F492291

General Info

Members Datasets Scaffolds Average Seq Length
1260 333 1257 218

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10076279|rootL2_100762795
Length 252
Sequence MHFTAPLKFAKGTGYSQFLFLKPYICFPPNQLPPMIEAVLIVLAYLIGSIPTSVWISRYFFEIDIRDYGSGNAGATNTFRVLGSKWGTIVMICDVLKGIIATSLYIMVSFYVVKDHDVDRTKLMIGLGLAAVIGHVFPIWAGFRGGKGVATLFGMIIAMQPAVAACCVLVFLLVLYLTRFVSLSSILAGVAFAILILFIFDDNVTLYRIFSVLVALLVILTHQKNINRLLNGTESKVPILKYRDRRRERRRG

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
209 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
217 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
218 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
260 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
283 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
284 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
285 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
286 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
287 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
288 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
292 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
293 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
294 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
295 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
296 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
303 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
304 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
305 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
306 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
321 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
328 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
329 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
332 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.19
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0.71
Rhizosphere 95.71
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1168309 2162886011 Bacteria 856
2 MBSR1b_contig_4379216 2162886012 Unclassified 1163
3 MBSR1b_contig_7995764 2162886012 Unclassified 1163
4 JGI24751J29686_10061188 3300002459 Bacteria 775
5 rootH1_10109167 3300003316 Bacteria 1140
6 rootH1_10125848 3300003316 Bacteria 3347
7 rootH2_10162769 3300003320 Bacteria 4159
8 rootH2_10197471 3300003320 Bacteria 2933
9 rootH2_10205626 3300003320 Bacteria 2737
10 rootL2_10076279 3300003322 Bacteria 5022
11 rootL2_10097124 3300003322 Unclassified 2320
12 rootL2_10135684 3300003322 Bacteria 4544
13 rootH1_10227879 3300003323 Unclassified 1569
14 JGI25160J50197_1003126 3300003354 Bacteria 7532
15 Ga0058861_12043672 3300004800 Bacteria 744
16 Ga0058862_12478465 3300004803 Bacteria 1575
17 Ga0065714_10079249 3300005288 Bacteria 2531
18 Ga0065714_10226543 3300005288 Unclassified 827
19 Ga0065704_10121850 3300005289 Bacteria 1759
20 Ga0065704_10182402 3300005289 Bacteria 1230
21 Ga0065712_10073224 3300005290 Bacteria 4461
22 Ga0065712_10089634 3300005290 Bacteria 2446
23 Ga0065712_10154453 3300005290 Bacteria 1321
24 Ga0065712_10170127 3300005290 Bacteria 1248
25 Ga0065712_10225270 3300005290 Bacteria 1028
26 Ga0065715_10013993 3300005293 Unclassified 1980
27 Ga0065715_10323297 3300005293 Bacteria 998
28 Ga0070658_10001461 3300005327 Bacteria 20135
29 Ga0070658_10045017 3300005327 Bacteria 3567
30 Ga0070658_10045140 3300005327 Bacteria 3562
31 Ga0070658_10100597 3300005327 Bacteria 2390
32 Ga0070658_10182071 3300005327 Bacteria 1768
33 Ga0070658_10824846 3300005327 Bacteria 806
34 Ga0070676_10000153 3300005328 Bacteria 27368
35 Ga0070676_10005303 3300005328 Bacteria 6859
36 Ga0070676_10033838 3300005328 Unclassified 2932
37 Ga0070683_100000329 3300005329 Bacteria 32745
38 Ga0070683_100018651 3300005329 Bacteria 6149
39 Ga0070683_100023520 3300005329 Bacteria 5511
40 Ga0070683_100053673 3300005329 Bacteria 3735
41 Ga0070683_100081163 3300005329 Bacteria 3036
42 Ga0070690_100051558 3300005330 Unclassified 2627
43 Ga0070690_100177737 3300005330 Unclassified 1469
44 Ga0070670_100032449 3300005331 Bacteria 4498
45 Ga0070670_100053200 3300005331 Bacteria 3477
46 Ga0070670_100149986 3300005331 Bacteria 2018
47 Ga0070670_100150728 3300005331 Bacteria 2012
48 Ga0070670_100174216 3300005331 Unclassified 1867
49 Ga0070670_100264373 3300005331 Bacteria 1500
50 Ga0070670_100358496 3300005331 Bacteria 1282
51 Ga0070670_100360560 3300005331 Bacteria 1278
52 Ga0070670_100522309 3300005331 Bacteria 1057
53 Ga0070670_100630214 3300005331 Bacteria 961
54 Ga0070670_100981754 3300005331 Bacteria 768
55 Ga0070677_10002116 3300005333 Bacteria 6336
56 Ga0070677_10042997 3300005333 Bacteria 1792
57 Ga0070677_10115552 3300005333 Bacteria 1204
58 Ga0070677_10153182 3300005333 Unclassified 1075
59 Ga0068869_100007813 3300005334 Bacteria 6860
60 Ga0068869_100012388 3300005334 Bacteria 5634
61 Ga0068869_100024126 3300005334 Bacteria 4211
62 Ga0068869_100031526 3300005334 Bacteria 3729
63 Ga0068869_100118166 3300005334 Unclassified 2025
64 Ga0068869_100162297 3300005334 Bacteria 1740
65 Ga0068869_100401576 3300005334 Bacteria 1127
66 Ga0070666_10000043 3300005335 Bacteria 111402
67 Ga0070666_10000209 3300005335 Bacteria 40151
68 Ga0070666_10031000 3300005335 Bacteria 3528
69 Ga0070666_10031370 3300005335 Bacteria 3508
70 Ga0070666_10119646 3300005335 Unclassified 1826
71 Ga0070666_10144826 3300005335 Bacteria 1656
72 Ga0070666_10292921 3300005335 Bacteria 1158
73 Ga0070680_100000076 3300005336 Bacteria 53273
74 Ga0070680_100012535 3300005336 Bacteria 6588
75 Ga0070680_100021326 3300005336 Bacteria 5147
76 Ga0070680_100024075 3300005336 Bacteria 4860
77 Ga0070680_100045972 3300005336 Bacteria 3550
78 Ga0070682_100000717 3300005337 Bacteria 19844
79 Ga0070682_100086673 3300005337 Bacteria 2039
80 Ga0070682_100155207 3300005337 Bacteria 1575
81 Ga0070682_100169628 3300005337 Unclassified 1515
82 Ga0070682_100243568 3300005337 Bacteria 1292
83 Ga0068868_100000726 3300005338 Bacteria 22242
84 Ga0068868_100001336 3300005338 Bacteria 17019
85 Ga0068868_100022584 3300005338 Bacteria 4750
86 Ga0068868_100078450 3300005338 Bacteria 2644
87 Ga0068868_100097530 3300005338 Bacteria 2375
88 Ga0068868_100172352 3300005338 Bacteria 1792
89 Ga0068868_100180291 3300005338 Bacteria 1752
90 Ga0068868_100247821 3300005338 Unclassified 1498
91 Ga0068868_100595379 3300005338 Bacteria 979
92 Ga0068868_100811708 3300005338 Bacteria 845
93 Ga0070660_100034772 3300005339 Bacteria 3810
94 Ga0070660_100043591 3300005339 Bacteria 3429
95 Ga0070660_100057089 3300005339 Bacteria 3023
96 Ga0070660_100083945 3300005339 Bacteria 2503
97 Ga0070660_100133622 3300005339 Bacteria 1987
98 Ga0070660_100147379 3300005339 Bacteria 1891
99 Ga0070660_100421503 3300005339 Unclassified 1105
100 Ga0070660_100551128 3300005339 Unclassified 962
101 Ga0070689_100019751 3300005340 Bacteria 4985
102 Ga0070689_100503540 3300005340 Bacteria 1038
103 Ga0070691_10001594 3300005341 Bacteria 9806
104 Ga0070691_10007717 3300005341 Bacteria 4928
105 Ga0070691_10041025 3300005341 Bacteria 2188
106 Ga0070687_100014051 3300005343 Unclassified 3587
107 Ga0070687_100125092 3300005343 Bacteria 1476
108 Ga0070687_100147780 3300005343 Bacteria 1376
109 Ga0070687_100356811 3300005343 Bacteria 945
110 Ga0070661_100004831 3300005344 Bacteria 9277
111 Ga0070661_100009444 3300005344 Bacteria 6751
112 Ga0070661_100064706 3300005344 Bacteria 2687
113 Ga0070661_100104590 3300005344 Unclassified 2109
114 Ga0070661_100168713 3300005344 Bacteria 1661
115 Ga0070668_100000556 3300005347 Bacteria 24937
116 Ga0070668_100012182 3300005347 Bacteria 6404
117 Ga0070668_100073785 3300005347 Bacteria 2660
118 Ga0070668_100138846 3300005347 Bacteria 1957
119 Ga0070668_100485189 3300005347 Unclassified 1068
120 Ga0070669_100009249 3300005353 Bacteria 7020
121 Ga0070669_100035738 3300005353 Bacteria 3600
122 Ga0070675_100010042 3300005354 Bacteria 7381
123 Ga0070675_100026514 3300005354 Bacteria 4652
124 Ga0070675_100043632 3300005354 Bacteria 3665
125 Ga0070675_100050419 3300005354 Bacteria 3418
126 Ga0070675_100611183 3300005354 Unclassified 989
127 Ga0070675_100638424 3300005354 Bacteria 967
128 Ga0070671_100001985 3300005355 Bacteria 15713
129 Ga0070671_100013745 3300005355 Bacteria 6530
130 Ga0070671_100069303 3300005355 Bacteria 2942
131 Ga0070671_100115887 3300005355 Unclassified 2253
132 Ga0070671_100585517 3300005355 Unclassified 964
133 Ga0070674_100029455 3300005356 Bacteria 3617
134 Ga0070674_100030959 3300005356 Bacteria 3541
135 Ga0070674_100753954 3300005356 Bacteria 837
136 Ga0070673_100000867 3300005364 Bacteria 17013
137 Ga0070673_100006375 3300005364 Bacteria 7667
138 Ga0070673_100037568 3300005364 Unclassified 3691
139 Ga0070673_100042687 3300005364 Unclassified 3498
140 Ga0070673_100059928 3300005364 Unclassified 3014
141 Ga0070673_100098764 3300005364 Bacteria 2400
142 Ga0070673_100206169 3300005364 Bacteria 1695
143 Ga0070673_100217525 3300005364 Unclassified 1652
144 Ga0070673_100219615 3300005364 Unclassified 1644
145 Ga0070673_100281591 3300005364 Bacteria 1459
146 Ga0070688_100004476 3300005365 Bacteria 7279
147 Ga0070688_100089412 3300005365 Bacteria 2009
148 Ga0070688_100169991 3300005365 Bacteria 1503
149 Ga0070688_100234589 3300005365 Bacteria 1299
150 Ga0070688_100262084 3300005365 Bacteria 1235
151 Ga0070659_100007187 3300005366 Bacteria 8080
152 Ga0070659_100014833 3300005366 Bacteria 5827
153 Ga0070659_100061370 3300005366 Bacteria 2971
154 Ga0070659_100191534 3300005366 Unclassified 1681
155 Ga0070659_100228816 3300005366 Bacteria 1536
156 Ga0070659_100542459 3300005366 Unclassified 995
157 Ga0070667_100000812 3300005367 Bacteria 29157
158 Ga0070667_100008930 3300005367 Bacteria 8297
159 Ga0070667_100020249 3300005367 Bacteria 5523
160 Ga0070667_100028595 3300005367 Bacteria 4642
161 Ga0070667_100057396 3300005367 Unclassified 3290
162 Ga0070667_100220075 3300005367 Bacteria 1690
163 Ga0070667_100250684 3300005367 Bacteria 1583
164 Ga0070667_100282103 3300005367 Bacteria 1492
165 Ga0070667_100299953 3300005367 Bacteria 1446
166 Ga0070667_100353261 3300005367 Bacteria 1331
167 Ga0070667_100547582 3300005367 Bacteria 1063
168 Ga0070701_10030425 3300005438 Bacteria 2671
169 Ga0070701_10042878 3300005438 Unclassified 2312
170 Ga0070700_100027344 3300005441 Unclassified 3381
171 Ga0070700_100206961 3300005441 Unclassified 1382
172 Ga0070663_100161237 3300005455 Bacteria 1726
173 Ga0070663_100370722 3300005455 Bacteria 1164
174 Ga0070663_100577370 3300005455 Bacteria 943
175 Ga0070678_100057003 3300005456 Unclassified 2860
176 Ga0070678_100059231 3300005456 Bacteria 2814
177 Ga0070678_100679540 3300005456 Bacteria 926
178 Ga0070662_100001017 3300005457 Bacteria 17158
179 Ga0070662_100039341 3300005457 Bacteria 3362
180 Ga0070662_100041094 3300005457 Bacteria 3297
181 Ga0070662_100047930 3300005457 Unclassified 3076
182 Ga0070662_100050347 3300005457 Bacteria 3005
183 Ga0070662_100062595 3300005457 Bacteria 2719
184 Ga0070662_100070905 3300005457 Bacteria 2568
185 Ga0070662_100153087 3300005457 Bacteria 1797
186 Ga0070681_10030832 3300005458 Bacteria 5382
187 Ga0070681_10034476 3300005458 Bacteria 5082
188 Ga0070681_10069046 3300005458 Bacteria 3500
189 Ga0070681_10089254 3300005458 Bacteria 3034
190 Ga0070681_10092504 3300005458 Bacteria 2973
191 Ga0070681_10189654 3300005458 Bacteria 1975
192 Ga0070681_10318982 3300005458 Bacteria 1463
193 Ga0070681_10498067 3300005458 Unclassified 1131
194 Ga0068867_100009628 3300005459 Bacteria 6814
195 Ga0068867_100017213 3300005459 Bacteria 5133
196 Ga0068867_100018823 3300005459 Bacteria 4913
197 Ga0068867_100045627 3300005459 Bacteria 3215
198 Ga0068867_100077217 3300005459 Bacteria 2502
199 Ga0068867_100124886 3300005459 Bacteria 1993
200 Ga0068867_100276407 3300005459 Bacteria 1375
201 Ga0068867_100393196 3300005459 Unclassified 1167
202 Ga0068867_100453623 3300005459 Bacteria 1093
203 Ga0068867_100576468 3300005459 Bacteria 978
204 Ga0070685_10023313 3300005466 Unclassified 3388
205 Ga0070685_10030244 3300005466 Bacteria 3015
206 Ga0070685_10162796 3300005466 Unclassified 1423
207 Ga0070685_10482928 3300005466 Bacteria 874
208 Ga0070698_100008720 3300005471 Bacteria 10923
209 Ga0070698_100034419 3300005471 Bacteria 5242
210 Ga0070698_100219385 3300005471 Bacteria 1836
211 Ga0070679_100001661 3300005530 Bacteria 20056
212 Ga0070679_100009375 3300005530 Bacteria 9257
213 Ga0070679_100022898 3300005530 Bacteria 6110
214 Ga0070679_100029983 3300005530 Bacteria 5368
215 Ga0070679_100037881 3300005530 Bacteria 4791
216 Ga0070679_100050468 3300005530 Bacteria 4145
217 Ga0070679_100062160 3300005530 Bacteria 3722
218 Ga0070679_100151851 3300005530 Bacteria 2292
219 Ga0070679_100241274 3300005530 Bacteria 1764
220 Ga0070684_100000768 3300005535 Bacteria 22215
221 Ga0070684_100001060 3300005535 Bacteria 19661
222 Ga0070684_100595267 3300005535 Unclassified 1028
223 Ga0068853_100000520 3300005539 Bacteria 26128
224 Ga0068853_100009389 3300005539 Bacteria 7886
225 Ga0068853_100010204 3300005539 Bacteria 7594
226 Ga0068853_100020753 3300005539 Bacteria 5465
227 Ga0068853_100059557 3300005539 Bacteria 3299
228 Ga0068853_100074904 3300005539 Bacteria 2954
229 Ga0068853_100097777 3300005539 Bacteria 2592
230 Ga0068853_100106099 3300005539 Bacteria 2489
231 Ga0068853_100154878 3300005539 Bacteria 2064
232 Ga0068853_100169030 3300005539 Bacteria 1977
233 Ga0068853_100205813 3300005539 Bacteria 1792
234 Ga0068853_100228366 3300005539 Bacteria 1702
235 Ga0068853_100267326 3300005539 Unclassified 1574
236 Ga0068853_100399359 3300005539 Bacteria 1286
237 Ga0068853_100410303 3300005539 Bacteria 1269
238 Ga0068853_100497853 3300005539 Bacteria 1150
239 Ga0070672_100000738 3300005543 Bacteria 19396
240 Ga0070672_100086295 3300005543 Bacteria 2524
241 Ga0070672_100097907 3300005543 Bacteria 2375
242 Ga0070672_100272233 3300005543 Bacteria 1430
243 Ga0070672_100318410 3300005543 Bacteria 1322
244 Ga0070686_100204799 3300005544 Unclassified 1417
245 Ga0070686_100547308 3300005544 Bacteria 905
246 Ga0070665_100000016 3300005548 Bacteria 451538
247 Ga0070665_100000486 3300005548 Bacteria 57134
248 Ga0070665_100076887 3300005548 Unclassified 3344
249 Ga0070665_100174223 3300005548 Bacteria 2152
250 Ga0070665_100589784 3300005548 Bacteria 1124
251 Ga0070704_100133488 3300005549 Unclassified 1928
252 Ga0068855_100001195 3300005563 Bacteria 32239
253 Ga0068855_100002033 3300005563 Bacteria 25069
254 Ga0068855_100027744 3300005563 Bacteria 6775
255 Ga0068855_100038229 3300005563 Bacteria 5703
256 Ga0068855_100095965 3300005563 Bacteria 3417
257 Ga0068855_100100781 3300005563 Bacteria 3325
258 Ga0068855_100125190 3300005563 Bacteria 2939
259 Ga0068855_100174465 3300005563 Unclassified 2433
260 Ga0068855_101058718 3300005563 Unclassified 850
261 Ga0070664_100007325 3300005564 Bacteria 8896
262 Ga0070664_100017660 3300005564 Bacteria 5858
263 Ga0070664_100101274 3300005564 Unclassified 2505
264 Ga0070664_100190998 3300005564 Bacteria 1825
265 Ga0070664_100252487 3300005564 Bacteria 1585
266 Ga0070664_100413307 3300005564 Bacteria 1235
267 Ga0070664_100501886 3300005564 Bacteria 1118
268 Ga0068857_100008614 3300005577 Bacteria 8827
269 Ga0068857_100032917 3300005577 Bacteria 4583
270 Ga0068857_100115318 3300005577 Bacteria 2416
271 Ga0068857_100132177 3300005577 Bacteria 2251
272 Ga0068857_100190919 3300005577 Bacteria 1866
273 Ga0068857_100499890 3300005577 Bacteria 1141
274 Ga0068857_100556531 3300005577 Bacteria 1081
275 Ga0068854_100003899 3300005578 Bacteria 9349
276 Ga0068854_100043746 3300005578 Bacteria 3176
277 Ga0068854_100061668 3300005578 Bacteria 2716
278 Ga0068854_100064033 3300005578 Unclassified 2670
279 Ga0068854_100068384 3300005578 Bacteria 2590
280 Ga0068854_100329767 3300005578 Bacteria 1243
281 Ga0068854_100505941 3300005578 Bacteria 1018
282 Ga0068856_100028734 3300005614 Bacteria 5433
283 Ga0068856_100062559 3300005614 Bacteria 3677
284 Ga0068856_100074389 3300005614 Bacteria 3363
285 Ga0068856_100113099 3300005614 Bacteria 2713
286 Ga0068856_100289020 3300005614 Bacteria 1656
287 Ga0070702_100453961 3300005615 Unclassified 930
288 Ga0068852_100002161 3300005616 Bacteria 13498
289 Ga0068852_100003948 3300005616 Bacteria 10424
290 Ga0068852_100005616 3300005616 Bacteria 8998
291 Ga0068852_100017743 3300005616 Bacteria 5592
292 Ga0068852_100030471 3300005616 Bacteria 4441
293 Ga0068852_100039278 3300005616 Bacteria 3984
294 Ga0068852_100073856 3300005616 Bacteria 3002
295 Ga0068852_100106272 3300005616 Bacteria 2544
296 Ga0068852_100126231 3300005616 Bacteria 2350
297 Ga0068852_100166256 3300005616 Bacteria 2064
298 Ga0068852_100211024 3300005616 Bacteria 1842
299 Ga0068852_100225934 3300005616 Bacteria 1782
300 Ga0068852_100414732 3300005616 Bacteria 1327
301 Ga0068852_100570823 3300005616 Unclassified 1133
302 Ga0068852_101072624 3300005616 Bacteria 825
303 Ga0068859_100000012 3300005617 Bacteria 300376
304 Ga0068859_100015449 3300005617 Bacteria 7669
305 Ga0068859_100016918 3300005617 Bacteria 7320
306 Ga0068859_100121114 3300005617 Bacteria 2683
307 Ga0068859_100155678 3300005617 Unclassified 2362
308 Ga0068859_100180962 3300005617 Bacteria 2191
309 Ga0068859_100182763 3300005617 Bacteria 2180
310 Ga0068859_100183247 3300005617 Unclassified 2177
311 Ga0068859_100232318 3300005617 Bacteria 1933
312 Ga0068859_100366272 3300005617 Bacteria 1536
313 Ga0068859_100391475 3300005617 Bacteria 1485
314 Ga0068859_100404895 3300005617 Bacteria 1460
315 Ga0068859_100470510 3300005617 Unclassified 1352
316 Ga0068864_100002330 3300005618 Bacteria 15704
317 Ga0068864_100010946 3300005618 Bacteria 7499
318 Ga0068864_100030323 3300005618 Bacteria 4583
319 Ga0068864_100064925 3300005618 Bacteria 3167
320 Ga0068864_100097281 3300005618 Unclassified 2606
321 Ga0068864_100279758 3300005618 Unclassified 1557
322 Ga0068864_100595738 3300005618 Bacteria 1072
323 Ga0068864_101165326 3300005618 Unclassified 768
324 Ga0068866_10010917 3300005718 Bacteria 3912
325 Ga0068866_10027968 3300005718 Bacteria 2682
326 Ga0068866_10043497 3300005718 Bacteria 2242
327 Ga0068866_10056271 3300005718 Unclassified 2023
328 Ga0068861_100049526 3300005719 Bacteria 3181
329 Ga0068861_100070790 3300005719 Bacteria 2702
330 Ga0068861_100073926 3300005719 Bacteria 2649
331 Ga0068861_100253963 3300005719 Bacteria 1501
332 Ga0068861_100406837 3300005719 Viruses 1209
333 Ga0068861_100440434 3300005719 Bacteria 1165
334 Ga0068851_10000423 3300005834 Bacteria 18902
335 Ga0068851_10019508 3300005834 Bacteria 3276
336 Ga0068851_10026913 3300005834 Bacteria 2830
337 Ga0068851_10066130 3300005834 Bacteria 1862
338 Ga0068870_10029291 3300005840 Bacteria 2772
339 Ga0068870_10038929 3300005840 Unclassified 2457
340 Ga0068863_100000858 3300005841 Bacteria 30354
341 Ga0068863_100003359 3300005841 Bacteria 15800
342 Ga0068863_100020445 3300005841 Bacteria 6326
343 Ga0068863_100024297 3300005841 Bacteria 5780
344 Ga0068863_100025383 3300005841 Bacteria 5650
345 Ga0068863_100031774 3300005841 Bacteria 5037
346 Ga0068863_100276818 3300005841 Bacteria 1625
347 Ga0068863_100325825 3300005841 Bacteria 1493
348 Ga0068863_100629581 3300005841 Bacteria 1063
349 Ga0068858_100001362 3300005842 Bacteria 25148
350 Ga0068858_100008022 3300005842 Bacteria 10169
351 Ga0068858_100047034 3300005842 Bacteria 4001
352 Ga0068858_100063752 3300005842 Bacteria 3410
353 Ga0068858_100319751 3300005842 Bacteria 1483
354 Ga0068858_100390710 3300005842 Bacteria 1336
355 Ga0068858_100856449 3300005842 Bacteria 888
356 Ga0068860_100000026 3300005843 Bacteria 270483
357 Ga0068860_100002209 3300005843 Bacteria 20481
358 Ga0068860_100007860 3300005843 Bacteria 10646
359 Ga0068860_100010129 3300005843 Bacteria 9342
360 Ga0068860_100016541 3300005843 Bacteria 7194
361 Ga0068860_100018967 3300005843 Bacteria 6682
362 Ga0068860_100072785 3300005843 Bacteria 3267
363 Ga0068860_100091780 3300005843 Bacteria 2893
364 Ga0068860_100151072 3300005843 Bacteria 2236
365 Ga0068860_100568775 3300005843 Bacteria 1137
366 Ga0068862_100010995 3300005844 Bacteria 7476
367 Ga0068862_100047162 3300005844 Unclassified 3676
368 Ga0068862_100064721 3300005844 Bacteria 3148
369 Ga0068862_100127894 3300005844 Bacteria 2244
370 Ga0068862_100133853 3300005844 Unclassified 2195
371 Ga0068862_100688106 3300005844 Bacteria 990
372 Ga0081539_10007837 3300005985 Bacteria 9546
373 Ga0070715_10006819 3300006163 Bacteria 3899
374 Ga0075366_10009633 3300006195 Bacteria 5399
375 Ga0075366_10076952 3300006195 Bacteria 1991
376 Ga0097621_100000027 3300006237 Bacteria 71873
377 Ga0097621_100007971 3300006237 Bacteria 7603
378 Ga0097621_100008933 3300006237 Bacteria 7244
379 Ga0097621_100078756 3300006237 Bacteria 2738
380 Ga0097621_100099328 3300006237 Bacteria 2446
381 Ga0097621_100117833 3300006237 Bacteria 2250
382 Ga0097621_100126650 3300006237 Bacteria 2170
383 Ga0097621_100139216 3300006237 Unclassified 2073
384 Ga0097621_100160061 3300006237 Bacteria 1935
385 Ga0097621_100576317 3300006237 Bacteria 1026
386 Ga0097621_100879549 3300006237 Unclassified 833
387 Ga0068871_100000107 3300006358 Bacteria 50575
388 Ga0068871_100008378 3300006358 Bacteria 7435
389 Ga0068871_100083065 3300006358 Bacteria 2656
390 Ga0068871_100086792 3300006358 Bacteria 2600
391 Ga0068871_100095306 3300006358 Bacteria 2485
392 Ga0068871_100097165 3300006358 Bacteria 2462
393 Ga0068871_100103213 3300006358 Bacteria 2390
394 Ga0068871_100125649 3300006358 Bacteria 2171
395 Ga0068871_100136715 3300006358 Bacteria 2082
396 Ga0068871_100161295 3300006358 Unclassified 1918
397 Ga0068871_100553333 3300006358 Bacteria 1042
398 Ga0075428_100056891 3300006844 Bacteria 4282
399 Ga0075430_100005928 3300006846 Bacteria 10322
400 Ga0075431_100001800 3300006847 Bacteria 20232
401 Ga0075434_100540770 3300006871 Unclassified 1185
402 Ga0075429_100015792 3300006880 Bacteria 6539
403 Ga0075429_100037587 3300006880 Unclassified 4214
404 Ga0075429_100041776 3300006880 Bacteria 3993
405 Ga0075429_100252586 3300006880 Bacteria 1544
406 Ga0075429_100642628 3300006880 Unclassified 929
407 Ga0068865_100002249 3300006881 Bacteria 11354
408 Ga0068865_100125695 3300006881 Unclassified 1914
409 Ga0068865_100128968 3300006881 Unclassified 1892
410 Ga0068865_100131110 3300006881 Unclassified 1878
411 Ga0068865_100197973 3300006881 Bacteria 1558
412 Ga0075436_100290683 3300006914 Unclassified 1170
413 Ga0097620_100000012 3300006931 Bacteria 300376
414 Ga0097620_100015449 3300006931 Bacteria 7669
415 Ga0097620_100016919 3300006931 Bacteria 7320
416 Ga0097620_100121119 3300006931 Bacteria 2683
417 Ga0097620_100155682 3300006931 Unclassified 2362
418 Ga0097620_100180977 3300006931 Bacteria 2191
419 Ga0097620_100182775 3300006931 Bacteria 2180
420 Ga0097620_100183241 3300006931 Unclassified 2177
421 Ga0097620_100232321 3300006931 Bacteria 1933
422 Ga0097620_100366299 3300006931 Bacteria 1536
423 Ga0097620_100391444 3300006931 Bacteria 1485
424 Ga0097620_100404905 3300006931 Bacteria 1460
425 Ga0105251_10095755 3300009011 Bacteria 1360
426 Ga0105240_10000258 3300009093 Bacteria 105011
427 Ga0105240_10000715 3300009093 Bacteria 60725
428 Ga0105240_10002252 3300009093 Bacteria 31329
429 Ga0105240_10004553 3300009093 Bacteria 21043
430 Ga0105240_10004621 3300009093 Bacteria 20878
431 Ga0105240_10016056 3300009093 Bacteria 10147
432 Ga0105240_10023337 3300009093 Bacteria 8185
433 Ga0105240_10039801 3300009093 Bacteria 6017
434 Ga0105240_10054842 3300009093 Bacteria 4993
435 Ga0105240_10060026 3300009093 Bacteria 4742
436 Ga0105240_10203604 3300009093 Unclassified 2318
437 Ga0105240_10212273 3300009093 Bacteria 2261
438 Ga0111539_10162199 3300009094 Unclassified 2614
439 Ga0105245_10507780 3300009098 Bacteria 1222
440 Ga0105247_10001409 3300009101 Bacteria 17436
441 Ga0105247_10008259 3300009101 Bacteria 6354
442 Ga0114129_10015867 3300009147 Bacteria 10712
443 Ga0105241_10000224 3300009174 Bacteria 42685
444 Ga0105241_10000533 3300009174 Bacteria 28600
445 Ga0105241_10069438 3300009174 Bacteria 2732
446 Ga0105241_10097536 3300009174 Bacteria 2331
447 Ga0105241_10139058 3300009174 Bacteria 1975
448 Ga0105241_10259768 3300009174 Unclassified 1476
449 Ga0105241_10332089 3300009174 Bacteria 1314
450 Ga0105241_10769260 3300009174 Bacteria 884
451 Ga0105242_10043542 3300009176 Bacteria 3631
452 Ga0105242_10056582 3300009176 Unclassified 3210
453 Ga0105242_10076969 3300009176 Bacteria 2782
454 Ga0105242_10451632 3300009176 Bacteria 1212
455 Ga0105242_10631368 3300009176 Bacteria 1039
456 Ga0105242_10844261 3300009176 Bacteria 911
457 Ga0105248_10004939 3300009177 Bacteria 14734
458 Ga0105248_10060288 3300009177 Bacteria 4260
459 Ga0105237_10005490 3300009545 Bacteria 14294
460 Ga0105237_10005694 3300009545 Bacteria 14017
461 Ga0105237_10014096 3300009545 Bacteria 8363
462 Ga0105237_10022472 3300009545 Bacteria 6471
463 Ga0105237_10047089 3300009545 Bacteria 4335
464 Ga0105237_10064862 3300009545 Bacteria 3648
465 Ga0105237_10098324 3300009545 Bacteria 2918
466 Ga0105237_10126957 3300009545 Unclassified 2545
467 Ga0105238_10006981 3300009551 Bacteria 11286
468 Ga0105238_10064549 3300009551 Unclassified 3662
469 Ga0105238_10078160 3300009551 Bacteria 3300
470 Ga0105238_10134127 3300009551 Unclassified 2454
471 Ga0105249_10001958 3300009553 Bacteria 17861
472 Ga0105249_10023081 3300009553 Bacteria 5579
473 Ga0105249_10034852 3300009553 Unclassified 4562
474 Ga0105249_10041170 3300009553 Bacteria 4198
475 Ga0105249_10102452 3300009553 Unclassified 2694
476 Ga0105249_10580375 3300009553 Bacteria 1174
477 Ga0105249_10596564 3300009553 Bacteria 1159
478 Ga0105249_10974557 3300009553 Bacteria 916
479 Ga0105239_10001037 3300010375 Bacteria 38729
480 Ga0105239_10011083 3300010375 Bacteria 10062
481 Ga0105239_10017966 3300010375 Bacteria 7820
482 Ga0105239_10043883 3300010375 Bacteria 4903
483 Ga0105239_10066389 3300010375 Bacteria 3963
484 Ga0105239_10127719 3300010375 Bacteria 2826
485 Ga0105239_10192320 3300010375 Bacteria 2284
486 Ga0105239_10371360 3300010375 Bacteria 1616
487 Ga0105239_10386859 3300010375 Unclassified 1582
488 Ga0105239_10411698 3300010375 Bacteria 1531
489 Ga0105246_10005718 3300011119 Bacteria 7591
490 Ga0105246_10094380 3300011119 Bacteria 2164
491 Ga0105246_10145723 3300011119 Bacteria 1786
492 Ga0105246_10215943 3300011119 Bacteria 1500
493 Ga0105246_10425992 3300011119 Bacteria 1109
494 Ga0105246_10767641 3300011119 Bacteria 852
495 Ga0157373_10000275 3300013100 Bacteria 41320
496 Ga0157373_10015282 3300013100 Bacteria 5611
497 Ga0157373_10016691 3300013100 Bacteria 5350
498 Ga0157373_10026324 3300013100 Bacteria 4202
499 Ga0157373_10038389 3300013100 Unclassified 3432
500 Ga0157373_10050702 3300013100 Bacteria 2955
501 Ga0157373_10110592 3300013100 Unclassified 1932
502 Ga0157373_10211189 3300013100 Bacteria 1369
503 Ga0157373_10277050 3300013100 Unclassified 1188
504 Ga0157373_10290340 3300013100 Unclassified 1160
505 Ga0157371_10000596 3300013102 Bacteria 43030
506 Ga0157371_10002078 3300013102 Bacteria 19616
507 Ga0157371_10011331 3300013102 Bacteria 6878
508 Ga0157371_10012915 3300013102 Bacteria 6359
509 Ga0157371_10024481 3300013102 Bacteria 4408
510 Ga0157371_10029505 3300013102 Bacteria 3965
511 Ga0157371_10064707 3300013102 Bacteria 2591
512 Ga0157371_10091472 3300013102 Bacteria 2155
513 Ga0157371_10091597 3300013102 Bacteria 2153
514 Ga0157371_10110867 3300013102 Bacteria 1947
515 Ga0157371_10137041 3300013102 Bacteria 1743
516 Ga0157371_10162979 3300013102 Bacteria 1592
517 Ga0157371_10169831 3300013102 Bacteria 1558
518 Ga0157371_10179070 3300013102 Bacteria 1516
519 Ga0157371_10226367 3300013102 Bacteria 1343
520 Ga0157371_10263919 3300013102 Bacteria 1242
521 Ga0157371_10755418 3300013102 Bacteria 730
522 Ga0157370_10000238 3300013104 Bacteria 70036
523 Ga0157370_10000405 3300013104 Bacteria 54383
524 Ga0157370_10001393 3300013104 Bacteria 29968
525 Ga0157370_10005886 3300013104 Bacteria 13672
526 Ga0157370_10055078 3300013104 Bacteria 3790
527 Ga0157370_10070212 3300013104 Bacteria 3307
528 Ga0157370_10160251 3300013104 Bacteria 2093
529 Ga0157370_10209739 3300013104 Unclassified 1806
530 Ga0157370_10322742 3300013104 Bacteria 1424
531 Ga0157370_10389986 3300013104 Bacteria 1282
532 Ga0157370_10770037 3300013104 Bacteria 876
533 Ga0157369_10023820 3300013105 Bacteria 6816
534 Ga0157369_10040594 3300013105 Bacteria 5079
535 Ga0157369_10059170 3300013105 Bacteria 4132
536 Ga0157369_10067243 3300013105 Bacteria 3853
537 Ga0157369_10068914 3300013105 Bacteria 3801
538 Ga0157369_10100151 3300013105 Unclassified 3089
539 Ga0157369_10161499 3300013105 Bacteria 2365
540 Ga0157369_10185665 3300013105 Bacteria 2187
541 Ga0157369_10188812 3300013105 Unclassified 2166
542 Ga0157369_10279023 3300013105 Bacteria 1740
543 Ga0157369_10366869 3300013105 Bacteria 1495
544 Ga0157369_10485617 3300013105 Bacteria 1278
545 Ga0157369_10583150 3300013105 Bacteria 1155
546 Ga0157369_10997484 3300013105 Bacteria 857
547 Ga0157374_10000841 3300013296 Bacteria 26835
548 Ga0157374_10006478 3300013296 Bacteria 9936
549 Ga0157374_10015281 3300013296 Bacteria 6732
550 Ga0157374_10017671 3300013296 Bacteria 6284
551 Ga0157374_10046728 3300013296 Bacteria 4011
552 Ga0157374_10128112 3300013296 Unclassified 2455
553 Ga0157374_10154491 3300013296 Bacteria 2232
554 Ga0157374_10296805 3300013296 Unclassified 1598
555 Ga0157374_10357898 3300013296 Bacteria 1451
556 Ga0157374_10450174 3300013296 Bacteria 1289
557 Ga0157374_10490250 3300013296 Bacteria 1233
558 Ga0157374_11316718 3300013296 Bacteria 744
559 Ga0157378_10002090 3300013297 Bacteria 17837
560 Ga0157378_10005857 3300013297 Bacteria 10768
561 Ga0157378_10010065 3300013297 Bacteria 8242
562 Ga0157378_10012644 3300013297 Bacteria 7387
563 Ga0157378_10023595 3300013297 Bacteria 5411
564 Ga0157378_10031342 3300013297 Bacteria 4697
565 Ga0157378_10045275 3300013297 Unclassified 3909
566 Ga0157378_10069077 3300013297 Bacteria 3169
567 Ga0157378_10101789 3300013297 Bacteria 2624
568 Ga0157378_10132143 3300013297 Unclassified 2311
569 Ga0157378_10369500 3300013297 Unclassified 1406
570 Ga0157378_10415877 3300013297 Bacteria 1328
571 Ga0157378_11065749 3300013297 Bacteria 844
572 Ga0157378_11356574 3300013297 Bacteria 753
573 Ga0163162_10000100 3300013306 Bacteria 78269
574 Ga0163162_10000279 3300013306 Bacteria 46872
575 Ga0163162_10001517 3300013306 Bacteria 21625
576 Ga0163162_10003820 3300013306 Bacteria 14438
577 Ga0163162_10004813 3300013306 Bacteria 13027
578 Ga0163162_10006228 3300013306 Bacteria 11565
579 Ga0163162_10006285 3300013306 Bacteria 11505
580 Ga0163162_10020346 3300013306 Bacteria 6519
581 Ga0163162_10038399 3300013306 Bacteria 4778
582 Ga0163162_10118184 3300013306 Unclassified 2753
583 Ga0163162_10162009 3300013306 Bacteria 2359
584 Ga0163162_10387958 3300013306 Bacteria 1530
585 Ga0163162_10502404 3300013306 Bacteria 1343
586 Ga0163162_10551733 3300013306 Unclassified 1280
587 Ga0163162_11602752 3300013306 Bacteria 743
588 Ga0157372_10002704 3300013307 Bacteria 19172
589 Ga0157372_10009200 3300013307 Bacteria 10502
590 Ga0157372_10010252 3300013307 Bacteria 9953
591 Ga0157372_10010966 3300013307 Bacteria 9644
592 Ga0157372_10015765 3300013307 Bacteria 8107
593 Ga0157372_10029622 3300013307 Bacteria 5980
594 Ga0157372_10031629 3300013307 Bacteria 5794
595 Ga0157372_10072476 3300013307 Bacteria 3882
596 Ga0157372_10090343 3300013307 Bacteria 3482
597 Ga0157372_10103164 3300013307 Bacteria 3258
598 Ga0157372_10109383 3300013307 Bacteria 3165
599 Ga0157372_10113091 3300013307 Bacteria 3111
600 Ga0157372_10114415 3300013307 Bacteria 3093
601 Ga0157372_10139494 3300013307 Bacteria 2792
602 Ga0157372_10141929 3300013307 Bacteria 2768
603 Ga0157372_10156889 3300013307 Bacteria 2629
604 Ga0157372_10165768 3300013307 Bacteria 2555
605 Ga0157372_10199261 3300013307 Bacteria 2319
606 Ga0157372_10222536 3300013307 Bacteria 2188
607 Ga0157372_10294364 3300013307 Unclassified 1888
608 Ga0157372_10298073 3300013307 Bacteria 1875
609 Ga0157372_10382776 3300013307 Unclassified 1639
610 Ga0157372_10388080 3300013307 Bacteria 1627
611 Ga0157372_10388520 3300013307 Bacteria 1626
612 Ga0157372_10626420 3300013307 Bacteria 1253
613 Ga0157372_10677249 3300013307 Bacteria 1201
614 Ga0157372_10711664 3300013307 Bacteria 1168
615 Ga0157372_10791279 3300013307 Unclassified 1102
616 Ga0157372_11149835 3300013307 Bacteria 897
617 Ga0157372_11462428 3300013307 Bacteria 787
618 Ga0157375_10000057 3300013308 Bacteria 122654
619 Ga0157375_10000336 3300013308 Bacteria 42479
620 Ga0157375_10038477 3300013308 Unclassified 4593
621 Ga0157375_10039491 3300013308 Bacteria 4543
622 Ga0157375_10053145 3300013308 Bacteria 3985
623 Ga0157375_10064756 3300013308 Bacteria 3641
624 Ga0157375_10076446 3300013308 Bacteria 3375
625 Ga0157375_10084012 3300013308 Bacteria 3231
626 Ga0157375_10086998 3300013308 Bacteria 3177
627 Ga0157375_10155431 3300013308 Bacteria 2426
628 Ga0157375_10166926 3300013308 Bacteria 2346
629 Ga0157375_10183454 3300013308 Bacteria 2245
630 Ga0157375_10275825 3300013308 Bacteria 1844
631 Ga0157375_10289583 3300013308 Unclassified 1801
632 Ga0157375_10348648 3300013308 Unclassified 1646
633 Ga0157375_10357986 3300013308 Bacteria 1625
634 Ga0157375_10653920 3300013308 Unclassified 1207
635 Ga0157375_10704417 3300013308 Bacteria 1163
636 Ga0157375_10734074 3300013308 Bacteria 1140
637 Ga0157375_11143710 3300013308 Bacteria 912
638 Ga0163163_10000193 3300014325 Bacteria 62699
639 Ga0163163_10000254 3300014325 Bacteria 54049
640 Ga0163163_10002122 3300014325 Bacteria 16737
641 Ga0163163_10009925 3300014325 Bacteria 8537
642 Ga0163163_10020274 3300014325 Bacteria 6258
643 Ga0163163_10142515 3300014325 Bacteria 2439
644 Ga0163163_10232058 3300014325 Bacteria 1894
645 Ga0163163_10238362 3300014325 Bacteria 1868
646 Ga0163163_10442588 3300014325 Bacteria 1359
647 Ga0163163_10506995 3300014325 Bacteria 1268
648 Ga0157380_10001093 3300014326 Bacteria 17458
649 Ga0157380_10006970 3300014326 Bacteria 7998
650 Ga0157380_10010950 3300014326 Bacteria 6540
651 Ga0157380_10150228 3300014326 Unclassified 2013
652 Ga0157380_10196143 3300014326 Bacteria 1787
653 Ga0157380_10248107 3300014326 Unclassified 1609
654 Ga0157380_10272719 3300014326 Bacteria 1543
655 Ga0157380_10399881 3300014326 Bacteria 1303
656 Ga0157380_10735489 3300014326 Bacteria 996
657 Ga0157380_11066258 3300014326 Bacteria 845
658 Ga0157377_10028251 3300014745 Bacteria 3018
659 Ga0157377_10057265 3300014745 Unclassified 2215
660 Ga0157377_10197146 3300014745 Unclassified 1276
661 Ga0157377_10210314 3300014745 Unclassified 1240
662 Ga0157379_10000367 3300014968 Bacteria 36246
663 Ga0157379_10017665 3300014968 Bacteria 6283
664 Ga0157379_10026404 3300014968 Bacteria 5170
665 Ga0157379_10033384 3300014968 Bacteria 4589
666 Ga0157379_10047182 3300014968 Bacteria 3842
667 Ga0157379_10132198 3300014968 Bacteria 2246
668 Ga0157379_10145105 3300014968 Bacteria 2140
669 Ga0157379_10304482 3300014968 Unclassified 1453
670 Ga0157379_10583198 3300014968 Bacteria 1042
671 Ga0157376_10000135 3300014969 Bacteria 50667
672 Ga0157376_10002989 3300014969 Bacteria 11593
673 Ga0157376_10007359 3300014969 Bacteria 7849
674 Ga0157376_10019024 3300014969 Bacteria 5283
675 Ga0157376_10127764 3300014969 Bacteria 2264
676 Ga0157376_10216996 3300014969 Unclassified 1769
677 Ga0157376_10242873 3300014969 Bacteria 1678
678 Ga0157376_10355273 3300014969 Bacteria 1404
679 Ga0157376_10411918 3300014969 Bacteria 1309
680 Ga0157376_10526796 3300014969 Unclassified 1166
681 Ga0157376_10766548 3300014969 Bacteria 975
682 Ga0163161_10001091 3300017792 Bacteria 20526
683 Ga0163161_10035078 3300017792 Bacteria 3589
684 Ga0163161_10101064 3300017792 Bacteria 2147
685 Ga0163161_10104760 3300017792 Bacteria 2109
686 Ga0163161_10268021 3300017792 Bacteria 1335
687 Ga0163161_10485161 3300017792 Bacteria 1004
688 Ga0197907_10191818 3300020069 Bacteria 1660
689 Ga0197907_10951066 3300020069 Bacteria 1812
690 Ga0206356_11664014 3300020070 Bacteria 1543
691 Ga0206355_1373070 3300020076 Unclassified 1018
692 Ga0206352_10396221 3300020078 Unclassified 965
693 Ga0206352_11083765 3300020078 Bacteria 1973
694 Ga0213876_10001740 3300021384 Bacteria 13213
695 Ga0213876_10010098 3300021384 Bacteria 5073
696 Ga0224712_10165530 3300022467 Unclassified 989
697 Ga0207426_1000104 3300025302 Bacteria 249464
698 Ga0207697_10013979 3300025315 Bacteria 3341
699 Ga0207697_10093496 3300025315 Unclassified 1276
700 Ga0207697_10181130 3300025315 Unclassified 923
701 Ga0207656_10002124 3300025321 Bacteria 6625
702 Ga0207682_10001049 3300025893 Bacteria 12716
703 Ga0207682_10063133 3300025893 Bacteria 1554
704 Ga0207642_10027167 3300025899 Bacteria 2340
705 Ga0207710_10012887 3300025900 Bacteria 3522
706 Ga0207710_10050658 3300025900 Unclassified 1863
707 Ga0207688_10035812 3300025901 Unclassified 2750
708 Ga0207688_10045084 3300025901 Unclassified 2459
709 Ga0207688_10077139 3300025901 Bacteria 1898
710 Ga0207680_10000371 3300025903 Bacteria 21501
711 Ga0207680_10025925 3300025903 Unclassified 3240
712 Ga0207680_10028803 3300025903 Bacteria 3112
713 Ga0207680_10075669 3300025903 Unclassified 2100
714 Ga0207680_10449108 3300025903 Bacteria 915
715 Ga0207647_10004784 3300025904 Bacteria 10024
716 Ga0207647_10012837 3300025904 Bacteria 5819
717 Ga0207647_10019112 3300025904 Bacteria 4613
718 Ga0207685_10010434 3300025905 Bacteria 2743
719 Ga0207645_10000511 3300025907 Bacteria 32164
720 Ga0207645_10004291 3300025907 Bacteria 10577
721 Ga0207645_10017285 3300025907 Unclassified 4765
722 Ga0207645_10297712 3300025907 Unclassified 1074
723 Ga0207645_10507983 3300025907 Bacteria 816
724 Ga0207643_10001735 3300025908 Bacteria 12216
725 Ga0207643_10061009 3300025908 Bacteria 2153
726 Ga0207643_10089852 3300025908 Unclassified 1789
727 Ga0207643_10205166 3300025908 Bacteria 1201
728 Ga0207643_10250150 3300025908 Bacteria 1092
729 Ga0207705_10034312 3300025909 Bacteria 3627
730 Ga0207705_10043425 3300025909 Bacteria 3230
731 Ga0207705_10163048 3300025909 Bacteria 1675
732 Ga0207705_10308121 3300025909 Bacteria 1215
733 Ga0207705_10345656 3300025909 Bacteria 1145
734 Ga0207705_10541303 3300025909 Bacteria 905
735 Ga0207654_10001646 3300025911 Bacteria 11680
736 Ga0207654_10003857 3300025911 Bacteria 7553
737 Ga0207654_10239301 3300025911 Bacteria 1212
738 Ga0207707_10000574 3300025912 Bacteria 37317
739 Ga0207707_10046727 3300025912 Bacteria 3771
740 Ga0207707_10073490 3300025912 Bacteria 2982
741 Ga0207707_10177512 3300025912 Bacteria 1860
742 Ga0207707_10255823 3300025912 Bacteria 1520
743 Ga0207707_10255895 3300025912 Bacteria 1520
744 Ga0207707_10476152 3300025912 Unclassified 1067
745 Ga0207707_10752275 3300025912 Bacteria 815
746 Ga0207695_10000327 3300025913 Bacteria 113436
747 Ga0207695_10000486 3300025913 Bacteria 84856
748 Ga0207695_10003818 3300025913 Bacteria 20882
749 Ga0207695_10008726 3300025913 Bacteria 12639
750 Ga0207695_10008950 3300025913 Bacteria 12463
751 Ga0207695_10012720 3300025913 Bacteria 10076
752 Ga0207695_10038067 3300025913 Bacteria 5184
753 Ga0207695_10043454 3300025913 Bacteria 4789
754 Ga0207695_10099398 3300025913 Unclassified 2907
755 Ga0207695_10152595 3300025913 Unclassified 2248
756 Ga0207671_10001742 3300025914 Bacteria 24460
757 Ga0207671_10004018 3300025914 Bacteria 14291
758 Ga0207671_10006632 3300025914 Bacteria 10262
759 Ga0207671_10059149 3300025914 Bacteria 2841
760 Ga0207671_10071305 3300025914 Unclassified 2591
761 Ga0207671_10166148 3300025914 Bacteria 1711
762 Ga0207671_10214903 3300025914 Bacteria 1505
763 Ga0207671_10384454 3300025914 Bacteria 1115
764 Ga0207660_10010881 3300025917 Bacteria 5915
765 Ga0207660_10135955 3300025917 Bacteria 1876
766 Ga0207662_10033075 3300025918 Bacteria 3012
767 Ga0207662_10327142 3300025918 Bacteria 1024
768 Ga0207657_10004159 3300025919 Bacteria 15337
769 Ga0207657_10018632 3300025919 Bacteria 6618
770 Ga0207657_10029137 3300025919 Bacteria 5029
771 Ga0207657_10136773 3300025919 Bacteria 2004
772 Ga0207657_10400054 3300025919 Bacteria 1080
773 Ga0207649_10006464 3300025920 Bacteria 6364
774 Ga0207649_10022783 3300025920 Bacteria 3619
775 Ga0207649_10082255 3300025920 Unclassified 2087
776 Ga0207649_10206618 3300025920 Bacteria 1390
777 Ga0207652_10000210 3300025921 Bacteria 61797
778 Ga0207652_10001002 3300025921 Bacteria 26045
779 Ga0207652_10002655 3300025921 Bacteria 15013
780 Ga0207652_10007311 3300025921 Bacteria 8898
781 Ga0207652_10028457 3300025921 Bacteria 4662
782 Ga0207652_10045845 3300025921 Bacteria 3728
783 Ga0207652_10058906 3300025921 Bacteria 3309
784 Ga0207652_10135432 3300025921 Bacteria 2199
785 Ga0207652_10175339 3300025921 Bacteria 1925
786 Ga0207652_10331774 3300025921 Bacteria 1373
787 Ga0207681_10027241 3300025923 Unclassified 3694
788 Ga0207681_10068587 3300025923 Bacteria 2464
789 Ga0207681_10330514 3300025923 Unclassified 1215
790 Ga0207694_10057302 3300025924 Unclassified 3029
791 Ga0207694_10061747 3300025924 Bacteria 2917
792 Ga0207694_10262784 3300025924 Bacteria 1414
793 Ga0207650_10009262 3300025925 Bacteria 6729
794 Ga0207650_10025960 3300025925 Unclassified 4176
795 Ga0207650_10041161 3300025925 Unclassified 3384
796 Ga0207650_10097267 3300025925 Bacteria 2260
797 Ga0207650_10117984 3300025925 Bacteria 2062
798 Ga0207650_10134753 3300025925 Bacteria 1936
799 Ga0207650_10313288 3300025925 Bacteria 1284
800 Ga0207650_10911341 3300025925 Bacteria 746
801 Ga0207659_10052816 3300025926 Bacteria 2897
802 Ga0207659_10077944 3300025926 Bacteria 2441
803 Ga0207659_10095451 3300025926 Bacteria 2230
804 Ga0207659_10185262 3300025926 Bacteria 1652
805 Ga0207659_10231083 3300025926 Unclassified 1492
806 Ga0207644_10045467 3300025931 Bacteria 3123
807 Ga0207644_10226122 3300025931 Bacteria 1485
808 Ga0207644_10248240 3300025931 Bacteria 1419
809 Ga0207644_10651355 3300025931 Bacteria 877
810 Ga0207644_10720483 3300025931 Unclassified 832
811 Ga0207644_10742717 3300025931 Bacteria 819
812 Ga0207690_10008207 3300025932 Bacteria 6194
813 Ga0207690_10029723 3300025932 Bacteria 3477
814 Ga0207690_10217383 3300025932 Bacteria 1460
815 Ga0207690_10358006 3300025932 Bacteria 1155
816 Ga0207706_10003803 3300025933 Bacteria 14383
817 Ga0207706_10005368 3300025933 Bacteria 11945
818 Ga0207706_10007905 3300025933 Bacteria 9817
819 Ga0207706_10026061 3300025933 Bacteria 5235
820 Ga0207706_10031025 3300025933 Bacteria 4763
821 Ga0207706_10032502 3300025933 Bacteria 4646
822 Ga0207706_10654384 3300025933 Unclassified 900
823 Ga0207686_10010535 3300025934 Bacteria 5037
824 Ga0207686_10023055 3300025934 Bacteria 3590
825 Ga0207686_10030121 3300025934 Unclassified 3210
826 Ga0207686_10147518 3300025934 Unclassified 1634
827 Ga0207686_10552608 3300025934 Bacteria 900
828 Ga0207670_10012704 3300025936 Bacteria 4936
829 Ga0207670_10113038 3300025936 Bacteria 1960
830 Ga0207670_10321076 3300025936 Bacteria 1218
831 Ga0207670_10797940 3300025936 Bacteria 786
832 Ga0207669_10043590 3300025937 Bacteria 2629
833 Ga0207669_10060082 3300025937 Bacteria 2328
834 Ga0207669_10077992 3300025937 Bacteria 2109
835 Ga0207669_10270361 3300025937 Bacteria 1276
836 Ga0207669_10310274 3300025937 Bacteria 1203
837 Ga0207704_10000484 3300025938 Bacteria 17750
838 Ga0207704_10045597 3300025938 Unclassified 2605
839 Ga0207704_10102486 3300025938 Bacteria 1912
840 Ga0207691_10002120 3300025940 Bacteria 19396
841 Ga0207691_10012396 3300025940 Bacteria 8172
842 Ga0207691_10013692 3300025940 Bacteria 7750
843 Ga0207691_10043591 3300025940 Bacteria 4134
844 Ga0207691_10064166 3300025940 Bacteria 3328
845 Ga0207691_10078152 3300025940 Bacteria 2979
846 Ga0207691_10079939 3300025940 Bacteria 2942
847 Ga0207691_10098164 3300025940 Bacteria 2617
848 Ga0207691_10213394 3300025940 Bacteria 1676
849 Ga0207691_10428141 3300025940 Bacteria 1127
850 Ga0207691_10478718 3300025940 Bacteria 1058
851 Ga0207711_10249460 3300025941 Bacteria 1630
852 Ga0207689_10000329 3300025942 Bacteria 44014
853 Ga0207689_10002405 3300025942 Bacteria 17429
854 Ga0207689_10005043 3300025942 Bacteria 11902
855 Ga0207689_10010393 3300025942 Bacteria 8016
856 Ga0207689_10021416 3300025942 Bacteria 5435
857 Ga0207689_10038305 3300025942 Bacteria 3972
858 Ga0207689_10044691 3300025942 Bacteria 3663
859 Ga0207689_10361108 3300025942 Unclassified 1208
860 Ga0207689_10381998 3300025942 Unclassified 1173
861 Ga0207661_10007884 3300025944 Bacteria 7589
862 Ga0207661_10043012 3300025944 Bacteria 3564
863 Ga0207661_10056567 3300025944 Bacteria 3149
864 Ga0207661_10107804 3300025944 Unclassified 2350
865 Ga0207679_10000751 3300025945 Bacteria 21527
866 Ga0207679_10001121 3300025945 Bacteria 17095
867 Ga0207679_10070887 3300025945 Bacteria 2627
868 Ga0207679_10113802 3300025945 Unclassified 2141
869 Ga0207679_10181918 3300025945 Bacteria 1740
870 Ga0207679_10191868 3300025945 Bacteria 1699
871 Ga0207679_10287659 3300025945 Bacteria 1412
872 Ga0207679_10470098 3300025945 Bacteria 1118
873 Ga0207667_10000340 3300025949 Bacteria 63904
874 Ga0207667_10009409 3300025949 Bacteria 11510
875 Ga0207667_10058269 3300025949 Bacteria 4052
876 Ga0207667_10061201 3300025949 Bacteria 3939
877 Ga0207667_10089071 3300025949 Bacteria 3190
878 Ga0207667_10109580 3300025949 Bacteria 2848
879 Ga0207667_10167573 3300025949 Bacteria 2258
880 Ga0207667_10235251 3300025949 Bacteria 1875
881 Ga0207667_10272676 3300025949 Bacteria 1729
882 Ga0207651_10002824 3300025960 Bacteria 8358
883 Ga0207651_10043146 3300025960 Bacteria 3008
884 Ga0207651_10069071 3300025960 Bacteria 2494
885 Ga0207651_10108025 3300025960 Bacteria 2081
886 Ga0207651_10119421 3300025960 Bacteria 1996
887 Ga0207651_10127715 3300025960 Unclassified 1940
888 Ga0207651_10297261 3300025960 Bacteria 1341
889 Ga0207651_10514420 3300025960 Bacteria 1036
890 Ga0207712_10001475 3300025961 Bacteria 16057
891 Ga0207712_10011683 3300025961 Bacteria 5598
892 Ga0207712_10012015 3300025961 Bacteria 5526
893 Ga0207712_10013170 3300025961 Bacteria 5301
894 Ga0207712_10031288 3300025961 Bacteria 3583
895 Ga0207712_10395825 3300025961 Bacteria 1160
896 Ga0207712_11050023 3300025961 Bacteria 724
897 Ga0207668_10034958 3300025972 Bacteria 3342
898 Ga0207668_10251892 3300025972 Bacteria 1434
899 Ga0207668_10328437 3300025972 Bacteria 1272
900 Ga0207640_10017218 3300025981 Bacteria 4223
901 Ga0207640_10155426 3300025981 Unclassified 1685
902 Ga0207640_10270452 3300025981 Unclassified 1329
903 Ga0207640_10639296 3300025981 Bacteria 905
904 Ga0207658_10000847 3300025986 Bacteria 25559
905 Ga0207658_10039539 3300025986 Bacteria 3403
906 Ga0207658_10051028 3300025986 Bacteria 3047
907 Ga0207658_10090037 3300025986 Bacteria 2377
908 Ga0207658_10260123 3300025986 Bacteria 1479
909 Ga0207658_10303514 3300025986 Unclassified 1376
910 Ga0207658_10591277 3300025986 Bacteria 996
911 Ga0207677_10001136 3300026023 Bacteria 14521
912 Ga0207677_10007895 3300026023 Bacteria 5915
913 Ga0207677_10018452 3300026023 Bacteria 4186
914 Ga0207677_10062805 3300026023 Unclassified 2578
915 Ga0207677_10067033 3300026023 Bacteria 2513
916 Ga0207677_10256846 3300026023 Unclassified 1422
917 Ga0207677_10369311 3300026023 Bacteria 1208
918 Ga0207677_10764604 3300026023 Bacteria 862
919 Ga0207703_10010768 3300026035 Bacteria 7135
920 Ga0207703_10040034 3300026035 Bacteria 3749
921 Ga0207703_10091248 3300026035 Bacteria 2562
922 Ga0207703_10276170 3300026035 Bacteria 1524
923 Ga0207703_10459619 3300026035 Bacteria 1190
924 Ga0207703_10790010 3300026035 Bacteria 906
925 Ga0207703_10827590 3300026035 Bacteria 885
926 Ga0207639_10010003 3300026041 Bacteria 6556
927 Ga0207639_10016589 3300026041 Bacteria 5213
928 Ga0207639_10019883 3300026041 Bacteria 4798
929 Ga0207639_10026659 3300026041 Bacteria 4200
930 Ga0207639_10123392 3300026041 Bacteria 2132
931 Ga0207639_10138006 3300026041 Unclassified 2028
932 Ga0207639_10149936 3300026041 Bacteria 1952
933 Ga0207639_10196223 3300026041 Unclassified 1728
934 Ga0207639_10200336 3300026041 Bacteria 1712
935 Ga0207639_10280880 3300026041 Bacteria 1464
936 Ga0207639_10289581 3300026041 Bacteria 1443
937 Ga0207639_10323026 3300026041 Unclassified 1371
938 Ga0207639_10379437 3300026041 Bacteria 1269
939 Ga0207639_10607474 3300026041 Bacteria 1009
940 Ga0207639_10655436 3300026041 Bacteria 971
941 Ga0207639_10723978 3300026041 Unclassified 924
942 Ga0207678_10013940 3300026067 Bacteria 7065
943 Ga0207678_10108296 3300026067 Bacteria 2370
944 Ga0207678_10171337 3300026067 Bacteria 1853
945 Ga0207708_10049982 3300026075 Bacteria 3183
946 Ga0207708_10132051 3300026075 Bacteria 1953
947 Ga0207708_10507710 3300026075 Unclassified 1011
948 Ga0207702_10093619 3300026078 Bacteria 2635
949 Ga0207702_10138992 3300026078 Bacteria 2195
950 Ga0207702_10643854 3300026078 Bacteria 1042
951 Ga0207641_10000152 3300026088 Bacteria 98311
952 Ga0207641_10000418 3300026088 Bacteria 49680
953 Ga0207641_10004489 3300026088 Bacteria 12072
954 Ga0207641_10051955 3300026088 Bacteria 3470
955 Ga0207641_10087159 3300026088 Bacteria 2724
956 Ga0207641_10115859 3300026088 Bacteria 2383
957 Ga0207641_10365245 3300026088 Bacteria 1379
958 Ga0207648_10001186 3300026089 Bacteria 29157
959 Ga0207648_10031158 3300026089 Bacteria 4715
960 Ga0207648_10045600 3300026089 Bacteria 3845
961 Ga0207648_10055669 3300026089 Bacteria 3452
962 Ga0207648_10063825 3300026089 Bacteria 3210
963 Ga0207648_10097621 3300026089 Bacteria 2571
964 Ga0207648_10101771 3300026089 Unclassified 2517
965 Ga0207648_10146808 3300026089 Unclassified 2080
966 Ga0207648_10148765 3300026089 Bacteria 2066
967 Ga0207648_10238101 3300026089 Bacteria 1620
968 Ga0207648_10643040 3300026089 Unclassified 980
969 Ga0207648_10733062 3300026089 Unclassified 917
970 Ga0207648_11067979 3300026089 Bacteria 757
971 Ga0207676_10006216 3300026095 Bacteria 8433
972 Ga0207676_10098522 3300026095 Unclassified 2417
973 Ga0207676_10367815 3300026095 Bacteria 1335
974 Ga0207676_10389956 3300026095 Unclassified 1299
975 Ga0207676_10586540 3300026095 Bacteria 1069
976 Ga0207676_11199633 3300026095 Bacteria 752
977 Ga0207674_10006492 3300026116 Bacteria 13755
978 Ga0207674_10012911 3300026116 Bacteria 9316
979 Ga0207674_10030052 3300026116 Bacteria 5715
980 Ga0207674_10081980 3300026116 Bacteria 3227
981 Ga0207674_10184496 3300026116 Bacteria 2037
982 Ga0207674_10254963 3300026116 Bacteria 1701
983 Ga0207674_10516949 3300026116 Bacteria 1153
984 Ga0207674_10754037 3300026116 Bacteria 940
985 Ga0207675_100062346 3300026118 Bacteria 3482
986 Ga0207675_100062529 3300026118 Bacteria 3477
987 Ga0207675_100075735 3300026118 Bacteria 3150
988 Ga0207675_100099250 3300026118 Bacteria 2743
989 Ga0207675_100103587 3300026118 Bacteria 2682
990 Ga0207675_100217452 3300026118 Unclassified 1840
991 Ga0207675_100233673 3300026118 Bacteria 1774
992 Ga0207675_100239542 3300026118 Bacteria 1753
993 Ga0207675_100337059 3300026118 Bacteria 1475
994 Ga0207683_10057040 3300026121 Unclassified 3428
995 Ga0207683_10141863 3300026121 Bacteria 2165
996 Ga0207683_10149980 3300026121 Bacteria 2104
997 Ga0207683_10178411 3300026121 Bacteria 1925
998 Ga0207683_10222892 3300026121 Unclassified 1718
999 Ga0207683_10259266 3300026121 Bacteria 1588
1000 Ga0207698_10008700 3300026142 Bacteria 6434
1001 Ga0207698_10023196 3300026142 Bacteria 4330
1002 Ga0207698_10024494 3300026142 Bacteria 4237
1003 Ga0207698_10025309 3300026142 Bacteria 4178
1004 Ga0207698_10033415 3300026142 Bacteria 3738
1005 Ga0207698_10049762 3300026142 Bacteria 3192
1006 Ga0207698_10065551 3300026142 Bacteria 2853
1007 Ga0207698_10080035 3300026142 Unclassified 2630
1008 Ga0207698_10140634 3300026142 Bacteria 2079
1009 Ga0207698_10156315 3300026142 Bacteria 1987
1010 Ga0207698_10308193 3300026142 Bacteria 1477
1011 Ga0209984_1016211 3300027424 Bacteria 994
1012 Ga0209995_1025689 3300027471 Unclassified 982
1013 Ga0268266_10000034 3300028379 Bacteria 354251
1014 Ga0268266_10002645 3300028379 Bacteria 18878
1015 Ga0268266_10028759 3300028379 Bacteria 4725
1016 Ga0268266_10960939 3300028379 Bacteria 827
1017 Ga0268265_10044613 3300028380 Bacteria 3302
1018 Ga0268265_10045980 3300028380 Bacteria 3261
1019 Ga0268265_10472459 3300028380 Unclassified 1176
1020 Ga0268265_11386286 3300028380 Bacteria 705
1021 Ga0268264_10000117 3300028381 Bacteria 195037
1022 Ga0268264_10005355 3300028381 Bacteria 10876
1023 Ga0268264_10007632 3300028381 Bacteria 9016
1024 Ga0268264_10024882 3300028381 Bacteria 4892
1025 Ga0268264_10090261 3300028381 Bacteria 2640
1026 Ga0268264_10103812 3300028381 Unclassified 2476
1027 Ga0268264_10234265 3300028381 Bacteria 1697
1028 Ga0268264_10328300 3300028381 Unclassified 1449
1029 Ga0268264_10709918 3300028381 Bacteria 999
1030 Ga0307517_10030353 3300028786 Bacteria 6340
1031 Ga0307515_10000039 3300028794 Bacteria 323229
1032 Ga0307511_10000153 3300030521 Bacteria 65598
1033 Ga0265327_10000030 3300031251 Bacteria 333531
1034 Ga0307513_10029047 3300031456 Bacteria 6311
1035 Ga0307408_100275715 3300031548 Bacteria 1398
1036 Ga0307508_10000937 3300031616 Bacteria 33974
1037 Ga0307518_10263568 3300031838 Bacteria 1083
1038 Ga0307410_10230324 3300031852 Bacteria 1430
1039 Ga0307414_10024549 3300032004 Bacteria 3847
1040 Ga0307414_10334306 3300032004 Bacteria 1294
1041 Ga0307415_100058480 3300032126 Bacteria 2654
1042 Ga0373955_0126666 3300035172 Bacteria 1488
1043 Ga0373924_0101236 3300035410 Bacteria 1240
1044 Ga0373933_0270802 3300035724 Bacteria 1096
1045 Ga0373933_0447585 3300035724 Bacteria 845
1046 Ga0373937_0261971 3300036401 Bacteria 1630
1047 Ga0373937_0423600 3300036401 Bacteria 1263
1048 Ga0395899_0004650 3300037312 Bacteria 10707
1049 Ga0395899_0014385 3300037312 Bacteria 6040
1050 Ga0395899_0017265 3300037312 Bacteria 5499
1051 Ga0395899_0344742 3300037312 Bacteria 998
1052 Ga0395900_0000594 3300037418 Bacteria 49651
1053 Ga0395900_0026735 3300037418 Bacteria 5907
1054 Ga0395900_0038159 3300037418 Bacteria 4952
1055 Ga0395900_0113079 3300037418 Bacteria 2787
1056 Ga0395900_0492261 3300037418 Bacteria 1177
1057 Ga0395900_0506480 3300037418 Bacteria 1157
1058 Ga0395898_0001271 3300037466 Bacteria 37310
1059 Ga0395898_0019396 3300037466 Bacteria 6921
1060 Ga0395898_0031929 3300037466 Bacteria 5258
1061 Ga0395898_0084334 3300037466 Bacteria 3063
1062 Ga0395898_0294244 3300037466 Bacteria 1549
1063 Ga0395905_0000527 3300037471 Bacteria 52435
1064 Ga0395905_0045277 3300037471 Bacteria 4127
1065 Ga0395905_0050843 3300037471 Bacteria 3882
1066 Ga0395901_0014247 3300038443 Bacteria 8095
1067 Ga0395901_0017770 3300038443 Bacteria 7260
1068 Ga0395901_0087877 3300038443 Bacteria 3250
1069 Ga0395901_0105083 3300038443 Bacteria 2964
1070 Ga0395901_0179498 3300038443 Bacteria 2220
1071 Ga0395901_0581778 3300038443 Bacteria 1131
1072 Ga0436365_1161343 3300039437 Bacteria 9975
1073 Ga0436365_1876803 3300039437 Bacteria 22992
1074 Ga0439465_0057582 3300041413 Bacteria 1283
1075 Ga0451849_0457641 3300041505 Bacteria 1154
1076 Ga0451851_0698711 3300041507 Bacteria 834
1077 Ga0439441_005719 3300042001 Bacteria 1945
1078 Ga0439443_030000 3300042003 Bacteria 893
1079 Ga0439445_0023729 3300042004 Unclassified 1555
1080 Ga0439449_0012045 3300042007 Unclassified 3251
1081 Ga0439449_0015551 3300042007 Bacteria 2860
1082 Ga0439454_020763 3300042011 Bacteria 966
1083 Ga0439457_010574 3300042014 Bacteria 2119
1084 Ga0439457_060182 3300042014 Bacteria 859
1085 Ga0450895_009516 3300042132 Bacteria 823
1086 Ga0450896_028602 3300042133 Bacteria 838
1087 Ga0450898_001510 3300042134 Bacteria 3081
1088 Ga0439460_0022853 3300042461 Bacteria 1719
1089 Ga0451577_0107026 3300042876 Bacteria 2500
1090 Ga0451577_0222244 3300042876 Bacteria 1707
1091 Ga0466972_0000175 3300044658 Bacteria 49585
1092 Ga0466972_0000782 3300044658 Bacteria 15085
1093 Ga0466966_0335187 3300044684 Bacteria 909
1094 Ga0466964_0052419 3300044706 Unclassified 1677
1095 Ga0453684_0038732 3300044712 Bacteria 6509
1096 Ga0453684_0054306 3300044712 Bacteria 5219
1097 Ga0453684_0077553 3300044712 Bacteria 4163
1098 Ga0466968_0038156 3300044735 Bacteria 2018
1099 Ga0466968_0125093 3300044735 Unclassified 1166
1100 Ga0466970_0001012 3300044765 Bacteria 13547
1101 Ga0466960_0091924 3300044901 Bacteria 1548
1102 Ga0466959_0503167 3300045049 Bacteria 819
1103 Ga0451576_0077826 3300045051 Bacteria 3452
1104 Ga0451576_0305980 3300045051 Bacteria 1663
1105 Ga0466967_0501574 3300045976 Bacteria 1191
1106 Ga0495638_0072586 3300046460 Unclassified 2103
1107 Ga0495638_0141913 3300046460 Unclassified 1401
1108 Ga0495653_0078610 3300046463 Bacteria 2446
1109 Ga0495580_0033076 3300046472 Bacteria 3727
1110 Ga0495628_0338979 3300046516 Bacteria 1107
1111 Ga0495648_0002156 3300046524 Bacteria 18542
1112 Ga0495587_0033786 3300046536 Bacteria 3086
1113 Ga0495587_0097319 3300046536 Bacteria 1697
1114 Ga0495621_0072455 3300046539 Bacteria 1271
1115 Ga0495621_0116141 3300046539 Bacteria 1031
1116 Ga0495645_0285819 3300046543 Bacteria 1083
1117 Ga0495633_0187636 3300046558 Unclassified 951
1118 Ga0495668_0050185 3300046616 Bacteria 2312
1119 Ga0495634_0097080 3300046642 Bacteria 1908
1120 Ga0495657_0025035 3300046675 Bacteria 4241
1121 Ga0495599_0413026 3300046678 Bacteria 803
1122 Ga0495658_0003503 3300046683 Bacteria 7765
1123 Ga0495658_0478832 3300046683 Unclassified 796
1124 Ga0495680_0447408 3300047322 Bacteria 885
1125 Ga0495684_0096239 3300047471 Bacteria 2241
1126 Ga0495686_0000041 3300047472 Bacteria 297599
1127 Ga0495686_0045508 3300047472 Bacteria 2776
1128 Ga0496101_0051249 3300048904 Bacteria 2974
1129 Ga0496105_0214858 3300048908 Bacteria 1567
1130 Ga0496107_0251565 3300048910 Bacteria 1315
1131 Ga0496108_0867115 3300048911 Bacteria 776
1132 Ga0496109_0172869 3300048912 Unclassified 2027
1133 Ga0496111_0017833 3300048914 Unclassified 4910
1134 Ga0496114_0448181 3300048917 Unclassified 1143
1135 Ga0496114_0582472 3300048917 Unclassified 987
1136 Ga0496115_0371094 3300048918 Bacteria 1165
1137 Ga0501305_051632 3300049161 Bacteria 691
1138 Ga0501292_010651 3300049515 Unclassified 1379
1139 Ga0501298_004827 3300049521 Bacteria 2143
1140 Ga0501299_002352 3300049522 Bacteria 2609
1141 Ga0501313_003594 3300049529 Bacteria 1552
1142 Ga0501313_003720 3300049529 Bacteria 1532
1143 Ga0501315_004296 3300049531 Unclassified 1483
1144 Ga0501340_000795 3300049556 Bacteria 1534
1145 Ga0501031_0030645 3300049568 Bacteria 3509
1146 Ga0501032_0011446 3300049569 Bacteria 6373
1147 Ga0501032_0259844 3300049569 Bacteria 1126
1148 Ga0501033_0197232 3300049570 Bacteria 1439
1149 Ga0501034_0013066 3300049571 Bacteria 8557
1150 Ga0501034_0016139 3300049571 Bacteria 7661
1151 Ga0501034_0066443 3300049571 Bacteria 3619
1152 Ga0501034_0070588 3300049571 Bacteria 3504
1153 Ga0501034_0217761 3300049571 Bacteria 1863
1154 Ga0501036_0055928 3300049572 Bacteria 3343
1155 Ga0501036_0078561 3300049572 Bacteria 2791
1156 Ga0501037_0003876 3300049573 Bacteria 10850
1157 Ga0501037_0052301 3300049573 Bacteria 2988
1158 Ga0501037_0098003 3300049573 Bacteria 2118
1159 Ga0501037_0225536 3300049573 Bacteria 1317
1160 Ga0501038_0007909 3300049574 Bacteria 9802
1161 Ga0501038_0320503 3300049574 Bacteria 1213
1162 Ga0501039_0016596 3300049575 Bacteria 5640
1163 Ga0501039_0202355 3300049575 Bacteria 1561
1164 Ga0501040_0183156 3300049576 Unclassified 1485
1165 Ga0501043_0007741 3300049579 Bacteria 8502
1166 Ga0501043_0052196 3300049579 Bacteria 3212
1167 Ga0501043_0068317 3300049579 Unclassified 2790
1168 Ga0501043_0096161 3300049579 Bacteria 2328
1169 Ga0501043_0155234 3300049579 Bacteria 1790
1170 Ga0501046_0010893 3300049580 Bacteria 7792
1171 Ga0501047_0002262 3300049581 Bacteria 18429
1172 Ga0501047_0142055 3300049581 Bacteria 2279
1173 Ga0501047_0326279 3300049581 Bacteria 1374
1174 Ga0501047_0378910 3300049581 Bacteria 1249
1175 Ga0501047_0778165 3300049581 Unclassified 772
1176 Ga0501067_0030643 3300049583 Bacteria 2983
1177 Ga0501068_0036486 3300049584 Bacteria 2940
1178 Ga0501069_0133656 3300049585 Bacteria 1421
1179 Ga0501070_0014912 3300049586 Bacteria 6537
1180 Ga0501070_0063339 3300049586 Bacteria 3063
1181 Ga0501070_0073982 3300049586 Bacteria 2820
1182 Ga0501070_0418080 3300049586 Bacteria 1083
1183 Ga0501072_0462128 3300049588 Bacteria 1005
1184 Ga0501073_0058616 3300049589 Bacteria 2690
1185 Ga0501074_0057085 3300049590 Bacteria 2812
1186 Ga0501198_007808 3300049649 Bacteria 1543
1187 Ga0501201_000258 3300049651 Bacteria 4759
1188 Ga0501202_004058 3300049652 Bacteria 2546
1189 Ga0501202_031722 3300049652 Bacteria 1106
1190 Ga0501216_040980 3300049660 Unclassified 886
1191 Ga0501217_001890 3300049661 Bacteria 4016
1192 Ga0501222_003740 3300049662 Bacteria 2069
1193 Ga0501223_007746 3300049663 Bacteria 2193
1194 Ga0501223_019582 3300049663 Bacteria 1329
1195 Ga0501233_001139 3300049668 Bacteria 4515
1196 Ga0501235_000140 3300049669 Bacteria 12163
1197 Ga0501235_013210 3300049669 Bacteria 1817
1198 Ga0501235_063768 3300049669 Unclassified 865
1199 Ga0501250_004483 3300049680 Bacteria 1392
1200 Ga0501255_011737 3300049684 Bacteria 1016
1201 Ga0501257_075834 3300049686 Bacteria 863
1202 Ga0501259_001544 3300049688 Bacteria 3831
1203 Ga0501259_025579 3300049688 Bacteria 1082
1204 Ga0501261_001807 3300049690 Bacteria 2636
1205 Ga0501221_001525 3300049704 Bacteria 3834
1206 Ga0501221_060809 3300049704 Bacteria 873
1207 Ga0501225_0021105 3300049705 Bacteria 1799
1208 Ga0501225_0022094 3300049705 Unclassified 1757
1209 Ga0501245_000855 3300049708 Bacteria 3855
1210 Ga0501245_010713 3300049708 Unclassified 1327
1211 Ga0501079_0444552 3300049741 Unclassified 1018
1212 Ga0501080_0064884 3300049742 Bacteria 3396
1213 Ga0501083_0050487 3300049744 Bacteria 2799
1214 Ga0501263_044221 3300049760 Bacteria 662
1215 Ga0501266_011754 3300049763 Bacteria 1124
1216 Ga0501268_018834 3300049765 Bacteria 1165
1217 Ga0501270_002470 3300049767 Bacteria 1898
1218 Ga0501279_012781 3300049775 Unclassified 1144
1219 Ga0501035_0018008 3300049822 Bacteria 6512
1220 Ga0501035_0025624 3300049822 Bacteria 5405
1221 Ga0501035_0206525 3300049822 Bacteria 1682
1222 Ga0501035_0721628 3300049822 Unclassified 802
1223 Ga0501044_0065549 3300049823 Bacteria 3704
1224 Ga0501044_0116849 3300049823 Bacteria 2672
1225 Ga0501044_0303018 3300049823 Bacteria 1526
1226 Ga0501044_0576252 3300049823 Bacteria 1020
1227 Ga0501045_0126116 3300049824 Bacteria 1902
1228 nmdc:mga0k408_120615_c1 3300050493 Bacteria 1553
1229 nmdc:mga05p37_145085_c1 3300050507 Unclassified 2907
1230 nmdc:mga09592_11480_c1 3300050508 Bacteria 7209
1231 nmdc:mga09592_27033_c1 3300050508 Bacteria 4758
1232 nmdc:mga09592_42061_c1 3300050508 Unclassified 3844
1233 nmdc:mga06r32_51640_c1 3300050510 Bacteria 3935
1234 nmdc:mga08y16_104126_c1 3300050511 Unclassified 2954
1235 nmdc:mga08y16_178907_c1 3300050511 Bacteria 2202
1236 Ga0495619_0050828 3300053085 Bacteria 2738
1237 Ga0500643_026965 3300053087 Unclassified 1792
1238 Ga0500643_084142 3300053087 Unclassified 871
1239 Ga0500644_0028808 3300053088 Bacteria 1740
1240 Ga0500646_0007425 3300053090 Bacteria 2802
1241 Ga0500562_000036 3300053108 Bacteria 78006
1242 Ga0500594_0014966 3300053118 Bacteria 1865
1243 Ga0500655_012414 3300053133 Unclassified 1549
1244 Ga0500568_0037481 3300053139 Bacteria 1966
1245 Ga0500588_0004743 3300053146 Bacteria 2965
1246 Ga0500604_0001825 3300053151 Bacteria 5927
1247 Ga0500616_0019418 3300053153 Bacteria 3831
1248 Ga0500622_0000484 3300053156 Bacteria 37287
1249 Ga0500622_0001151 3300053156 Bacteria 22018
1250 Ga0500637_0166241 3300053178 Bacteria 1270
1251 Ga0500611_000018 3300053727 Bacteria 111023
1252 Ga0500645_009647 3300053730 Bacteria 3234
1253 Ga0501084_0058664 3300054114 Bacteria 3220
1254 Ga0501084_0267362 3300054114 Bacteria 1444
1255 Ga0500661_015042 3300055283 Bacteria 1389
1256 Ga0587109_039515 3300059624 Bacteria 930
1257 Ga0501082_0112373 3300060353 Bacteria 2358

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028380 Ga0268265_11386286 Ga0268265_113862862 175
2 3300044712 Ga0453684_0054306 Ga0453684_0054306_3889_4536 176
3 3300025907 Ga0207645_10507983 Ga0207645_105079831 178
4 3300025908 Ga0207643_10205166 Ga0207643_102051662 178
5 3300027424 Ga0209984_1016211 Ga0209984_10162112 183
6 3300042014 Ga0439457_060182 Ga0439457_060182_23_619 196
7 3300049571 Ga0501034_0066443 Ga0501034_0066443_2400_3074 198
8 3300049574 Ga0501038_0320503 Ga0501038_0320503_234_908 198
9 3300049581 Ga0501047_0142055 Ga0501047_0142055_373_1047 198
10 3300049583 Ga0501067_0030643 Ga0501067_0030643_568_1242 198
11 3300049585 Ga0501069_0133656 Ga0501069_0133656_78_752 198
12 3300049586 Ga0501070_0014912 Ga0501070_0014912_5610_6284 198
13 3300049744 Ga0501083_0050487 Ga0501083_0050487_1309_1983 198
14 3300049823 Ga0501044_0116849 Ga0501044_0116849_1028_1702 198
15 3300054114 Ga0501084_0058664 Ga0501084_0058664_1365_2039 198
16 3300060353 Ga0501082_0112373 Ga0501082_0112373_1159_1833 198
17 3300005616 Ga0068852_101072624 Ga0068852_1010726241 203
18 3300003316 rootH1_10109167 rootH1_101091671 205
19 3300004800 Ga0058861_12043672 Ga0058861_120436721 206
20 3300004803 Ga0058862_12478465 Ga0058862_124784652 206
21 3300005327 Ga0070658_10001461 Ga0070658_1000146119 206
22 3300005328 Ga0070676_10000153 Ga0070676_1000015315 206
23 3300005334 Ga0068869_100401576 Ga0068869_1004015762 206
24 3300005335 Ga0070666_10000209 Ga0070666_1000020922 206
25 3300005336 Ga0070680_100000076 Ga0070680_10000007614 206
26 3300005337 Ga0070682_100000717 Ga0070682_10000071710 206
27 3300005338 Ga0068868_100001336 Ga0068868_1000013369 206
28 3300005339 Ga0070660_100421503 Ga0070660_1004215031 206
29 3300005341 Ga0070691_10001594 Ga0070691_1000159410 206
30 3300005347 Ga0070668_100000556 Ga0070668_10000055617 206
31 3300005364 Ga0070673_100000867 Ga0070673_1000008675 206
32 3300005367 Ga0070667_100000812 Ga0070667_1000008129 206
33 3300005456 Ga0070678_100057003 Ga0070678_1000570033 206
34 3300005457 Ga0070662_100001017 Ga0070662_10000101710 206
35 3300005458 Ga0070681_10030832 Ga0070681_100308323 206
36 3300005459 Ga0068867_100009628 Ga0068867_1000096286 206
37 3300005530 Ga0070679_100001661 Ga0070679_1000016614 206
38 3300005539 Ga0068853_100020753 Ga0068853_1000207535 206
39 3300005539 Ga0068853_100228366 Ga0068853_1002283662 206
40 3300005543 Ga0070672_100000738 Ga0070672_1000007383 206
41 3300005548 Ga0070665_100000486 Ga0070665_10000048651 206
42 3300005563 Ga0068855_100027744 Ga0068855_1000277444 206
43 3300005564 Ga0070664_100101274 Ga0070664_1001012742 206
44 3300005616 Ga0068852_100030471 Ga0068852_1000304714 206
45 3300005617 Ga0068859_100404895 Ga0068859_1004048952 206
46 3300005618 Ga0068864_100002330 Ga0068864_1000023306 206
47 3300005719 Ga0068861_100073926 Ga0068861_1000739261 206
48 3300005834 Ga0068851_10000423 Ga0068851_100004232 206
49 3300005841 Ga0068863_100000858 Ga0068863_10000085815 206
50 3300005842 Ga0068858_100008022 Ga0068858_1000080226 206
51 3300005842 Ga0068858_100390710 Ga0068858_1003907102 206
52 3300005843 Ga0068860_100016541 Ga0068860_1000165413 206
53 3300006358 Ga0068871_100125649 Ga0068871_1001256492 206
54 3300006931 Ga0097620_100404905 Ga0097620_1004049052 206
55 3300009093 Ga0105240_10002252 Ga0105240_1000225222 206
56 3300009101 Ga0105247_10008259 Ga0105247_100082596 206
57 3300009174 Ga0105241_10000224 Ga0105241_1000022428 206
58 3300009174 Ga0105241_10139058 Ga0105241_101390583 206
59 3300009176 Ga0105242_10056582 Ga0105242_100565823 206
60 3300009177 Ga0105248_10060288 Ga0105248_100602883 206
61 3300009551 Ga0105238_10134127 Ga0105238_101341272 206
62 3300009553 Ga0105249_10023081 Ga0105249_100230815 206
63 3300013104 Ga0157370_10001393 Ga0157370_1000139322 206
64 3300013296 Ga0157374_10000841 Ga0157374_1000084120 206
65 3300013297 Ga0157378_10012644 Ga0157378_100126443 206
66 3300013306 Ga0163162_10000100 Ga0163162_1000010016 206
67 3300013308 Ga0157375_10000057 Ga0157375_10000057107 206
68 3300014325 Ga0163163_10000254 Ga0163163_1000025430 206
69 3300014968 Ga0157379_10000367 Ga0157379_1000036716 206
70 3300014969 Ga0157376_10000135 Ga0157376_1000013527 206
71 3300025315 Ga0207697_10013979 Ga0207697_100139793 206
72 3300025321 Ga0207656_10002124 Ga0207656_100021242 206
73 3300025900 Ga0207710_10050658 Ga0207710_100506582 206
74 3300025903 Ga0207680_10075669 Ga0207680_100756693 206
75 3300025907 Ga0207645_10004291 Ga0207645_100042911 206
76 3300025909 Ga0207705_10043425 Ga0207705_100434252 206
77 3300025911 Ga0207654_10003857 Ga0207654_100038576 206
78 3300025912 Ga0207707_10000574 Ga0207707_100005743 206
79 3300025913 Ga0207695_10008950 Ga0207695_100089503 206
80 3300025914 Ga0207671_10384454 Ga0207671_103844542 206
81 3300025917 Ga0207660_10010881 Ga0207660_100108813 206
82 3300025921 Ga0207652_10001002 Ga0207652_1000100222 206
83 3300025931 Ga0207644_10226122 Ga0207644_102261222 206
84 3300025933 Ga0207706_10007905 Ga0207706_100079056 206
85 3300025934 Ga0207686_10030121 Ga0207686_100301213 206
86 3300025938 Ga0207704_10000484 Ga0207704_100004846 206
87 3300025940 Ga0207691_10002120 Ga0207691_1000212015 206
88 3300025942 Ga0207689_10361108 Ga0207689_103611081 206
89 3300025945 Ga0207679_10113802 Ga0207679_101138022 206
90 3300025949 Ga0207667_10058269 Ga0207667_100582694 206
91 3300025960 Ga0207651_10002824 Ga0207651_100028243 206
92 3300025961 Ga0207712_10011683 Ga0207712_100116835 206
93 3300025972 Ga0207668_10251892 Ga0207668_102518921 206
94 3300025986 Ga0207658_10000847 Ga0207658_1000084713 206
95 3300026023 Ga0207677_10001136 Ga0207677_100011366 206
96 3300026035 Ga0207703_10010768 Ga0207703_100107686 206
97 3300026041 Ga0207639_10016589 Ga0207639_100165893 206
98 3300026041 Ga0207639_10200336 Ga0207639_102003362 206
99 3300026088 Ga0207641_10004489 Ga0207641_100044892 206
100 3300026089 Ga0207648_10063825 Ga0207648_100638253 206
101 3300026095 Ga0207676_10006216 Ga0207676_100062166 206
102 3300026118 Ga0207675_100103587 Ga0207675_1001035873 206
103 3300026121 Ga0207683_10057040 Ga0207683_100570403 206
104 3300026142 Ga0207698_10080035 Ga0207698_100800353 206
105 3300028379 Ga0268266_10002645 Ga0268266_100026456 206
106 3300028381 Ga0268264_10007632 Ga0268264_100076328 206
107 3300048910 Ga0496107_0251565 Ga0496107_0251565_582_1241 206
108 3300048912 Ga0496109_0172869 Ga0496109_0172869_892_1551 206
109 3300048918 Ga0496115_0371094 Ga0496115_0371094_470_1144 206
110 3300003322 rootL2_10097124 rootL2_100971243 207
111 3300049556 Ga0501340_000795 Ga0501340_000795_16_642 207
112 3300049708 Ga0501245_010713 Ga0501245_010713_550_1176 207
113 3300049760 Ga0501263_044221 Ga0501263_044221_26_652 207
114 3300005329 Ga0070683_100053673 Ga0070683_1000536732 208
115 3300005341 Ga0070691_10041025 Ga0070691_100410251 208
116 3300005563 Ga0068855_100001195 Ga0068855_10000119517 208
117 3300005578 Ga0068854_100061668 Ga0068854_1000616682 208
118 3300005616 Ga0068852_100166256 Ga0068852_1001662563 208
119 3300009093 Ga0105240_10000715 Ga0105240_1000071539 208
120 3300013104 Ga0157370_10160251 Ga0157370_101602512 208
121 3300013307 Ga0157372_10139494 Ga0157372_101394943 208
122 3300020069 Ga0197907_10951066 Ga0197907_109510662 208
123 3300020078 Ga0206352_11083765 Ga0206352_110837652 208
124 3300025913 Ga0207695_10000327 Ga0207695_1000032774 208
125 3300025944 Ga0207661_10056567 Ga0207661_100565674 208
126 3300025949 Ga0207667_10000340 Ga0207667_1000034035 208
127 3300026142 Ga0207698_10140634 Ga0207698_101406343 208
128 3300003316 rootH1_10125848 rootH1_101258483 209
129 3300005290 Ga0065712_10089634 Ga0065712_100896342 209
130 3300005293 Ga0065715_10013993 Ga0065715_100139932 209
131 3300005331 Ga0070670_100032449 Ga0070670_1000324493 209
132 3300005334 Ga0068869_100118166 Ga0068869_1001181662 209
133 3300005340 Ga0070689_100019751 Ga0070689_1000197515 209
134 3300005343 Ga0070687_100014051 Ga0070687_1000140515 209
135 3300005347 Ga0070668_100485189 Ga0070668_1004851891 209
136 3300005364 Ga0070673_100042687 Ga0070673_1000426871 209
137 3300005365 Ga0070688_100004476 Ga0070688_1000044761 209
138 3300005441 Ga0070700_100027344 Ga0070700_1000273445 209
139 3300005466 Ga0070685_10023313 Ga0070685_100233135 209
140 3300005544 Ga0070686_100204799 Ga0070686_1002047992 209
141 3300005549 Ga0070704_100133488 Ga0070704_1001334882 209
142 3300005617 Ga0068859_100155678 Ga0068859_1001556782 209
143 3300005618 Ga0068864_100097281 Ga0068864_1000972812 209
144 3300005840 Ga0068870_10038929 Ga0068870_100389293 209
145 3300005844 Ga0068862_100047162 Ga0068862_1000471622 209
146 3300006237 Ga0097621_100879549 Ga0097621_1008795491 209
147 3300006880 Ga0075429_100642628 Ga0075429_1006426282 209
148 3300006881 Ga0068865_100125695 Ga0068865_1001256952 209
149 3300006931 Ga0097620_100155682 Ga0097620_1001556822 209
150 3300009553 Ga0105249_10102452 Ga0105249_101024522 209
151 3300013308 Ga0157375_10348648 Ga0157375_103486482 209
152 3300014326 Ga0157380_10735489 Ga0157380_107354892 209
153 3300014326 Ga0157380_11066258 Ga0157380_110662581 209
154 3300014745 Ga0157377_10028251 Ga0157377_100282514 209
155 3300017792 Ga0163161_10268021 Ga0163161_102680212 209
156 3300025893 Ga0207682_10063133 Ga0207682_100631331 209
157 3300025908 Ga0207643_10001735 Ga0207643_1000173511 209
158 3300025913 Ga0207695_10099398 Ga0207695_100993982 209
159 3300025925 Ga0207650_10025960 Ga0207650_100259603 209
160 3300025934 Ga0207686_10010535 Ga0207686_100105353 209
161 3300025934 Ga0207686_10147518 Ga0207686_101475182 209
162 3300025936 Ga0207670_10113038 Ga0207670_101130382 209
163 3300025940 Ga0207691_10079939 Ga0207691_100799392 209
164 3300025942 Ga0207689_10038305 Ga0207689_100383052 209
165 3300025960 Ga0207651_10514420 Ga0207651_105144202 209
166 3300025961 Ga0207712_10013170 Ga0207712_100131703 209
167 3300025981 Ga0207640_10270452 Ga0207640_102704522 209
168 3300026041 Ga0207639_10655436 Ga0207639_106554361 209
169 3300026095 Ga0207676_10098522 Ga0207676_100985223 209
170 3300026116 Ga0207674_10184496 Ga0207674_101844962 209
171 3300026116 Ga0207674_10754037 Ga0207674_107540371 209
172 3300026118 Ga0207675_100217452 Ga0207675_1002174522 209
173 3300048908 Ga0496105_0214858 Ga0496105_0214858_354_1007 209
174 3300003322 rootL2_10135684 rootL2_101356842 210
175 3300005289 Ga0065704_10182402 Ga0065704_101824022 210
176 3300005328 Ga0070676_10005303 Ga0070676_100053036 210
177 3300005330 Ga0070690_100051558 Ga0070690_1000515582 210
178 3300005334 Ga0068869_100012388 Ga0068869_1000123886 210
179 3300005334 Ga0068869_100031526 Ga0068869_1000315262 210
180 3300005335 Ga0070666_10031370 Ga0070666_100313703 210
181 3300005335 Ga0070666_10119646 Ga0070666_101196462 210
182 3300005338 Ga0068868_100000726 Ga0068868_1000007262 210
183 3300005338 Ga0068868_100022584 Ga0068868_1000225841 210
184 3300005343 Ga0070687_100147780 Ga0070687_1001477802 210
185 3300005347 Ga0070668_100012182 Ga0070668_1000121823 210
186 3300005355 Ga0070671_100115887 Ga0070671_1001158873 210
187 3300005364 Ga0070673_100059928 Ga0070673_1000599282 210
188 3300005364 Ga0070673_100217525 Ga0070673_1002175251 210
189 3300005365 Ga0070688_100262084 Ga0070688_1002620842 210
190 3300005367 Ga0070667_100028595 Ga0070667_1000285952 210
191 3300005457 Ga0070662_100039341 Ga0070662_1000393412 210
192 3300005457 Ga0070662_100062595 Ga0070662_1000625952 210
193 3300005458 Ga0070681_10092504 Ga0070681_100925043 210
194 3300005466 Ga0070685_10482928 Ga0070685_104829281 210
195 3300005471 Ga0070698_100008720 Ga0070698_1000087203 210
196 3300005539 Ga0068853_100074904 Ga0068853_1000749043 210
197 3300005539 Ga0068853_100106099 Ga0068853_1001060992 210
198 3300005578 Ga0068854_100043746 Ga0068854_1000437463 210
199 3300005578 Ga0068854_100064033 Ga0068854_1000640332 210
200 3300005614 Ga0068856_100113099 Ga0068856_1001130993 210
201 3300005617 Ga0068859_100180962 Ga0068859_1001809623 210
202 3300005618 Ga0068864_100279758 Ga0068864_1002797582 210
203 3300005718 Ga0068866_10056271 Ga0068866_100562712 210
204 3300005719 Ga0068861_100049526 Ga0068861_1000495261 210
205 3300005841 Ga0068863_100325825 Ga0068863_1003258252 210
206 3300005842 Ga0068858_100856449 Ga0068858_1008564491 210
207 3300005843 Ga0068860_100000026 Ga0068860_10000002666 210
208 3300005844 Ga0068862_100127894 Ga0068862_1001278942 210
209 3300006163 Ga0070715_10006819 Ga0070715_100068193 210
210 3300006358 Ga0068871_100553333 Ga0068871_1005533331 210
211 3300006871 Ga0075434_100540770 Ga0075434_1005407702 210
212 3300006914 Ga0075436_100290683 Ga0075436_1002906832 210
213 3300006931 Ga0097620_100180977 Ga0097620_1001809773 210
214 3300009093 Ga0105240_10000258 Ga0105240_1000025831 210
215 3300009093 Ga0105240_10203604 Ga0105240_102036043 210
216 3300009545 Ga0105237_10022472 Ga0105237_100224724 210
217 3300009551 Ga0105238_10006981 Ga0105238_100069819 210
218 3300009553 Ga0105249_10580375 Ga0105249_105803752 210
219 3300010375 Ga0105239_10043883 Ga0105239_100438834 210
220 3300010375 Ga0105239_10386859 Ga0105239_103868591 210
221 3300011119 Ga0105246_10145723 Ga0105246_101457232 210
222 3300013296 Ga0157374_10015281 Ga0157374_100152817 210
223 3300013297 Ga0157378_10023595 Ga0157378_100235955 210
224 3300013306 Ga0163162_10006285 Ga0163162_100062852 210
225 3300013307 Ga0157372_10141929 Ga0157372_101419292 210
226 3300013308 Ga0157375_10039491 Ga0157375_100394913 210
227 3300013308 Ga0157375_10064756 Ga0157375_100647563 210
228 3300014745 Ga0157377_10197146 Ga0157377_101971462 210
229 3300014969 Ga0157376_10007359 Ga0157376_100073593 210
230 3300017792 Ga0163161_10104760 Ga0163161_101047602 210
231 3300025903 Ga0207680_10028803 Ga0207680_100288033 210
232 3300025905 Ga0207685_10010434 Ga0207685_100104342 210
233 3300025907 Ga0207645_10017285 Ga0207645_100172855 210
234 3300025908 Ga0207643_10089852 Ga0207643_100898522 210
235 3300025911 Ga0207654_10001646 Ga0207654_100016469 210
236 3300025912 Ga0207707_10046727 Ga0207707_100467274 210
237 3300025913 Ga0207695_10008726 Ga0207695_1000872610 210
238 3300025914 Ga0207671_10004018 Ga0207671_100040189 210
239 3300025924 Ga0207694_10061747 Ga0207694_100617474 210
240 3300025933 Ga0207706_10003803 Ga0207706_100038032 210
241 3300025933 Ga0207706_10026061 Ga0207706_100260614 210
242 3300025938 Ga0207704_10102486 Ga0207704_101024862 210
243 3300025942 Ga0207689_10021416 Ga0207689_100214162 210
244 3300025942 Ga0207689_10044691 Ga0207689_100446913 210
245 3300025945 Ga0207679_10181918 Ga0207679_101819182 210
246 3300025960 Ga0207651_10119421 Ga0207651_101194213 210
247 3300026023 Ga0207677_10007895 Ga0207677_100078956 210
248 3300026023 Ga0207677_10256846 Ga0207677_102568462 210
249 3300026035 Ga0207703_10091248 Ga0207703_100912482 210
250 3300026041 Ga0207639_10123392 Ga0207639_101233923 210
251 3300026041 Ga0207639_10280880 Ga0207639_102808802 210
252 3300026089 Ga0207648_10643040 Ga0207648_106430402 210
253 3300026095 Ga0207676_10389956 Ga0207676_103899562 210
254 3300026118 Ga0207675_100062529 Ga0207675_1000625292 210
255 3300026142 Ga0207698_10049762 Ga0207698_100497623 210
256 3300028381 Ga0268264_10000117 Ga0268264_1000011742 210
257 3300030521 Ga0307511_10000153 Ga0307511_1000015333 210
258 3300035410 Ga0373924_0101236 Ga0373924_0101236_480_1142 210
259 3300035724 Ga0373933_0270802 Ga0373933_0270802_243_905 210
260 3300036401 Ga0373937_0261971 Ga0373937_0261971_725_1387 210
261 3300042876 Ga0451577_0222244 Ga0451577_0222244_292_954 210
262 3300044658 Ga0466972_0000782 Ga0466972_0000782_13107_13772 210
263 3300045051 Ga0451576_0305980 Ga0451576_0305980_200_862 210
264 3300046460 Ga0495638_0141913 Ga0495638_0141913_482_1168 210
265 3300046463 Ga0495653_0078610 Ga0495653_0078610_1275_1937 210
266 3300046516 Ga0495628_0338979 Ga0495628_0338979_260_922 210
267 3300046536 Ga0495587_0097319 Ga0495587_0097319_103_765 210
268 3300046675 Ga0495657_0025035 Ga0495657_0025035_2517_3179 210
269 3300046678 Ga0495599_0413026 Ga0495599_0413026_83_745 210
270 3300046683 Ga0495658_0478832 Ga0495658_0478832_55_717 210
271 3300047322 Ga0495680_0447408 Ga0495680_0447408_71_733 210
272 3300047471 Ga0495684_0096239 Ga0495684_0096239_940_1602 210
273 3300048917 Ga0496114_0448181 Ga0496114_0448181_207_869 210
274 3300049521 Ga0501298_004827 Ga0501298_004827_379_1014 210
275 3300053133 Ga0500655_012414 Ga0500655_012414_515_1198 210
276 3300005327 Ga0070658_10182071 Ga0070658_101820712 211
277 3300005331 Ga0070670_100522309 Ga0070670_1005223092 211
278 3300005338 Ga0068868_100247821 Ga0068868_1002478211 211
279 3300005338 Ga0068868_100595379 Ga0068868_1005953792 211
280 3300005355 Ga0070671_100069303 Ga0070671_1000693032 211
281 3300005367 Ga0070667_100008930 Ga0070667_1000089302 211
282 3300005617 Ga0068859_100183247 Ga0068859_1001832472 211
283 3300005617 Ga0068859_100232318 Ga0068859_1002323182 211
284 3300005834 Ga0068851_10019508 Ga0068851_100195082 211
285 3300005841 Ga0068863_100024297 Ga0068863_1000242977 211
286 3300005842 Ga0068858_100319751 Ga0068858_1003197512 211
287 3300005843 Ga0068860_100018967 Ga0068860_1000189675 211
288 3300006237 Ga0097621_100126650 Ga0097621_1001266502 211
289 3300006358 Ga0068871_100136715 Ga0068871_1001367152 211
290 3300006931 Ga0097620_100183241 Ga0097620_1001832412 211
291 3300006931 Ga0097620_100232321 Ga0097620_1002323212 211
292 3300009176 Ga0105242_10076969 Ga0105242_100769693 211
293 3300013307 Ga0157372_11149835 Ga0157372_111498352 211
294 3300014968 Ga0157379_10583198 Ga0157379_105831981 211
295 3300025937 Ga0207669_10310274 Ga0207669_103102742 211
296 3300025942 Ga0207689_10002405 Ga0207689_1000240515 211
297 3300026089 Ga0207648_10045600 Ga0207648_100456003 211
298 3300026095 Ga0207676_10367815 Ga0207676_103678152 211
299 3300026118 Ga0207675_100075735 Ga0207675_1000757352 211
300 3300026121 Ga0207683_10149980 Ga0207683_101499802 211
301 3300028380 Ga0268265_10472459 Ga0268265_104724592 211
302 3300028381 Ga0268264_10328300 Ga0268264_103283002 211
303 iso_pu_bacteria 2818991444 2819589611 211
304 iso_pu_bacteria 2914759650 2914763341 211
305 iso_pu_bacteria 2929154850 2929156201 211
306 3300049822 Ga0501035_0721628 Ga0501035_0721628_39_692 213
307 3300049823 Ga0501044_0303018 Ga0501044_0303018_232_885 213
308 3300003323 rootH1_10227879 rootH1_102278792 214
309 3300005331 Ga0070670_100149986 Ga0070670_1001499862 214
310 3300005331 Ga0070670_100264373 Ga0070670_1002643732 214
311 3300005344 Ga0070661_100168713 Ga0070661_1001687132 214
312 3300005354 Ga0070675_100043632 Ga0070675_1000436323 214
313 3300005355 Ga0070671_100013745 Ga0070671_1000137456 214
314 3300005365 Ga0070688_100234589 Ga0070688_1002345892 214
315 3300005366 Ga0070659_100228816 Ga0070659_1002288162 214
316 3300005367 Ga0070667_100353261 Ga0070667_1003532612 214
317 3300005459 Ga0068867_100077217 Ga0068867_1000772172 214
318 3300005539 Ga0068853_100059557 Ga0068853_1000595572 214
319 3300005543 Ga0070672_100097907 Ga0070672_1000979074 214
320 3300005563 Ga0068855_100174465 Ga0068855_1001744652 214
321 3300005577 Ga0068857_100032917 Ga0068857_1000329172 214
322 3300005578 Ga0068854_100003899 Ga0068854_1000038998 214
323 3300005616 Ga0068852_100002161 Ga0068852_10000216111 214
324 3300005841 Ga0068863_100020445 Ga0068863_1000204455 214
325 3300005843 Ga0068860_100010129 Ga0068860_1000101293 214
326 3300006237 Ga0097621_100000027 Ga0097621_1000000275 214
327 3300006358 Ga0068871_100000107 Ga0068871_10000010713 214
328 3300006881 Ga0068865_100197973 Ga0068865_1001979732 214
329 3300009093 Ga0105240_10016056 Ga0105240_100160562 214
330 3300009093 Ga0105240_10054842 Ga0105240_100548423 214
331 3300009093 Ga0105240_10060026 Ga0105240_100600264 214
332 3300009174 Ga0105241_10332089 Ga0105241_103320892 214
333 3300009177 Ga0105248_10004939 Ga0105248_100049393 214
334 3300009545 Ga0105237_10014096 Ga0105237_100140962 214
335 3300009545 Ga0105237_10064862 Ga0105237_100648622 214
336 3300009545 Ga0105237_10126957 Ga0105237_101269572 214
337 3300009551 Ga0105238_10064549 Ga0105238_100645494 214
338 3300009551 Ga0105238_10078160 Ga0105238_100781602 214
339 3300010375 Ga0105239_10001037 Ga0105239_1000103729 214
340 3300013100 Ga0157373_10110592 Ga0157373_101105922 214
341 3300013104 Ga0157370_10005886 Ga0157370_100058863 214
342 3300013105 Ga0157369_10059170 Ga0157369_100591702 214
343 3300013297 Ga0157378_10005857 Ga0157378_100058573 214
344 3300013306 Ga0163162_10001517 Ga0163162_100015174 214
345 3300013306 Ga0163162_10038399 Ga0163162_100383993 214
346 3300013307 Ga0157372_10002704 Ga0157372_100027044 214
347 3300013308 Ga0157375_10000336 Ga0157375_1000033623 214
348 3300013308 Ga0157375_10704417 Ga0157375_107044171 214
349 3300014325 Ga0163163_10000193 Ga0163163_1000019344 214
350 3300014326 Ga0157380_10001093 Ga0157380_100010933 214
351 3300014968 Ga0157379_10017665 Ga0157379_100176652 214
352 3300014969 Ga0157376_10002989 Ga0157376_100029894 214
353 3300017792 Ga0163161_10001091 Ga0163161_100010915 214
354 3300020069 Ga0197907_10191818 Ga0197907_101918182 214
355 3300020070 Ga0206356_11664014 Ga0206356_116640142 214
356 3300020076 Ga0206355_1373070 Ga0206355_13730702 214
357 3300020078 Ga0206352_10396221 Ga0206352_103962212 214
358 3300022467 Ga0224712_10165530 Ga0224712_101655301 214
359 3300025904 Ga0207647_10004784 Ga0207647_100047843 214
360 3300025913 Ga0207695_10012720 Ga0207695_100127202 214
361 3300025913 Ga0207695_10038067 Ga0207695_100380672 214
362 3300025913 Ga0207695_10152595 Ga0207695_101525953 214
363 3300025914 Ga0207671_10006632 Ga0207671_1000663210 214
364 3300025914 Ga0207671_10059149 Ga0207671_100591492 214
365 3300025914 Ga0207671_10214903 Ga0207671_102149032 214
366 3300025924 Ga0207694_10057302 Ga0207694_100573022 214
367 3300025924 Ga0207694_10262784 Ga0207694_102627841 214
368 3300025925 Ga0207650_10097267 Ga0207650_100972672 214
369 3300025925 Ga0207650_10117984 Ga0207650_101179842 214
370 3300025926 Ga0207659_10077944 Ga0207659_100779442 214
371 3300025931 Ga0207644_10248240 Ga0207644_102482401 214
372 3300025932 Ga0207690_10217383 Ga0207690_102173832 214
373 3300025940 Ga0207691_10428141 Ga0207691_104281411 214
374 3300025949 Ga0207667_10009409 Ga0207667_100094098 214
375 3300025949 Ga0207667_10061201 Ga0207667_100612014 214
376 3300025981 Ga0207640_10017218 Ga0207640_100172183 214
377 3300025986 Ga0207658_10090037 Ga0207658_100900372 214
378 3300026041 Ga0207639_10019883 Ga0207639_100198833 214
379 3300026088 Ga0207641_10115859 Ga0207641_101158592 214
380 3300026116 Ga0207674_10012911 Ga0207674_100129118 214
381 3300026118 Ga0207675_100239542 Ga0207675_1002395422 214
382 3300026142 Ga0207698_10023196 Ga0207698_100231964 214
383 3300028381 Ga0268264_10024882 Ga0268264_100248823 214
384 3300032004 Ga0307414_10024549 Ga0307414_100245494 214
385 3300032004 Ga0307414_10334306 Ga0307414_103343062 214
386 3300048904 Ga0496101_0051249 Ga0496101_0051249_1628_2272 214
387 3300049161 Ga0501305_051632 Ga0501305_051632_12_659 214
388 3300049515 Ga0501292_010651 Ga0501292_010651_395_1042 214
389 3300049522 Ga0501299_002352 Ga0501299_002352_1462_2109 214
390 3300049529 Ga0501313_003594 Ga0501313_003594_11_658 214
391 3300049529 Ga0501313_003720 Ga0501313_003720_11_658 214
392 3300049531 Ga0501315_004296 Ga0501315_004296_11_658 214
393 3300049649 Ga0501198_007808 Ga0501198_007808_60_707 214
394 3300049651 Ga0501201_000258 Ga0501201_000258_1051_1698 214
395 3300049660 Ga0501216_040980 Ga0501216_040980_166_813 214
396 3300049661 Ga0501217_001890 Ga0501217_001890_2376_3023 214
397 3300049662 Ga0501222_003740 Ga0501222_003740_249_896 214
398 3300049663 Ga0501223_007746 Ga0501223_007746_1363_2010 214
399 3300049668 Ga0501233_001139 Ga0501233_001139_689_1336 214
400 3300049669 Ga0501235_000140 Ga0501235_000140_4407_5054 214
401 3300049669 Ga0501235_063768 Ga0501235_063768_88_735 214
402 3300049680 Ga0501250_004483 Ga0501250_004483_323_970 214
403 3300049684 Ga0501255_011737 Ga0501255_011737_165_812 214
404 3300049686 Ga0501257_075834 Ga0501257_075834_66_713 214
405 3300049688 Ga0501259_001544 Ga0501259_001544_71_718 214
406 3300049688 Ga0501259_025579 Ga0501259_025579_363_1010 214
407 3300049690 Ga0501261_001807 Ga0501261_001807_1036_1683 214
408 3300049704 Ga0501221_001525 Ga0501221_001525_2830_3477 214
409 3300049705 Ga0501225_0022094 Ga0501225_0022094_698_1345 214
410 3300049708 Ga0501245_000855 Ga0501245_000855_2501_3148 214
411 3300049765 Ga0501268_018834 Ga0501268_018834_243_890 214
412 3300049767 Ga0501270_002470 Ga0501270_002470_565_1212 214
413 3300049775 Ga0501279_012781 Ga0501279_012781_140_787 214
414 2162886011 MRS1b_contig_1168309 MRS1b_0423.00000220 215
415 2162886012 MBSR1b_contig_4379216 MBSR1b_0987.00004380 215
416 2162886012 MBSR1b_contig_7995764 MBSR1b_0023.00001030 215
417 3300002459 JGI24751J29686_10061188 JGI24751J29686_100611881 215
418 3300003320 rootH2_10162769 rootH2_101627692 215
419 3300003320 rootH2_10197471 rootH2_101974712 215
420 3300003320 rootH2_10205626 rootH2_102056262 215
421 3300003322 rootL2_10076279 rootL2_100762795 215
422 3300003354 JGI25160J50197_1003126 JGI25160J50197_10031266 215
423 3300005288 Ga0065714_10079249 Ga0065714_100792492 215
424 3300005288 Ga0065714_10226543 Ga0065714_102265431 215
425 3300005289 Ga0065704_10121850 Ga0065704_101218502 215
426 3300005290 Ga0065712_10073224 Ga0065712_100732244 215
427 3300005290 Ga0065712_10154453 Ga0065712_101544532 215
428 3300005290 Ga0065712_10170127 Ga0065712_101701272 215
429 3300005290 Ga0065712_10225270 Ga0065712_102252701 215
430 3300005293 Ga0065715_10323297 Ga0065715_103232971 215
431 3300005327 Ga0070658_10045017 Ga0070658_100450172 215
432 3300005327 Ga0070658_10045140 Ga0070658_100451403 215
433 3300005327 Ga0070658_10100597 Ga0070658_101005972 215
434 3300005327 Ga0070658_10824846 Ga0070658_108248461 215
435 3300005328 Ga0070676_10033838 Ga0070676_100338382 215
436 3300005329 Ga0070683_100000329 Ga0070683_10000032917 215
437 3300005329 Ga0070683_100018651 Ga0070683_1000186515 215
438 3300005329 Ga0070683_100023520 Ga0070683_1000235206 215
439 3300005329 Ga0070683_100081163 Ga0070683_1000811632 215
440 3300005330 Ga0070690_100177737 Ga0070690_1001777372 215
441 3300005331 Ga0070670_100053200 Ga0070670_1000532002 215
442 3300005331 Ga0070670_100150728 Ga0070670_1001507282 215
443 3300005331 Ga0070670_100174216 Ga0070670_1001742162 215
444 3300005331 Ga0070670_100358496 Ga0070670_1003584961 215
445 3300005331 Ga0070670_100360560 Ga0070670_1003605602 215
446 3300005331 Ga0070670_100630214 Ga0070670_1006302142 215
447 3300005331 Ga0070670_100981754 Ga0070670_1009817541 215
448 3300005333 Ga0070677_10002116 Ga0070677_100021165 215
449 3300005333 Ga0070677_10042997 Ga0070677_100429972 215
450 3300005333 Ga0070677_10115552 Ga0070677_101155522 215
451 3300005333 Ga0070677_10153182 Ga0070677_101531821 215
452 3300005334 Ga0068869_100007813 Ga0068869_1000078135 215
453 3300005334 Ga0068869_100024126 Ga0068869_1000241263 215
454 3300005334 Ga0068869_100162297 Ga0068869_1001622972 215
455 3300005335 Ga0070666_10000043 Ga0070666_100000435 215
456 3300005335 Ga0070666_10031000 Ga0070666_100310003 215
457 3300005335 Ga0070666_10144826 Ga0070666_101448262 215
458 3300005335 Ga0070666_10292921 Ga0070666_102929212 215
459 3300005336 Ga0070680_100012535 Ga0070680_1000125352 215
460 3300005336 Ga0070680_100021326 Ga0070680_1000213264 215
461 3300005336 Ga0070680_100024075 Ga0070680_1000240753 215
462 3300005336 Ga0070680_100045972 Ga0070680_1000459724 215
463 3300005337 Ga0070682_100086673 Ga0070682_1000866732 215
464 3300005337 Ga0070682_100155207 Ga0070682_1001552071 215
465 3300005337 Ga0070682_100169628 Ga0070682_1001696282 215
466 3300005337 Ga0070682_100243568 Ga0070682_1002435682 215
467 3300005338 Ga0068868_100078450 Ga0068868_1000784503 215
468 3300005338 Ga0068868_100097530 Ga0068868_1000975301 215
469 3300005338 Ga0068868_100172352 Ga0068868_1001723522 215
470 3300005338 Ga0068868_100180291 Ga0068868_1001802912 215
471 3300005338 Ga0068868_100811708 Ga0068868_1008117081 215
472 3300005339 Ga0070660_100034772 Ga0070660_1000347722 215
473 3300005339 Ga0070660_100043591 Ga0070660_1000435914 215
474 3300005339 Ga0070660_100057089 Ga0070660_1000570894 215
475 3300005339 Ga0070660_100083945 Ga0070660_1000839452 215
476 3300005339 Ga0070660_100133622 Ga0070660_1001336222 215
477 3300005339 Ga0070660_100147379 Ga0070660_1001473792 215
478 3300005339 Ga0070660_100551128 Ga0070660_1005511281 215
479 3300005340 Ga0070689_100503540 Ga0070689_1005035401 215
480 3300005341 Ga0070691_10007717 Ga0070691_100077173 215
481 3300005343 Ga0070687_100125092 Ga0070687_1001250921 215
482 3300005343 Ga0070687_100356811 Ga0070687_1003568111 215
483 3300005344 Ga0070661_100004831 Ga0070661_1000048318 215
484 3300005344 Ga0070661_100009444 Ga0070661_1000094443 215
485 3300005344 Ga0070661_100064706 Ga0070661_1000647063 215
486 3300005344 Ga0070661_100104590 Ga0070661_1001045902 215
487 3300005347 Ga0070668_100073785 Ga0070668_1000737852 215
488 3300005347 Ga0070668_100138846 Ga0070668_1001388462 215
489 3300005353 Ga0070669_100009249 Ga0070669_1000092493 215
490 3300005353 Ga0070669_100035738 Ga0070669_1000357382 215
491 3300005354 Ga0070675_100010042 Ga0070675_1000100427 215
492 3300005354 Ga0070675_100026514 Ga0070675_1000265143 215
493 3300005354 Ga0070675_100050419 Ga0070675_1000504192 215
494 3300005354 Ga0070675_100611183 Ga0070675_1006111832 215
495 3300005354 Ga0070675_100638424 Ga0070675_1006384241 215
496 3300005355 Ga0070671_100001985 Ga0070671_10000198513 215
497 3300005355 Ga0070671_100585517 Ga0070671_1005855171 215
498 3300005356 Ga0070674_100029455 Ga0070674_1000294552 215
499 3300005356 Ga0070674_100030959 Ga0070674_1000309593 215
500 3300005356 Ga0070674_100753954 Ga0070674_1007539541 215
501 3300005364 Ga0070673_100006375 Ga0070673_1000063754 215
502 3300005364 Ga0070673_100037568 Ga0070673_1000375685 215
503 3300005364 Ga0070673_100098764 Ga0070673_1000987644 215
504 3300005364 Ga0070673_100206169 Ga0070673_1002061692 215
505 3300005364 Ga0070673_100219615 Ga0070673_1002196152 215
506 3300005364 Ga0070673_100281591 Ga0070673_1002815911 215
507 3300005365 Ga0070688_100089412 Ga0070688_1000894122 215
508 3300005365 Ga0070688_100169991 Ga0070688_1001699912 215
509 3300005366 Ga0070659_100007187 Ga0070659_1000071877 215
510 3300005366 Ga0070659_100014833 Ga0070659_1000148334 215
511 3300005366 Ga0070659_100061370 Ga0070659_1000613703 215
512 3300005366 Ga0070659_100191534 Ga0070659_1001915342 215
513 3300005366 Ga0070659_100542459 Ga0070659_1005424591 215
514 3300005367 Ga0070667_100020249 Ga0070667_1000202496 215
515 3300005367 Ga0070667_100057396 Ga0070667_1000573964 215
516 3300005367 Ga0070667_100220075 Ga0070667_1002200752 215
517 3300005367 Ga0070667_100250684 Ga0070667_1002506842 215
518 3300005367 Ga0070667_100282103 Ga0070667_1002821032 215
519 3300005367 Ga0070667_100299953 Ga0070667_1002999532 215
520 3300005367 Ga0070667_100547582 Ga0070667_1005475822 215
521 3300005438 Ga0070701_10030425 Ga0070701_100304253 215
522 3300005438 Ga0070701_10042878 Ga0070701_100428782 215
523 3300005441 Ga0070700_100206961 Ga0070700_1002069612 215
524 3300005455 Ga0070663_100161237 Ga0070663_1001612372 215
525 3300005455 Ga0070663_100370722 Ga0070663_1003707222 215
526 3300005455 Ga0070663_100577370 Ga0070663_1005773701 215
527 3300005456 Ga0070678_100059231 Ga0070678_1000592312 215
528 3300005456 Ga0070678_100679540 Ga0070678_1006795401 215
529 3300005457 Ga0070662_100041094 Ga0070662_1000410942 215
530 3300005457 Ga0070662_100047930 Ga0070662_1000479303 215
531 3300005457 Ga0070662_100050347 Ga0070662_1000503473 215
532 3300005457 Ga0070662_100070905 Ga0070662_1000709052 215
533 3300005457 Ga0070662_100153087 Ga0070662_1001530872 215
534 3300005458 Ga0070681_10034476 Ga0070681_100344763 215
535 3300005458 Ga0070681_10069046 Ga0070681_100690462 215
536 3300005458 Ga0070681_10089254 Ga0070681_100892542 215
537 3300005458 Ga0070681_10189654 Ga0070681_101896542 215
538 3300005458 Ga0070681_10318982 Ga0070681_103189822 215
539 3300005458 Ga0070681_10498067 Ga0070681_104980671 215
540 3300005459 Ga0068867_100017213 Ga0068867_1000172134 215
541 3300005459 Ga0068867_100018823 Ga0068867_1000188233 215
542 3300005459 Ga0068867_100045627 Ga0068867_1000456272 215
543 3300005459 Ga0068867_100124886 Ga0068867_1001248862 215
544 3300005459 Ga0068867_100276407 Ga0068867_1002764072 215
545 3300005459 Ga0068867_100393196 Ga0068867_1003931961 215
546 3300005459 Ga0068867_100453623 Ga0068867_1004536231 215
547 3300005459 Ga0068867_100576468 Ga0068867_1005764682 215
548 3300005466 Ga0070685_10030244 Ga0070685_100302442 215
549 3300005466 Ga0070685_10162796 Ga0070685_101627962 215
550 3300005471 Ga0070698_100034419 Ga0070698_1000344194 215
551 3300005471 Ga0070698_100219385 Ga0070698_1002193852 215
552 3300005530 Ga0070679_100009375 Ga0070679_1000093752 215
553 3300005530 Ga0070679_100022898 Ga0070679_1000228985 215
554 3300005530 Ga0070679_100029983 Ga0070679_1000299833 215
555 3300005530 Ga0070679_100037881 Ga0070679_1000378813 215
556 3300005530 Ga0070679_100050468 Ga0070679_1000504682 215
557 3300005530 Ga0070679_100062160 Ga0070679_1000621603 215
558 3300005530 Ga0070679_100151851 Ga0070679_1001518512 215
559 3300005530 Ga0070679_100241274 Ga0070679_1002412742 215
560 3300005535 Ga0070684_100000768 Ga0070684_10000076821 215
561 3300005535 Ga0070684_100001060 Ga0070684_10000106019 215
562 3300005535 Ga0070684_100595267 Ga0070684_1005952672 215
563 3300005539 Ga0068853_100000520 Ga0068853_10000052022 215
564 3300005539 Ga0068853_100009389 Ga0068853_1000093893 215
565 3300005539 Ga0068853_100010204 Ga0068853_1000102045 215
566 3300005539 Ga0068853_100097777 Ga0068853_1000977772 215
567 3300005539 Ga0068853_100154878 Ga0068853_1001548782 215
568 3300005539 Ga0068853_100169030 Ga0068853_1001690302 215
569 3300005539 Ga0068853_100205813 Ga0068853_1002058132 215
570 3300005539 Ga0068853_100267326 Ga0068853_1002673262 215
571 3300005539 Ga0068853_100399359 Ga0068853_1003993592 215
572 3300005539 Ga0068853_100410303 Ga0068853_1004103031 215
573 3300005539 Ga0068853_100497853 Ga0068853_1004978531 215
574 3300005543 Ga0070672_100086295 Ga0070672_1000862954 215
575 3300005543 Ga0070672_100272233 Ga0070672_1002722331 215
576 3300005543 Ga0070672_100318410 Ga0070672_1003184102 215
577 3300005544 Ga0070686_100547308 Ga0070686_1005473081 215
578 3300005548 Ga0070665_100000016 Ga0070665_100000016320 215
579 3300005548 Ga0070665_100076887 Ga0070665_1000768872 215
580 3300005548 Ga0070665_100174223 Ga0070665_1001742234 215
581 3300005548 Ga0070665_100589784 Ga0070665_1005897841 215
582 3300005563 Ga0068855_100002033 Ga0068855_10000203320 215
583 3300005563 Ga0068855_100038229 Ga0068855_1000382294 215
584 3300005563 Ga0068855_100095965 Ga0068855_1000959654 215
585 3300005563 Ga0068855_100100781 Ga0068855_1001007812 215
586 3300005563 Ga0068855_100125190 Ga0068855_1001251903 215
587 3300005563 Ga0068855_101058718 Ga0068855_1010587181 215
588 3300005564 Ga0070664_100007325 Ga0070664_1000073258 215
589 3300005564 Ga0070664_100017660 Ga0070664_1000176606 215
590 3300005564 Ga0070664_100190998 Ga0070664_1001909982 215
591 3300005564 Ga0070664_100252487 Ga0070664_1002524872 215
592 3300005564 Ga0070664_100413307 Ga0070664_1004133071 215
593 3300005564 Ga0070664_100501886 Ga0070664_1005018862 215
594 3300005577 Ga0068857_100008614 Ga0068857_1000086148 215
595 3300005577 Ga0068857_100115318 Ga0068857_1001153182 215
596 3300005577 Ga0068857_100132177 Ga0068857_1001321773 215
597 3300005577 Ga0068857_100190919 Ga0068857_1001909192 215
598 3300005577 Ga0068857_100499890 Ga0068857_1004998902 215
599 3300005577 Ga0068857_100556531 Ga0068857_1005565312 215
600 3300005578 Ga0068854_100068384 Ga0068854_1000683842 215
601 3300005578 Ga0068854_100329767 Ga0068854_1003297672 215
602 3300005578 Ga0068854_100505941 Ga0068854_1005059411 215
603 3300005614 Ga0068856_100028734 Ga0068856_1000287344 215
604 3300005614 Ga0068856_100062559 Ga0068856_1000625592 215
605 3300005614 Ga0068856_100074389 Ga0068856_1000743893 215
606 3300005614 Ga0068856_100289020 Ga0068856_1002890202 215
607 3300005615 Ga0070702_100453961 Ga0070702_1004539612 215
608 3300005616 Ga0068852_100003948 Ga0068852_1000039484 215
609 3300005616 Ga0068852_100005616 Ga0068852_1000056164 215
610 3300005616 Ga0068852_100017743 Ga0068852_1000177436 215
611 3300005616 Ga0068852_100039278 Ga0068852_1000392782 215
612 3300005616 Ga0068852_100073856 Ga0068852_1000738562 215
613 3300005616 Ga0068852_100106272 Ga0068852_1001062723 215
614 3300005616 Ga0068852_100126231 Ga0068852_1001262312 215
615 3300005616 Ga0068852_100211024 Ga0068852_1002110243 215
616 3300005616 Ga0068852_100225934 Ga0068852_1002259342 215
617 3300005616 Ga0068852_100414732 Ga0068852_1004147322 215
618 3300005616 Ga0068852_100570823 Ga0068852_1005708231 215
619 3300005617 Ga0068859_100000012 Ga0068859_100000012177 215
620 3300005617 Ga0068859_100015449 Ga0068859_1000154495 215
621 3300005617 Ga0068859_100016918 Ga0068859_1000169182 215
622 3300005617 Ga0068859_100121114 Ga0068859_1001211142 215
623 3300005617 Ga0068859_100182763 Ga0068859_1001827632 215
624 3300005617 Ga0068859_100366272 Ga0068859_1003662722 215
625 3300005617 Ga0068859_100391475 Ga0068859_1003914751 215
626 3300005617 Ga0068859_100470510 Ga0068859_1004705102 215
627 3300005618 Ga0068864_100010946 Ga0068864_1000109467 215
628 3300005618 Ga0068864_100030323 Ga0068864_1000303234 215
629 3300005618 Ga0068864_100064925 Ga0068864_1000649253 215
630 3300005618 Ga0068864_100595738 Ga0068864_1005957382 215
631 3300005618 Ga0068864_101165326 Ga0068864_1011653261 215
632 3300005718 Ga0068866_10010917 Ga0068866_100109173 215
633 3300005718 Ga0068866_10027968 Ga0068866_100279684 215
634 3300005718 Ga0068866_10043497 Ga0068866_100434971 215
635 3300005719 Ga0068861_100070790 Ga0068861_1000707903 215
636 3300005719 Ga0068861_100253963 Ga0068861_1002539632 215
637 3300005719 Ga0068861_100406837 Ga0068861_1004068372 215
638 3300005719 Ga0068861_100440434 Ga0068861_1004404342 215
639 3300005834 Ga0068851_10026913 Ga0068851_100269132 215
640 3300005834 Ga0068851_10066130 Ga0068851_100661302 215
641 3300005840 Ga0068870_10029291 Ga0068870_100292913 215
642 3300005841 Ga0068863_100003359 Ga0068863_10000335912 215
643 3300005841 Ga0068863_100025383 Ga0068863_1000253834 215
644 3300005841 Ga0068863_100031774 Ga0068863_1000317743 215
645 3300005841 Ga0068863_100276818 Ga0068863_1002768182 215
646 3300005841 Ga0068863_100629581 Ga0068863_1006295811 215
647 3300005842 Ga0068858_100001362 Ga0068858_10000136216 215
648 3300005842 Ga0068858_100047034 Ga0068858_1000470343 215
649 3300005842 Ga0068858_100063752 Ga0068858_1000637523 215
650 3300005843 Ga0068860_100002209 Ga0068860_10000220910 215
651 3300005843 Ga0068860_100007860 Ga0068860_1000078606 215
652 3300005843 Ga0068860_100072785 Ga0068860_1000727853 215
653 3300005843 Ga0068860_100091780 Ga0068860_1000917803 215
654 3300005843 Ga0068860_100151072 Ga0068860_1001510723 215
655 3300005843 Ga0068860_100568775 Ga0068860_1005687751 215
656 3300005844 Ga0068862_100010995 Ga0068862_1000109953 215
657 3300005844 Ga0068862_100064721 Ga0068862_1000647214 215
658 3300005844 Ga0068862_100133853 Ga0068862_1001338532 215
659 3300005844 Ga0068862_100688106 Ga0068862_1006881062 215
660 3300005985 Ga0081539_10007837 Ga0081539_100078375 215
661 3300006195 Ga0075366_10009633 Ga0075366_100096334 215
662 3300006195 Ga0075366_10076952 Ga0075366_100769523 215
663 3300006237 Ga0097621_100007971 Ga0097621_1000079714 215
664 3300006237 Ga0097621_100008933 Ga0097621_1000089336 215
665 3300006237 Ga0097621_100078756 Ga0097621_1000787563 215
666 3300006237 Ga0097621_100099328 Ga0097621_1000993283 215
667 3300006237 Ga0097621_100117833 Ga0097621_1001178332 215
668 3300006237 Ga0097621_100139216 Ga0097621_1001392162 215
669 3300006237 Ga0097621_100160061 Ga0097621_1001600612 215
670 3300006237 Ga0097621_100576317 Ga0097621_1005763171 215
671 3300006358 Ga0068871_100008378 Ga0068871_1000083787 215
672 3300006358 Ga0068871_100083065 Ga0068871_1000830651 215
673 3300006358 Ga0068871_100086792 Ga0068871_1000867922 215
674 3300006358 Ga0068871_100095306 Ga0068871_1000953062 215
675 3300006358 Ga0068871_100097165 Ga0068871_1000971652 215
676 3300006358 Ga0068871_100103213 Ga0068871_1001032133 215
677 3300006358 Ga0068871_100161295 Ga0068871_1001612952 215
678 3300006844 Ga0075428_100056891 Ga0075428_1000568913 215
679 3300006846 Ga0075430_100005928 Ga0075430_1000059283 215
680 3300006847 Ga0075431_100001800 Ga0075431_1000018009 215
681 3300006880 Ga0075429_100015792 Ga0075429_1000157925 215
682 3300006880 Ga0075429_100037587 Ga0075429_1000375871 215
683 3300006880 Ga0075429_100041776 Ga0075429_1000417762 215
684 3300006880 Ga0075429_100252586 Ga0075429_1002525862 215
685 3300006881 Ga0068865_100002249 Ga0068865_10000224911 215
686 3300006881 Ga0068865_100128968 Ga0068865_1001289682 215
687 3300006881 Ga0068865_100131110 Ga0068865_1001311102 215
688 3300006931 Ga0097620_100000012 Ga0097620_100000012177 215
689 3300006931 Ga0097620_100015449 Ga0097620_1000154495 215
690 3300006931 Ga0097620_100016919 Ga0097620_1000169192 215
691 3300006931 Ga0097620_100121119 Ga0097620_1001211193 215
692 3300006931 Ga0097620_100182775 Ga0097620_1001827752 215
693 3300006931 Ga0097620_100366299 Ga0097620_1003662992 215
694 3300006931 Ga0097620_100391444 Ga0097620_1003914441 215
695 3300009011 Ga0105251_10095755 Ga0105251_100957552 215
696 3300009093 Ga0105240_10004553 Ga0105240_100045533 215
697 3300009093 Ga0105240_10004621 Ga0105240_100046214 215
698 3300009093 Ga0105240_10023337 Ga0105240_100233376 215
699 3300009093 Ga0105240_10039801 Ga0105240_100398013 215
700 3300009093 Ga0105240_10212273 Ga0105240_102122732 215
701 3300009094 Ga0111539_10162199 Ga0111539_101621993 215
702 3300009098 Ga0105245_10507780 Ga0105245_105077802 215
703 3300009101 Ga0105247_10001409 Ga0105247_100014093 215
704 3300009147 Ga0114129_10015867 Ga0114129_100158674 215
705 3300009174 Ga0105241_10000533 Ga0105241_100005331 215
706 3300009174 Ga0105241_10069438 Ga0105241_100694383 215
707 3300009174 Ga0105241_10097536 Ga0105241_100975363 215
708 3300009174 Ga0105241_10259768 Ga0105241_102597682 215
709 3300009174 Ga0105241_10769260 Ga0105241_107692601 215
710 3300009176 Ga0105242_10043542 Ga0105242_100435423 215
711 3300009176 Ga0105242_10451632 Ga0105242_104516322 215
712 3300009176 Ga0105242_10631368 Ga0105242_106313682 215
713 3300009176 Ga0105242_10844261 Ga0105242_108442611 215
714 3300009545 Ga0105237_10005490 Ga0105237_100054908 215
715 3300009545 Ga0105237_10005694 Ga0105237_100056944 215
716 3300009545 Ga0105237_10047089 Ga0105237_100470893 215
717 3300009545 Ga0105237_10098324 Ga0105237_100983241 215
718 3300009553 Ga0105249_10001958 Ga0105249_100019589 215
719 3300009553 Ga0105249_10034852 Ga0105249_100348525 215
720 3300009553 Ga0105249_10041170 Ga0105249_100411703 215
721 3300009553 Ga0105249_10596564 Ga0105249_105965642 215
722 3300009553 Ga0105249_10974557 Ga0105249_109745572 215
723 3300010375 Ga0105239_10011083 Ga0105239_100110839 215
724 3300010375 Ga0105239_10017966 Ga0105239_100179664 215
725 3300010375 Ga0105239_10066389 Ga0105239_100663892 215
726 3300010375 Ga0105239_10127719 Ga0105239_101277192 215
727 3300010375 Ga0105239_10192320 Ga0105239_101923202 215
728 3300010375 Ga0105239_10371360 Ga0105239_103713602 215
729 3300010375 Ga0105239_10411698 Ga0105239_104116981 215
730 3300011119 Ga0105246_10005718 Ga0105246_100057183 215
731 3300011119 Ga0105246_10094380 Ga0105246_100943802 215
732 3300011119 Ga0105246_10215943 Ga0105246_102159431 215
733 3300011119 Ga0105246_10425992 Ga0105246_104259921 215
734 3300011119 Ga0105246_10767641 Ga0105246_107676411 215
735 3300013100 Ga0157373_10000275 Ga0157373_1000027519 215
736 3300013100 Ga0157373_10015282 Ga0157373_100152827 215
737 3300013100 Ga0157373_10016691 Ga0157373_100166912 215
738 3300013100 Ga0157373_10026324 Ga0157373_100263244 215
739 3300013100 Ga0157373_10038389 Ga0157373_100383891 215
740 3300013100 Ga0157373_10050702 Ga0157373_100507022 215
741 3300013100 Ga0157373_10211189 Ga0157373_102111892 215
742 3300013100 Ga0157373_10277050 Ga0157373_102770502 215
743 3300013100 Ga0157373_10290340 Ga0157373_102903401 215
744 3300013102 Ga0157371_10000596 Ga0157371_100005965 215
745 3300013102 Ga0157371_10002078 Ga0157371_100020784 215
746 3300013102 Ga0157371_10011331 Ga0157371_100113314 215
747 3300013102 Ga0157371_10012915 Ga0157371_100129152 215
748 3300013102 Ga0157371_10024481 Ga0157371_100244812 215
749 3300013102 Ga0157371_10029505 Ga0157371_100295056 215
750 3300013102 Ga0157371_10064707 Ga0157371_100647072 215
751 3300013102 Ga0157371_10091472 Ga0157371_100914721 215
752 3300013102 Ga0157371_10091597 Ga0157371_100915972 215
753 3300013102 Ga0157371_10110867 Ga0157371_101108672 215
754 3300013102 Ga0157371_10137041 Ga0157371_101370411 215
755 3300013102 Ga0157371_10162979 Ga0157371_101629792 215
756 3300013102 Ga0157371_10169831 Ga0157371_101698311 215
757 3300013102 Ga0157371_10179070 Ga0157371_101790702 215
758 3300013102 Ga0157371_10226367 Ga0157371_102263672 215
759 3300013102 Ga0157371_10263919 Ga0157371_102639192 215
760 3300013102 Ga0157371_10755418 Ga0157371_107554181 215
761 3300013104 Ga0157370_10000238 Ga0157370_1000023841 215
762 3300013104 Ga0157370_10000405 Ga0157370_1000040515 215
763 3300013104 Ga0157370_10055078 Ga0157370_100550783 215
764 3300013104 Ga0157370_10070212 Ga0157370_100702122 215
765 3300013104 Ga0157370_10209739 Ga0157370_102097391 215
766 3300013104 Ga0157370_10322742 Ga0157370_103227421 215
767 3300013104 Ga0157370_10389986 Ga0157370_103899862 215
768 3300013104 Ga0157370_10770037 Ga0157370_107700371 215
769 3300013105 Ga0157369_10023820 Ga0157369_100238205 215
770 3300013105 Ga0157369_10040594 Ga0157369_100405942 215
771 3300013105 Ga0157369_10067243 Ga0157369_100672432 215
772 3300013105 Ga0157369_10068914 Ga0157369_100689142 215
773 3300013105 Ga0157369_10100151 Ga0157369_101001511 215
774 3300013105 Ga0157369_10161499 Ga0157369_101614992 215
775 3300013105 Ga0157369_10185665 Ga0157369_101856652 215
776 3300013105 Ga0157369_10188812 Ga0157369_101888122 215
777 3300013105 Ga0157369_10279023 Ga0157369_102790231 215
778 3300013105 Ga0157369_10366869 Ga0157369_103668691 215
779 3300013105 Ga0157369_10485617 Ga0157369_104856172 215
780 3300013105 Ga0157369_10583150 Ga0157369_105831501 215
781 3300013105 Ga0157369_10997484 Ga0157369_109974841 215
782 3300013296 Ga0157374_10006478 Ga0157374_100064789 215
783 3300013296 Ga0157374_10017671 Ga0157374_100176715 215
784 3300013296 Ga0157374_10046728 Ga0157374_100467284 215
785 3300013296 Ga0157374_10128112 Ga0157374_101281122 215
786 3300013296 Ga0157374_10154491 Ga0157374_101544913 215
787 3300013296 Ga0157374_10296805 Ga0157374_102968052 215
788 3300013296 Ga0157374_10357898 Ga0157374_103578982 215
789 3300013296 Ga0157374_10450174 Ga0157374_104501742 215
790 3300013296 Ga0157374_10490250 Ga0157374_104902502 215
791 3300013296 Ga0157374_11316718 Ga0157374_113167181 215
792 3300013297 Ga0157378_10002090 Ga0157378_100020905 215
793 3300013297 Ga0157378_10010065 Ga0157378_100100653 215
794 3300013297 Ga0157378_10031342 Ga0157378_100313423 215
795 3300013297 Ga0157378_10045275 Ga0157378_100452752 215
796 3300013297 Ga0157378_10069077 Ga0157378_100690774 215
797 3300013297 Ga0157378_10101789 Ga0157378_101017892 215
798 3300013297 Ga0157378_10132143 Ga0157378_101321432 215
799 3300013297 Ga0157378_10369500 Ga0157378_103695002 215
800 3300013297 Ga0157378_10415877 Ga0157378_104158772 215
801 3300013297 Ga0157378_11065749 Ga0157378_110657492 215
802 3300013297 Ga0157378_11356574 Ga0157378_113565741 215
803 3300013306 Ga0163162_10000279 Ga0163162_1000027926 215
804 3300013306 Ga0163162_10003820 Ga0163162_100038208 215
805 3300013306 Ga0163162_10004813 Ga0163162_100048133 215
806 3300013306 Ga0163162_10006228 Ga0163162_1000622811 215
807 3300013306 Ga0163162_10020346 Ga0163162_100203462 215
808 3300013306 Ga0163162_10118184 Ga0163162_101181842 215
809 3300013306 Ga0163162_10162009 Ga0163162_101620092 215
810 3300013306 Ga0163162_10387958 Ga0163162_103879582 215
811 3300013306 Ga0163162_10502404 Ga0163162_105024042 215
812 3300013306 Ga0163162_10551733 Ga0163162_105517332 215
813 3300013306 Ga0163162_11602752 Ga0163162_116027521 215
814 3300013307 Ga0157372_10009200 Ga0157372_100092007 215
815 3300013307 Ga0157372_10010252 Ga0157372_100102529 215
816 3300013307 Ga0157372_10010966 Ga0157372_100109667 215
817 3300013307 Ga0157372_10015765 Ga0157372_100157658 215
818 3300013307 Ga0157372_10029622 Ga0157372_100296224 215
819 3300013307 Ga0157372_10031629 Ga0157372_100316295 215
820 3300013307 Ga0157372_10072476 Ga0157372_100724765 215
821 3300013307 Ga0157372_10090343 Ga0157372_100903433 215
822 3300013307 Ga0157372_10103164 Ga0157372_101031642 215
823 3300013307 Ga0157372_10109383 Ga0157372_101093832 215
824 3300013307 Ga0157372_10113091 Ga0157372_101130914 215
825 3300013307 Ga0157372_10114415 Ga0157372_101144153 215
826 3300013307 Ga0157372_10156889 Ga0157372_101568893 215
827 3300013307 Ga0157372_10165768 Ga0157372_101657684 215
828 3300013307 Ga0157372_10199261 Ga0157372_101992612 215
829 3300013307 Ga0157372_10222536 Ga0157372_102225362 215
830 3300013307 Ga0157372_10294364 Ga0157372_102943642 215
831 3300013307 Ga0157372_10298073 Ga0157372_102980732 215
832 3300013307 Ga0157372_10382776 Ga0157372_103827762 215
833 3300013307 Ga0157372_10388080 Ga0157372_103880802 215
834 3300013307 Ga0157372_10388520 Ga0157372_103885202 215
835 3300013307 Ga0157372_10626420 Ga0157372_106264202 215
836 3300013307 Ga0157372_10677249 Ga0157372_106772491 215
837 3300013307 Ga0157372_10711664 Ga0157372_107116642 215
838 3300013307 Ga0157372_10791279 Ga0157372_107912791 215
839 3300013307 Ga0157372_11462428 Ga0157372_114624281 215
840 3300013308 Ga0157375_10038477 Ga0157375_100384774 215
841 3300013308 Ga0157375_10053145 Ga0157375_100531454 215
842 3300013308 Ga0157375_10076446 Ga0157375_100764463 215
843 3300013308 Ga0157375_10084012 Ga0157375_100840123 215
844 3300013308 Ga0157375_10086998 Ga0157375_100869982 215
845 3300013308 Ga0157375_10155431 Ga0157375_101554312 215
846 3300013308 Ga0157375_10166926 Ga0157375_101669263 215
847 3300013308 Ga0157375_10183454 Ga0157375_101834542 215
848 3300013308 Ga0157375_10275825 Ga0157375_102758252 215
849 3300013308 Ga0157375_10289583 Ga0157375_102895832 215
850 3300013308 Ga0157375_10357986 Ga0157375_103579862 215
851 3300013308 Ga0157375_10653920 Ga0157375_106539201 215
852 3300013308 Ga0157375_10734074 Ga0157375_107340741 215
853 3300013308 Ga0157375_11143710 Ga0157375_111437101 215
854 3300014325 Ga0163163_10002122 Ga0163163_100021226 215
855 3300014325 Ga0163163_10009925 Ga0163163_100099257 215
856 3300014325 Ga0163163_10020274 Ga0163163_100202743 215
857 3300014325 Ga0163163_10142515 Ga0163163_101425152 215
858 3300014325 Ga0163163_10232058 Ga0163163_102320582 215
859 3300014325 Ga0163163_10238362 Ga0163163_102383622 215
860 3300014325 Ga0163163_10442588 Ga0163163_104425882 215
861 3300014325 Ga0163163_10506995 Ga0163163_105069951 215
862 3300014326 Ga0157380_10006970 Ga0157380_100069705 215
863 3300014326 Ga0157380_10010950 Ga0157380_100109502 215
864 3300014326 Ga0157380_10150228 Ga0157380_101502282 215
865 3300014326 Ga0157380_10196143 Ga0157380_101961432 215
866 3300014326 Ga0157380_10248107 Ga0157380_102481072 215
867 3300014326 Ga0157380_10272719 Ga0157380_102727191 215
868 3300014326 Ga0157380_10399881 Ga0157380_103998811 215
869 3300014745 Ga0157377_10057265 Ga0157377_100572653 215
870 3300014745 Ga0157377_10210314 Ga0157377_102103142 215
871 3300014968 Ga0157379_10026404 Ga0157379_100264042 215
872 3300014968 Ga0157379_10033384 Ga0157379_100333843 215
873 3300014968 Ga0157379_10047182 Ga0157379_100471823 215
874 3300014968 Ga0157379_10132198 Ga0157379_101321982 215
875 3300014968 Ga0157379_10145105 Ga0157379_101451052 215
876 3300014968 Ga0157379_10304482 Ga0157379_103044822 215
877 3300014969 Ga0157376_10019024 Ga0157376_100190242 215
878 3300014969 Ga0157376_10127764 Ga0157376_101277643 215
879 3300014969 Ga0157376_10216996 Ga0157376_102169962 215
880 3300014969 Ga0157376_10242873 Ga0157376_102428732 215
881 3300014969 Ga0157376_10355273 Ga0157376_103552731 215
882 3300014969 Ga0157376_10411918 Ga0157376_104119181 215
883 3300014969 Ga0157376_10526796 Ga0157376_105267961 215
884 3300014969 Ga0157376_10766548 Ga0157376_107665482 215
885 3300017792 Ga0163161_10035078 Ga0163161_100350784 215
886 3300017792 Ga0163161_10101064 Ga0163161_101010641 215
887 3300017792 Ga0163161_10485161 Ga0163161_104851612 215
888 3300021384 Ga0213876_10001740 Ga0213876_100017404 215
889 3300021384 Ga0213876_10010098 Ga0213876_100100984 215
890 3300025302 Ga0207426_1000104 Ga0207426_100010452 215
891 3300025315 Ga0207697_10093496 Ga0207697_100934962 215
892 3300025315 Ga0207697_10181130 Ga0207697_101811301 215
893 3300025893 Ga0207682_10001049 Ga0207682_100010494 215
894 3300025899 Ga0207642_10027167 Ga0207642_100271672 215
895 3300025900 Ga0207710_10012887 Ga0207710_100128872 215
896 3300025901 Ga0207688_10035812 Ga0207688_100358122 215
897 3300025901 Ga0207688_10045084 Ga0207688_100450842 215
898 3300025901 Ga0207688_10077139 Ga0207688_100771392 215
899 3300025903 Ga0207680_10000371 Ga0207680_1000037113 215
900 3300025903 Ga0207680_10025925 Ga0207680_100259252 215
901 3300025903 Ga0207680_10449108 Ga0207680_104491082 215
902 3300025904 Ga0207647_10012837 Ga0207647_100128373 215
903 3300025904 Ga0207647_10019112 Ga0207647_100191123 215
904 3300025907 Ga0207645_10000511 Ga0207645_1000051123 215
905 3300025907 Ga0207645_10297712 Ga0207645_102977121 215
906 3300025908 Ga0207643_10061009 Ga0207643_100610093 215
907 3300025908 Ga0207643_10250150 Ga0207643_102501501 215
908 3300025909 Ga0207705_10034312 Ga0207705_100343123 215
909 3300025909 Ga0207705_10163048 Ga0207705_101630482 215
910 3300025909 Ga0207705_10308121 Ga0207705_103081212 215
911 3300025909 Ga0207705_10345656 Ga0207705_103456561 215
912 3300025909 Ga0207705_10541303 Ga0207705_105413031 215
913 3300025911 Ga0207654_10239301 Ga0207654_102393012 215
914 3300025912 Ga0207707_10073490 Ga0207707_100734901 215
915 3300025912 Ga0207707_10177512 Ga0207707_101775122 215
916 3300025912 Ga0207707_10255823 Ga0207707_102558232 215
917 3300025912 Ga0207707_10255895 Ga0207707_102558952 215
918 3300025912 Ga0207707_10476152 Ga0207707_104761522 215
919 3300025912 Ga0207707_10752275 Ga0207707_107522751 215
920 3300025913 Ga0207695_10000486 Ga0207695_1000048670 215
921 3300025913 Ga0207695_10003818 Ga0207695_1000381819 215
922 3300025913 Ga0207695_10043454 Ga0207695_100434542 215
923 3300025914 Ga0207671_10001742 Ga0207671_100017428 215
924 3300025914 Ga0207671_10071305 Ga0207671_100713053 215
925 3300025914 Ga0207671_10166148 Ga0207671_101661482 215
926 3300025917 Ga0207660_10135955 Ga0207660_101359552 215
927 3300025918 Ga0207662_10033075 Ga0207662_100330753 215
928 3300025918 Ga0207662_10327142 Ga0207662_103271422 215
929 3300025919 Ga0207657_10004159 Ga0207657_100041597 215
930 3300025919 Ga0207657_10018632 Ga0207657_100186326 215
931 3300025919 Ga0207657_10029137 Ga0207657_100291375 215
932 3300025919 Ga0207657_10136773 Ga0207657_101367732 215
933 3300025919 Ga0207657_10400054 Ga0207657_104000542 215
934 3300025920 Ga0207649_10006464 Ga0207649_100064646 215
935 3300025920 Ga0207649_10022783 Ga0207649_100227833 215
936 3300025920 Ga0207649_10082255 Ga0207649_100822552 215
937 3300025920 Ga0207649_10206618 Ga0207649_102066182 215
938 3300025921 Ga0207652_10000210 Ga0207652_1000021053 215
939 3300025921 Ga0207652_10002655 Ga0207652_1000265512 215
940 3300025921 Ga0207652_10007311 Ga0207652_100073117 215
941 3300025921 Ga0207652_10028457 Ga0207652_100284571 215
942 3300025921 Ga0207652_10045845 Ga0207652_100458454 215
943 3300025921 Ga0207652_10058906 Ga0207652_100589062 215
944 3300025921 Ga0207652_10135432 Ga0207652_101354322 215
945 3300025921 Ga0207652_10175339 Ga0207652_101753393 215
946 3300025921 Ga0207652_10331774 Ga0207652_103317742 215
947 3300025923 Ga0207681_10027241 Ga0207681_100272414 215
948 3300025923 Ga0207681_10068587 Ga0207681_100685872 215
949 3300025923 Ga0207681_10330514 Ga0207681_103305142 215
950 3300025925 Ga0207650_10009262 Ga0207650_100092622 215
951 3300025925 Ga0207650_10041161 Ga0207650_100411614 215
952 3300025925 Ga0207650_10134753 Ga0207650_101347532 215
953 3300025925 Ga0207650_10313288 Ga0207650_103132882 215
954 3300025925 Ga0207650_10911341 Ga0207650_109113411 215
955 3300025926 Ga0207659_10052816 Ga0207659_100528162 215
956 3300025926 Ga0207659_10095451 Ga0207659_100954512 215
957 3300025926 Ga0207659_10185262 Ga0207659_101852622 215
958 3300025926 Ga0207659_10231083 Ga0207659_102310832 215
959 3300025931 Ga0207644_10045467 Ga0207644_100454675 215
960 3300025931 Ga0207644_10651355 Ga0207644_106513552 215
961 3300025931 Ga0207644_10720483 Ga0207644_107204832 215
962 3300025931 Ga0207644_10742717 Ga0207644_107427171 215
963 3300025932 Ga0207690_10008207 Ga0207690_100082073 215
964 3300025932 Ga0207690_10029723 Ga0207690_100297232 215
965 3300025932 Ga0207690_10358006 Ga0207690_103580062 215
966 3300025933 Ga0207706_10005368 Ga0207706_100053686 215
967 3300025933 Ga0207706_10031025 Ga0207706_100310253 215
968 3300025933 Ga0207706_10032502 Ga0207706_100325023 215
969 3300025933 Ga0207706_10654384 Ga0207706_106543841 215
970 3300025934 Ga0207686_10023055 Ga0207686_100230555 215
971 3300025934 Ga0207686_10552608 Ga0207686_105526082 215
972 3300025936 Ga0207670_10012704 Ga0207670_100127043 215
973 3300025936 Ga0207670_10321076 Ga0207670_103210761 215
974 3300025936 Ga0207670_10797940 Ga0207670_107979401 215
975 3300025937 Ga0207669_10043590 Ga0207669_100435902 215
976 3300025937 Ga0207669_10060082 Ga0207669_100600821 215
977 3300025937 Ga0207669_10077992 Ga0207669_100779922 215
978 3300025937 Ga0207669_10270361 Ga0207669_102703612 215
979 3300025938 Ga0207704_10045597 Ga0207704_100455972 215
980 3300025940 Ga0207691_10012396 Ga0207691_100123965 215
981 3300025940 Ga0207691_10013692 Ga0207691_100136925 215
982 3300025940 Ga0207691_10043591 Ga0207691_100435914 215
983 3300025940 Ga0207691_10064166 Ga0207691_100641663 215
984 3300025940 Ga0207691_10078152 Ga0207691_100781522 215
985 3300025940 Ga0207691_10098164 Ga0207691_100981642 215
986 3300025940 Ga0207691_10213394 Ga0207691_102133942 215
987 3300025940 Ga0207691_10478718 Ga0207691_104787181 215
988 3300025941 Ga0207711_10249460 Ga0207711_102494602 215
989 3300025942 Ga0207689_10000329 Ga0207689_1000032926 215
990 3300025942 Ga0207689_10005043 Ga0207689_1000504311 215
991 3300025942 Ga0207689_10010393 Ga0207689_100103932 215
992 3300025942 Ga0207689_10381998 Ga0207689_103819982 215
993 3300025944 Ga0207661_10007884 Ga0207661_100078848 215
994 3300025944 Ga0207661_10043012 Ga0207661_100430124 215
995 3300025944 Ga0207661_10107804 Ga0207661_101078043 215
996 3300025945 Ga0207679_10000751 Ga0207679_1000075115 215
997 3300025945 Ga0207679_10001121 Ga0207679_100011218 215
998 3300025945 Ga0207679_10070887 Ga0207679_100708872 215
999 3300025945 Ga0207679_10191868 Ga0207679_101918682 215
1000 3300025945 Ga0207679_10287659 Ga0207679_102876592 215
1001 3300025945 Ga0207679_10470098 Ga0207679_104700982 215
1002 3300025949 Ga0207667_10089071 Ga0207667_100890714 215
1003 3300025949 Ga0207667_10109580 Ga0207667_101095803 215
1004 3300025949 Ga0207667_10167573 Ga0207667_101675732 215
1005 3300025949 Ga0207667_10235251 Ga0207667_102352512 215
1006 3300025949 Ga0207667_10272676 Ga0207667_102726762 215
1007 3300025960 Ga0207651_10043146 Ga0207651_100431463 215
1008 3300025960 Ga0207651_10069071 Ga0207651_100690712 215
1009 3300025960 Ga0207651_10108025 Ga0207651_101080251 215
1010 3300025960 Ga0207651_10127715 Ga0207651_101277152 215
1011 3300025960 Ga0207651_10297261 Ga0207651_102972611 215
1012 3300025961 Ga0207712_10001475 Ga0207712_100014758 215
1013 3300025961 Ga0207712_10012015 Ga0207712_100120153 215
1014 3300025961 Ga0207712_10031288 Ga0207712_100312883 215
1015 3300025961 Ga0207712_10395825 Ga0207712_103958251 215
1016 3300025961 Ga0207712_11050023 Ga0207712_110500231 215
1017 3300025972 Ga0207668_10034958 Ga0207668_100349582 215
1018 3300025972 Ga0207668_10328437 Ga0207668_103284372 215
1019 3300025981 Ga0207640_10155426 Ga0207640_101554263 215
1020 3300025981 Ga0207640_10639296 Ga0207640_106392962 215
1021 3300025986 Ga0207658_10039539 Ga0207658_100395395 215
1022 3300025986 Ga0207658_10051028 Ga0207658_100510283 215
1023 3300025986 Ga0207658_10260123 Ga0207658_102601231 215
1024 3300025986 Ga0207658_10303514 Ga0207658_103035142 215
1025 3300025986 Ga0207658_10591277 Ga0207658_105912772 215
1026 3300026023 Ga0207677_10018452 Ga0207677_100184523 215
1027 3300026023 Ga0207677_10062805 Ga0207677_100628052 215
1028 3300026023 Ga0207677_10067033 Ga0207677_100670334 215
1029 3300026023 Ga0207677_10369311 Ga0207677_103693111 215
1030 3300026023 Ga0207677_10764604 Ga0207677_107646041 215
1031 3300026035 Ga0207703_10040034 Ga0207703_100400343 215
1032 3300026035 Ga0207703_10276170 Ga0207703_102761702 215
1033 3300026035 Ga0207703_10459619 Ga0207703_104596192 215
1034 3300026035 Ga0207703_10790010 Ga0207703_107900101 215
1035 3300026035 Ga0207703_10827590 Ga0207703_108275902 215
1036 3300026041 Ga0207639_10010003 Ga0207639_100100035 215
1037 3300026041 Ga0207639_10026659 Ga0207639_100266593 215
1038 3300026041 Ga0207639_10138006 Ga0207639_101380062 215
1039 3300026041 Ga0207639_10149936 Ga0207639_101499362 215
1040 3300026041 Ga0207639_10196223 Ga0207639_101962232 215
1041 3300026041 Ga0207639_10289581 Ga0207639_102895811 215
1042 3300026041 Ga0207639_10323026 Ga0207639_103230262 215
1043 3300026041 Ga0207639_10379437 Ga0207639_103794371 215
1044 3300026041 Ga0207639_10607474 Ga0207639_106074742 215
1045 3300026041 Ga0207639_10723978 Ga0207639_107239781 215
1046 3300026067 Ga0207678_10013940 Ga0207678_100139406 215
1047 3300026067 Ga0207678_10108296 Ga0207678_101082962 215
1048 3300026067 Ga0207678_10171337 Ga0207678_101713372 215
1049 3300026075 Ga0207708_10049982 Ga0207708_100499823 215
1050 3300026075 Ga0207708_10132051 Ga0207708_101320512 215
1051 3300026075 Ga0207708_10507710 Ga0207708_105077102 215
1052 3300026078 Ga0207702_10093619 Ga0207702_100936191 215
1053 3300026078 Ga0207702_10138992 Ga0207702_101389923 215
1054 3300026078 Ga0207702_10643854 Ga0207702_106438541 215
1055 3300026088 Ga0207641_10000152 Ga0207641_1000015259 215
1056 3300026088 Ga0207641_10000418 Ga0207641_1000041829 215
1057 3300026088 Ga0207641_10051955 Ga0207641_100519553 215
1058 3300026088 Ga0207641_10087159 Ga0207641_100871592 215
1059 3300026088 Ga0207641_10365245 Ga0207641_103652452 215
1060 3300026089 Ga0207648_10001186 Ga0207648_100011868 215
1061 3300026089 Ga0207648_10031158 Ga0207648_100311585 215
1062 3300026089 Ga0207648_10055669 Ga0207648_100556693 215
1063 3300026089 Ga0207648_10097621 Ga0207648_100976212 215
1064 3300026089 Ga0207648_10101771 Ga0207648_101017713 215
1065 3300026089 Ga0207648_10146808 Ga0207648_101468083 215
1066 3300026089 Ga0207648_10148765 Ga0207648_101487653 215
1067 3300026089 Ga0207648_10238101 Ga0207648_102381012 215
1068 3300026089 Ga0207648_10733062 Ga0207648_107330621 215
1069 3300026089 Ga0207648_11067979 Ga0207648_110679791 215
1070 3300026095 Ga0207676_10586540 Ga0207676_105865402 215
1071 3300026095 Ga0207676_11199633 Ga0207676_111996331 215
1072 3300026116 Ga0207674_10006492 Ga0207674_100064923 215
1073 3300026116 Ga0207674_10030052 Ga0207674_100300523 215
1074 3300026116 Ga0207674_10081980 Ga0207674_100819804 215
1075 3300026116 Ga0207674_10254963 Ga0207674_102549632 215
1076 3300026116 Ga0207674_10516949 Ga0207674_105169492 215
1077 3300026118 Ga0207675_100062346 Ga0207675_1000623461 215
1078 3300026118 Ga0207675_100099250 Ga0207675_1000992502 215
1079 3300026118 Ga0207675_100233673 Ga0207675_1002336732 215
1080 3300026118 Ga0207675_100337059 Ga0207675_1003370592 215
1081 3300026121 Ga0207683_10141863 Ga0207683_101418632 215
1082 3300026121 Ga0207683_10178411 Ga0207683_101784112 215
1083 3300026121 Ga0207683_10222892 Ga0207683_102228922 215
1084 3300026121 Ga0207683_10259266 Ga0207683_102592662 215
1085 3300026142 Ga0207698_10008700 Ga0207698_100087007 215
1086 3300026142 Ga0207698_10024494 Ga0207698_100244942 215
1087 3300026142 Ga0207698_10025309 Ga0207698_100253094 215
1088 3300026142 Ga0207698_10033415 Ga0207698_100334154 215
1089 3300026142 Ga0207698_10065551 Ga0207698_100655512 215
1090 3300026142 Ga0207698_10156315 Ga0207698_101563153 215
1091 3300026142 Ga0207698_10308193 Ga0207698_103081932 215
1092 3300027471 Ga0209995_1025689 Ga0209995_10256892 215
1093 3300028379 Ga0268266_10000034 Ga0268266_10000034188 215
1094 3300028379 Ga0268266_10028759 Ga0268266_100287593 215
1095 3300028379 Ga0268266_10960939 Ga0268266_109609391 215
1096 3300028380 Ga0268265_10044613 Ga0268265_100446133 215
1097 3300028380 Ga0268265_10045980 Ga0268265_100459805 215
1098 3300028381 Ga0268264_10005355 Ga0268264_100053557 215
1099 3300028381 Ga0268264_10090261 Ga0268264_100902612 215
1100 3300028381 Ga0268264_10103812 Ga0268264_101038122 215
1101 3300028381 Ga0268264_10234265 Ga0268264_102342652 215
1102 3300028381 Ga0268264_10709918 Ga0268264_107099182 215
1103 3300028786 Ga0307517_10030353 Ga0307517_100303533 215
1104 3300028794 Ga0307515_10000039 Ga0307515_10000039106 215
1105 3300031251 Ga0265327_10000030 Ga0265327_1000003023 215
1106 3300031456 Ga0307513_10029047 Ga0307513_100290473 215
1107 3300031548 Ga0307408_100275715 Ga0307408_1002757152 215
1108 3300031616 Ga0307508_10000937 Ga0307508_1000093716 215
1109 3300031838 Ga0307518_10263568 Ga0307518_102635682 215
1110 3300031852 Ga0307410_10230324 Ga0307410_102303242 215
1111 3300032126 Ga0307415_100058480 Ga0307415_1000584801 215
1112 3300035172 Ga0373955_0126666 Ga0373955_0126666_790_1449 215
1113 3300035724 Ga0373933_0447585 Ga0373933_0447585_152_811 215
1114 3300036401 Ga0373937_0423600 Ga0373937_0423600_217_876 215
1115 3300037312 Ga0395899_0004650 Ga0395899_0004650_5588_6244 215
1116 3300037312 Ga0395899_0014385 Ga0395899_0014385_3566_4219 215
1117 3300037312 Ga0395899_0017265 Ga0395899_0017265_3095_3751 215
1118 3300037312 Ga0395899_0344742 Ga0395899_0344742_198_854 215
1119 3300037418 Ga0395900_0000594 Ga0395900_0000594_21907_22563 215
1120 3300037418 Ga0395900_0026735 Ga0395900_0026735_2822_3475 215
1121 3300037418 Ga0395900_0038159 Ga0395900_0038159_309_962 215
1122 3300037418 Ga0395900_0113079 Ga0395900_0113079_108_755 215
1123 3300037418 Ga0395900_0492261 Ga0395900_0492261_11_667 215
1124 3300037418 Ga0395900_0506480 Ga0395900_0506480_161_817 215
1125 3300037466 Ga0395898_0001271 Ga0395898_0001271_27851_28507 215
1126 3300037466 Ga0395898_0019396 Ga0395898_0019396_1673_2326 215
1127 3300037466 Ga0395898_0031929 Ga0395898_0031929_2663_3316 215
1128 3300037466 Ga0395898_0084334 Ga0395898_0084334_2382_3029 215
1129 3300037466 Ga0395898_0294244 Ga0395898_0294244_329_985 215
1130 3300037471 Ga0395905_0000527 Ga0395905_0000527_46087_46740 215
1131 3300037471 Ga0395905_0045277 Ga0395905_0045277_1505_2152 215
1132 3300037471 Ga0395905_0050843 Ga0395905_0050843_195_848 215
1133 3300038443 Ga0395901_0014247 Ga0395901_0014247_5010_5663 215
1134 3300038443 Ga0395901_0017770 Ga0395901_0017770_4635_5288 215
1135 3300038443 Ga0395901_0087877 Ga0395901_0087877_276_932 215
1136 3300038443 Ga0395901_0105083 Ga0395901_0105083_565_1212 215
1137 3300038443 Ga0395901_0179498 Ga0395901_0179498_1155_1808 215
1138 3300038443 Ga0395901_0581778 Ga0395901_0581778_340_993 215
1139 3300039437 Ga0436365_1161343 Ga0436365_1161343_6746_7435 215
1140 3300039437 Ga0436365_1876803 Ga0436365_1876803_4440_5105 215
1141 3300041413 Ga0439465_0057582 Ga0439465_0057582_290_961 215
1142 3300041505 Ga0451849_0457641 Ga0451849_0457641_388_1041 215
1143 3300041507 Ga0451851_0698711 Ga0451851_0698711_84_755 215
1144 3300042001 Ga0439441_005719 Ga0439441_005719_606_1277 215
1145 3300042003 Ga0439443_030000 Ga0439443_030000_19_690 215
1146 3300042004 Ga0439445_0023729 Ga0439445_0023729_335_1006 215
1147 3300042007 Ga0439449_0012045 Ga0439449_0012045_577_1248 215
1148 3300042007 Ga0439449_0015551 Ga0439449_0015551_1249_1902 215
1149 3300042011 Ga0439454_020763 Ga0439454_020763_166_837 215
1150 3300042014 Ga0439457_010574 Ga0439457_010574_539_1210 215
1151 3300042132 Ga0450895_009516 Ga0450895_009516_24_695 215
1152 3300042133 Ga0450896_028602 Ga0450896_028602_79_750 215
1153 3300042134 Ga0450898_001510 Ga0450898_001510_1872_2543 215
1154 3300042461 Ga0439460_0022853 Ga0439460_0022853_137_808 215
1155 3300042876 Ga0451577_0107026 Ga0451577_0107026_252_899 215
1156 3300044658 Ga0466972_0000175 Ga0466972_0000175_38602_39267 215
1157 3300044684 Ga0466966_0335187 Ga0466966_0335187_182_832 215
1158 3300044706 Ga0466964_0052419 Ga0466964_0052419_66_734 215
1159 3300044712 Ga0453684_0038732 Ga0453684_0038732_3246_3905 215
1160 3300044712 Ga0453684_0077553 Ga0453684_0077553_92_739 215
1161 3300044735 Ga0466968_0038156 Ga0466968_0038156_393_1058 215
1162 3300044735 Ga0466968_0125093 Ga0466968_0125093_394_1062 215
1163 3300044765 Ga0466970_0001012 Ga0466970_0001012_2648_3313 215
1164 3300044901 Ga0466960_0091924 Ga0466960_0091924_203_877 215
1165 3300045049 Ga0466959_0503167 Ga0466959_0503167_139_786 215
1166 3300045051 Ga0451576_0077826 Ga0451576_0077826_351_998 215
1167 3300045976 Ga0466967_0501574 Ga0466967_0501574_35_694 215
1168 3300046460 Ga0495638_0072586 Ga0495638_0072586_1240_1917 215
1169 3300046472 Ga0495580_0033076 Ga0495580_0033076_2541_3200 215
1170 3300046524 Ga0495648_0002156 Ga0495648_0002156_11847_12530 215
1171 3300046536 Ga0495587_0033786 Ga0495587_0033786_1775_2434 215
1172 3300046539 Ga0495621_0072455 Ga0495621_0072455_154_825 215
1173 3300046539 Ga0495621_0116141 Ga0495621_0116141_50_721 215
1174 3300046543 Ga0495645_0285819 Ga0495645_0285819_97_756 215
1175 3300046558 Ga0495633_0187636 Ga0495633_0187636_273_932 215
1176 3300046616 Ga0495668_0050185 Ga0495668_0050185_1055_1729 215
1177 3300046642 Ga0495634_0097080 Ga0495634_0097080_464_1126 215
1178 3300046683 Ga0495658_0003503 Ga0495658_0003503_6456_7115 215
1179 3300047472 Ga0495686_0000041 Ga0495686_0000041_78354_79073 215
1180 3300047472 Ga0495686_0045508 Ga0495686_0045508_410_1075 215
1181 3300048911 Ga0496108_0867115 Ga0496108_0867115_85_747 215
1182 3300048914 Ga0496111_0017833 Ga0496111_0017833_3158_3820 215
1183 3300048917 Ga0496114_0582472 Ga0496114_0582472_46_705 215
1184 3300049568 Ga0501031_0030645 Ga0501031_0030645_948_1604 215
1185 3300049569 Ga0501032_0011446 Ga0501032_0011446_5173_5844 215
1186 3300049569 Ga0501032_0259844 Ga0501032_0259844_39_689 215
1187 3300049570 Ga0501033_0197232 Ga0501033_0197232_710_1366 215
1188 3300049571 Ga0501034_0013066 Ga0501034_0013066_5379_6032 215
1189 3300049571 Ga0501034_0016139 Ga0501034_0016139_1970_2620 215
1190 3300049571 Ga0501034_0070588 Ga0501034_0070588_1919_2590 215
1191 3300049571 Ga0501034_0217761 Ga0501034_0217761_1116_1769 215
1192 3300049572 Ga0501036_0055928 Ga0501036_0055928_830_1486 215
1193 3300049572 Ga0501036_0078561 Ga0501036_0078561_1915_2586 215
1194 3300049573 Ga0501037_0003876 Ga0501037_0003876_8696_9352 215
1195 3300049573 Ga0501037_0052301 Ga0501037_0052301_1110_1781 215
1196 3300049573 Ga0501037_0098003 Ga0501037_0098003_1365_2030 215
1197 3300049573 Ga0501037_0225536 Ga0501037_0225536_576_1226 215
1198 3300049574 Ga0501038_0007909 Ga0501038_0007909_8430_9086 215
1199 3300049575 Ga0501039_0016596 Ga0501039_0016596_350_1006 215
1200 3300049575 Ga0501039_0202355 Ga0501039_0202355_280_951 215
1201 3300049576 Ga0501040_0183156 Ga0501040_0183156_748_1404 215
1202 3300049579 Ga0501043_0007741 Ga0501043_0007741_925_1581 215
1203 3300049579 Ga0501043_0052196 Ga0501043_0052196_1432_2103 215
1204 3300049579 Ga0501043_0068317 Ga0501043_0068317_1930_2577 215
1205 3300049579 Ga0501043_0096161 Ga0501043_0096161_1528_2178 215
1206 3300049579 Ga0501043_0155234 Ga0501043_0155234_488_1153 215
1207 3300049580 Ga0501046_0010893 Ga0501046_0010893_6220_6891 215
1208 3300049581 Ga0501047_0002262 Ga0501047_0002262_1641_2312 215
1209 3300049581 Ga0501047_0326279 Ga0501047_0326279_93_758 215
1210 3300049581 Ga0501047_0378910 Ga0501047_0378910_146_796 215
1211 3300049581 Ga0501047_0778165 Ga0501047_0778165_84_749 215
1212 3300049584 Ga0501068_0036486 Ga0501068_0036486_941_1597 215
1213 3300049586 Ga0501070_0063339 Ga0501070_0063339_1453_2106 215
1214 3300049586 Ga0501070_0073982 Ga0501070_0073982_1359_2030 215
1215 3300049586 Ga0501070_0418080 Ga0501070_0418080_301_966 215
1216 3300049588 Ga0501072_0462128 Ga0501072_0462128_239_895 215
1217 3300049589 Ga0501073_0058616 Ga0501073_0058616_1926_2597 215
1218 3300049590 Ga0501074_0057085 Ga0501074_0057085_516_1187 215
1219 3300049652 Ga0501202_004058 Ga0501202_004058_926_1576 215
1220 3300049652 Ga0501202_031722 Ga0501202_031722_134_781 215
1221 3300049663 Ga0501223_019582 Ga0501223_019582_212_862 215
1222 3300049669 Ga0501235_013210 Ga0501235_013210_107_757 215
1223 3300049704 Ga0501221_060809 Ga0501221_060809_67_714 215
1224 3300049705 Ga0501225_0021105 Ga0501225_0021105_431_1081 215
1225 3300049741 Ga0501079_0444552 Ga0501079_0444552_92_763 215
1226 3300049742 Ga0501080_0064884 Ga0501080_0064884_1550_2221 215
1227 3300049763 Ga0501266_011754 Ga0501266_011754_456_1106 215
1228 3300049822 Ga0501035_0018008 Ga0501035_0018008_4977_5630 215
1229 3300049822 Ga0501035_0025624 Ga0501035_0025624_3756_4412 215
1230 3300049822 Ga0501035_0206525 Ga0501035_0206525_92_763 215
1231 3300049823 Ga0501044_0065549 Ga0501044_0065549_2269_2934 215
1232 3300049823 Ga0501044_0576252 Ga0501044_0576252_32_682 215
1233 3300049824 Ga0501045_0126116 Ga0501045_0126116_241_912 215
1234 3300050493 nmdc:mga0k408_120615_c1 nmdc:mga0k408_120615_c1_197_862 215
1235 3300050507 nmdc:mga05p37_145085_c1 nmdc:mga05p37_145085_c1_1957_2613 215
1236 3300050508 nmdc:mga09592_11480_c1 nmdc:mga09592_11480_c1_351_1022 215
1237 3300050508 nmdc:mga09592_27033_c1 nmdc:mga09592_27033_c1_3673_4329 215
1238 3300050508 nmdc:mga09592_42061_c1 nmdc:mga09592_42061_c1_635_1300 215
1239 3300050510 nmdc:mga06r32_51640_c1 nmdc:mga06r32_51640_c1_1571_2227 215
1240 3300050511 nmdc:mga08y16_104126_c1 nmdc:mga08y16_104126_c1_1676_2338 215
1241 3300050511 nmdc:mga08y16_178907_c1 nmdc:mga08y16_178907_c1_743_1414 215
1242 3300053085 Ga0495619_0050828 Ga0495619_0050828_1499_2158 215
1243 3300053087 Ga0500643_026965 Ga0500643_026965_454_1137 215
1244 3300053087 Ga0500643_084142 Ga0500643_084142_150_803 215
1245 3300053088 Ga0500644_0028808 Ga0500644_0028808_106_759 215
1246 3300053090 Ga0500646_0007425 Ga0500646_0007425_2046_2699 215
1247 3300053108 Ga0500562_000036 Ga0500562_000036_10648_11301 215
1248 3300053118 Ga0500594_0014966 Ga0500594_0014966_112_765 215
1249 3300053139 Ga0500568_0037481 Ga0500568_0037481_62_745 215
1250 3300053146 Ga0500588_0004743 Ga0500588_0004743_529_1191 215
1251 3300053151 Ga0500604_0001825 Ga0500604_0001825_5099_5773 215
1252 3300053153 Ga0500616_0019418 Ga0500616_0019418_1377_2039 215
1253 3300053156 Ga0500622_0000484 Ga0500622_0000484_11031_11681 215
1254 3300053156 Ga0500622_0001151 Ga0500622_0001151_10733_11416 215
1255 3300053178 Ga0500637_0166241 Ga0500637_0166241_380_1060 215
1256 3300053727 Ga0500611_000018 Ga0500611_000018_5833_6510 215
1257 3300053730 Ga0500645_009647 Ga0500645_009647_1131_1784 215
1258 3300054114 Ga0501084_0267362 Ga0501084_0267362_709_1380 215
1259 3300055283 Ga0500661_015042 Ga0500661_015042_423_1076 215
1260 3300059624 Ga0587109_039515 Ga0587109_039515_228_875 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

43

229

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7798 1 201
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.76 3 206
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.7493 1 201
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.744 3 206
6yxa-assembly1.cif.gz_A-2 structure of the bifunctional rel enzyme from b. subtilis 0.3775 56 159
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7534 10 192 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7424 10 192 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7254 10 192 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7152 10 192 1.10.1760.20
af_I1KG51_268_372_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.5559 3 126 1.20.58.1220
ID Description Score Start End GO Terms
AF-A0A1I0MYY8-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9389 1 204 GO:0005886
GO:0008654
GO:0043772
AF-A0A4V1ZZ72-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9353 1 121 GO:0005886
GO:0008654
GO:0043772
AF-A0A2T6ENC9-F1-model_v4 deleted 0.935 1 122
AF-A0A380DR25-F1-model_v4 Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY (EC 2.3.1.-) 0.931 1 133 GO:0005886
GO:0008654
GO:0043772
AF-A0A7V1RH82-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9252 3 201 GO:0004366
GO:0005886
GO:0008654
GO:0043772

Feature Viewer

pLDDT pTM Quality
87.2 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map