ga0395901_0005012 | |||
| 2356 | Ga0395901_0005682 | |||
| 2357 | Ga0395901_0014443 | |||
| 2358 | Ga0395901_0023949 | |||
| 2359 | Ga0395901_0031335 | |||
| 2360 | Ga0395901_0034344 | |||
| 2361 | Ga0395901_0034381 | |||
| 2362 | Ga0395901_0036892 | |||
| 2363 | Ga0395901_0037861 | |||
| 2364 | Ga0395901_0116974 | |||
| 2365 | Ga0395901_0132967 | |||
| 2366 | Ga0395901_0219510 | |||
| 2367 | Ga0395901_0309422 | |||
| 2368 | Ga0395901_0396393 | |||
| 2369 | Ga0395901_0437559 | |||
| 2370 | Ga0395901_0555126 | |||
| 2371 | Ga0395901_0574277 | |||
| 2372 | Ga0395901_0623278 | |||
| 2373 | Ga0395901_0634961 | |||
| 2374 | Ga0395901_0659236 | |||
| 2375 | Ga0395901_0831040 | |||
| 2376 | Ga0395901_0878926 | |||
| 2377 | Ga0395901_1144632 | |||
| 2378 | Ga0395901_1250855 | |||
| 2379 | Ga0395901_1262653 | |||
| 2380 | Ga0395901_1468921 | |||
| 2381 | Ga0395901_1721376 | |||
| 2382 | Ga0436365_0736792 | |||
| 2383 | Ga0436365_0774065 | |||
| 2384 | Ga0436363_0542870 | |||
| 2385 | Ga0436362_0401320 | |||
| 2386 | Ga0451798_0883369 | |||
| 2387 | Ga0451845_0093183 | |||
| 2388 | Ga0439445_0109023 | |||
| 2389 | Ga0439448_0003296 | |||
| 2390 | Ga0439448_0352572 | |||
| 2391 | Ga0439432_123679 | |||
| 2392 | Ga0439449_0105076 | |||
| 2393 | Ga0439452_139586 | |||
| 2394 | Ga0439455_0129337 | |||
| 2395 | Ga0450920_014143 | |||
| 2396 | Ga0439458_0000082 | |||
| 2397 | Ga0466972_0042978 | |||
| 2398 | Ga0466972_0361720 | |||
| 2399 | Ga0466965_0774859 | |||
| 2400 | Ga0466966_0045888 | |||
| 2401 | Ga0466966_0226970 | |||
| 2402 | Ga0466966_0591890 | |||
| 2403 | Ga0466961_0032451 | |||
| 2404 | Ga0466961_0122345 | |||
| 2405 | Ga0466961_0564414 | |||
| 2406 | Ga0466963_0191332 | |||
| 2407 | Ga0466963_0202006 | |||
| 2408 | Ga0466963_0304280 | |||
| 2409 | Ga0466963_0320705 | |||
| 2410 | Ga0466963_0492386 | |||
| 2411 | Ga0453684_0973996 | |||
| 2412 | Ga0466971_0012442 | |||
| 2413 | Ga0466971_0350897 | |||
| 2414 | Ga0466970_0037992 | |||
| 2415 | Ga0466970_0354545 | |||
| 2416 | Ga0466970_0629636 | |||
| 2417 | Ga0466957_0019065 | |||
| 2418 | Ga0466957_0469993 | |||
| 2419 | Ga0466957_0754840 | |||
| 2420 | Ga0466957_0979015 | |||
| 2421 | Ga0466957_1147276 | |||
| 2422 | Ga0466957_1254086 | |||
| 2423 | Ga0466960_0070364 | |||
| 2424 | Ga0466959_0007425 | |||
| 2425 | Ga0466959_0031930 | |||
| 2426 | Ga0466959_0303826 | |||
| 2427 | Ga0466959_0700351 | |||
| 2428 | Ga0466959_0781340 | |||
| 2429 | Ga0466959_0974987 | |||
| 2430 | Ga0466958_0014628 | |||
| 2431 | Ga0466958_0066871 | |||
| 2432 | Ga0466958_0190920 | |||
| 2433 | Ga0466958_0225463 | |||
| 2434 | Ga0466958_0284637 | |||
| 2435 | Ga0466958_0324106 | |||
| 2436 | Ga0466967_0132311 | |||
| 2437 | Ga0466967_0139830 | |||
| 2438 | Ga0466967_0180776 | |||
| 2439 | Ga0466967_2088876 | |||
| 2440 | Ga0495580_0733381 | |||
| 2441 | Ga0495585_0330632 | |||
| 2442 | Ga0495620_0051741 | |||
| 2443 | Ga0495643_0035553 | |||
| 2444 | Ga0495663_0066716 | |||
| 2445 | Ga0495598_0144965 | |||
| 2446 | Ga0495598_0300676 | |||
| 2447 | Ga0495621_0014694 | |||
| 2448 | Ga0495597_0229925 | |||
| 2449 | Ga0495633_0304744 | |||
| 2450 | Ga0495668_0024802 | |||
| 2451 | Ga0495669_0001241 | |||
| 2452 | Ga0495669_0010849 | |||
| 2453 | Ga0495669_0533461 | |||
| 2454 | Ga0495670_0050424 | |||
| 2455 | Ga0495680_0963749 | |||
| 2456 | Ga0495687_196894 | |||
| 2457 | Ga0495677_0021289 | |||
| 2458 | Ga0495677_0301144 | |||
| 2459 | Ga0495602_0417670 | |||
| 2460 | Ga0496100_0096807 | |||
| 2461 | Ga0496101_0023068 | |||
| 2462 | Ga0496101_1605422 | |||
| 2463 | Ga0496107_0166859 | |||
| 2464 | Ga0496108_0231364 | |||
| 2465 | Ga0496108_0362431 | |||
| 2466 | Ga0496108_0456533 | |||
| 2467 | Ga0496108_0846647 | |||
| 2468 | Ga0496109_0037881 | |||
| 2469 | Ga0496109_0172543 | |||
| 2470 | Ga0496109_0331685 | |||
| 2471 | Ga0496109_1822904 | |||
| 2472 | Ga0496110_0003415 | |||
| 2473 | Ga0496110_0038741 | |||
| 2474 | Ga0496111_0045856 | |||
| 2475 | Ga0496111_0172451 | |||
| 2476 | Ga0496111_0193719 | |||
| 2477 | Ga0496112_0052100 | |||
| 2478 | Ga0496112_0076194 | |||
| 2479 | Ga0496112_0088102 | |||
| 2480 | Ga0496113_0378992 | |||
| 2481 | Ga0496114_0000006 | |||
| 2482 | Ga0496114_0329602 | |||
| 2483 | Ga0496115_0040388 | |||
| 2484 | Ga0501033_0007786 | |||
| 2485 | Ga0501034_0512577 | |||
| 2486 | Ga0501037_0309062 | |||
| 2487 | Ga0501038_0428397 | |||
| 2488 | Ga0501043_0655793 | |||
| 2489 | Ga0501047_0083530 | |||
| 2490 | Ga0501069_0297965 | |||
| 2491 | Ga0501202_077640 | |||
| 2492 | Ga0501207_008383 | |||
| 2493 | Ga0501209_052778 | |||
| 2494 | Ga0501209_144547 | |||
| 2495 | Ga0501216_082991 | |||
| 2496 | Ga0501216_162071 | |||
| 2497 | Ga0501235_001852 | |||
| 2498 | Ga0501239_002286 | |||
| 2499 | Ga0501240_099622 | |||
| 2500 | Ga0501249_004971 | |||
| 2501 | Ga0501249_027414 | |||
| 2502 | Ga0501257_064775 | |||
| 2503 | Ga0501221_009292 | |||
| 2504 | Ga0501080_0755275 | |||
| 2505 | Ga0501232_013604 | |||
| 2506 | Ga0501262_003659 | |||
| 2507 | Ga0501263_011872 | |||
| 2508 | Ga0501270_075996 | |||
| 2509 | Ga0501279_026914 | |||
| 2510 | Ga0501035_0574197 | |||
| 2511 | Ga0501044_0050423 | |||
| 2512 | Ga0501212_041352 | |||
| 2513 | Ga0500643_000008 | |||
| 2514 | Ga0500556_0207686 | |||
| 2515 | Ga0500568_0092573 | |||
| 2516 | Ga0500616_0003431 | |||
| 2517 | Ga0500645_094592 | |||
| 2518 | Ga0590071_084186 | |||
| 2519 | Ga0590077_148725 | |||
| 2520 | Ga0466962_0079769 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6i08-assembly1.cif.gz_E | the glic pentameric ligand-gated ion channel mutant e243c-i201w | 0.7869 | 35 | 77 |
| 7rww-assembly1.cif.gz_A | crystal structure of a zn-bound ridc1 variant | 0.7671 | 25 | 77 |
| 6ot9-assembly1.cif.gz_C | bimetallic dodecameric cage design 1 (bmc1) from cytochrome cb562 | 0.742 | 25 | 77 |
| 3m79-assembly2.cif.gz_E | a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces crystallized in the presence of cu(ii) and zn(ii) | 0.7402 | 24 | 77 |
| 3m4c-assembly1.cif.gz_B | a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase | 0.7387 | 25 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3v1dD00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.8693 | 38 | 77 | 4.10.860.20 |
| 3v1dA00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.8681 | 38 | 77 | 4.10.860.20 |
| 3v1dG00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.867 | 38 | 77 | 4.10.860.20 |
| af_A0A1D6PNQ4_16_492_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7849 | 8 | 74 | 3.40.50.1820 |
| af_O76618_188_603_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7702 | 2 | 72 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8HYP3-F1-model_v4 | Uncharacterized protein | 0.9492 | 1 | 81 |
GO:0016020
|
| AF-A0A3A1P9H1-F1-model_v4 | Uncharacterized protein | 0.9458 | 1 | 82 |
GO:0016020
|
| AF-A0A3A1P9H1-F1-model_v4 | Uncharacterized protein | 0.9344 | 1 | 82 |
GO:0016020
|
| AF-A0A3S2VS45-F1-model_v4 | Uncharacterized protein | 0.9306 | 1 | 82 |
GO:0016020
|
| AF-A0A7Z0APF6-F1-model_v4 | deleted | 0.9281 | 1 | 82 |
|