F492275

General Info

Members Datasets Scaffolds Average Seq Length
1258 375 1236 261

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10396901|Ga0307516_103969012
Length 260
Sequence MNIPTMAEMVNKGETPEILFWVGCAGSFDDRYKRVTRAFTSILNALEVKFAVLGTEETCTGDPARRAGNEFLFQMQAMGNIQVLNGYGIKKIVTACPHCFNTLKNEYPDLGGDYEVIHHSTFLQELIDSGKLKFDGGPFKGKKITYHDSCFLGRANNIYEAPRSVLEALDADLVEMKRSRKTGLCCGAGGGQMFKEPESGKKDINIERTEEALATGASTIAVACPFCMTMMSDGIKNKEKEQEIKVKDLAELIAEAKGLT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
9 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
10 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
11 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
12 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
13 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
14 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
15 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
16 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
17 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
18 2914759650 Rhizosphaericola mali Isolate Rhizosphere
19 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
20 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
21 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
22 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
23 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
258 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
262 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
263 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
314 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
333 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
334 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
335 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
336 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
337 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
341 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
344 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
351 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
352 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
353 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
354 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
355 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
356 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
357 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
358 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
361 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
366 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
367 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
370 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
371 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
372 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.93
Metatranscriptomes 0.24
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.76
Nodule 0
Rhizoplane 0.79
Rhizosphere 86.88
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1496964 2162886007 Bacteria 130484
2 JGI24740J21852_10002421 3300001979 Bacteria 8480
3 JGI24740J21852_10025974 3300001979 Bacteria 1967
4 JGI24739J22299_10003460 3300001989 Bacteria 6019
5 JGI24744J21845_10015297 3300002077 Bacteria 1533
6 JGI24751J29686_10001005 3300002459 Bacteria 6184
7 JGI25154J39366_1000008 3300002738 Bacteria 315375
8 JGI25153J46596_10015194 3300003215 Bacteria 3152
9 rootH1_10055331 3300003316 Bacteria 13942
10 rootH2_10011844 3300003320 Bacteria 47214
11 rootH2_10042039 3300003320 Bacteria 5114
12 rootH2_10182038 3300003320 Bacteria 3612
13 rootL2_10014879 3300003322 Bacteria 9679
14 rootL2_10036963 3300003322 Bacteria 2904
15 rootL2_10038788 3300003322 Bacteria 6903
16 rootL2_10060235 3300003322 Bacteria 3774
17 rootL2_10218651 3300003322 Bacteria 2034
18 rootL2_10254425 3300003322 Bacteria 3119
19 rootH1_10002440 3300003323 Bacteria 15342
20 rootH1_10003895 3300003316 Bacteria 5975
21 rootH1_10003895 3300003323 Bacteria 2763
22 rootH1_10009220 3300003323 Bacteria 22214
23 rootH1_10025005 3300003323 Bacteria 27131
24 rootH1_10026366 3300003323 Bacteria 5497
25 rootH1_10044057 3300003323 Bacteria 2006
26 rootH1_10046814 3300003323 Bacteria 14858
27 rootH1_10163906 3300003323 Bacteria 2355
28 rootH1_10227635 3300003323 Bacteria 2538
29 rootH1_10355453 3300003323 Unclassified 1296
30 JGI25160J50197_1001859 3300003354 Bacteria 10131
31 JGI25160J50197_1002751 3300003354 Bacteria 8066
32 JGI25160J50197_1008132 3300003354 Bacteria 4025
33 JGI25160J50197_1016930 3300003354 Bacteria 2329
34 Ga0055535_1007531 3300003761 Bacteria 2068
35 Ga0055542_1001813 3300003762 Bacteria 8800
36 Ga0055526_1057620 3300003771 Bacteria 845
37 Ga0055536_1014404 3300003781 Bacteria 2780
38 Ga0055528_1000434 3300003790 Bacteria 33559
39 Ga0055530_10002451 3300003791 Bacteria 11926
40 Ga0055531_10000145 3300003794 Bacteria 81767
41 Ga0058863_11501916 3300004799 Bacteria 2795
42 Ga0058861_11625277 3300004800 Bacteria 2605
43 Ga0058862_12122275 3300004803 Bacteria 1524
44 Ga0065165_1000012 3300005262 Bacteria 303241
45 Ga0065165_1000538 3300005262 Bacteria 57448
46 Ga0065704_10070178 3300005289 Bacteria 132449
47 Ga0065704_10150728 3300005289 Bacteria 1431
48 Ga0065712_10022575 3300005290 Bacteria 1457
49 Ga0065712_10026502 3300005290 Bacteria 1392
50 Ga0065712_10080017 3300005290 Bacteria 3148
51 Ga0065715_10145992 3300005293 Bacteria 1769
52 Ga0065707_10188054 3300005295 Bacteria 1377
53 Ga0070658_10078668 3300005327 Bacteria 2707
54 Ga0070658_10106986 3300005327 Bacteria 2314
55 Ga0070658_10144629 3300005327 Bacteria 1987
56 Ga0070658_10171519 3300005327 Bacteria 1822
57 Ga0070658_10222318 3300005327 Bacteria 1597
58 Ga0070658_10293491 3300005327 Bacteria 1386
59 Ga0070676_10001097 3300005328 Bacteria 13523
60 Ga0070676_10001862 3300005328 Bacteria 10739
61 Ga0070676_10238920 3300005328 Bacteria 1207
62 Ga0070683_100000211 3300005329 Bacteria 39486
63 Ga0070683_100003981 3300005329 Bacteria 12096
64 Ga0070683_100104126 3300005329 Bacteria 2674
65 Ga0070683_100312727 3300005329 Bacteria 1495
66 Ga0070690_100014268 3300005330 Bacteria 4712
67 Ga0070690_100066291 3300005330 Unclassified 2337
68 Ga0070690_100193665 3300005330 Bacteria 1411
69 Ga0070690_100241802 3300005330 Bacteria 1273
70 Ga0070670_100024858 3300005331 Bacteria 5153
71 Ga0070670_100051716 3300005331 Bacteria 3528
72 Ga0070670_100059876 3300005331 Bacteria 3268
73 Ga0070670_100066625 3300005331 Bacteria 3090
74 Ga0070670_100069204 3300005331 Bacteria 3030
75 Ga0070670_100118734 3300005331 Bacteria 2281
76 Ga0070670_100131414 3300005331 Bacteria 2162
77 Ga0070670_100131755 3300005331 Bacteria 2159
78 Ga0070670_100153735 3300005331 Bacteria 1992
79 Ga0070670_100158760 3300005331 Bacteria 1959
80 Ga0070677_10265636 3300005333 Bacteria 858
81 Ga0068869_100003189 3300005334 Bacteria 10019
82 Ga0068869_100044406 3300005334 Bacteria 3196
83 Ga0068869_100046935 3300005334 Bacteria 3117
84 Ga0068869_100055434 3300005334 Unclassified 2889
85 Ga0068869_100096571 3300005334 Bacteria 2231
86 Ga0068869_100523582 3300005334 Bacteria 993
87 Ga0070666_10000494 3300005335 Bacteria 23741
88 Ga0070666_10007048 3300005335 Bacteria 6929
89 Ga0070666_10018002 3300005335 Bacteria 4534
90 Ga0070666_10046730 3300005335 Bacteria 2905
91 Ga0070666_10102400 3300005335 Bacteria 1975
92 Ga0070666_10107213 3300005335 Bacteria 1930
93 Ga0070666_10114691 3300005335 Bacteria 1865
94 Ga0070666_10221787 3300005335 Unclassified 1334
95 Ga0070666_10258854 3300005335 Unclassified 1233
96 Ga0070680_100029490 3300005336 Bacteria 4407
97 Ga0070680_100063713 3300005336 Bacteria 3020
98 Ga0070680_100177809 3300005336 Unclassified 1792
99 Ga0070682_100000839 3300005337 Bacteria 17934
100 Ga0070682_100014031 3300005337 Bacteria 4623
101 Ga0070682_100023486 3300005337 Bacteria 3660
102 Ga0070682_100034117 3300005337 Bacteria 3096
103 Ga0070682_100136595 3300005337 Bacteria 1666
104 Ga0068868_100006735 3300005338 Bacteria 8157
105 Ga0068868_100028228 3300005338 Bacteria 4288
106 Ga0068868_100038859 3300005338 Bacteria 3694
107 Ga0068868_100041817 3300005338 Bacteria 3572
108 Ga0068868_100045008 3300005338 Bacteria 3452
109 Ga0068868_100053100 3300005338 Bacteria 3192
110 Ga0068868_100119984 3300005338 Bacteria 2144
111 Ga0068868_100159045 3300005338 Bacteria 1865
112 Ga0068868_100189141 3300005338 Bacteria 1711
113 Ga0068868_100233219 3300005338 Bacteria 1544
114 Ga0070660_100007919 3300005339 Bacteria 7413
115 Ga0070660_100008806 3300005339 Bacteria 7070
116 Ga0070660_100010345 3300005339 Bacteria 6590
117 Ga0070660_100025573 3300005339 Bacteria 4389
118 Ga0070660_100036738 3300005339 Bacteria 3712
119 Ga0070660_100108028 3300005339 Bacteria 2211
120 Ga0070660_100196694 3300005339 Bacteria 1634
121 Ga0070660_100586598 3300005339 Bacteria 931
122 Ga0070689_100004082 3300005340 Bacteria 9834
123 Ga0070689_100013502 3300005340 Bacteria 5913
124 Ga0070689_100040741 3300005340 Bacteria 3562
125 Ga0070689_100138841 3300005340 Bacteria 1953
126 Ga0070687_100076672 3300005343 Bacteria 1811
127 Ga0070661_100006697 3300005344 Bacteria 7947
128 Ga0070661_100007080 3300005344 Bacteria 7738
129 Ga0070661_100090405 3300005344 Bacteria 2267
130 Ga0070661_100123091 3300005344 Bacteria 1944
131 Ga0070668_100010123 3300005347 Bacteria 6990
132 Ga0070668_100058702 3300005347 Bacteria 2977
133 Ga0070668_100541666 3300005347 Bacteria 1012
134 Ga0070669_100002091 3300005353 Bacteria 14439
135 Ga0070669_100084745 3300005353 Bacteria 2366
136 Ga0070669_100134446 3300005353 Bacteria 1901
137 Ga0070669_100178617 3300005353 Bacteria 1659
138 Ga0070669_100301974 3300005353 Bacteria 1288
139 Ga0070675_100005185 3300005354 Bacteria 9936
140 Ga0070675_100133043 3300005354 Bacteria 2121
141 Ga0070675_100152521 3300005354 Bacteria 1982
142 Ga0070675_100185965 3300005354 Bacteria 1798
143 Ga0070675_100505944 3300005354 Bacteria 1089
144 Ga0070671_100010922 3300005355 Bacteria 7293
145 Ga0070671_100014470 3300005355 Bacteria 6377
146 Ga0070671_100032531 3300005355 Bacteria 4312
147 Ga0070671_100104256 3300005355 Bacteria 2380
148 Ga0070671_100142262 3300005355 Unclassified 2024
149 Ga0070671_100174876 3300005355 Bacteria 1816
150 Ga0070674_100036943 3300005356 Unclassified 3283
151 Ga0070674_100056548 3300005356 Bacteria 2721
152 Ga0070674_100074879 3300005356 Bacteria 2403
153 Ga0070674_100154435 3300005356 Bacteria 1735
154 Ga0070674_100169844 3300005356 Bacteria 1661
155 Ga0070674_100208115 3300005356 Bacteria 1514
156 Ga0070673_100007156 3300005364 Bacteria 7331
157 Ga0070673_100008683 3300005364 Bacteria 6774
158 Ga0070673_100011359 3300005364 Bacteria 6077
159 Ga0070673_100012291 3300005364 Bacteria 5874
160 Ga0070673_100014508 3300005364 Bacteria 5492
161 Ga0070673_100027495 3300005364 Bacteria 4218
162 Ga0070673_100057579 3300005364 Unclassified 3070
163 Ga0070673_100293741 3300005364 Bacteria 1429
164 Ga0070688_100012960 3300005365 Bacteria 4689
165 Ga0070688_100052920 3300005365 Unclassified 2538
166 Ga0070688_100461733 3300005365 Bacteria 951
167 Ga0070659_100009607 3300005366 Bacteria 7109
168 Ga0070659_100016082 3300005366 Bacteria 5613
169 Ga0070659_100115822 3300005366 Bacteria 2166
170 Ga0070659_100148669 3300005366 Bacteria 1910
171 Ga0070659_100378472 3300005366 Bacteria 1192
172 Ga0070667_100002118 3300005367 Bacteria 17495
173 Ga0070667_100012244 3300005367 Bacteria 7096
174 Ga0070667_100061418 3300005367 Unclassified 3182
175 Ga0070667_100207792 3300005367 Bacteria 1739
176 Ga0070667_100216469 3300005367 Bacteria 1704
177 Ga0070667_100297295 3300005367 Bacteria 1453
178 Ga0070700_100165919 3300005441 Bacteria 1525
179 Ga0070663_100195682 3300005455 Bacteria 1575
180 Ga0070663_100239119 3300005455 Bacteria 1433
181 Ga0070663_100658707 3300005455 Bacteria 886
182 Ga0070678_100078934 3300005456 Bacteria 2488
183 Ga0070678_100084512 3300005456 Bacteria 2416
184 Ga0070678_100127346 3300005456 Bacteria 2018
185 Ga0070678_100170142 3300005456 Bacteria 1774
186 Ga0070678_100245525 3300005456 Bacteria 1499
187 Ga0070662_100002740 3300005457 Bacteria 10892
188 Ga0070662_100002963 3300005457 Bacteria 10548
189 Ga0070662_100026249 3300005457 Bacteria 4033
190 Ga0070662_100037593 3300005457 Bacteria 3433
191 Ga0070681_10022138 3300005458 Bacteria 6378
192 Ga0070681_10035520 3300005458 Bacteria 5008
193 Ga0070681_10040115 3300005458 Bacteria 4694
194 Ga0070681_10042587 3300005458 Bacteria 4549
195 Ga0070681_10058368 3300005458 Bacteria 3838
196 Ga0070681_10083510 3300005458 Bacteria 3147
197 Ga0068867_100012907 3300005459 Bacteria 5911
198 Ga0068867_100026915 3300005459 Unclassified 4132
199 Ga0068867_100123570 3300005459 Unclassified 2003
200 Ga0068867_100225485 3300005459 Bacteria 1512
201 Ga0068867_100735824 3300005459 Bacteria 874
202 Ga0070685_10013516 3300005466 Bacteria 4306
203 Ga0070685_10086583 3300005466 Bacteria 1889
204 Ga0070685_10178672 3300005466 Bacteria 1365
205 Ga0070685_10306769 3300005466 Bacteria 1071
206 Ga0070707_100153722 3300005468 Bacteria 2241
207 Ga0070698_100002098 3300005471 Bacteria 22130
208 Ga0070679_100000723 3300005530 Bacteria 28502
209 Ga0070679_100001843 3300005530 Bacteria 19045
210 Ga0070679_100011352 3300005530 Bacteria 8489
211 Ga0070679_100122541 3300005530 Bacteria 2584
212 Ga0070679_100189299 3300005530 Bacteria 2027
213 Ga0070679_100281455 3300005530 Bacteria 1616
214 Ga0070679_100326678 3300005530 Bacteria 1483
215 Ga0070684_100000568 3300005535 Bacteria 25497
216 Ga0070684_100006999 3300005535 Bacteria 8761
217 Ga0070684_100018337 3300005535 Bacteria 5764
218 Ga0070684_100025026 3300005535 Bacteria 5012
219 Ga0070684_100078655 3300005535 Bacteria 2914
220 Ga0070684_100143033 3300005535 Bacteria 2164
221 Ga0068853_100015015 3300005539 Bacteria 6362
222 Ga0068853_100020902 3300005539 Bacteria 5446
223 Ga0068853_100032600 3300005539 Bacteria 4414
224 Ga0068853_100039686 3300005539 Bacteria 4016
225 Ga0068853_100040732 3300005539 Bacteria 3965
226 Ga0068853_100041327 3300005539 Bacteria 3938
227 Ga0068853_100051928 3300005539 Bacteria 3530
228 Ga0068853_100084001 3300005539 Bacteria 2790
229 Ga0068853_100088973 3300005539 Bacteria 2711
230 Ga0068853_100123171 3300005539 Bacteria 2315
231 Ga0068853_100237648 3300005539 Bacteria 1669
232 Ga0070672_100021588 3300005543 Bacteria 4715
233 Ga0070672_100056638 3300005543 Bacteria 3075
234 Ga0070672_100099984 3300005543 Bacteria 2352
235 Ga0070672_100127800 3300005543 Bacteria 2086
236 Ga0070672_100164049 3300005543 Bacteria 1845
237 Ga0070672_100326363 3300005543 Bacteria 1305
238 Ga0070686_100168186 3300005544 Bacteria 1549
239 Ga0070686_100185447 3300005544 Bacteria 1481
240 Ga0070665_100000009 3300005548 Bacteria 562640
241 Ga0070665_100000032 3300005548 Bacteria 333352
242 Ga0070665_100007337 3300005548 Bacteria 11216
243 Ga0070665_100069649 3300005548 Bacteria 3526
244 Ga0070665_100235692 3300005548 Bacteria 1831
245 Ga0068855_100004190 3300005563 Bacteria 17595
246 Ga0068855_100004378 3300005563 Bacteria 17254
247 Ga0068855_100037651 3300005563 Bacteria 5751
248 Ga0068855_100096879 3300005563 Bacteria 3398
249 Ga0068855_100149470 3300005563 Bacteria 2656
250 Ga0068855_100216265 3300005563 Bacteria 2151
251 Ga0068855_100300962 3300005563 Bacteria 1776
252 Ga0070664_100003902 3300005564 Bacteria 12033
253 Ga0070664_100038086 3300005564 Bacteria 4046
254 Ga0070664_100046301 3300005564 Bacteria 3673
255 Ga0070664_100060152 3300005564 Bacteria 3234
256 Ga0070664_100209697 3300005564 Bacteria 1741
257 Ga0070664_100213665 3300005564 Unclassified 1724
258 Ga0070664_100229237 3300005564 Bacteria 1665
259 Ga0068857_100019417 3300005577 Bacteria 5967
260 Ga0068857_100120806 3300005577 Bacteria 2359
261 Ga0068857_100232384 3300005577 Bacteria 1687
262 Ga0068857_100505375 3300005577 Bacteria 1135
263 Ga0068854_100007154 3300005578 Bacteria 7128
264 Ga0068854_100010782 3300005578 Bacteria 5930
265 Ga0068854_100047797 3300005578 Bacteria 3050
266 Ga0068854_100076232 3300005578 Bacteria 2464
267 Ga0068854_100122753 3300005578 Unclassified 1974
268 Ga0068854_100244134 3300005578 Unclassified 1431
269 Ga0068854_100247391 3300005578 Bacteria 1422
270 Ga0068854_100347392 3300005578 Bacteria 1213
271 Ga0068856_100010769 3300005614 Bacteria 8881
272 Ga0068856_100021551 3300005614 Bacteria 6263
273 Ga0068856_100022647 3300005614 Bacteria 6108
274 Ga0068856_100029089 3300005614 Bacteria 5398
275 Ga0068856_100101482 3300005614 Bacteria 2870
276 Ga0068856_100169939 3300005614 Bacteria 2192
277 Ga0070702_100018678 3300005615 Bacteria 3601
278 Ga0068852_100000563 3300005616 Bacteria 24454
279 Ga0068852_100001109 3300005616 Bacteria 17756
280 Ga0068852_100003236 3300005616 Bacteria 11371
281 Ga0068852_100024963 3300005616 Bacteria 4837
282 Ga0068852_100046492 3300005616 Bacteria 3699
283 Ga0068852_100152109 3300005616 Bacteria 2153
284 Ga0068852_100310184 3300005616 Bacteria 1529
285 Ga0068852_100439524 3300005616 Bacteria 1289
286 Ga0068852_100492592 3300005616 Bacteria 1219
287 Ga0068852_100860810 3300005616 Bacteria 922
288 Ga0068859_100000186 3300005617 Bacteria 60206
289 Ga0068859_100009061 3300005617 Bacteria 10051
290 Ga0068859_100012192 3300005617 Bacteria 8641
291 Ga0068859_100014826 3300005617 Bacteria 7828
292 Ga0068859_100028632 3300005617 Bacteria 5586
293 Ga0068859_100029379 3300005617 Bacteria 5516
294 Ga0068859_100104576 3300005617 Bacteria 2890
295 Ga0068859_100270488 3300005617 Unclassified 1791
296 Ga0068859_100471794 3300005617 Bacteria 1350
297 Ga0068859_100477711 3300005617 Unclassified 1342
298 Ga0068864_100011587 3300005618 Bacteria 7281
299 Ga0068864_100091472 3300005618 Bacteria 2684
300 Ga0068864_100109092 3300005618 Bacteria 2463
301 Ga0068864_100140134 3300005618 Bacteria 2181
302 Ga0068864_100343205 3300005618 Bacteria 1407
303 Ga0068864_100348227 3300005618 Unclassified 1397
304 Ga0068864_100431453 3300005618 Bacteria 1257
305 Ga0068864_100435503 3300005618 Bacteria 1251
306 Ga0068866_10049578 3300005718 Bacteria 2128
307 Ga0068866_10471689 3300005718 Unclassified 825
308 Ga0068861_100003838 3300005719 Bacteria 10031
309 Ga0068861_100015284 3300005719 Bacteria 5406
310 Ga0068861_100018566 3300005719 Bacteria 4954
311 Ga0068851_10172784 3300005834 Unclassified 1193
312 Ga0068851_10198439 3300005834 Bacteria 1119
313 Ga0068851_10232301 3300005834 Bacteria 1040
314 Ga0068870_10092657 3300005840 Bacteria 1692
315 Ga0068863_100005438 3300005841 Bacteria 12547
316 Ga0068863_100010031 3300005841 Bacteria 9218
317 Ga0068863_100054873 3300005841 Bacteria 3775
318 Ga0068863_100137008 3300005841 Bacteria 2339
319 Ga0068863_100147666 3300005841 Bacteria 2249
320 Ga0068863_100230708 3300005841 Unclassified 1785
321 Ga0068863_100310907 3300005841 Unclassified 1530
322 Ga0068863_100355766 3300005841 Bacteria 1427
323 Ga0068863_100638635 3300005841 Bacteria 1055
324 Ga0068858_100034101 3300005842 Bacteria 4721
325 Ga0068858_100055774 3300005842 Bacteria 3653
326 Ga0068860_100000103 3300005843 Bacteria 139076
327 Ga0068860_100007278 3300005843 Bacteria 11071
328 Ga0068860_100008158 3300005843 Bacteria 10426
329 Ga0068860_100015108 3300005843 Bacteria 7546
330 Ga0068860_100023114 3300005843 Bacteria 6012
331 Ga0068860_100061503 3300005843 Bacteria 3568
332 Ga0068860_100108739 3300005843 Bacteria 2650
333 Ga0068860_100118158 3300005843 Bacteria 2538
334 Ga0068860_100126114 3300005843 Bacteria 2454
335 Ga0068860_100175252 3300005843 Bacteria 2072
336 Ga0068860_100208123 3300005843 Bacteria 1897
337 Ga0068860_100364162 3300005843 Bacteria 1425
338 Ga0068860_100381874 3300005843 Bacteria 1391
339 Ga0068862_100008262 3300005844 Bacteria 8611
340 Ga0068862_100033405 3300005844 Bacteria 4349
341 Ga0068862_100064862 3300005844 Bacteria 3145
342 Ga0068862_100131918 3300005844 Bacteria 2210
343 Ga0081540_1021508 3300005983 Bacteria 3837
344 Ga0081539_10001436 3300005985 Bacteria 40812
345 Ga0075366_10043379 3300006195 Bacteria 2664
346 Ga0075366_10066624 3300006195 Bacteria 2143
347 Ga0075366_10113768 3300006195 Bacteria 1629
348 Ga0075366_10190833 3300006195 Bacteria 1245
349 Ga0097621_100000262 3300006237 Bacteria 35568
350 Ga0097621_100004436 3300006237 Bacteria 9770
351 Ga0097621_100016613 3300006237 Bacteria 5568
352 Ga0097621_100035111 3300006237 Bacteria 4004
353 Ga0097621_100052642 3300006237 Bacteria 3317
354 Ga0097621_100067639 3300006237 Bacteria 2945
355 Ga0097621_100069959 3300006237 Bacteria 2898
356 Ga0097621_100285776 3300006237 Bacteria 1453
357 Ga0097621_100443712 3300006237 Unclassified 1168
358 Ga0068871_100000063 3300006358 Bacteria 58377
359 Ga0068871_100020662 3300006358 Bacteria 5048
360 Ga0068871_100045193 3300006358 Unclassified 3544
361 Ga0068871_100050289 3300006358 Bacteria 3371
362 Ga0068871_100072907 3300006358 Bacteria 2829
363 Ga0068871_100073458 3300006358 Unclassified 2820
364 Ga0068871_100102663 3300006358 Bacteria 2397
365 Ga0068871_100143196 3300006358 Bacteria 2034
366 Ga0068871_100188926 3300006358 Bacteria 1774
367 Ga0068871_100249250 3300006358 Bacteria 1546
368 Ga0068871_100281803 3300006358 Unclassified 1454
369 Ga0068871_100575784 3300006358 Bacteria 1022
370 Ga0075428_100002349 3300006844 Bacteria 20539
371 Ga0075428_100008703 3300006844 Bacteria 11259
372 Ga0075428_100020591 3300006844 Bacteria 7304
373 Ga0075430_100010476 3300006846 Bacteria 7851
374 Ga0075430_100069014 3300006846 Bacteria 2966
375 Ga0075430_100248528 3300006846 Bacteria 1474
376 Ga0075431_100001800 3300006847 Bacteria 20232
377 Ga0075431_100035126 3300006847 Bacteria 5162
378 Ga0075431_100162372 3300006847 Bacteria 2297
379 Ga0075429_100004013 3300006880 Bacteria 12599
380 Ga0075429_100022149 3300006880 Bacteria 5512
381 Ga0068865_100000704 3300006881 Bacteria 18817
382 Ga0097620_100000186 3300006931 Bacteria 60206
383 Ga0097620_100009061 3300006931 Bacteria 10051
384 Ga0097620_100012190 3300006931 Bacteria 8641
385 Ga0097620_100014825 3300006931 Bacteria 7828
386 Ga0097620_100028632 3300006931 Bacteria 5586
387 Ga0097620_100029379 3300006931 Bacteria 5516
388 Ga0097620_100104574 3300006931 Bacteria 2890
389 Ga0097620_100270503 3300006931 Unclassified 1791
390 Ga0097620_100471804 3300006931 Bacteria 1350
391 Ga0097620_100477720 3300006931 Unclassified 1342
392 Ga0105251_10086077 3300009011 Unclassified 1448
393 Ga0105240_10000131 3300009093 Bacteria 154386
394 Ga0105240_10000173 3300009093 Bacteria 131281
395 Ga0105240_10000194 3300009093 Bacteria 123394
396 Ga0105240_10011235 3300009093 Bacteria 12485
397 Ga0105240_10012925 3300009093 Bacteria 11499
398 Ga0105240_10021663 3300009093 Bacteria 8544
399 Ga0105240_10026039 3300009093 Bacteria 7681
400 Ga0105240_10055254 3300009093 Bacteria 4972
401 Ga0105240_10056004 3300009093 Bacteria 4935
402 Ga0105240_10074250 3300009093 Bacteria 4198
403 Ga0105240_10093952 3300009093 Bacteria 3659
404 Ga0105240_10179332 3300009093 Bacteria 2501
405 Ga0105240_10249085 3300009093 Bacteria 2056
406 Ga0105240_10318249 3300009093 Bacteria 1774
407 Ga0105240_10458175 3300009093 Bacteria 1426
408 Ga0111539_10003454 3300009094 Bacteria 20812
409 Ga0111539_10009405 3300009094 Bacteria 12333
410 Ga0111539_10242929 3300009094 Unclassified 2096
411 Ga0111539_10400481 3300009094 Bacteria 1599
412 Ga0111539_10879248 3300009094 Bacteria 1042
413 Ga0105245_10431448 3300009098 Bacteria 1323
414 Ga0105247_10003642 3300009101 Bacteria 10008
415 Ga0105247_10006330 3300009101 Bacteria 7333
416 Ga0105247_10042855 3300009101 Bacteria 2772
417 Ga0114129_10130029 3300009147 Bacteria 3459
418 Ga0105243_10118455 3300009148 Bacteria 2228
419 Ga0105243_10350961 3300009148 Bacteria 1354
420 Ga0105243_10920112 3300009148 Bacteria 871
421 Ga0105241_10007177 3300009174 Bacteria 8201
422 Ga0105241_10007203 3300009174 Bacteria 8185
423 Ga0105241_10031420 3300009174 Bacteria 3976
424 Ga0105241_10064593 3300009174 Bacteria 2826
425 Ga0105241_10068977 3300009174 Bacteria 2741
426 Ga0105241_10095327 3300009174 Bacteria 2355
427 Ga0105241_10194874 3300009174 Bacteria 1689
428 Ga0105242_10016017 3300009176 Bacteria 5824
429 Ga0105242_10026648 3300009176 Bacteria 4582
430 Ga0105242_10167145 3300009176 Bacteria 1930
431 Ga0105242_10224296 3300009176 Bacteria 1681
432 Ga0105242_10297766 3300009176 Bacteria 1471
433 Ga0105242_10550028 3300009176 Bacteria 1106
434 Ga0105242_10757227 3300009176 Bacteria 957
435 Ga0105248_10174430 3300009177 Bacteria 2423
436 Ga0105248_10469247 3300009177 Bacteria 1419
437 Ga0105248_10481803 3300009177 Bacteria 1398
438 Ga0105237_10000928 3300009545 Bacteria 39475
439 Ga0105237_10001232 3300009545 Bacteria 34099
440 Ga0105237_10001508 3300009545 Bacteria 30617
441 Ga0105237_10005887 3300009545 Bacteria 13747
442 Ga0105237_10009764 3300009545 Bacteria 10266
443 Ga0105237_10017711 3300009545 Bacteria 7384
444 Ga0105237_10035264 3300009545 Bacteria 5062
445 Ga0105237_10052271 3300009545 Bacteria 4102
446 Ga0105237_10066269 3300009545 Bacteria 3606
447 Ga0105237_10086981 3300009545 Bacteria 3115
448 Ga0105237_10199158 3300009545 Bacteria 2002
449 Ga0105237_10228932 3300009545 Bacteria 1859
450 Ga0105237_10243597 3300009545 Bacteria 1799
451 Ga0105238_10004908 3300009551 Bacteria 13235
452 Ga0105238_10053480 3300009551 Bacteria 4057
453 Ga0105238_10064372 3300009551 Bacteria 3666
454 Ga0105238_10071256 3300009551 Bacteria 3473
455 Ga0105238_10595846 3300009551 Bacteria 1113
456 Ga0105249_10001561 3300009553 Bacteria 20115
457 Ga0105249_10004716 3300009553 Bacteria 11769
458 Ga0105249_10010856 3300009553 Bacteria 8004
459 Ga0105249_10011525 3300009553 Bacteria 7770
460 Ga0105249_10047552 3300009553 Bacteria 3910
461 Ga0105249_10164600 3300009553 Bacteria 2146
462 Ga0105249_10178213 3300009553 Bacteria 2066
463 Ga0105239_10000222 3300010375 Bacteria 83623
464 Ga0105239_10000246 3300010375 Bacteria 80752
465 Ga0105239_10001174 3300010375 Bacteria 35994
466 Ga0105239_10001470 3300010375 Bacteria 31340
467 Ga0105239_10006659 3300010375 Bacteria 13359
468 Ga0105239_10018569 3300010375 Bacteria 7682
469 Ga0105239_10024439 3300010375 Bacteria 6658
470 Ga0105239_10064401 3300010375 Bacteria 4024
471 Ga0105239_10074626 3300010375 Bacteria 3729
472 Ga0105239_10132230 3300010375 Bacteria 2776
473 Ga0105239_10142748 3300010375 Bacteria 2669
474 Ga0105246_10113769 3300011119 Bacteria 1993
475 Ga0157373_10021980 3300013100 Bacteria 4629
476 Ga0157373_10023654 3300013100 Bacteria 4453
477 Ga0157373_10037206 3300013100 Bacteria 3490
478 Ga0157373_10051215 3300013100 Bacteria 2941
479 Ga0157371_10003421 3300013102 Bacteria 14416
480 Ga0157371_10003608 3300013102 Bacteria 13948
481 Ga0157371_10022360 3300013102 Bacteria 4635
482 Ga0157371_10030133 3300013102 Bacteria 3915
483 Ga0157371_10033448 3300013102 Bacteria 3694
484 Ga0157371_10064172 3300013102 Bacteria 2602
485 Ga0157371_10076577 3300013102 Bacteria 2369
486 Ga0157371_10106827 3300013102 Unclassified 1987
487 Ga0157371_10111040 3300013102 Bacteria 1946
488 Ga0157370_10000860 3300013104 Bacteria 38540
489 Ga0157370_10001951 3300013104 Bacteria 25406
490 Ga0157370_10003393 3300013104 Bacteria 18718
491 Ga0157370_10003477 3300013104 Bacteria 18480
492 Ga0157370_10101415 3300013104 Bacteria 2696
493 Ga0157370_10129521 3300013104 Bacteria 2354
494 Ga0157370_10186772 3300013104 Bacteria 1924
495 Ga0157369_10000566 3300013105 Bacteria 48674
496 Ga0157369_10025473 3300013105 Bacteria 6568
497 Ga0157369_10052626 3300013105 Bacteria 4405
498 Ga0157369_10084258 3300013105 Bacteria 3398
499 Ga0157369_10094153 3300013105 Bacteria 3197
500 Ga0157369_10170556 3300013105 Unclassified 2293
501 Ga0157369_10268431 3300013105 Unclassified 1778
502 Ga0157369_10398068 3300013105 Unclassified 1429
503 Ga0157369_10483202 3300013105 Bacteria 1282
504 Ga0157374_10000002 3300013296 Bacteria 1054226
505 Ga0157374_10004275 3300013296 Bacteria 12011
506 Ga0157374_10008376 3300013296 Bacteria 8829
507 Ga0157374_10014583 3300013296 Bacteria 6879
508 Ga0157374_10024342 3300013296 Bacteria 5427
509 Ga0157374_10115391 3300013296 Bacteria 2587
510 Ga0157374_10217981 3300013296 Bacteria 1872
511 Ga0157374_10352697 3300013296 Bacteria 1462
512 Ga0157374_10436586 3300013296 Bacteria 1309
513 Ga0157374_10475786 3300013296 Bacteria 1252
514 Ga0157378_10003418 3300013297 Bacteria 14085
515 Ga0157378_10019947 3300013297 Bacteria 5895
516 Ga0157378_10023060 3300013297 Bacteria 5479
517 Ga0157378_10031977 3300013297 Bacteria 4648
518 Ga0157378_10036858 3300013297 Bacteria 4328
519 Ga0157378_10053382 3300013297 Bacteria 3598
520 Ga0157378_10054357 3300013297 Unclassified 3565
521 Ga0157378_10085627 3300013297 Bacteria 2855
522 Ga0157378_10146489 3300013297 Bacteria 2197
523 Ga0157378_10169072 3300013297 Bacteria 2049
524 Ga0157378_10201193 3300013297 Bacteria 1884
525 Ga0157378_10266013 3300013297 Bacteria 1647
526 Ga0157378_10455207 3300013297 Bacteria 1271
527 Ga0157378_10755168 3300013297 Bacteria 996
528 Ga0163162_10000088 3300013306 Bacteria 85462
529 Ga0163162_10000269 3300013306 Bacteria 47344
530 Ga0163162_10000503 3300013306 Bacteria 36430
531 Ga0163162_10001119 3300013306 Bacteria 24928
532 Ga0163162_10001757 3300013306 Bacteria 20302
533 Ga0163162_10004586 3300013306 Bacteria 13309
534 Ga0163162_10004762 3300013306 Bacteria 13094
535 Ga0163162_10011935 3300013306 Bacteria 8472
536 Ga0163162_10042898 3300013306 Bacteria 4528
537 Ga0163162_10059108 3300013306 Unclassified 3865
538 Ga0163162_10128348 3300013306 Bacteria 2643
539 Ga0163162_10215481 3300013306 Bacteria 2050
540 Ga0163162_10323664 3300013306 Bacteria 1674
541 Ga0163162_10330051 3300013306 Bacteria 1658
542 Ga0163162_10340255 3300013306 Bacteria 1633
543 Ga0163162_10501349 3300013306 Bacteria 1344
544 Ga0163162_10558804 3300013306 Bacteria 1272
545 Ga0163162_10616780 3300013306 Bacteria 1210
546 Ga0163162_10667232 3300013306 Bacteria 1163
547 Ga0163162_10717008 3300013306 Bacteria 1121
548 Ga0157372_10000020 3300013307 Bacteria 208056
549 Ga0157372_10000972 3300013307 Bacteria 31262
550 Ga0157372_10001229 3300013307 Bacteria 27743
551 Ga0157372_10008233 3300013307 Bacteria 11082
552 Ga0157372_10024621 3300013307 Bacteria 6542
553 Ga0157372_10029586 3300013307 Bacteria 5983
554 Ga0157372_10057201 3300013307 Bacteria 4359
555 Ga0157372_10070768 3300013307 Bacteria 3926
556 Ga0157372_10092267 3300013307 Bacteria 3445
557 Ga0157372_10111735 3300013307 Bacteria 3130
558 Ga0157372_10149244 3300013307 Bacteria 2697
559 Ga0157372_10175438 3300013307 Bacteria 2481
560 Ga0157372_10244853 3300013307 Bacteria 2081
561 Ga0157372_10264644 3300013307 Bacteria 1997
562 Ga0157372_10296533 3300013307 Bacteria 1880
563 Ga0157372_10526893 3300013307 Bacteria 1377
564 Ga0157372_10600481 3300013307 Bacteria 1283
565 Ga0157372_10651979 3300013307 Bacteria 1226
566 Ga0157372_11214187 3300013307 Bacteria 871
567 Ga0157375_10000324 3300013308 Bacteria 42877
568 Ga0157375_10005137 3300013308 Bacteria 11365
569 Ga0157375_10011842 3300013308 Bacteria 7714
570 Ga0157375_10083868 3300013308 Bacteria 3233
571 Ga0157375_10087696 3300013308 Bacteria 3164
572 Ga0157375_10087931 3300013308 Bacteria 3161
573 Ga0157375_10117566 3300013308 Unclassified 2764
574 Ga0157375_10129202 3300013308 Bacteria 2645
575 Ga0157375_10232243 3300013308 Bacteria 2003
576 Ga0157375_10254367 3300013308 Bacteria 1918
577 Ga0157375_10260730 3300013308 Bacteria 1895
578 Ga0157375_10294161 3300013308 Bacteria 1787
579 Ga0157375_10460213 3300013308 Bacteria 1437
580 Ga0157375_10747193 3300013308 Bacteria 1130
581 Ga0163163_10000462 3300014325 Bacteria 37124
582 Ga0163163_10000973 3300014325 Bacteria 24371
583 Ga0163163_10163224 3300014325 Bacteria 2274
584 Ga0163163_10218594 3300014325 Bacteria 1954
585 Ga0163163_10518876 3300014325 Bacteria 1254
586 Ga0163163_10631219 3300014325 Bacteria 1135
587 Ga0157380_10039474 3300014326 Bacteria 3672
588 Ga0157380_10101750 3300014326 Bacteria 2395
589 Ga0157380_10430641 3300014326 Bacteria 1261
590 Ga0157380_10907327 3300014326 Bacteria 908
591 Ga0157377_10003472 3300014745 Bacteria 7142
592 Ga0157377_10010978 3300014745 Bacteria 4503
593 Ga0157377_10063284 3300014745 Bacteria 2119
594 Ga0157377_10210471 3300014745 Bacteria 1240
595 Ga0157379_10011042 3300014968 Bacteria 7871
596 Ga0157379_10061033 3300014968 Bacteria 3371
597 Ga0157379_10137811 3300014968 Bacteria 2199
598 Ga0157379_10149734 3300014968 Bacteria 2105
599 Ga0157379_10299480 3300014968 Bacteria 1465
600 Ga0157379_10427214 3300014968 Bacteria 1221
601 Ga0157376_10000482 3300014969 Bacteria 25758
602 Ga0157376_10005255 3300014969 Bacteria 9041
603 Ga0157376_10010084 3300014969 Bacteria 6897
604 Ga0157376_10016550 3300014969 Bacteria 5602
605 Ga0157376_10041114 3300014969 Bacteria 3783
606 Ga0157376_10122620 3300014969 Bacteria 2306
607 Ga0157376_10153759 3300014969 Bacteria 2077
608 Ga0157376_10217687 3300014969 Bacteria 1767
609 Ga0157376_10412714 3300014969 Bacteria 1308
610 Ga0157376_10568163 3300014969 Bacteria 1125
611 Ga0182005_1000141 3300015265 Bacteria 50863
612 Ga0163161_10006237 3300017792 Bacteria 8258
613 Ga0163161_10010065 3300017792 Bacteria 6545
614 Ga0163161_10110674 3300017792 Bacteria 2053
615 Ga0163161_10146204 3300017792 Bacteria 1793
616 Ga0163161_10153297 3300017792 Bacteria 1752
617 Ga0163161_10244592 3300017792 Bacteria 1396
618 Ga0163161_10310724 3300017792 Bacteria 1244
619 Ga0163161_10781619 3300017792 Bacteria 801
620 Ga0213876_10002105 3300021384 Bacteria 11776
621 Ga0213876_10022393 3300021384 Bacteria 3341
622 Ga0209436_102078 3300025208 Bacteria 6286
623 Ga0209436_106646 3300025208 Bacteria 2509
624 Ga0207427_100025 3300025231 Bacteria 433726
625 Ga0209437_100010 3300025233 Bacteria 838447
626 Ga0209258_100251 3300025242 Bacteria 97368
627 Ga0209646_1000045 3300025246 Bacteria 333765
628 Ga0209026_1000075 3300025250 Bacteria 202874
629 Ga0209026_1000388 3300025250 Bacteria 39840
630 Ga0209148_1000226 3300025254 Bacteria 92517
631 Ga0209233_1000017 3300025261 Bacteria 898076
632 Ga0209455_1006935 3300025272 Bacteria 3276
633 Ga0209673_1000515 3300025273 Bacteria 63365
634 Ga0209130_1005524 3300025284 Bacteria 4358
635 Ga0209676_1001025 3300025292 Bacteria 32516
636 Ga0209564_1005082 3300025295 Bacteria 7672
637 Ga0209564_1012230 3300025295 Bacteria 3759
638 Ga0209758_1010293 3300025297 Bacteria 5623
639 Ga0209758_1020297 3300025297 Bacteria 3151
640 Ga0209050_1000887 3300025298 Bacteria 39898
641 Ga0209050_1039965 3300025298 Bacteria 1314
642 Ga0207426_1000019 3300025302 Bacteria 558579
643 Ga0207426_1000073 3300025302 Bacteria 323756
644 Ga0207426_1000159 3300025302 Bacteria 175899
645 Ga0207426_1004429 3300025302 Bacteria 6855
646 Ga0207426_1007405 3300025302 Bacteria 4602
647 Ga0207426_1054419 3300025302 Bacteria 1177
648 Ga0209257_1000013 3300025304 Bacteria 1047305
649 Ga0209257_1002689 3300025304 Bacteria 17008
650 Ga0207697_10110647 3300025315 Bacteria 1176
651 Ga0207656_10048622 3300025321 Bacteria 1827
652 Ga0207656_10157521 3300025321 Bacteria 1079
653 Ga0207642_10023623 3300025899 Bacteria 2459
654 Ga0207710_10007094 3300025900 Bacteria 4754
655 Ga0207710_10061500 3300025900 Bacteria 1704
656 Ga0207680_10000236 3300025903 Bacteria 26619
657 Ga0207680_10075368 3300025903 Bacteria 2104
658 Ga0207680_10075512 3300025903 Unclassified 2102
659 Ga0207680_10117968 3300025903 Bacteria 1732
660 Ga0207680_10531613 3300025903 Bacteria 839
661 Ga0207647_10006080 3300025904 Bacteria 8796
662 Ga0207647_10009470 3300025904 Bacteria 6918
663 Ga0207647_10014191 3300025904 Bacteria 5499
664 Ga0207647_10016241 3300025904 Bacteria 5082
665 Ga0207647_10249925 3300025904 Bacteria 1017
666 Ga0207645_10000672 3300025907 Bacteria 28332
667 Ga0207645_10008320 3300025907 Bacteria 7246
668 Ga0207645_10008581 3300025907 Bacteria 7119
669 Ga0207645_10020979 3300025907 Bacteria 4267
670 Ga0207645_10073351 3300025907 Bacteria 2191
671 Ga0207645_10177282 3300025907 Bacteria 1398
672 Ga0207643_10004789 3300025908 Bacteria 7250
673 Ga0207643_10047850 3300025908 Unclassified 2421
674 Ga0207705_10000043 3300025909 Bacteria 181491
675 Ga0207705_10003539 3300025909 Bacteria 11893
676 Ga0207705_10023722 3300025909 Bacteria 4377
677 Ga0207705_10135110 3300025909 Bacteria 1838
678 Ga0207705_10238420 3300025909 Bacteria 1385
679 Ga0207705_10494944 3300025909 Bacteria 949
680 Ga0207654_10003275 3300025911 Bacteria 8187
681 Ga0207654_10005386 3300025911 Bacteria 6469
682 Ga0207654_10077335 3300025911 Bacteria 1994
683 Ga0207654_10140733 3300025911 Bacteria 1538
684 Ga0207654_10161714 3300025911 Bacteria 1447
685 Ga0207707_10007990 3300025912 Bacteria 9188
686 Ga0207707_10042037 3300025912 Bacteria 3991
687 Ga0207707_10524828 3300025912 Bacteria 1008
688 Ga0207695_10000016 3300025913 Bacteria 771991
689 Ga0207695_10000053 3300025913 Bacteria 396740
690 Ga0207695_10000217 3300025913 Bacteria 155047
691 Ga0207695_10006326 3300025913 Bacteria 15404
692 Ga0207695_10008885 3300025913 Bacteria 12508
693 Ga0207695_10010445 3300025913 Bacteria 11355
694 Ga0207695_10018213 3300025913 Bacteria 8127
695 Ga0207695_10019425 3300025913 Bacteria 7826
696 Ga0207695_10038992 3300025913 Bacteria 5109
697 Ga0207695_10042677 3300025913 Bacteria 4840
698 Ga0207695_10129963 3300025913 Bacteria 2477
699 Ga0207695_10130845 3300025913 Bacteria 2467
700 Ga0207695_10238868 3300025913 Bacteria 1719
701 Ga0207695_10284273 3300025913 Bacteria 1547
702 Ga0207695_10295585 3300025913 Bacteria 1511
703 Ga0207695_10359298 3300025913 Bacteria 1343
704 Ga0207671_10000262 3300025914 Bacteria 78823
705 Ga0207671_10000651 3300025914 Bacteria 45376
706 Ga0207671_10003316 3300025914 Bacteria 16180
707 Ga0207671_10003616 3300025914 Bacteria 15269
708 Ga0207671_10004977 3300025914 Bacteria 12445
709 Ga0207671_10006106 3300025914 Bacteria 10843
710 Ga0207671_10009242 3300025914 Bacteria 8259
711 Ga0207671_10030097 3300025914 Bacteria 4049
712 Ga0207671_10055929 3300025914 Bacteria 2923
713 Ga0207671_10103554 3300025914 Bacteria 2158
714 Ga0207671_10333334 3300025914 Bacteria 1202
715 Ga0207671_10499279 3300025914 Bacteria 970
716 Ga0207660_10028247 3300025917 Bacteria 3836
717 Ga0207660_10090125 3300025917 Unclassified 2271
718 Ga0207660_10353152 3300025917 Bacteria 1178
719 Ga0207660_10387250 3300025917 Bacteria 1124
720 Ga0207662_10009899 3300025918 Bacteria 5259
721 Ga0207662_10043890 3300025918 Bacteria 2639
722 Ga0207657_10012205 3300025919 Bacteria 8489
723 Ga0207657_10015266 3300025919 Bacteria 7448
724 Ga0207657_10031930 3300025919 Bacteria 4763
725 Ga0207657_10062733 3300025919 Bacteria 3180
726 Ga0207657_10065191 3300025919 Bacteria 3106
727 Ga0207649_10005106 3300025920 Bacteria 7094
728 Ga0207649_10005653 3300025920 Bacteria 6769
729 Ga0207649_10086228 3300025920 Bacteria 2046
730 Ga0207649_10307152 3300025920 Bacteria 1162
731 Ga0207652_10000546 3300025921 Bacteria 38083
732 Ga0207652_10000697 3300025921 Bacteria 32555
733 Ga0207652_10001189 3300025921 Bacteria 23425
734 Ga0207652_10011595 3300025921 Bacteria 7110
735 Ga0207652_10017232 3300025921 Bacteria 5910
736 Ga0207652_10094674 3300025921 Bacteria 2630
737 Ga0207652_10162553 3300025921 Bacteria 2002
738 Ga0207652_10244335 3300025921 Bacteria 1618
739 Ga0207681_10075306 3300025923 Bacteria 2367
740 Ga0207681_10195596 3300025923 Bacteria 1550
741 Ga0207681_10313829 3300025923 Bacteria 1244
742 Ga0207694_10029582 3300025924 Bacteria 4180
743 Ga0207694_10106234 3300025924 Bacteria 2230
744 Ga0207694_10119113 3300025924 Bacteria 2107
745 Ga0207650_10028475 3300025925 Bacteria 4006
746 Ga0207650_10064915 3300025925 Bacteria 2734
747 Ga0207650_10071855 3300025925 Bacteria 2604
748 Ga0207650_10086617 3300025925 Bacteria 2385
749 Ga0207650_10105236 3300025925 Bacteria 2178
750 Ga0207650_10108738 3300025925 Bacteria 2144
751 Ga0207650_10137224 3300025925 Bacteria 1920
752 Ga0207650_10187350 3300025925 Bacteria 1652
753 Ga0207650_10329440 3300025925 Bacteria 1252
754 Ga0207650_10332486 3300025925 Bacteria 1246
755 Ga0207659_10019428 3300025926 Bacteria 4474
756 Ga0207659_10113203 3300025926 Bacteria 2066
757 Ga0207659_10145995 3300025926 Bacteria 1842
758 Ga0207659_10311622 3300025926 Bacteria 1296
759 Ga0207687_10596631 3300025927 Bacteria 930
760 Ga0207644_10049847 3300025931 Bacteria 2999
761 Ga0207644_10067738 3300025931 Bacteria 2603
762 Ga0207644_10153290 3300025931 Bacteria 1785
763 Ga0207644_10163916 3300025931 Unclassified 1730
764 Ga0207644_10189786 3300025931 Bacteria 1615
765 Ga0207644_10267455 3300025931 Bacteria 1369
766 Ga0207690_10015077 3300025932 Bacteria 4679
767 Ga0207690_10171450 3300025932 Bacteria 1626
768 Ga0207690_10271468 3300025932 Bacteria 1318
769 Ga0207706_10015309 3300025933 Bacteria 6933
770 Ga0207706_10029962 3300025933 Bacteria 4857
771 Ga0207706_10032827 3300025933 Bacteria 4620
772 Ga0207706_10077635 3300025933 Bacteria 2920
773 Ga0207686_10001727 3300025934 Bacteria 12163
774 Ga0207686_10027849 3300025934 Bacteria 3314
775 Ga0207686_10261878 3300025934 Bacteria 1268
776 Ga0207686_10306994 3300025934 Bacteria 1180
777 Ga0207686_10355821 3300025934 Bacteria 1104
778 Ga0207670_10020660 3300025936 Bacteria 4050
779 Ga0207670_10022239 3300025936 Bacteria 3927
780 Ga0207670_10038548 3300025936 Bacteria 3122
781 Ga0207669_10050000 3300025937 Unclassified 2496
782 Ga0207669_10075525 3300025937 Bacteria 2136
783 Ga0207669_10351695 3300025937 Bacteria 1139
784 Ga0207669_10560358 3300025937 Bacteria 923
785 Ga0207704_10000042 3300025938 Bacteria 89683
786 Ga0207704_10036651 3300025938 Bacteria 2824
787 Ga0207691_10007169 3300025940 Bacteria 10754
788 Ga0207691_10042428 3300025940 Bacteria 4194
789 Ga0207691_10070864 3300025940 Unclassified 3147
790 Ga0207691_10126450 3300025940 Bacteria 2261
791 Ga0207691_10129221 3300025940 Bacteria 2233
792 Ga0207691_10160440 3300025940 Bacteria 1973
793 Ga0207691_10166309 3300025940 Bacteria 1933
794 Ga0207691_10166719 3300025940 Archaea 1930
795 Ga0207691_10238304 3300025940 Bacteria 1573
796 Ga0207691_10332745 3300025940 Bacteria 1301
797 Ga0207711_10463195 3300025941 Unclassified 1180
798 Ga0207689_10000687 3300025942 Bacteria 32323
799 Ga0207689_10010494 3300025942 Bacteria 7978
800 Ga0207689_10013015 3300025942 Bacteria 7104
801 Ga0207689_10043720 3300025942 Bacteria 3703
802 Ga0207689_10047343 3300025942 Bacteria 3551
803 Ga0207689_10054304 3300025942 Bacteria 3300
804 Ga0207689_10061068 3300025942 Bacteria 3099
805 Ga0207689_10295319 3300025942 Unclassified 1343
806 Ga0207661_10003519 3300025944 Bacteria 10883
807 Ga0207661_10013659 3300025944 Bacteria 5929
808 Ga0207661_10029870 3300025944 Unclassified 4191
809 Ga0207661_10064891 3300025944 Bacteria 2962
810 Ga0207661_10182718 3300025944 Bacteria 1833
811 Ga0207661_10584133 3300025944 Bacteria 1025
812 Ga0207679_10000391 3300025945 Bacteria 31474
813 Ga0207679_10041004 3300025945 Bacteria 3318
814 Ga0207679_10046169 3300025945 Bacteria 3156
815 Ga0207679_10291558 3300025945 Unclassified 1403
816 Ga0207667_10002377 3300025949 Bacteria 23543
817 Ga0207667_10004375 3300025949 Bacteria 17295
818 Ga0207667_10005684 3300025949 Bacteria 15203
819 Ga0207667_10044109 3300025949 Bacteria 4728
820 Ga0207667_10060111 3300025949 Bacteria 3978
821 Ga0207667_10087799 3300025949 Bacteria 3217
822 Ga0207667_10222152 3300025949 Bacteria 1935
823 Ga0207667_10256539 3300025949 Bacteria 1788
824 Ga0207651_10010254 3300025960 Bacteria 5183
825 Ga0207651_10012448 3300025960 Bacteria 4816
826 Ga0207651_10014573 3300025960 Bacteria 4545
827 Ga0207651_10049249 3300025960 Bacteria 2853
828 Ga0207651_10059851 3300025960 Bacteria 2641
829 Ga0207651_10077021 3300025960 Bacteria 2386
830 Ga0207651_10511602 3300025960 Bacteria 1039
831 Ga0207712_10001621 3300025961 Bacteria 15164
832 Ga0207712_10027580 3300025961 Bacteria 3793
833 Ga0207712_10089376 3300025961 Bacteria 2264
834 Ga0207712_10115694 3300025961 Bacteria 2019
835 Ga0207712_10131182 3300025961 Bacteria 1910
836 Ga0207712_10380889 3300025961 Bacteria 1181
837 Ga0207668_10057455 3300025972 Bacteria 2714
838 Ga0207668_10065618 3300025972 Bacteria 2570
839 Ga0207668_10468506 3300025972 Bacteria 1078
840 Ga0207640_10093308 3300025981 Bacteria 2091
841 Ga0207640_10114491 3300025981 Bacteria 1919
842 Ga0207640_10144763 3300025981 Bacteria 1737
843 Ga0207640_10213835 3300025981 Bacteria 1471
844 Ga0207640_10226768 3300025981 Bacteria 1434
845 Ga0207640_10459248 3300025981 Bacteria 1051
846 Ga0207658_10002069 3300025986 Bacteria 14933
847 Ga0207658_10024336 3300025986 Bacteria 4236
848 Ga0207658_10202537 3300025986 Bacteria 1658
849 Ga0207658_10226135 3300025986 Bacteria 1577
850 Ga0207658_10434495 3300025986 Bacteria 1160
851 Ga0207677_10024930 3300026023 Bacteria 3724
852 Ga0207677_10037430 3300026023 Bacteria 3171
853 Ga0207677_10047197 3300026023 Bacteria 2890
854 Ga0207677_10071144 3300026023 Bacteria 2454
855 Ga0207677_10153342 3300026023 Bacteria 1781
856 Ga0207677_10345200 3300026023 Bacteria 1245
857 Ga0207677_10374559 3300026023 Bacteria 1200
858 Ga0207703_10021148 3300026035 Bacteria 5092
859 Ga0207703_10065810 3300026035 Bacteria 2980
860 Ga0207703_10534453 3300026035 Bacteria 1104
861 Ga0207639_10016487 3300026041 Bacteria 5230
862 Ga0207639_10087919 3300026041 Bacteria 2478
863 Ga0207639_10137118 3300026041 Bacteria 2034
864 Ga0207639_10192364 3300026041 Bacteria 1744
865 Ga0207639_10227628 3300026041 Bacteria 1614
866 Ga0207639_10369963 3300026041 Bacteria 1285
867 Ga0207678_10008521 3300026067 Bacteria 9034
868 Ga0207678_10069354 3300026067 Bacteria 3023
869 Ga0207678_10117878 3300026067 Bacteria 2265
870 Ga0207678_10175767 3300026067 Bacteria 1828
871 Ga0207708_10118932 3300026075 Bacteria 2058
872 Ga0207702_10006154 3300026078 Bacteria 10389
873 Ga0207702_10041222 3300026078 Bacteria 3871
874 Ga0207702_10041908 3300026078 Bacteria 3839
875 Ga0207702_10055438 3300026078 Bacteria 3361
876 Ga0207702_10085314 3300026078 Bacteria 2751
877 Ga0207702_10562336 3300026078 Bacteria 1116
878 Ga0207641_10000194 3300026088 Bacteria 82153
879 Ga0207641_10032468 3300026088 Bacteria 4333
880 Ga0207641_10091229 3300026088 Bacteria 2666
881 Ga0207641_10092843 3300026088 Bacteria 2644
882 Ga0207641_10190047 3300026088 Bacteria 1887
883 Ga0207641_10193413 3300026088 Bacteria 1871
884 Ga0207648_10001034 3300026089 Bacteria 31257
885 Ga0207648_10002952 3300026089 Bacteria 17989
886 Ga0207648_10006979 3300026089 Bacteria 11173
887 Ga0207648_10070808 3300026089 Bacteria 3040
888 Ga0207648_10093869 3300026089 Bacteria 2624
889 Ga0207648_10106014 3300026089 Bacteria 2466
890 Ga0207648_10163339 3300026089 Unclassified 1967
891 Ga0207648_10178819 3300026089 Bacteria 1877
892 Ga0207648_10445944 3300026089 Bacteria 1178
893 Ga0207648_10656054 3300026089 Bacteria 970
894 Ga0207676_10002355 3300026095 Bacteria 13499
895 Ga0207676_10009188 3300026095 Bacteria 7038
896 Ga0207676_10091855 3300026095 Bacteria 2495
897 Ga0207676_10106351 3300026095 Bacteria 2338
898 Ga0207676_10172199 3300026095 Unclassified 1887
899 Ga0207676_10234036 3300026095 Bacteria 1644
900 Ga0207676_10283053 3300026095 Bacteria 1506
901 Ga0207676_10312848 3300026095 Bacteria 1438
902 Ga0207676_10402602 3300026095 Bacteria 1279
903 Ga0207674_10001890 3300026116 Bacteria 26652
904 Ga0207674_10004509 3300026116 Bacteria 16740
905 Ga0207674_10008250 3300026116 Bacteria 12059
906 Ga0207674_10024037 3300026116 Bacteria 6517
907 Ga0207674_10180493 3300026116 Bacteria 2062
908 Ga0207674_10227596 3300026116 Bacteria 1813
909 Ga0207675_100000359 3300026118 Bacteria 43729
910 Ga0207675_100008546 3300026118 Bacteria 9630
911 Ga0207675_100077748 3300026118 Bacteria 3109
912 Ga0207675_100118148 3300026118 Bacteria 2507
913 Ga0207675_100543847 3300026118 Bacteria 1160
914 Ga0207683_10001842 3300026121 Bacteria 18744
915 Ga0207683_10010191 3300026121 Bacteria 8015
916 Ga0207683_10013467 3300026121 Bacteria 6977
917 Ga0207683_10077172 3300026121 Bacteria 2950
918 Ga0207683_10079045 3300026121 Bacteria 2915
919 Ga0207683_10108393 3300026121 Bacteria 2485
920 Ga0207683_10110779 3300026121 Bacteria 2458
921 Ga0207683_10216388 3300026121 Bacteria 1745
922 Ga0207683_10470219 3300026121 Unclassified 1160
923 Ga0207698_10002645 3300026142 Bacteria 10648
924 Ga0207698_10013319 3300026142 Bacteria 5422
925 Ga0207698_10036983 3300026142 Bacteria 3590
926 Ga0207698_10114523 3300026142 Bacteria 2268
927 Ga0207698_10124278 3300026142 Bacteria 2191
928 Ga0207698_10124472 3300026142 Unclassified 2189
929 Ga0207698_10181425 3300026142 Bacteria 1865
930 Ga0207698_10644036 3300026142 Bacteria 1049
931 Ga0207428_10124108 3300027907 Bacteria 1978
932 Ga0207428_10483522 3300027907 Bacteria 900
933 Ga0268266_10000030 3300028379 Bacteria 417120
934 Ga0268266_10000105 3300028379 Bacteria 176691
935 Ga0268266_10029062 3300028379 Bacteria 4698
936 Ga0268266_10036019 3300028379 Bacteria 4210
937 Ga0268266_10809385 3300028379 Bacteria 905
938 Ga0268265_10004817 3300028380 Bacteria 9303
939 Ga0268265_10146360 3300028380 Unclassified 1986
940 Ga0268265_10186707 3300028380 Bacteria 1786
941 Ga0268265_10283158 3300028380 Bacteria 1484
942 Ga0268264_10000013 3300028381 Bacteria 513859
943 Ga0268264_10001619 3300028381 Bacteria 20805
944 Ga0268264_10005141 3300028381 Bacteria 11086
945 Ga0268264_10006791 3300028381 Bacteria 9615
946 Ga0268264_10010589 3300028381 Bacteria 7622
947 Ga0268264_10017207 3300028381 Bacteria 5921
948 Ga0268264_10027588 3300028381 Bacteria 4642
949 Ga0268264_10031768 3300028381 Bacteria 4330
950 Ga0268264_10076822 3300028381 Bacteria 2842
951 Ga0268264_10193368 3300028381 Bacteria 1856
952 Ga0268264_10225710 3300028381 Unclassified 1727
953 Ga0268264_10369736 3300028381 Bacteria 1370
954 Ga0268264_10468347 3300028381 Bacteria 1224
955 Ga0307517_10000963 3300028786 Bacteria 48832
956 Ga0307517_10002485 3300028786 Bacteria 29476
957 Ga0307517_10124065 3300028786 Bacteria 1894
958 Ga0307515_10000001 3300028794 Bacteria 4259510
959 Ga0307515_10000074 3300028794 Bacteria 229874
960 Ga0307515_10086115 3300028794 Bacteria 4010
961 Ga0265338_10026397 3300028800 Bacteria 5860
962 Ga0265340_10184270 3300031247 Bacteria 943
963 Ga0265327_10000055 3300031251 Bacteria 247188
964 Ga0265327_10000107 3300031251 Bacteria 183770
965 Ga0265327_10000440 3300031251 Bacteria 75453
966 Ga0265327_10000577 3300031251 Bacteria 62128
967 Ga0265327_10013417 3300031251 Bacteria 5441
968 Ga0307513_10051322 3300031456 Bacteria 4451
969 Ga0307513_10352451 3300031456 Bacteria 1219
970 Ga0307509_10037736 3300031507 Bacteria 5279
971 Ga0307509_10258430 3300031507 Bacteria 1519
972 Ga0307509_10309073 3300031507 Bacteria 1324
973 Ga0307509_10360768 3300031507 Bacteria 1173
974 Ga0307408_100000984 3300031548 Bacteria 21994
975 Ga0307408_100320861 3300031548 Bacteria 1305
976 Ga0265313_10094585 3300031595 Bacteria 1335
977 Ga0307508_10000446 3300031616 Bacteria 49383
978 Ga0307516_10042048 3300031730 Bacteria 4536
979 Ga0307516_10396901 3300031730 Bacteria 1039
980 Ga0307405_10010137 3300031731 Bacteria 4864
981 Ga0307413_10043532 3300031824 Bacteria 2647
982 Ga0307410_10141746 3300031852 Unclassified 1779
983 Ga0307412_10002839 3300031911 Bacteria 9604
984 Ga0307416_100109594 3300032002 Bacteria 2429
985 Ga0307416_100945803 3300032002 Bacteria 963
986 Ga0307414_10030435 3300032004 Bacteria 3526
987 Ga0307414_10441218 3300032004 Bacteria 1139
988 Ga0307411_10436232 3300032005 Bacteria 1092
989 Ga0307411_10541162 3300032005 Bacteria 992
990 Ga0307507_10060399 3300033179 Bacteria 3540
991 Ga0307510_10000555 3300033180 Bacteria 37450
992 Ga0307510_10152016 3300033180 Bacteria 1931
993 Ga0373931_0038054 3300035691 Bacteria 2515
994 Ga0373927_0005537 3300035695 Bacteria 8692
995 Ga0373937_0016236 3300036401 Bacteria 6607
996 Ga0373937_0081483 3300036401 Bacteria 2994
997 Ga0395899_0000136 3300037312 Bacteria 112112
998 Ga0395899_0001590 3300037312 Bacteria 19085
999 Ga0395899_0071954 3300037312 Bacteria 2530
1000 Ga0395899_0086313 3300037312 Bacteria 2279
1001 Ga0395899_0229765 3300037312 Bacteria 1281
1002 Ga0395900_0004139 3300037418 Bacteria 15441
1003 Ga0395900_0005994 3300037418 Bacteria 12692
1004 Ga0395900_0102716 3300037418 Bacteria 2936
1005 Ga0395900_0148838 3300037418 Bacteria 2393
1006 Ga0395900_0187474 3300037418 Bacteria 2099
1007 Ga0395900_0212394 3300037418 Bacteria 1953
1008 Ga0395900_0334701 3300037418 Bacteria 1491
1009 Ga0395900_0348970 3300037418 Bacteria 1453
1010 Ga0395900_0418773 3300037418 Bacteria 1301
1011 Ga0395898_0001279 3300037466 Bacteria 37056
1012 Ga0395898_0041168 3300037466 Bacteria 4564
1013 Ga0395898_0049581 3300037466 Bacteria 4113
1014 Ga0395898_0102470 3300037466 Bacteria 2748
1015 Ga0395898_0108487 3300037466 Bacteria 2662
1016 Ga0395898_0220400 3300037466 Bacteria 1809
1017 Ga0395905_0005471 3300037471 Bacteria 12952
1018 Ga0395905_0106202 3300037471 Bacteria 2637
1019 Ga0395905_0144335 3300037471 Bacteria 2240
1020 Ga0395905_0146888 3300037471 Bacteria 2219
1021 Ga0395901_0004694 3300038443 Bacteria 13783
1022 Ga0395901_0007368 3300038443 Bacteria 11099
1023 Ga0395901_0116887 3300038443 Bacteria 2802
1024 Ga0436365_0133629 3300039437 Bacteria 996
1025 Ga0436365_0509594 3300039437 Bacteria 9324
1026 Ga0436365_0851555 3300039437 Bacteria 1751
1027 Ga0436365_1079918 3300039437 Bacteria 37760
1028 Ga0436365_1349840 3300039437 Bacteria 1535
1029 Ga0436365_1398854 3300039437 Bacteria 1175
1030 Ga0439436_0010894 3300041404 Bacteria 2768
1031 Ga0439439_0008037 3300041406 Bacteria 2480
1032 Ga0439439_0010046 3300041406 Bacteria 2259
1033 Ga0451843_0362820 3300041509 Unclassified 1194
1034 Ga0451853_1632338 3300041512 Bacteria 1116
1035 Ga0439431_0001484 3300041997 Bacteria 5179
1036 Ga0439431_0010623 3300041997 Bacteria 2091
1037 Ga0439431_0046198 3300041997 Bacteria 1120
1038 Ga0439441_005343 3300042001 Bacteria 1992
1039 Ga0439445_0009386 3300042004 Bacteria 2306
1040 Ga0439449_0125708 3300042007 Bacteria 952
1041 Ga0439457_001255 3300042014 Bacteria 7614
1042 Ga0439462_0005305 3300042015 Bacteria 3174
1043 Ga0439462_0026471 3300042015 Bacteria 1529
1044 Ga0450899_008281 3300042135 Bacteria 1139
1045 Ga0451577_0002283 3300042876 Bacteria 23205
1046 Ga0451577_0006025 3300042876 Bacteria 12208
1047 Ga0451577_0030795 3300042876 Bacteria 4845
1048 Ga0451577_0729629 3300042876 Bacteria 897
1049 Ga0466969_0012582 3300044656 Bacteria 4460
1050 Ga0466969_0076579 3300044656 Bacteria 1602
1051 Ga0466969_0183978 3300044656 Bacteria 956
1052 Ga0466972_0000022 3300044658 Bacteria 193802
1053 Ga0466972_0000083 3300044658 Bacteria 87204
1054 Ga0466972_0008993 3300044658 Bacteria 5014
1055 Ga0453683_0122800 3300044673 Bacteria 1635
1056 Ga0453683_0252664 3300044673 Bacteria 1124
1057 Ga0466966_0044889 3300044684 Bacteria 2827
1058 Ga0466961_0268557 3300044693 Bacteria 1045
1059 Ga0453684_0002802 3300044712 Bacteria 41228
1060 Ga0453684_0113589 3300044712 Bacteria 3285
1061 Ga0453684_0319194 3300044712 Bacteria 1760
1062 Ga0466970_0000367 3300044765 Bacteria 21910
1063 Ga0466970_0017449 3300044765 Bacteria 3710
1064 Ga0466957_0001147 3300044842 Bacteria 13704
1065 Ga0466957_0157937 3300044842 Bacteria 1471
1066 Ga0466960_0030410 3300044901 Bacteria 2485
1067 Ga0466959_0114365 3300045049 Unclassified 1923
1068 Ga0466959_0145688 3300045049 Bacteria 1671
1069 Ga0451576_0001459 3300045051 Bacteria 40206
1070 Ga0451576_0107160 3300045051 Bacteria 2907
1071 Ga0451576_0347377 3300045051 Bacteria 1553
1072 Ga0451576_0361309 3300045051 Bacteria 1521
1073 Ga0466958_0191661 3300045836 Bacteria 1299
1074 Ga0466967_0419645 3300045976 Bacteria 1304
1075 Ga0495627_038356 3300046453 Bacteria 1481
1076 Ga0495592_0092667 3300046454 Bacteria 2165
1077 Ga0495638_0000004 3300046460 Bacteria 700795
1078 Ga0495638_0019515 3300046460 Bacteria 4486
1079 Ga0495638_0070770 3300046460 Bacteria 2135
1080 Ga0495651_0093658 3300046462 Bacteria 2249
1081 Ga0495606_0036909 3300046507 Bacteria 3322
1082 Ga0495630_0025276 3300046517 Bacteria 4390
1083 Ga0495631_0035208 3300046518 Bacteria 2241
1084 Ga0495632_0100707 3300046519 Bacteria 1362
1085 Ga0495648_0005425 3300046524 Bacteria 10597
1086 Ga0495652_0068583 3300046529 Bacteria 2971
1087 Ga0495640_0342044 3300046533 Unclassified 924
1088 Ga0495633_0000576 3300046558 Bacteria 35568
1089 Ga0495668_0000108 3300046616 Bacteria 132593
1090 Ga0495668_0001051 3300046616 Bacteria 29297
1091 Ga0495668_0014854 3300046616 Bacteria 4557
1092 Ga0495668_0079098 3300046616 Bacteria 1805
1093 Ga0495611_0000785 3300046648 Bacteria 17670
1094 Ga0495657_0067426 3300046675 Bacteria 2349
1095 Ga0495646_0034961 3300046680 Bacteria 3118
1096 Ga0495670_0007986 3300046691 Bacteria 5204
1097 Ga0495600_0228455 3300046809 Bacteria 1189
1098 Ga0495581_0322353 3300047315 Bacteria 903
1099 Ga0495636_0000020 3300047318 Bacteria 75085
1100 Ga0495672_0007681 3300047320 Bacteria 8082
1101 Ga0495672_0018066 3300047320 Bacteria 4695
1102 Ga0495672_0061917 3300047320 Bacteria 2155
1103 Ga0495676_0348037 3300047321 Bacteria 991
1104 Ga0495680_0064105 3300047322 Bacteria 2819
1105 Ga0495687_000010 3300047443 Bacteria 413735
1106 Ga0495687_126662 3300047443 Bacteria 912
1107 Ga0495675_0101641 3300047444 Bacteria 1798
1108 Ga0495686_0000195 3300047472 Bacteria 113003
1109 Ga0495686_0000322 3300047472 Bacteria 79695
1110 Ga0495686_0039754 3300047472 Bacteria 3002
1111 Ga0496100_0701004 3300048903 Bacteria 790
1112 Ga0496101_0086402 3300048904 Bacteria 2326
1113 Ga0496101_0164494 3300048904 Bacteria 1703
1114 Ga0496104_0103851 3300048907 Bacteria 2723
1115 Ga0496110_0058385 3300048913 Bacteria 3399
1116 Ga0496110_0108822 3300048913 Bacteria 2489
1117 Ga0496114_0027289 3300048917 Bacteria 4676
1118 Ga0496114_0375254 3300048917 Bacteria 1259
1119 Ga0496115_0065188 3300048918 Unclassified 2942
1120 Ga0496115_0175553 3300048918 Bacteria 1771
1121 Ga0496121_0000007 3300048924 Bacteria 942516
1122 Ga0496124_0047989 3300048927 Bacteria 3651
1123 Ga0496126_0003675 3300048929 Bacteria 19161
1124 Ga0495682_0093812 3300049460 Bacteria 1078
1125 Ga0501300_010190 3300049523 Bacteria 1371
1126 Ga0501031_0029299 3300049568 Bacteria 3591
1127 Ga0501031_0171012 3300049568 Bacteria 1420
1128 Ga0501032_0006173 3300049569 Bacteria 8820
1129 Ga0501032_0046898 3300049569 Bacteria 2920
1130 Ga0501033_0075464 3300049570 Bacteria 2474
1131 Ga0501034_0000017 3300049571 Bacteria 285938
1132 Ga0501034_0138595 3300049571 Bacteria 2413
1133 Ga0501034_0156508 3300049571 Bacteria 2252
1134 Ga0501034_0174542 3300049571 Bacteria 2115
1135 Ga0501034_0193871 3300049571 Bacteria 1993
1136 Ga0501034_0195727 3300049571 Bacteria 1981
1137 Ga0501036_0011056 3300049572 Bacteria 7463
1138 Ga0501036_0142628 3300049572 Bacteria 2021
1139 Ga0501037_0006114 3300049573 Bacteria 8795
1140 Ga0501037_0006584 3300049573 Bacteria 8498
1141 Ga0501037_0069074 3300049573 Bacteria 2573
1142 Ga0501038_0016450 3300049574 Bacteria 6704
1143 Ga0501039_0039794 3300049575 Bacteria 3630
1144 Ga0501039_0040623 3300049575 Bacteria 3590
1145 Ga0501043_0004526 3300049579 Bacteria 11298
1146 Ga0501043_0060263 3300049579 Bacteria 2979
1147 Ga0501043_0161509 3300049579 Bacteria 1750
1148 Ga0501046_0003983 3300049580 Bacteria 13485
1149 Ga0501046_0024453 3300049580 Bacteria 4955
1150 Ga0501047_0018963 3300049581 Bacteria 6598
1151 Ga0501047_0287376 3300049581 Bacteria 1488
1152 Ga0501047_0340209 3300049581 Unclassified 1338
1153 Ga0501048_0046639 3300049582 Bacteria 3093
1154 Ga0501067_0222391 3300049583 Bacteria 1051
1155 Ga0501067_0304924 3300049583 Bacteria 887
1156 Ga0501069_0041446 3300049585 Bacteria 2545
1157 Ga0501070_0052241 3300049586 Bacteria 3392
1158 Ga0501070_0085635 3300049586 Bacteria 2609
1159 Ga0501073_0000371 3300049589 Bacteria 30293
1160 Ga0501073_0208216 3300049589 Unclassified 1351
1161 Ga0501074_0001823 3300049590 Bacteria 14583
1162 Ga0501202_005461 3300049652 Unclassified 2252
1163 Ga0501217_088849 3300049661 Bacteria 865
1164 Ga0501227_051643 3300049665 Bacteria 1039
1165 Ga0501235_011272 3300049669 Bacteria 1959
1166 Ga0501257_013189 3300049686 Bacteria 1894
1167 Ga0501257_048453 3300049686 Unclassified 1056
1168 Ga0501259_000124 3300049688 Bacteria 11295
1169 Ga0501225_0005750 3300049705 Bacteria 3631
1170 Ga0501080_0033155 3300049742 Bacteria 4821
1171 Ga0501080_0639454 3300049742 Bacteria 942
1172 Ga0501241_003204 3300049758 Bacteria 3103
1173 Ga0501266_000169 3300049763 Bacteria 8335
1174 Ga0501035_0018959 3300049822 Bacteria 6336
1175 Ga0501035_0071677 3300049822 Bacteria 3067
1176 Ga0501035_0183140 3300049822 Bacteria 1804
1177 Ga0501035_0680809 3300049822 Bacteria 831
1178 Ga0501044_0040941 3300049823 Bacteria 4825
1179 Ga0501044_0101383 3300049823 Bacteria 2896
1180 Ga0501044_0167344 3300049823 Bacteria 2172
1181 Ga0501044_0390655 3300049823 Bacteria 1305
1182 Ga0501044_0439212 3300049823 Bacteria 1213
1183 Ga0501044_0687508 3300049823 Bacteria 909
1184 Ga0501284_00028 3300050005 Bacteria 76036
1185 nmdc:mga0k408_184157_c1 3300050493 Bacteria 1245
1186 nmdc:mga0k408_90431_c1 3300050493 Bacteria 1797
1187 nmdc:mga05p37_153807_c1 3300050507 Bacteria 2812
1188 nmdc:mga05p37_95217_c1 3300050507 Bacteria 3668
1189 nmdc:mga09592_241940_c1 3300050508 Bacteria 1564
1190 nmdc:mga0qj67_204136_c1 3300050509 Bacteria 1605
1191 nmdc:mga08y16_144765_c1 3300050511 Bacteria 2470
1192 nmdc:mga08y16_25409_c1 3300050511 Bacteria 6246
1193 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
1194 Ga0500635_0021275 3300053080 Bacteria 1997
1195 Ga0495619_0059311 3300053085 Bacteria 2542
1196 Ga0500578_0000718 3300053086 Bacteria 39295
1197 Ga0500644_0000008 3300053088 Bacteria 130338
1198 Ga0500644_0024211 3300053088 Bacteria 1853
1199 Ga0500646_0002493 3300053090 Bacteria 4780
1200 Ga0500646_0070148 3300053090 Bacteria 1049
1201 Ga0500583_0023070 3300053092 Bacteria 2618
1202 Ga0500583_0088433 3300053092 Bacteria 1505
1203 Ga0500651_0130404 3300053093 Bacteria 1521
1204 Ga0500651_0217713 3300053093 Bacteria 1121
1205 Ga0500650_0041310 3300053098 Bacteria 2129
1206 Ga0500556_0069307 3300053104 Bacteria 1315
1207 Ga0500562_000010 3300053108 Bacteria 183815
1208 Ga0500569_000603 3300053109 Bacteria 6081
1209 Ga0500607_122404 3300053121 Bacteria 1256
1210 Ga0500658_0002665 3300053134 Bacteria 6866
1211 Ga0500658_0110602 3300053134 Bacteria 1209
1212 Ga0500559_0023505 3300053136 Bacteria 2617
1213 Ga0500559_0104563 3300053136 Bacteria 1307
1214 Ga0500568_0000562 3300053139 Bacteria 27303
1215 Ga0500568_0102573 3300053139 Bacteria 1072
1216 Ga0500577_0095318 3300053142 Bacteria 1209
1217 Ga0500588_0000498 3300053146 Bacteria 6257
1218 Ga0500589_051861 3300053147 Bacteria 1901
1219 Ga0500616_0000015 3300053153 Bacteria 633259
1220 Ga0500616_0001133 3300053153 Bacteria 27399
1221 Ga0500616_0007631 3300053153 Bacteria 6836
1222 Ga0500616_0015241 3300053153 Unclassified 4400
1223 Ga0500616_0029000 3300053153 Bacteria 3047
1224 Ga0500616_0064329 3300053153 Bacteria 1889
1225 Ga0500622_0001907 3300053156 Bacteria 15724
1226 Ga0500622_0003516 3300053156 Bacteria 10389
1227 Ga0500622_0003745 3300053156 Bacteria 9937
1228 Ga0500622_0012215 3300053156 Bacteria 4658
1229 Ga0500622_0013565 3300053156 Bacteria 4397
1230 Ga0500627_0046488 3300053158 Bacteria 1881
1231 Ga0500633_0000788 3300053160 Bacteria 5395
1232 Ga0500611_000092 3300053727 Bacteria 25966
1233 Ga0500611_013239 3300053727 Bacteria 1411
1234 Ga0500645_016255 3300053730 Bacteria 2346
1235 Ga0501082_0118958 3300060353 Bacteria 2289
1236 Ga0501082_0292598 3300060353 Bacteria 1418

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10234036 Ga0207676_102340362 243
2 3300028794 Ga0307515_10086115 Ga0307515_100861154 249
3 3300005331 Ga0070670_100069204 Ga0070670_1000692044 250
4 3300005539 Ga0068853_100020902 Ga0068853_1000209022 250
5 3300005841 Ga0068863_100638635 Ga0068863_1006386352 250
6 3300025321 Ga0207656_10048622 Ga0207656_100486222 250
7 3300026041 Ga0207639_10137118 Ga0207639_101371182 250
8 3300026121 Ga0207683_10010191 Ga0207683_1001019110 250
9 3300026121 Ga0207683_10216388 Ga0207683_102163881 250
10 iso_pu_bacteria 2818991442 2819574518 250
11 3300005616 Ga0068852_100046492 Ga0068852_1000464925 251
12 3300025914 Ga0207671_10333334 Ga0207671_103333342 251
13 3300026142 Ga0207698_10013319 Ga0207698_100133194 251
14 3300049686 Ga0501257_048453 Ga0501257_048453_173_958 251
15 3300005339 Ga0070660_100007919 Ga0070660_1000079194 252
16 3300005366 Ga0070659_100016082 Ga0070659_1000160826 252
17 3300005564 Ga0070664_100209697 Ga0070664_1002096973 252
18 3300025904 Ga0207647_10006080 Ga0207647_100060806 252
19 3300025919 Ga0207657_10015266 Ga0207657_100152666 252
20 3300025932 Ga0207690_10015077 Ga0207690_100150774 252
21 3300026142 Ga0207698_10124278 Ga0207698_101242783 252
22 3300002459 JGI24751J29686_10001005 JGI24751J29686_100010056 253
23 3300003322 rootL2_10036963 rootL2_100369633 253
24 3300003323 rootH1_10026366 rootH1_100263663 253
25 3300005328 Ga0070676_10001862 Ga0070676_100018626 253
26 3300005329 Ga0070683_100000211 Ga0070683_10000021131 253
27 3300005329 Ga0070683_100003981 Ga0070683_1000039813 253
28 3300005330 Ga0070690_100066291 Ga0070690_1000662912 253
29 3300005330 Ga0070690_100241802 Ga0070690_1002418022 253
30 3300005331 Ga0070670_100051716 Ga0070670_1000517164 253
31 3300005331 Ga0070670_100059876 Ga0070670_1000598761 253
32 3300005331 Ga0070670_100131414 Ga0070670_1001314144 253
33 3300005331 Ga0070670_100131755 Ga0070670_1001317552 253
34 3300005331 Ga0070670_100158760 Ga0070670_1001587604 253
35 3300005334 Ga0068869_100055434 Ga0068869_1000554343 253
36 3300005334 Ga0068869_100523582 Ga0068869_1005235821 253
37 3300005335 Ga0070666_10007048 Ga0070666_100070487 253
38 3300005335 Ga0070666_10102400 Ga0070666_101024001 253
39 3300005335 Ga0070666_10221787 Ga0070666_102217872 253
40 3300005335 Ga0070666_10258854 Ga0070666_102588541 253
41 3300005338 Ga0068868_100006735 Ga0068868_1000067355 253
42 3300005338 Ga0068868_100038859 Ga0068868_1000388594 253
43 3300005338 Ga0068868_100119984 Ga0068868_1001199843 253
44 3300005338 Ga0068868_100233219 Ga0068868_1002332193 253
45 3300005340 Ga0070689_100004082 Ga0070689_10000408211 253
46 3300005340 Ga0070689_100040741 Ga0070689_1000407412 253
47 3300005340 Ga0070689_100138841 Ga0070689_1001388414 253
48 3300005344 Ga0070661_100006697 Ga0070661_1000066974 253
49 3300005344 Ga0070661_100007080 Ga0070661_1000070809 253
50 3300005344 Ga0070661_100123091 Ga0070661_1001230911 253
51 3300005347 Ga0070668_100010123 Ga0070668_1000101232 253
52 3300005353 Ga0070669_100002091 Ga0070669_1000020915 253
53 3300005353 Ga0070669_100134446 Ga0070669_1001344463 253
54 3300005353 Ga0070669_100301974 Ga0070669_1003019742 253
55 3300005354 Ga0070675_100005185 Ga0070675_1000051853 253
56 3300005354 Ga0070675_100505944 Ga0070675_1005059441 253
57 3300005355 Ga0070671_100014470 Ga0070671_1000144705 253
58 3300005355 Ga0070671_100142262 Ga0070671_1001422621 253
59 3300005364 Ga0070673_100007156 Ga0070673_1000071564 253
60 3300005364 Ga0070673_100011359 Ga0070673_1000113595 253
61 3300005364 Ga0070673_100027495 Ga0070673_1000274956 253
62 3300005365 Ga0070688_100012960 Ga0070688_1000129603 253
63 3300005366 Ga0070659_100148669 Ga0070659_1001486692 253
64 3300005367 Ga0070667_100061418 Ga0070667_1000614183 253
65 3300005367 Ga0070667_100297295 Ga0070667_1002972952 253
66 3300005455 Ga0070663_100239119 Ga0070663_1002391192 253
67 3300005456 Ga0070678_100084512 Ga0070678_1000845124 253
68 3300005457 Ga0070662_100002740 Ga0070662_10000274012 253
69 3300005457 Ga0070662_100002963 Ga0070662_1000029638 253
70 3300005457 Ga0070662_100037593 Ga0070662_1000375931 253
71 3300005459 Ga0068867_100026915 Ga0068867_1000269153 253
72 3300005459 Ga0068867_100225485 Ga0068867_1002254851 253
73 3300005466 Ga0070685_10013516 Ga0070685_100135162 253
74 3300005466 Ga0070685_10178672 Ga0070685_101786722 253
75 3300005535 Ga0070684_100000568 Ga0070684_10000056823 253
76 3300005535 Ga0070684_100006999 Ga0070684_1000069999 253
77 3300005535 Ga0070684_100018337 Ga0070684_1000183377 253
78 3300005539 Ga0068853_100039686 Ga0068853_1000396865 253
79 3300005539 Ga0068853_100237648 Ga0068853_1002376482 253
80 3300005543 Ga0070672_100127800 Ga0070672_1001278003 253
81 3300005544 Ga0070686_100185447 Ga0070686_1001854472 253
82 3300005548 Ga0070665_100069649 Ga0070665_1000696495 253
83 3300005564 Ga0070664_100003902 Ga0070664_1000039024 253
84 3300005564 Ga0070664_100038086 Ga0070664_1000380864 253
85 3300005564 Ga0070664_100213665 Ga0070664_1002136652 253
86 3300005577 Ga0068857_100019417 Ga0068857_1000194174 253
87 3300005578 Ga0068854_100010782 Ga0068854_1000107824 253
88 3300005578 Ga0068854_100076232 Ga0068854_1000762321 253
89 3300005578 Ga0068854_100244134 Ga0068854_1002441342 253
90 3300005616 Ga0068852_100024963 Ga0068852_1000249635 253
91 3300005617 Ga0068859_100009061 Ga0068859_1000090616 253
92 3300005617 Ga0068859_100012192 Ga0068859_1000121927 253
93 3300005617 Ga0068859_100014826 Ga0068859_1000148265 253
94 3300005617 Ga0068859_100029379 Ga0068859_1000293794 253
95 3300005617 Ga0068859_100104576 Ga0068859_1001045762 253
96 3300005617 Ga0068859_100270488 Ga0068859_1002704882 253
97 3300005617 Ga0068859_100471794 Ga0068859_1004717942 253
98 3300005618 Ga0068864_100011587 Ga0068864_1000115873 253
99 3300005618 Ga0068864_100109092 Ga0068864_1001090923 253
100 3300005618 Ga0068864_100431453 Ga0068864_1004314532 253
101 3300005718 Ga0068866_10049578 Ga0068866_100495783 253
102 3300005718 Ga0068866_10471689 Ga0068866_104716891 253
103 3300005719 Ga0068861_100018566 Ga0068861_1000185666 253
104 3300005834 Ga0068851_10172784 Ga0068851_101727843 253
105 3300005841 Ga0068863_100137008 Ga0068863_1001370083 253
106 3300005841 Ga0068863_100147666 Ga0068863_1001476662 253
107 3300005841 Ga0068863_100230708 Ga0068863_1002307082 253
108 3300005841 Ga0068863_100310907 Ga0068863_1003109072 253
109 3300005843 Ga0068860_100023114 Ga0068860_1000231144 253
110 3300005843 Ga0068860_100126114 Ga0068860_1001261144 253
111 3300005843 Ga0068860_100175252 Ga0068860_1001752523 253
112 3300005843 Ga0068860_100208123 Ga0068860_1002081233 253
113 3300005843 Ga0068860_100364162 Ga0068860_1003641622 253
114 3300005844 Ga0068862_100008262 Ga0068862_1000082627 253
115 3300005844 Ga0068862_100064862 Ga0068862_1000648622 253
116 3300006195 Ga0075366_10043379 Ga0075366_100433793 253
117 3300006237 Ga0097621_100004436 Ga0097621_10000443610 253
118 3300006237 Ga0097621_100052642 Ga0097621_1000526425 253
119 3300006237 Ga0097621_100285776 Ga0097621_1002857762 253
120 3300006358 Ga0068871_100000063 Ga0068871_1000000635 253
121 3300006358 Ga0068871_100102663 Ga0068871_1001026632 253
122 3300006358 Ga0068871_100249250 Ga0068871_1002492502 253
123 3300006931 Ga0097620_100009061 Ga0097620_1000090616 253
124 3300006931 Ga0097620_100012190 Ga0097620_1000121907 253
125 3300006931 Ga0097620_100014825 Ga0097620_1000148255 253
126 3300006931 Ga0097620_100029379 Ga0097620_1000293797 253
127 3300006931 Ga0097620_100104574 Ga0097620_1001045742 253
128 3300006931 Ga0097620_100270503 Ga0097620_1002705032 253
129 3300006931 Ga0097620_100471804 Ga0097620_1004718042 253
130 3300009011 Ga0105251_10086077 Ga0105251_100860772 253
131 3300009093 Ga0105240_10021663 Ga0105240_100216635 253
132 3300009093 Ga0105240_10318249 Ga0105240_103182492 253
133 3300009094 Ga0111539_10003454 Ga0111539_1000345418 253
134 3300009094 Ga0111539_10242929 Ga0111539_102429293 253
135 3300009101 Ga0105247_10003642 Ga0105247_1000364210 253
136 3300009101 Ga0105247_10042855 Ga0105247_100428554 253
137 3300009176 Ga0105242_10224296 Ga0105242_102242963 253
138 3300009177 Ga0105248_10174430 Ga0105248_101744302 253
139 3300009553 Ga0105249_10011525 Ga0105249_1001152510 253
140 3300009553 Ga0105249_10164600 Ga0105249_101646003 253
141 3300009553 Ga0105249_10178213 Ga0105249_101782132 253
142 3300010375 Ga0105239_10074626 Ga0105239_100746264 253
143 3300010375 Ga0105239_10142748 Ga0105239_101427483 253
144 3300013100 Ga0157373_10023654 Ga0157373_100236544 253
145 3300013102 Ga0157371_10076577 Ga0157371_100765773 253
146 3300013296 Ga0157374_10008376 Ga0157374_100083767 253
147 3300013296 Ga0157374_10014583 Ga0157374_100145833 253
148 3300013296 Ga0157374_10024342 Ga0157374_100243427 253
149 3300013297 Ga0157378_10003418 Ga0157378_1000341813 253
150 3300013297 Ga0157378_10085627 Ga0157378_100856275 253
151 3300013297 Ga0157378_10266013 Ga0157378_102660131 253
152 3300013306 Ga0163162_10001757 Ga0163162_100017577 253
153 3300013306 Ga0163162_10004586 Ga0163162_1000458611 253
154 3300013306 Ga0163162_10059108 Ga0163162_100591083 253
155 3300013306 Ga0163162_10128348 Ga0163162_101283482 253
156 3300013306 Ga0163162_10616780 Ga0163162_106167801 253
157 3300013307 Ga0157372_10029586 Ga0157372_100295865 253
158 3300013307 Ga0157372_10651979 Ga0157372_106519792 253
159 3300013308 Ga0157375_10000324 Ga0157375_1000032422 253
160 3300013308 Ga0157375_10005137 Ga0157375_100051374 253
161 3300013308 Ga0157375_10117566 Ga0157375_101175663 253
162 3300013308 Ga0157375_10129202 Ga0157375_101292022 253
163 3300013308 Ga0157375_10232243 Ga0157375_102322433 253
164 3300014325 Ga0163163_10000462 Ga0163163_100004622 253
165 3300014325 Ga0163163_10000973 Ga0163163_1000097314 253
166 3300014326 Ga0157380_10430641 Ga0157380_104306412 253
167 3300014326 Ga0157380_10907327 Ga0157380_109073271 253
168 3300014745 Ga0157377_10003472 Ga0157377_100034724 253
169 3300014745 Ga0157377_10010978 Ga0157377_100109783 253
170 3300014968 Ga0157379_10011042 Ga0157379_100110425 253
171 3300014968 Ga0157379_10061033 Ga0157379_100610332 253
172 3300014968 Ga0157379_10299480 Ga0157379_102994802 253
173 3300014968 Ga0157379_10427214 Ga0157379_104272142 253
174 3300014969 Ga0157376_10000482 Ga0157376_1000048223 253
175 3300014969 Ga0157376_10016550 Ga0157376_100165501 253
176 3300014969 Ga0157376_10041114 Ga0157376_100411145 253
177 3300017792 Ga0163161_10006237 Ga0163161_100062375 253
178 3300017792 Ga0163161_10310724 Ga0163161_103107241 253
179 3300025315 Ga0207697_10110647 Ga0207697_101106472 253
180 3300025900 Ga0207710_10007094 Ga0207710_100070946 253
181 3300025903 Ga0207680_10075512 Ga0207680_100755122 253
182 3300025903 Ga0207680_10531613 Ga0207680_105316131 253
183 3300025904 Ga0207647_10249925 Ga0207647_102499252 253
184 3300025907 Ga0207645_10008581 Ga0207645_100085811 253
185 3300025907 Ga0207645_10020979 Ga0207645_100209795 253
186 3300025909 Ga0207705_10238420 Ga0207705_102384202 253
187 3300025913 Ga0207695_10130845 Ga0207695_101308454 253
188 3300025913 Ga0207695_10359298 Ga0207695_103592982 253
189 3300025920 Ga0207649_10005106 Ga0207649_100051069 253
190 3300025920 Ga0207649_10005653 Ga0207649_100056533 253
191 3300025923 Ga0207681_10313829 Ga0207681_103138292 253
192 3300025925 Ga0207650_10071855 Ga0207650_100718551 253
193 3300025925 Ga0207650_10105236 Ga0207650_101052363 253
194 3300025925 Ga0207650_10137224 Ga0207650_101372244 253
195 3300025925 Ga0207650_10187350 Ga0207650_101873503 253
196 3300025926 Ga0207659_10019428 Ga0207659_100194283 253
197 3300025926 Ga0207659_10311622 Ga0207659_103116221 253
198 3300025931 Ga0207644_10049847 Ga0207644_100498471 253
199 3300025931 Ga0207644_10163916 Ga0207644_101639162 253
200 3300025932 Ga0207690_10171450 Ga0207690_101714502 253
201 3300025932 Ga0207690_10271468 Ga0207690_102714682 253
202 3300025933 Ga0207706_10015309 Ga0207706_100153098 253
203 3300025933 Ga0207706_10029962 Ga0207706_100299625 253
204 3300025933 Ga0207706_10032827 Ga0207706_100328275 253
205 3300025933 Ga0207706_10077635 Ga0207706_100776352 253
206 3300025934 Ga0207686_10261878 Ga0207686_102618782 253
207 3300025936 Ga0207670_10020660 Ga0207670_100206602 253
208 3300025936 Ga0207670_10022239 Ga0207670_100222392 253
209 3300025937 Ga0207669_10351695 Ga0207669_103516952 253
210 3300025938 Ga0207704_10036651 Ga0207704_100366513 253
211 3300025940 Ga0207691_10126450 Ga0207691_101264503 253
212 3300025940 Ga0207691_10238304 Ga0207691_102383041 253
213 3300025941 Ga0207711_10463195 Ga0207711_104631952 253
214 3300025942 Ga0207689_10013015 Ga0207689_100130159 253
215 3300025942 Ga0207689_10043720 Ga0207689_100437201 253
216 3300025944 Ga0207661_10003519 Ga0207661_100035196 253
217 3300025944 Ga0207661_10013659 Ga0207661_100136594 253
218 3300025944 Ga0207661_10029870 Ga0207661_100298705 253
219 3300025945 Ga0207679_10000391 Ga0207679_1000039128 253
220 3300025945 Ga0207679_10291558 Ga0207679_102915581 253
221 3300025960 Ga0207651_10012448 Ga0207651_100124482 253
222 3300025961 Ga0207712_10089376 Ga0207712_100893763 253
223 3300025961 Ga0207712_10115694 Ga0207712_101156942 253
224 3300025961 Ga0207712_10131182 Ga0207712_101311822 253
225 3300025972 Ga0207668_10057455 Ga0207668_100574553 253
226 3300025981 Ga0207640_10144763 Ga0207640_101447631 253
227 3300025986 Ga0207658_10202537 Ga0207658_102025372 253
228 3300026023 Ga0207677_10024930 Ga0207677_100249302 253
229 3300026041 Ga0207639_10227628 Ga0207639_102276282 253
230 3300026067 Ga0207678_10175767 Ga0207678_101757671 253
231 3300026088 Ga0207641_10091229 Ga0207641_100912293 253
232 3300026088 Ga0207641_10190047 Ga0207641_101900473 253
233 3300026088 Ga0207641_10193413 Ga0207641_101934132 253
234 3300026089 Ga0207648_10006979 Ga0207648_1000697911 253
235 3300026089 Ga0207648_10093869 Ga0207648_100938692 253
236 3300026095 Ga0207676_10002355 Ga0207676_100023553 253
237 3300026095 Ga0207676_10402602 Ga0207676_104026022 253
238 3300026116 Ga0207674_10001890 Ga0207674_100018904 253
239 3300026116 Ga0207674_10004509 Ga0207674_1000450913 253
240 3300026118 Ga0207675_100000359 Ga0207675_10000035932 253
241 3300026121 Ga0207683_10077172 Ga0207683_100771723 253
242 3300026121 Ga0207683_10110779 Ga0207683_101107794 253
243 3300026142 Ga0207698_10124472 Ga0207698_101244722 253
244 3300026142 Ga0207698_10181425 Ga0207698_101814251 253
245 3300028379 Ga0268266_10036019 Ga0268266_100360194 253
246 3300028379 Ga0268266_10809385 Ga0268266_108093851 253
247 3300028380 Ga0268265_10004817 Ga0268265_100048172 253
248 3300028380 Ga0268265_10146360 Ga0268265_101463602 253
249 3300028381 Ga0268264_10017207 Ga0268264_100172074 253
250 3300028381 Ga0268264_10225710 Ga0268264_102257103 253
251 3300028381 Ga0268264_10369736 Ga0268264_103697362 253
252 3300028794 Ga0307515_10000001 Ga0307515_100000011304 253
253 3300028800 Ga0265338_10026397 Ga0265338_100263974 253
254 3300031251 Ga0265327_10000440 Ga0265327_1000044017 253
255 3300031456 Ga0307513_10051322 Ga0307513_100513222 253
256 3300031456 Ga0307513_10352451 Ga0307513_103524511 253
257 3300031507 Ga0307509_10037736 Ga0307509_100377363 253
258 3300031507 Ga0307509_10309073 Ga0307509_103090732 253
259 3300035695 Ga0373927_0005537 Ga0373927_0005537_5911_6687 253
260 3300036401 Ga0373937_0016236 Ga0373937_0016236_3055_3831 253
261 3300041509 Ga0451843_0362820 Ga0451843_0362820_196_957 253
262 3300045049 Ga0466959_0114365 Ga0466959_0114365_342_1118 253
263 3300046454 Ga0495592_0092667 Ga0495592_0092667_386_1162 253
264 3300046517 Ga0495630_0025276 Ga0495630_0025276_388_1164 253
265 3300046533 Ga0495640_0342044 Ga0495640_0342044_151_912 253
266 3300046616 Ga0495668_0001051 Ga0495668_0001051_23905_24681 253
267 3300046616 Ga0495668_0014854 Ga0495668_0014854_2857_3633 253
268 3300046675 Ga0495657_0067426 Ga0495657_0067426_840_1616 253
269 3300046680 Ga0495646_0034961 Ga0495646_0034961_1952_2728 253
270 3300047320 Ga0495672_0018066 Ga0495672_0018066_2887_3663 253
271 3300047321 Ga0495676_0348037 Ga0495676_0348037_22_798 253
272 3300047322 Ga0495680_0064105 Ga0495680_0064105_1377_2153 253
273 3300047444 Ga0495675_0101641 Ga0495675_0101641_623_1399 253
274 3300047472 Ga0495686_0000322 Ga0495686_0000322_8418_9221 253
275 3300048903 Ga0496100_0701004 Ga0496100_0701004_13_774 253
276 3300048904 Ga0496101_0086402 Ga0496101_0086402_47_808 253
277 3300048913 Ga0496110_0058385 Ga0496110_0058385_1492_2268 253
278 3300048913 Ga0496110_0108822 Ga0496110_0108822_272_1048 253
279 3300048917 Ga0496114_0375254 Ga0496114_0375254_223_984 253
280 3300050511 nmdc:mga08y16_3350_c1 nmdc:mga08y16_3350_c1_4012_4788 253
281 3300053085 Ga0495619_0059311 Ga0495619_0059311_143_919 253
282 3300053136 Ga0500559_0023505 Ga0500559_0023505_1348_2109 253
283 3300053146 Ga0500588_0000498 Ga0500588_0000498_236_1012 253
284 3300053730 Ga0500645_016255 Ga0500645_016255_439_1215 253
285 iso_pu_bacteria 2881955468 2881955708 253
286 3300001979 JGI24740J21852_10025974 JGI24740J21852_100259742 254
287 3300002077 JGI24744J21845_10015297 JGI24744J21845_100152972 254
288 3300003316 rootH1_10055331 rootH1_100553315 254
289 3300003320 rootH2_10011844 rootH2_100118443 254
290 3300003320 rootH2_10042039 rootH2_100420393 254
291 3300003322 rootL2_10060235 rootL2_100602354 254
292 3300003323 rootH1_10002440 rootH1_100024408 254
293 3300003323 rootH1_10227635 rootH1_102276352 254
294 3300003354 JGI25160J50197_1001859 JGI25160J50197_10018596 254
295 3300003354 JGI25160J50197_1008132 JGI25160J50197_10081323 254
296 3300003761 Ga0055535_1007531 Ga0055535_10075312 254
297 3300003762 Ga0055542_1001813 Ga0055542_10018133 254
298 3300003794 Ga0055531_10000145 Ga0055531_1000014562 254
299 3300005289 Ga0065704_10150728 Ga0065704_101507281 254
300 3300005290 Ga0065712_10022575 Ga0065712_100225751 254
301 3300005290 Ga0065712_10026502 Ga0065712_100265022 254
302 3300005295 Ga0065707_10188054 Ga0065707_101880542 254
303 3300005327 Ga0070658_10171519 Ga0070658_101715192 254
304 3300005327 Ga0070658_10293491 Ga0070658_102934911 254
305 3300005328 Ga0070676_10238920 Ga0070676_102389201 254
306 3300005329 Ga0070683_100104126 Ga0070683_1001041261 254
307 3300005330 Ga0070690_100014268 Ga0070690_1000142684 254
308 3300005330 Ga0070690_100193665 Ga0070690_1001936652 254
309 3300005331 Ga0070670_100024858 Ga0070670_1000248585 254
310 3300005331 Ga0070670_100066625 Ga0070670_1000666253 254
311 3300005331 Ga0070670_100118734 Ga0070670_1001187341 254
312 3300005331 Ga0070670_100153735 Ga0070670_1001537352 254
313 3300005334 Ga0068869_100003189 Ga0068869_10000318912 254
314 3300005334 Ga0068869_100044406 Ga0068869_1000444065 254
315 3300005334 Ga0068869_100046935 Ga0068869_1000469354 254
316 3300005334 Ga0068869_100096571 Ga0068869_1000965714 254
317 3300005335 Ga0070666_10000494 Ga0070666_1000049416 254
318 3300005335 Ga0070666_10046730 Ga0070666_100467302 254
319 3300005335 Ga0070666_10107213 Ga0070666_101072132 254
320 3300005335 Ga0070666_10114691 Ga0070666_101146913 254
321 3300005336 Ga0070680_100029490 Ga0070680_1000294902 254
322 3300005336 Ga0070680_100177809 Ga0070680_1001778092 254
323 3300005337 Ga0070682_100014031 Ga0070682_1000140313 254
324 3300005337 Ga0070682_100023486 Ga0070682_1000234862 254
325 3300005337 Ga0070682_100034117 Ga0070682_1000341174 254
326 3300005337 Ga0070682_100136595 Ga0070682_1001365952 254
327 3300005338 Ga0068868_100028228 Ga0068868_1000282282 254
328 3300005338 Ga0068868_100041817 Ga0068868_1000418173 254
329 3300005338 Ga0068868_100053100 Ga0068868_1000531004 254
330 3300005338 Ga0068868_100159045 Ga0068868_1001590453 254
331 3300005339 Ga0070660_100008806 Ga0070660_1000088062 254
332 3300005339 Ga0070660_100025573 Ga0070660_1000255734 254
333 3300005339 Ga0070660_100036738 Ga0070660_1000367382 254
334 3300005340 Ga0070689_100013502 Ga0070689_1000135028 254
335 3300005343 Ga0070687_100076672 Ga0070687_1000766722 254
336 3300005344 Ga0070661_100090405 Ga0070661_1000904052 254
337 3300005347 Ga0070668_100541666 Ga0070668_1005416661 254
338 3300005353 Ga0070669_100084745 Ga0070669_1000847452 254
339 3300005354 Ga0070675_100133043 Ga0070675_1001330433 254
340 3300005354 Ga0070675_100185965 Ga0070675_1001859652 254
341 3300005355 Ga0070671_100010922 Ga0070671_1000109227 254
342 3300005355 Ga0070671_100032531 Ga0070671_1000325313 254
343 3300005355 Ga0070671_100104256 Ga0070671_1001042562 254
344 3300005355 Ga0070671_100174876 Ga0070671_1001748762 254
345 3300005356 Ga0070674_100056548 Ga0070674_1000565484 254
346 3300005356 Ga0070674_100074879 Ga0070674_1000748793 254
347 3300005356 Ga0070674_100208115 Ga0070674_1002081152 254
348 3300005364 Ga0070673_100012291 Ga0070673_1000122913 254
349 3300005364 Ga0070673_100293741 Ga0070673_1002937412 254
350 3300005365 Ga0070688_100052920 Ga0070688_1000529203 254
351 3300005365 Ga0070688_100461733 Ga0070688_1004617331 254
352 3300005366 Ga0070659_100009607 Ga0070659_1000096075 254
353 3300005366 Ga0070659_100115822 Ga0070659_1001158222 254
354 3300005367 Ga0070667_100002118 Ga0070667_10000211811 254
355 3300005367 Ga0070667_100012244 Ga0070667_1000122447 254
356 3300005367 Ga0070667_100207792 Ga0070667_1002077923 254
357 3300005367 Ga0070667_100216469 Ga0070667_1002164691 254
358 3300005441 Ga0070700_100165919 Ga0070700_1001659191 254
359 3300005456 Ga0070678_100127346 Ga0070678_1001273463 254
360 3300005457 Ga0070662_100026249 Ga0070662_1000262494 254
361 3300005458 Ga0070681_10040115 Ga0070681_100401153 254
362 3300005458 Ga0070681_10042587 Ga0070681_100425872 254
363 3300005458 Ga0070681_10083510 Ga0070681_100835102 254
364 3300005459 Ga0068867_100012907 Ga0068867_1000129073 254
365 3300005459 Ga0068867_100735824 Ga0068867_1007358241 254
366 3300005466 Ga0070685_10086583 Ga0070685_100865832 254
367 3300005466 Ga0070685_10306769 Ga0070685_103067691 254
368 3300005468 Ga0070707_100153722 Ga0070707_1001537221 254
369 3300005471 Ga0070698_100002098 Ga0070698_10000209818 254
370 3300005530 Ga0070679_100000723 Ga0070679_1000007238 254
371 3300005530 Ga0070679_100011352 Ga0070679_1000113525 254
372 3300005530 Ga0070679_100189299 Ga0070679_1001892992 254
373 3300005530 Ga0070679_100281455 Ga0070679_1002814552 254
374 3300005530 Ga0070679_100326678 Ga0070679_1003266782 254
375 3300005535 Ga0070684_100025026 Ga0070684_1000250265 254
376 3300005535 Ga0070684_100078655 Ga0070684_1000786553 254
377 3300005535 Ga0070684_100143033 Ga0070684_1001430332 254
378 3300005539 Ga0068853_100032600 Ga0068853_1000326002 254
379 3300005539 Ga0068853_100040732 Ga0068853_1000407321 254
380 3300005539 Ga0068853_100041327 Ga0068853_1000413272 254
381 3300005539 Ga0068853_100051928 Ga0068853_1000519283 254
382 3300005539 Ga0068853_100084001 Ga0068853_1000840013 254
383 3300005543 Ga0070672_100021588 Ga0070672_1000215885 254
384 3300005543 Ga0070672_100099984 Ga0070672_1000999841 254
385 3300005543 Ga0070672_100164049 Ga0070672_1001640492 254
386 3300005544 Ga0070686_100168186 Ga0070686_1001681863 254
387 3300005548 Ga0070665_100000009 Ga0070665_10000000954 254
388 3300005563 Ga0068855_100037651 Ga0068855_1000376514 254
389 3300005563 Ga0068855_100149470 Ga0068855_1001494701 254
390 3300005564 Ga0070664_100046301 Ga0070664_1000463012 254
391 3300005564 Ga0070664_100060152 Ga0070664_1000601523 254
392 3300005577 Ga0068857_100120806 Ga0068857_1001208062 254
393 3300005577 Ga0068857_100505375 Ga0068857_1005053751 254
394 3300005578 Ga0068854_100007154 Ga0068854_1000071543 254
395 3300005578 Ga0068854_100122753 Ga0068854_1001227533 254
396 3300005614 Ga0068856_100021551 Ga0068856_1000215515 254
397 3300005614 Ga0068856_100022647 Ga0068856_1000226474 254
398 3300005614 Ga0068856_100101482 Ga0068856_1001014822 254
399 3300005614 Ga0068856_100169939 Ga0068856_1001699393 254
400 3300005615 Ga0070702_100018678 Ga0070702_1000186782 254
401 3300005616 Ga0068852_100003236 Ga0068852_1000032362 254
402 3300005616 Ga0068852_100152109 Ga0068852_1001521091 254
403 3300005616 Ga0068852_100439524 Ga0068852_1004395241 254
404 3300005616 Ga0068852_100492592 Ga0068852_1004925922 254
405 3300005616 Ga0068852_100860810 Ga0068852_1008608101 254
406 3300005617 Ga0068859_100000186 Ga0068859_10000018634 254
407 3300005617 Ga0068859_100028632 Ga0068859_1000286325 254
408 3300005617 Ga0068859_100477711 Ga0068859_1004777112 254
409 3300005618 Ga0068864_100091472 Ga0068864_1000914724 254
410 3300005618 Ga0068864_100343205 Ga0068864_1003432052 254
411 3300005618 Ga0068864_100348227 Ga0068864_1003482272 254
412 3300005618 Ga0068864_100435503 Ga0068864_1004355032 254
413 3300005719 Ga0068861_100003838 Ga0068861_1000038385 254
414 3300005719 Ga0068861_100015284 Ga0068861_1000152844 254
415 3300005834 Ga0068851_10198439 Ga0068851_101984391 254
416 3300005834 Ga0068851_10232301 Ga0068851_102323012 254
417 3300005840 Ga0068870_10092657 Ga0068870_100926572 254
418 3300005841 Ga0068863_100005438 Ga0068863_1000054383 254
419 3300005841 Ga0068863_100010031 Ga0068863_1000100316 254
420 3300005841 Ga0068863_100355766 Ga0068863_1003557663 254
421 3300005842 Ga0068858_100034101 Ga0068858_1000341016 254
422 3300005842 Ga0068858_100055774 Ga0068858_1000557744 254
423 3300005843 Ga0068860_100000103 Ga0068860_10000010337 254
424 3300005843 Ga0068860_100007278 Ga0068860_1000072783 254
425 3300005843 Ga0068860_100008158 Ga0068860_10000815813 254
426 3300005843 Ga0068860_100015108 Ga0068860_1000151088 254
427 3300005843 Ga0068860_100108739 Ga0068860_1001087394 254
428 3300005843 Ga0068860_100118158 Ga0068860_1001181583 254
429 3300005843 Ga0068860_100381874 Ga0068860_1003818741 254
430 3300005844 Ga0068862_100131918 Ga0068862_1001319183 254
431 3300005983 Ga0081540_1021508 Ga0081540_10215084 254
432 3300005985 Ga0081539_10001436 Ga0081539_1000143631 254
433 3300006195 Ga0075366_10190833 Ga0075366_101908332 254
434 3300006237 Ga0097621_100016613 Ga0097621_1000166134 254
435 3300006237 Ga0097621_100035111 Ga0097621_1000351113 254
436 3300006237 Ga0097621_100067639 Ga0097621_1000676392 254
437 3300006237 Ga0097621_100069959 Ga0097621_1000699594 254
438 3300006358 Ga0068871_100020662 Ga0068871_1000206623 254
439 3300006358 Ga0068871_100045193 Ga0068871_1000451934 254
440 3300006358 Ga0068871_100050289 Ga0068871_1000502893 254
441 3300006358 Ga0068871_100072907 Ga0068871_1000729072 254
442 3300006358 Ga0068871_100143196 Ga0068871_1001431963 254
443 3300006358 Ga0068871_100188926 Ga0068871_1001889263 254
444 3300006358 Ga0068871_100281803 Ga0068871_1002818032 254
445 3300006358 Ga0068871_100575784 Ga0068871_1005757841 254
446 3300006844 Ga0075428_100002349 Ga0075428_10000234917 254
447 3300006844 Ga0075428_100008703 Ga0075428_10000870312 254
448 3300006846 Ga0075430_100010476 Ga0075430_1000104761 254
449 3300006846 Ga0075430_100069014 Ga0075430_1000690143 254
450 3300006847 Ga0075431_100001800 Ga0075431_1000018005 254
451 3300006847 Ga0075431_100035126 Ga0075431_1000351265 254
452 3300006847 Ga0075431_100162372 Ga0075431_1001623724 254
453 3300006880 Ga0075429_100004013 Ga0075429_10000401311 254
454 3300006880 Ga0075429_100022149 Ga0075429_1000221497 254
455 3300006931 Ga0097620_100000186 Ga0097620_10000018628 254
456 3300006931 Ga0097620_100028632 Ga0097620_1000286325 254
457 3300006931 Ga0097620_100477720 Ga0097620_1004777202 254
458 3300009093 Ga0105240_10000131 Ga0105240_1000013174 254
459 3300009093 Ga0105240_10000194 Ga0105240_1000019474 254
460 3300009093 Ga0105240_10011235 Ga0105240_100112359 254
461 3300009093 Ga0105240_10055254 Ga0105240_100552543 254
462 3300009093 Ga0105240_10056004 Ga0105240_100560044 254
463 3300009093 Ga0105240_10249085 Ga0105240_102490852 254
464 3300009093 Ga0105240_10458175 Ga0105240_104581752 254
465 3300009094 Ga0111539_10400481 Ga0111539_104004812 254
466 3300009094 Ga0111539_10879248 Ga0111539_108792482 254
467 3300009101 Ga0105247_10006330 Ga0105247_100063305 254
468 3300009147 Ga0114129_10130029 Ga0114129_101300292 254
469 3300009148 Ga0105243_10118455 Ga0105243_101184552 254
470 3300009148 Ga0105243_10350961 Ga0105243_103509611 254
471 3300009174 Ga0105241_10007177 Ga0105241_100071778 254
472 3300009174 Ga0105241_10031420 Ga0105241_100314204 254
473 3300009174 Ga0105241_10064593 Ga0105241_100645934 254
474 3300009174 Ga0105241_10194874 Ga0105241_101948741 254
475 3300009176 Ga0105242_10016017 Ga0105242_100160175 254
476 3300009176 Ga0105242_10167145 Ga0105242_101671452 254
477 3300009176 Ga0105242_10297766 Ga0105242_102977661 254
478 3300009176 Ga0105242_10550028 Ga0105242_105500282 254
479 3300009177 Ga0105248_10469247 Ga0105248_104692471 254
480 3300009177 Ga0105248_10481803 Ga0105248_104818032 254
481 3300009545 Ga0105237_10001232 Ga0105237_1000123227 254
482 3300009545 Ga0105237_10005887 Ga0105237_100058877 254
483 3300009545 Ga0105237_10052271 Ga0105237_100522714 254
484 3300009545 Ga0105237_10066269 Ga0105237_100662693 254
485 3300009545 Ga0105237_10086981 Ga0105237_100869814 254
486 3300009545 Ga0105237_10199158 Ga0105237_101991582 254
487 3300009551 Ga0105238_10004908 Ga0105238_100049084 254
488 3300009551 Ga0105238_10071256 Ga0105238_100712564 254
489 3300009551 Ga0105238_10595846 Ga0105238_105958461 254
490 3300009553 Ga0105249_10001561 Ga0105249_1000156110 254
491 3300009553 Ga0105249_10004716 Ga0105249_100047166 254
492 3300009553 Ga0105249_10010856 Ga0105249_100108564 254
493 3300010375 Ga0105239_10000246 Ga0105239_1000024635 254
494 3300010375 Ga0105239_10001470 Ga0105239_1000147018 254
495 3300010375 Ga0105239_10006659 Ga0105239_100066599 254
496 3300010375 Ga0105239_10018569 Ga0105239_100185698 254
497 3300010375 Ga0105239_10024439 Ga0105239_100244396 254
498 3300010375 Ga0105239_10064401 Ga0105239_100644014 254
499 3300011119 Ga0105246_10113769 Ga0105246_101137692 254
500 3300013100 Ga0157373_10021980 Ga0157373_100219806 254
501 3300013100 Ga0157373_10037206 Ga0157373_100372062 254
502 3300013100 Ga0157373_10051215 Ga0157373_100512153 254
503 3300013102 Ga0157371_10022360 Ga0157371_100223602 254
504 3300013102 Ga0157371_10030133 Ga0157371_100301335 254
505 3300013102 Ga0157371_10033448 Ga0157371_100334483 254
506 3300013102 Ga0157371_10111040 Ga0157371_101110401 254
507 3300013104 Ga0157370_10000860 Ga0157370_1000086016 254
508 3300013104 Ga0157370_10003477 Ga0157370_100034775 254
509 3300013104 Ga0157370_10101415 Ga0157370_101014153 254
510 3300013105 Ga0157369_10052626 Ga0157369_100526262 254
511 3300013105 Ga0157369_10084258 Ga0157369_100842582 254
512 3300013105 Ga0157369_10170556 Ga0157369_101705563 254
513 3300013105 Ga0157369_10268431 Ga0157369_102684312 254
514 3300013296 Ga0157374_10000002 Ga0157374_10000002524 254
515 3300013296 Ga0157374_10115391 Ga0157374_101153913 254
516 3300013296 Ga0157374_10217981 Ga0157374_102179813 254
517 3300013296 Ga0157374_10352697 Ga0157374_103526971 254
518 3300013296 Ga0157374_10436586 Ga0157374_104365861 254
519 3300013296 Ga0157374_10475786 Ga0157374_104757861 254
520 3300013297 Ga0157378_10019947 Ga0157378_100199472 254
521 3300013297 Ga0157378_10036858 Ga0157378_100368584 254
522 3300013297 Ga0157378_10053382 Ga0157378_100533822 254
523 3300013297 Ga0157378_10054357 Ga0157378_100543573 254
524 3300013297 Ga0157378_10146489 Ga0157378_101464892 254
525 3300013297 Ga0157378_10201193 Ga0157378_102011931 254
526 3300013297 Ga0157378_10455207 Ga0157378_104552071 254
527 3300013297 Ga0157378_10755168 Ga0157378_107551682 254
528 3300013306 Ga0163162_10000269 Ga0163162_100002695 254
529 3300013306 Ga0163162_10000503 Ga0163162_1000050319 254
530 3300013306 Ga0163162_10004762 Ga0163162_100047622 254
531 3300013306 Ga0163162_10011935 Ga0163162_100119354 254
532 3300013306 Ga0163162_10042898 Ga0163162_100428985 254
533 3300013306 Ga0163162_10215481 Ga0163162_102154811 254
534 3300013306 Ga0163162_10330051 Ga0163162_103300512 254
535 3300013306 Ga0163162_10340255 Ga0163162_103402552 254
536 3300013306 Ga0163162_10667232 Ga0163162_106672321 254
537 3300013306 Ga0163162_10717008 Ga0163162_107170082 254
538 3300013307 Ga0157372_10001229 Ga0157372_100012295 254
539 3300013307 Ga0157372_10024621 Ga0157372_100246214 254
540 3300013307 Ga0157372_10057201 Ga0157372_100572014 254
541 3300013307 Ga0157372_10070768 Ga0157372_100707684 254
542 3300013307 Ga0157372_10092267 Ga0157372_100922673 254
543 3300013307 Ga0157372_10149244 Ga0157372_101492443 254
544 3300013307 Ga0157372_10175438 Ga0157372_101754383 254
545 3300013307 Ga0157372_10244853 Ga0157372_102448532 254
546 3300013307 Ga0157372_10526893 Ga0157372_105268932 254
547 3300013307 Ga0157372_10600481 Ga0157372_106004812 254
548 3300013307 Ga0157372_11214187 Ga0157372_112141871 254
549 3300013308 Ga0157375_10011842 Ga0157375_100118425 254
550 3300013308 Ga0157375_10083868 Ga0157375_100838684 254
551 3300013308 Ga0157375_10087696 Ga0157375_100876962 254
552 3300013308 Ga0157375_10087931 Ga0157375_100879312 254
553 3300013308 Ga0157375_10254367 Ga0157375_102543673 254
554 3300013308 Ga0157375_10260730 Ga0157375_102607302 254
555 3300013308 Ga0157375_10460213 Ga0157375_104602132 254
556 3300013308 Ga0157375_10747193 Ga0157375_107471932 254
557 3300014325 Ga0163163_10218594 Ga0163163_102185941 254
558 3300014325 Ga0163163_10518876 Ga0163163_105188761 254
559 3300014325 Ga0163163_10631219 Ga0163163_106312191 254
560 3300014326 Ga0157380_10039474 Ga0157380_100394742 254
561 3300014326 Ga0157380_10101750 Ga0157380_101017503 254
562 3300014745 Ga0157377_10063284 Ga0157377_100632842 254
563 3300014745 Ga0157377_10210471 Ga0157377_102104712 254
564 3300014968 Ga0157379_10137811 Ga0157379_101378111 254
565 3300014968 Ga0157379_10149734 Ga0157379_101497342 254
566 3300014969 Ga0157376_10005255 Ga0157376_100052556 254
567 3300014969 Ga0157376_10010084 Ga0157376_100100846 254
568 3300014969 Ga0157376_10217687 Ga0157376_102176872 254
569 3300014969 Ga0157376_10412714 Ga0157376_104127141 254
570 3300015265 Ga0182005_1000141 Ga0182005_100014111 254
571 3300017792 Ga0163161_10010065 Ga0163161_100100655 254
572 3300017792 Ga0163161_10110674 Ga0163161_101106741 254
573 3300017792 Ga0163161_10146204 Ga0163161_101462043 254
574 3300017792 Ga0163161_10153297 Ga0163161_101532972 254
575 3300017792 Ga0163161_10244592 Ga0163161_102445922 254
576 3300017792 Ga0163161_10781619 Ga0163161_107816191 254
577 3300021384 Ga0213876_10002105 Ga0213876_1000210516 254
578 3300021384 Ga0213876_10022393 Ga0213876_100223932 254
579 3300025208 Ga0209436_106646 Ga0209436_1066462 254
580 3300025242 Ga0209258_100251 Ga0209258_10025161 254
581 3300025254 Ga0209148_1000226 Ga0209148_100022619 254
582 3300025284 Ga0209130_1005524 Ga0209130_10055244 254
583 3300025302 Ga0207426_1000019 Ga0207426_10000198 254
584 3300025302 Ga0207426_1000073 Ga0207426_1000073225 254
585 3300025304 Ga0209257_1000013 Ga0209257_100001377 254
586 3300025321 Ga0207656_10157521 Ga0207656_101575212 254
587 3300025899 Ga0207642_10023623 Ga0207642_100236232 254
588 3300025900 Ga0207710_10061500 Ga0207710_100615004 254
589 3300025903 Ga0207680_10000236 Ga0207680_1000023616 254
590 3300025903 Ga0207680_10075368 Ga0207680_100753683 254
591 3300025903 Ga0207680_10117968 Ga0207680_101179681 254
592 3300025904 Ga0207647_10014191 Ga0207647_100141915 254
593 3300025904 Ga0207647_10016241 Ga0207647_100162417 254
594 3300025907 Ga0207645_10073351 Ga0207645_100733511 254
595 3300025907 Ga0207645_10177282 Ga0207645_101772822 254
596 3300025908 Ga0207643_10004789 Ga0207643_100047894 254
597 3300025909 Ga0207705_10494944 Ga0207705_104949442 254
598 3300025911 Ga0207654_10140733 Ga0207654_101407332 254
599 3300025911 Ga0207654_10161714 Ga0207654_101617142 254
600 3300025912 Ga0207707_10524828 Ga0207707_105248282 254
601 3300025913 Ga0207695_10000016 Ga0207695_10000016572 254
602 3300025913 Ga0207695_10000217 Ga0207695_1000021778 254
603 3300025913 Ga0207695_10006326 Ga0207695_1000632613 254
604 3300025913 Ga0207695_10010445 Ga0207695_100104456 254
605 3300025913 Ga0207695_10042677 Ga0207695_100426775 254
606 3300025913 Ga0207695_10129963 Ga0207695_101299633 254
607 3300025913 Ga0207695_10295585 Ga0207695_102955851 254
608 3300025914 Ga0207671_10003616 Ga0207671_100036167 254
609 3300025914 Ga0207671_10004977 Ga0207671_1000497711 254
610 3300025914 Ga0207671_10006106 Ga0207671_1000610611 254
611 3300025914 Ga0207671_10030097 Ga0207671_100300974 254
612 3300025917 Ga0207660_10090125 Ga0207660_100901253 254
613 3300025917 Ga0207660_10353152 Ga0207660_103531522 254
614 3300025917 Ga0207660_10387250 Ga0207660_103872502 254
615 3300025918 Ga0207662_10009899 Ga0207662_100098996 254
616 3300025918 Ga0207662_10043890 Ga0207662_100438903 254
617 3300025919 Ga0207657_10012205 Ga0207657_100122054 254
618 3300025919 Ga0207657_10062733 Ga0207657_100627333 254
619 3300025920 Ga0207649_10086228 Ga0207649_100862283 254
620 3300025920 Ga0207649_10307152 Ga0207649_103071522 254
621 3300025921 Ga0207652_10000546 Ga0207652_100005468 254
622 3300025921 Ga0207652_10017232 Ga0207652_100172324 254
623 3300025921 Ga0207652_10094674 Ga0207652_100946743 254
624 3300025921 Ga0207652_10162553 Ga0207652_101625532 254
625 3300025921 Ga0207652_10244335 Ga0207652_102443353 254
626 3300025923 Ga0207681_10075306 Ga0207681_100753061 254
627 3300025924 Ga0207694_10029582 Ga0207694_100295825 254
628 3300025924 Ga0207694_10106234 Ga0207694_101062343 254
629 3300025925 Ga0207650_10028475 Ga0207650_100284755 254
630 3300025925 Ga0207650_10064915 Ga0207650_100649153 254
631 3300025925 Ga0207650_10086617 Ga0207650_100866173 254
632 3300025925 Ga0207650_10108738 Ga0207650_101087381 254
633 3300025925 Ga0207650_10329440 Ga0207650_103294401 254
634 3300025926 Ga0207659_10113203 Ga0207659_101132033 254
635 3300025931 Ga0207644_10067738 Ga0207644_100677383 254
636 3300025931 Ga0207644_10153290 Ga0207644_101532902 254
637 3300025931 Ga0207644_10189786 Ga0207644_101897862 254
638 3300025931 Ga0207644_10267455 Ga0207644_102674552 254
639 3300025934 Ga0207686_10001727 Ga0207686_100017278 254
640 3300025934 Ga0207686_10027849 Ga0207686_100278493 254
641 3300025934 Ga0207686_10306994 Ga0207686_103069942 254
642 3300025934 Ga0207686_10355821 Ga0207686_103558211 254
643 3300025936 Ga0207670_10038548 Ga0207670_100385484 254
644 3300025937 Ga0207669_10075525 Ga0207669_100755252 254
645 3300025937 Ga0207669_10560358 Ga0207669_105603581 254
646 3300025940 Ga0207691_10042428 Ga0207691_100424282 254
647 3300025940 Ga0207691_10129221 Ga0207691_101292211 254
648 3300025940 Ga0207691_10160440 Ga0207691_101604402 254
649 3300025940 Ga0207691_10166719 Ga0207691_101667192 254
650 3300025942 Ga0207689_10000687 Ga0207689_1000068716 254
651 3300025942 Ga0207689_10010494 Ga0207689_100104943 254
652 3300025942 Ga0207689_10047343 Ga0207689_100473435 254
653 3300025942 Ga0207689_10054304 Ga0207689_100543043 254
654 3300025942 Ga0207689_10061068 Ga0207689_100610684 254
655 3300025944 Ga0207661_10182718 Ga0207661_101827181 254
656 3300025945 Ga0207679_10041004 Ga0207679_100410043 254
657 3300025945 Ga0207679_10046169 Ga0207679_100461692 254
658 3300025949 Ga0207667_10002377 Ga0207667_100023774 254
659 3300025949 Ga0207667_10044109 Ga0207667_100441094 254
660 3300025960 Ga0207651_10049249 Ga0207651_100492494 254
661 3300025960 Ga0207651_10059851 Ga0207651_100598511 254
662 3300025960 Ga0207651_10077021 Ga0207651_100770212 254
663 3300025960 Ga0207651_10511602 Ga0207651_105116021 254
664 3300025961 Ga0207712_10001621 Ga0207712_1000162114 254
665 3300025961 Ga0207712_10027580 Ga0207712_100275802 254
666 3300025961 Ga0207712_10380889 Ga0207712_103808892 254
667 3300025972 Ga0207668_10065618 Ga0207668_100656182 254
668 3300025972 Ga0207668_10468506 Ga0207668_104685061 254
669 3300025981 Ga0207640_10213835 Ga0207640_102138351 254
670 3300025986 Ga0207658_10002069 Ga0207658_100020698 254
671 3300025986 Ga0207658_10024336 Ga0207658_100243367 254
672 3300025986 Ga0207658_10226135 Ga0207658_102261351 254
673 3300026023 Ga0207677_10047197 Ga0207677_100471972 254
674 3300026023 Ga0207677_10071144 Ga0207677_100711443 254
675 3300026023 Ga0207677_10153342 Ga0207677_101533423 254
676 3300026023 Ga0207677_10345200 Ga0207677_103452001 254
677 3300026035 Ga0207703_10021148 Ga0207703_100211485 254
678 3300026035 Ga0207703_10065810 Ga0207703_100658104 254
679 3300026035 Ga0207703_10534453 Ga0207703_105344531 254
680 3300026041 Ga0207639_10087919 Ga0207639_100879191 254
681 3300026041 Ga0207639_10192364 Ga0207639_101923642 254
682 3300026041 Ga0207639_10369963 Ga0207639_103699631 254
683 3300026067 Ga0207678_10117878 Ga0207678_101178782 254
684 3300026075 Ga0207708_10118932 Ga0207708_101189322 254
685 3300026078 Ga0207702_10041222 Ga0207702_100412224 254
686 3300026078 Ga0207702_10055438 Ga0207702_100554384 254
687 3300026078 Ga0207702_10085314 Ga0207702_100853142 254
688 3300026088 Ga0207641_10000194 Ga0207641_1000019433 254
689 3300026088 Ga0207641_10032468 Ga0207641_100324685 254
690 3300026088 Ga0207641_10092843 Ga0207641_100928432 254
691 3300026089 Ga0207648_10002952 Ga0207648_100029523 254
692 3300026089 Ga0207648_10106014 Ga0207648_101060144 254
693 3300026089 Ga0207648_10163339 Ga0207648_101633393 254
694 3300026089 Ga0207648_10178819 Ga0207648_101788192 254
695 3300026089 Ga0207648_10445944 Ga0207648_104459442 254
696 3300026089 Ga0207648_10656054 Ga0207648_106560542 254
697 3300026095 Ga0207676_10009188 Ga0207676_100091884 254
698 3300026095 Ga0207676_10091855 Ga0207676_100918552 254
699 3300026095 Ga0207676_10106351 Ga0207676_101063514 254
700 3300026095 Ga0207676_10172199 Ga0207676_101721992 254
701 3300026095 Ga0207676_10283053 Ga0207676_102830531 254
702 3300026095 Ga0207676_10312848 Ga0207676_103128482 254
703 3300026116 Ga0207674_10008250 Ga0207674_100082506 254
704 3300026116 Ga0207674_10024037 Ga0207674_100240372 254
705 3300026118 Ga0207675_100008546 Ga0207675_1000085465 254
706 3300026118 Ga0207675_100077748 Ga0207675_1000777483 254
707 3300026118 Ga0207675_100118148 Ga0207675_1001181482 254
708 3300026118 Ga0207675_100543847 Ga0207675_1005438472 254
709 3300026121 Ga0207683_10079045 Ga0207683_100790454 254
710 3300026121 Ga0207683_10108393 Ga0207683_101083934 254
711 3300026142 Ga0207698_10114523 Ga0207698_101145233 254
712 3300026142 Ga0207698_10644036 Ga0207698_106440361 254
713 3300027907 Ga0207428_10124108 Ga0207428_101241081 254
714 3300028379 Ga0268266_10000105 Ga0268266_1000010591 254
715 3300028380 Ga0268265_10283158 Ga0268265_102831582 254
716 3300028381 Ga0268264_10000013 Ga0268264_10000013283 254
717 3300028381 Ga0268264_10005141 Ga0268264_100051413 254
718 3300028381 Ga0268264_10010589 Ga0268264_100105895 254
719 3300028381 Ga0268264_10027588 Ga0268264_100275884 254
720 3300028381 Ga0268264_10031768 Ga0268264_100317687 254
721 3300028381 Ga0268264_10076822 Ga0268264_100768223 254
722 3300028381 Ga0268264_10193368 Ga0268264_101933682 254
723 3300028381 Ga0268264_10468347 Ga0268264_104683472 254
724 3300028786 Ga0307517_10000963 Ga0307517_1000096316 254
725 3300028786 Ga0307517_10124065 Ga0307517_101240651 254
726 3300028794 Ga0307515_10000074 Ga0307515_10000074132 254
727 3300031247 Ga0265340_10184270 Ga0265340_101842701 254
728 3300031251 Ga0265327_10000107 Ga0265327_1000010742 254
729 3300031251 Ga0265327_10013417 Ga0265327_100134174 254
730 3300031595 Ga0265313_10094585 Ga0265313_100945852 254
731 3300031616 Ga0307508_10000446 Ga0307508_1000044620 254
732 3300031730 Ga0307516_10042048 Ga0307516_100420486 254
733 3300031730 Ga0307516_10396901 Ga0307516_103969012 254
734 3300031824 Ga0307413_10043532 Ga0307413_100435323 254
735 3300031852 Ga0307410_10141746 Ga0307410_101417462 254
736 3300032002 Ga0307416_100945803 Ga0307416_1009458031 254
737 3300032005 Ga0307411_10436232 Ga0307411_104362322 254
738 3300032005 Ga0307411_10541162 Ga0307411_105411621 254
739 3300033179 Ga0307507_10060399 Ga0307507_100603994 254
740 3300033180 Ga0307510_10000555 Ga0307510_100005556 254
741 3300037312 Ga0395899_0001590 Ga0395899_0001590_10823_11647 254
742 3300037418 Ga0395900_0004139 Ga0395900_0004139_7311_8135 254
743 3300037418 Ga0395900_0005994 Ga0395900_0005994_2705_3484 254
744 3300037418 Ga0395900_0102716 Ga0395900_0102716_1395_2237 254
745 3300037418 Ga0395900_0334701 Ga0395900_0334701_271_1050 254
746 3300037466 Ga0395898_0001279 Ga0395898_0001279_23360_24184 254
747 3300037471 Ga0395905_0005471 Ga0395905_0005471_1944_2786 254
748 3300038443 Ga0395901_0004694 Ga0395901_0004694_3349_4173 254
749 3300039437 Ga0436365_0133629 Ga0436365_0133629_125_904 254
750 3300039437 Ga0436365_0509594 Ga0436365_0509594_7833_8612 254
751 3300039437 Ga0436365_0851555 Ga0436365_0851555_25_804 254
752 3300039437 Ga0436365_1079918 Ga0436365_1079918_11772_12551 254
753 3300039437 Ga0436365_1349840 Ga0436365_1349840_331_1110 254
754 3300039437 Ga0436365_1398854 Ga0436365_1398854_213_992 254
755 3300041404 Ga0439436_0010894 Ga0439436_0010894_819_1598 254
756 3300041406 Ga0439439_0008037 Ga0439439_0008037_1137_1916 254
757 3300041406 Ga0439439_0010046 Ga0439439_0010046_222_1001 254
758 3300041512 Ga0451853_1632338 Ga0451853_1632338_124_903 254
759 3300041997 Ga0439431_0001484 Ga0439431_0001484_2717_3496 254
760 3300041997 Ga0439431_0010623 Ga0439431_0010623_649_1428 254
761 3300041997 Ga0439431_0046198 Ga0439431_0046198_34_813 254
762 3300042001 Ga0439441_005343 Ga0439441_005343_159_938 254
763 3300042004 Ga0439445_0009386 Ga0439445_0009386_603_1382 254
764 3300042014 Ga0439457_001255 Ga0439457_001255_3641_4420 254
765 3300042015 Ga0439462_0005305 Ga0439462_0005305_831_1610 254
766 3300042135 Ga0450899_008281 Ga0450899_008281_96_875 254
767 3300044656 Ga0466969_0183978 Ga0466969_0183978_37_816 254
768 3300044658 Ga0466972_0000022 Ga0466972_0000022_93719_94501 254
769 3300044658 Ga0466972_0000083 Ga0466972_0000083_64685_65464 254
770 3300044658 Ga0466972_0008993 Ga0466972_0008993_197_961 254
771 3300044673 Ga0453683_0252664 Ga0453683_0252664_108_887 254
772 3300044712 Ga0453684_0319194 Ga0453684_0319194_426_1193 254
773 3300044765 Ga0466970_0000367 Ga0466970_0000367_11879_12661 254
774 3300044842 Ga0466957_0001147 Ga0466957_0001147_3312_4091 254
775 3300044842 Ga0466957_0157937 Ga0466957_0157937_512_1291 254
776 3300044901 Ga0466960_0030410 Ga0466960_0030410_638_1402 254
777 3300045051 Ga0451576_0361309 Ga0451576_0361309_194_997 254
778 3300045976 Ga0466967_0419645 Ga0466967_0419645_207_986 254
779 3300046453 Ga0495627_038356 Ga0495627_038356_10_789 254
780 3300046460 Ga0495638_0019515 Ga0495638_0019515_537_1301 254
781 3300046460 Ga0495638_0070770 Ga0495638_0070770_655_1419 254
782 3300046519 Ga0495632_0100707 Ga0495632_0100707_368_1147 254
783 3300046524 Ga0495648_0005425 Ga0495648_0005425_7724_8488 254
784 3300046558 Ga0495633_0000576 Ga0495633_0000576_15849_16658 254
785 3300046616 Ga0495668_0000108 Ga0495668_0000108_15750_16529 254
786 3300046648 Ga0495611_0000785 Ga0495611_0000785_6564_7328 254
787 3300046809 Ga0495600_0228455 Ga0495600_0228455_232_1110 254
788 3300047315 Ga0495581_0322353 Ga0495581_0322353_68_847 254
789 3300047320 Ga0495672_0007681 Ga0495672_0007681_184_963 254
790 3300047320 Ga0495672_0061917 Ga0495672_0061917_927_1691 254
791 3300047443 Ga0495687_000010 Ga0495687_000010_49782_50546 254
792 3300047443 Ga0495687_126662 Ga0495687_126662_109_888 254
793 3300047472 Ga0495686_0000195 Ga0495686_0000195_6929_7708 254
794 3300047472 Ga0495686_0039754 Ga0495686_0039754_952_1731 254
795 3300048904 Ga0496101_0164494 Ga0496101_0164494_100_879 254
796 3300048917 Ga0496114_0027289 Ga0496114_0027289_1381_2160 254
797 3300048918 Ga0496115_0175553 Ga0496115_0175553_380_1159 254
798 3300048927 Ga0496124_0047989 Ga0496124_0047989_2576_3340 254
799 3300048929 Ga0496126_0003675 Ga0496126_0003675_15404_16183 254
800 3300049523 Ga0501300_010190 Ga0501300_010190_349_1128 254
801 3300049568 Ga0501031_0171012 Ga0501031_0171012_583_1368 254
802 3300049569 Ga0501032_0006173 Ga0501032_0006173_3429_4208 254
803 3300049570 Ga0501033_0075464 Ga0501033_0075464_1436_2221 254
804 3300049571 Ga0501034_0138595 Ga0501034_0138595_970_1749 254
805 3300049571 Ga0501034_0156508 Ga0501034_0156508_141_926 254
806 3300049571 Ga0501034_0193871 Ga0501034_0193871_801_1580 254
807 3300049572 Ga0501036_0142628 Ga0501036_0142628_25_804 254
808 3300049573 Ga0501037_0006114 Ga0501037_0006114_4216_4980 254
809 3300049573 Ga0501037_0069074 Ga0501037_0069074_783_1562 254
810 3300049575 Ga0501039_0039794 Ga0501039_0039794_2562_3326 254
811 3300049579 Ga0501043_0004526 Ga0501043_0004526_4835_5614 254
812 3300049579 Ga0501043_0060263 Ga0501043_0060263_1168_1953 254
813 3300049580 Ga0501046_0003983 Ga0501046_0003983_6418_7197 254
814 3300049581 Ga0501047_0018963 Ga0501047_0018963_2862_3626 254
815 3300049582 Ga0501048_0046639 Ga0501048_0046639_526_1305 254
816 3300049583 Ga0501067_0304924 Ga0501067_0304924_56_835 254
817 3300049586 Ga0501070_0052241 Ga0501070_0052241_1893_2672 254
818 3300049589 Ga0501073_0000371 Ga0501073_0000371_6159_6938 254
819 3300049590 Ga0501074_0001823 Ga0501074_0001823_13286_14065 254
820 3300049652 Ga0501202_005461 Ga0501202_005461_1043_1822 254
821 3300049705 Ga0501225_0005750 Ga0501225_0005750_2702_3481 254
822 3300049758 Ga0501241_003204 Ga0501241_003204_1636_2400 254
823 3300049822 Ga0501035_0018959 Ga0501035_0018959_3078_3842 254
824 3300049822 Ga0501035_0071677 Ga0501035_0071677_2053_2838 254
825 3300049822 Ga0501035_0680809 Ga0501035_0680809_22_801 254
826 3300049823 Ga0501044_0040941 Ga0501044_0040941_3118_3882 254
827 3300049823 Ga0501044_0167344 Ga0501044_0167344_501_1286 254
828 3300049823 Ga0501044_0390655 Ga0501044_0390655_255_1034 254
829 3300050005 Ga0501284_00028 Ga0501284_00028_38077_38841 254
830 3300050493 nmdc:mga0k408_90431_c1 nmdc:mga0k408_90431_c1_695_1474 254
831 3300050507 nmdc:mga05p37_153807_c1 nmdc:mga05p37_153807_c1_1828_2607 254
832 3300050507 nmdc:mga05p37_95217_c1 nmdc:mga05p37_95217_c1_87_926 254
833 3300050508 nmdc:mga09592_241940_c1 nmdc:mga09592_241940_c1_189_1028 254
834 3300050511 nmdc:mga08y16_144765_c1 nmdc:mga08y16_144765_c1_1308_2087 254
835 3300053086 Ga0500578_0000718 Ga0500578_0000718_29154_29990 254
836 3300053088 Ga0500644_0000008 Ga0500644_0000008_28867_29646 254
837 3300053090 Ga0500646_0002493 Ga0500646_0002493_846_1625 254
838 3300053090 Ga0500646_0070148 Ga0500646_0070148_85_921 254
839 3300053092 Ga0500583_0088433 Ga0500583_0088433_49_828 254
840 3300053093 Ga0500651_0130404 Ga0500651_0130404_441_1220 254
841 3300053093 Ga0500651_0217713 Ga0500651_0217713_155_964 254
842 3300053098 Ga0500650_0041310 Ga0500650_0041310_362_1141 254
843 3300053108 Ga0500562_000010 Ga0500562_000010_98043_98822 254
844 3300053109 Ga0500569_000603 Ga0500569_000603_3460_4239 254
845 3300053121 Ga0500607_122404 Ga0500607_122404_30_809 254
846 3300053134 Ga0500658_0002665 Ga0500658_0002665_112_891 254
847 3300053136 Ga0500559_0104563 Ga0500559_0104563_173_952 254
848 3300053139 Ga0500568_0000562 Ga0500568_0000562_13269_14048 254
849 3300053142 Ga0500577_0095318 Ga0500577_0095318_365_1144 254
850 3300053147 Ga0500589_051861 Ga0500589_051861_81_860 254
851 3300053153 Ga0500616_0001133 Ga0500616_0001133_6466_7245 254
852 3300053153 Ga0500616_0007631 Ga0500616_0007631_3873_4652 254
853 3300053153 Ga0500616_0015241 Ga0500616_0015241_1668_2447 254
854 3300053153 Ga0500616_0064329 Ga0500616_0064329_1022_1801 254
855 3300053156 Ga0500622_0001907 Ga0500622_0001907_7555_8319 254
856 3300053156 Ga0500622_0003516 Ga0500622_0003516_1789_2568 254
857 3300053156 Ga0500622_0003745 Ga0500622_0003745_8337_9116 254
858 3300053158 Ga0500627_0046488 Ga0500627_0046488_463_1242 254
859 3300053160 Ga0500633_0000788 Ga0500633_0000788_1548_2327 254
860 3300053727 Ga0500611_013239 Ga0500611_013239_418_1197 254
861 3300060353 Ga0501082_0292598 Ga0501082_0292598_263_1042 254
862 iso_pu_bacteria 2818991444 2819587175 254
863 iso_pu_bacteria 2818991460 2819678713 254
864 iso_pu_bacteria 2884791551 2884791780 254
865 iso_pu_bacteria 2896109856 2896110066 254
866 iso_pu_bacteria 2914759650 2914760029 254
867 iso_pu_bacteria 2929154850 2929156806 254
868 iso_pu_bacteria 2929177148 2929182393 254
869 iso_pu_bacteria 2929239360 2929242423 254
870 2162886007 SwRhRL2b_contig_1496964 SwRhRL2b_0604.00001730 255
871 3300001979 JGI24740J21852_10002421 JGI24740J21852_100024211 255
872 3300001989 JGI24739J22299_10003460 JGI24739J22299_100034603 255
873 3300002738 JGI25154J39366_1000008 JGI25154J39366_1000008168 255
874 3300003215 JGI25153J46596_10015194 JGI25153J46596_100151944 255
875 3300003320 rootH2_10182038 rootH2_101820383 255
876 3300003322 rootL2_10014879 rootL2_100148796 255
877 3300003322 rootL2_10038788 rootL2_100387886 255
878 3300003322 rootL2_10218651 rootL2_102186512 255
879 3300003322 rootL2_10254425 rootL2_102544252 255
880 3300003323 rootH1_10003895 rootH1_100038951 255
881 3300003323 rootH1_10009220 rootH1_1000922019 255
882 3300003323 rootH1_10025005 rootH1_1002500521 255
883 3300003323 rootH1_10044057 rootH1_100440571 255
884 3300003323 rootH1_10046814 rootH1_1004681412 255
885 3300003323 rootH1_10163906 rootH1_101639062 255
886 3300003323 rootH1_10355453 rootH1_103554532 255
887 3300003354 JGI25160J50197_1002751 JGI25160J50197_10027512 255
888 3300003354 JGI25160J50197_1016930 JGI25160J50197_10169301 255
889 3300003771 Ga0055526_1057620 Ga0055526_10576201 255
890 3300003781 Ga0055536_1014404 Ga0055536_10144042 255
891 3300003790 Ga0055528_1000434 Ga0055528_100043412 255
892 3300003791 Ga0055530_10002451 Ga0055530_100024514 255
893 3300004799 Ga0058863_11501916 Ga0058863_115019162 255
894 3300004800 Ga0058861_11625277 Ga0058861_116252772 255
895 3300004803 Ga0058862_12122275 Ga0058862_121222751 255
896 3300005262 Ga0065165_1000012 Ga0065165_100001221 255
897 3300005262 Ga0065165_1000538 Ga0065165_100053811 255
898 3300005289 Ga0065704_10070178 Ga0065704_10070178116 255
899 3300005290 Ga0065712_10080017 Ga0065712_100800172 255
900 3300005293 Ga0065715_10145992 Ga0065715_101459922 255
901 3300005327 Ga0070658_10078668 Ga0070658_100786681 255
902 3300005327 Ga0070658_10106986 Ga0070658_101069862 255
903 3300005327 Ga0070658_10144629 Ga0070658_101446292 255
904 3300005327 Ga0070658_10222318 Ga0070658_102223182 255
905 3300005328 Ga0070676_10001097 Ga0070676_100010973 255
906 3300005329 Ga0070683_100312727 Ga0070683_1003127273 255
907 3300005333 Ga0070677_10265636 Ga0070677_102656361 255
908 3300005335 Ga0070666_10018002 Ga0070666_100180025 255
909 3300005336 Ga0070680_100063713 Ga0070680_1000637131 255
910 3300005337 Ga0070682_100000839 Ga0070682_1000008394 255
911 3300005338 Ga0068868_100045008 Ga0068868_1000450084 255
912 3300005338 Ga0068868_100189141 Ga0068868_1001891412 255
913 3300005339 Ga0070660_100010345 Ga0070660_1000103455 255
914 3300005339 Ga0070660_100108028 Ga0070660_1001080282 255
915 3300005339 Ga0070660_100196694 Ga0070660_1001966942 255
916 3300005339 Ga0070660_100586598 Ga0070660_1005865982 255
917 3300005347 Ga0070668_100058702 Ga0070668_1000587021 255
918 3300005353 Ga0070669_100178617 Ga0070669_1001786172 255
919 3300005354 Ga0070675_100152521 Ga0070675_1001525212 255
920 3300005356 Ga0070674_100036943 Ga0070674_1000369434 255
921 3300005356 Ga0070674_100154435 Ga0070674_1001544351 255
922 3300005356 Ga0070674_100169844 Ga0070674_1001698441 255
923 3300005364 Ga0070673_100008683 Ga0070673_1000086836 255
924 3300005364 Ga0070673_100014508 Ga0070673_1000145086 255
925 3300005364 Ga0070673_100057579 Ga0070673_1000575793 255
926 3300005366 Ga0070659_100378472 Ga0070659_1003784721 255
927 3300005455 Ga0070663_100195682 Ga0070663_1001956822 255
928 3300005455 Ga0070663_100658707 Ga0070663_1006587071 255
929 3300005456 Ga0070678_100078934 Ga0070678_1000789344 255
930 3300005456 Ga0070678_100170142 Ga0070678_1001701421 255
931 3300005456 Ga0070678_100245525 Ga0070678_1002455252 255
932 3300005458 Ga0070681_10022138 Ga0070681_100221384 255
933 3300005458 Ga0070681_10035520 Ga0070681_100355202 255
934 3300005458 Ga0070681_10058368 Ga0070681_100583681 255
935 3300005459 Ga0068867_100123570 Ga0068867_1001235703 255
936 3300005530 Ga0070679_100001843 Ga0070679_1000018438 255
937 3300005530 Ga0070679_100122541 Ga0070679_1001225412 255
938 3300005539 Ga0068853_100015015 Ga0068853_1000150153 255
939 3300005539 Ga0068853_100088973 Ga0068853_1000889732 255
940 3300005539 Ga0068853_100123171 Ga0068853_1001231711 255
941 3300005543 Ga0070672_100056638 Ga0070672_1000566384 255
942 3300005543 Ga0070672_100326363 Ga0070672_1003263632 255
943 3300005548 Ga0070665_100000032 Ga0070665_10000003217 255
944 3300005548 Ga0070665_100007337 Ga0070665_1000073372 255
945 3300005548 Ga0070665_100235692 Ga0070665_1002356921 255
946 3300005563 Ga0068855_100004190 Ga0068855_1000041908 255
947 3300005563 Ga0068855_100004378 Ga0068855_1000043788 255
948 3300005563 Ga0068855_100096879 Ga0068855_1000968797 255
949 3300005563 Ga0068855_100216265 Ga0068855_1002162652 255
950 3300005563 Ga0068855_100300962 Ga0068855_1003009622 255
951 3300005564 Ga0070664_100229237 Ga0070664_1002292372 255
952 3300005577 Ga0068857_100232384 Ga0068857_1002323842 255
953 3300005578 Ga0068854_100047797 Ga0068854_1000477974 255
954 3300005578 Ga0068854_100247391 Ga0068854_1002473911 255
955 3300005578 Ga0068854_100347392 Ga0068854_1003473922 255
956 3300005614 Ga0068856_100010769 Ga0068856_1000107694 255
957 3300005614 Ga0068856_100029089 Ga0068856_1000290897 255
958 3300005616 Ga0068852_100000563 Ga0068852_10000056323 255
959 3300005616 Ga0068852_100001109 Ga0068852_10000110910 255
960 3300005616 Ga0068852_100310184 Ga0068852_1003101842 255
961 3300005618 Ga0068864_100140134 Ga0068864_1001401342 255
962 3300005841 Ga0068863_100054873 Ga0068863_1000548736 255
963 3300005843 Ga0068860_100061503 Ga0068860_1000615031 255
964 3300005844 Ga0068862_100033405 Ga0068862_1000334053 255
965 3300006195 Ga0075366_10066624 Ga0075366_100666242 255
966 3300006195 Ga0075366_10113768 Ga0075366_101137682 255
967 3300006237 Ga0097621_100000262 Ga0097621_10000026223 255
968 3300006237 Ga0097621_100443712 Ga0097621_1004437121 255
969 3300006358 Ga0068871_100073458 Ga0068871_1000734581 255
970 3300006844 Ga0075428_100020591 Ga0075428_1000205912 255
971 3300006846 Ga0075430_100248528 Ga0075430_1002485281 255
972 3300006881 Ga0068865_100000704 Ga0068865_1000007042 255
973 3300009093 Ga0105240_10000173 Ga0105240_10000173112 255
974 3300009093 Ga0105240_10012925 Ga0105240_100129259 255
975 3300009093 Ga0105240_10026039 Ga0105240_100260398 255
976 3300009093 Ga0105240_10074250 Ga0105240_100742502 255
977 3300009093 Ga0105240_10093952 Ga0105240_100939523 255
978 3300009093 Ga0105240_10179332 Ga0105240_101793321 255
979 3300009094 Ga0111539_10009405 Ga0111539_1000940511 255
980 3300009098 Ga0105245_10431448 Ga0105245_104314482 255
981 3300009148 Ga0105243_10920112 Ga0105243_109201121 255
982 3300009174 Ga0105241_10007203 Ga0105241_100072035 255
983 3300009174 Ga0105241_10068977 Ga0105241_100689773 255
984 3300009174 Ga0105241_10095327 Ga0105241_100953272 255
985 3300009176 Ga0105242_10026648 Ga0105242_100266485 255
986 3300009176 Ga0105242_10757227 Ga0105242_107572271 255
987 3300009545 Ga0105237_10000928 Ga0105237_1000092820 255
988 3300009545 Ga0105237_10001508 Ga0105237_1000150811 255
989 3300009545 Ga0105237_10009764 Ga0105237_100097648 255
990 3300009545 Ga0105237_10017711 Ga0105237_100177112 255
991 3300009545 Ga0105237_10035264 Ga0105237_100352643 255
992 3300009545 Ga0105237_10228932 Ga0105237_102289322 255
993 3300009545 Ga0105237_10243597 Ga0105237_102435972 255
994 3300009551 Ga0105238_10053480 Ga0105238_100534806 255
995 3300009551 Ga0105238_10064372 Ga0105238_100643724 255
996 3300009553 Ga0105249_10047552 Ga0105249_100475522 255
997 3300010375 Ga0105239_10000222 Ga0105239_1000022215 255
998 3300010375 Ga0105239_10001174 Ga0105239_1000117420 255
999 3300010375 Ga0105239_10132230 Ga0105239_101322303 255
1000 3300013102 Ga0157371_10003421 Ga0157371_100034219 255
1001 3300013102 Ga0157371_10003608 Ga0157371_100036084 255
1002 3300013102 Ga0157371_10064172 Ga0157371_100641722 255
1003 3300013102 Ga0157371_10106827 Ga0157371_101068273 255
1004 3300013104 Ga0157370_10001951 Ga0157370_1000195111 255
1005 3300013104 Ga0157370_10003393 Ga0157370_100033939 255
1006 3300013104 Ga0157370_10129521 Ga0157370_101295212 255
1007 3300013104 Ga0157370_10186772 Ga0157370_101867722 255
1008 3300013105 Ga0157369_10000566 Ga0157369_100005663 255
1009 3300013105 Ga0157369_10025473 Ga0157369_100254731 255
1010 3300013105 Ga0157369_10094153 Ga0157369_100941534 255
1011 3300013105 Ga0157369_10398068 Ga0157369_103980681 255
1012 3300013105 Ga0157369_10483202 Ga0157369_104832022 255
1013 3300013296 Ga0157374_10004275 Ga0157374_100042757 255
1014 3300013297 Ga0157378_10023060 Ga0157378_100230604 255
1015 3300013297 Ga0157378_10031977 Ga0157378_100319773 255
1016 3300013297 Ga0157378_10169072 Ga0157378_101690723 255
1017 3300013306 Ga0163162_10000088 Ga0163162_100000888 255
1018 3300013306 Ga0163162_10001119 Ga0163162_1000111919 255
1019 3300013306 Ga0163162_10323664 Ga0163162_103236642 255
1020 3300013306 Ga0163162_10501349 Ga0163162_105013493 255
1021 3300013306 Ga0163162_10558804 Ga0163162_105588042 255
1022 3300013307 Ga0157372_10000020 Ga0157372_10000020102 255
1023 3300013307 Ga0157372_10000972 Ga0157372_1000097221 255
1024 3300013307 Ga0157372_10008233 Ga0157372_100082332 255
1025 3300013307 Ga0157372_10111735 Ga0157372_101117351 255
1026 3300013307 Ga0157372_10264644 Ga0157372_102646441 255
1027 3300013307 Ga0157372_10296533 Ga0157372_102965331 255
1028 3300013308 Ga0157375_10294161 Ga0157375_102941611 255
1029 3300014325 Ga0163163_10163224 Ga0163163_101632242 255
1030 3300014969 Ga0157376_10122620 Ga0157376_101226201 255
1031 3300014969 Ga0157376_10153759 Ga0157376_101537592 255
1032 3300014969 Ga0157376_10568163 Ga0157376_105681632 255
1033 3300025208 Ga0209436_102078 Ga0209436_1020781 255
1034 3300025231 Ga0207427_100025 Ga0207427_1000255 255
1035 3300025233 Ga0209437_100010 Ga0209437_100010267 255
1036 3300025246 Ga0209646_1000045 Ga0209646_1000045168 255
1037 3300025250 Ga0209026_1000075 Ga0209026_100007565 255
1038 3300025250 Ga0209026_1000388 Ga0209026_10003885 255
1039 3300025261 Ga0209233_1000017 Ga0209233_1000017280 255
1040 3300025272 Ga0209455_1006935 Ga0209455_10069354 255
1041 3300025273 Ga0209673_1000515 Ga0209673_10005151 255
1042 3300025292 Ga0209676_1001025 Ga0209676_10010255 255
1043 3300025295 Ga0209564_1005082 Ga0209564_10050822 255
1044 3300025295 Ga0209564_1012230 Ga0209564_10122305 255
1045 3300025297 Ga0209758_1010293 Ga0209758_10102934 255
1046 3300025297 Ga0209758_1020297 Ga0209758_10202971 255
1047 3300025298 Ga0209050_1000887 Ga0209050_100088717 255
1048 3300025298 Ga0209050_1039965 Ga0209050_10399651 255
1049 3300025302 Ga0207426_1000159 Ga0207426_100015997 255
1050 3300025302 Ga0207426_1004429 Ga0207426_10044293 255
1051 3300025302 Ga0207426_1007405 Ga0207426_10074053 255
1052 3300025302 Ga0207426_1054419 Ga0207426_10544192 255
1053 3300025304 Ga0209257_1002689 Ga0209257_100268913 255
1054 3300025904 Ga0207647_10009470 Ga0207647_100094705 255
1055 3300025907 Ga0207645_10000672 Ga0207645_1000067232 255
1056 3300025907 Ga0207645_10008320 Ga0207645_100083206 255
1057 3300025908 Ga0207643_10047850 Ga0207643_100478503 255
1058 3300025909 Ga0207705_10000043 Ga0207705_1000004337 255
1059 3300025909 Ga0207705_10003539 Ga0207705_1000353912 255
1060 3300025909 Ga0207705_10023722 Ga0207705_100237221 255
1061 3300025909 Ga0207705_10135110 Ga0207705_101351102 255
1062 3300025911 Ga0207654_10003275 Ga0207654_100032755 255
1063 3300025911 Ga0207654_10005386 Ga0207654_100053864 255
1064 3300025911 Ga0207654_10077335 Ga0207654_100773353 255
1065 3300025912 Ga0207707_10007990 Ga0207707_1000799012 255
1066 3300025912 Ga0207707_10042037 Ga0207707_100420374 255
1067 3300025913 Ga0207695_10000053 Ga0207695_1000005344 255
1068 3300025913 Ga0207695_10008885 Ga0207695_1000888511 255
1069 3300025913 Ga0207695_10018213 Ga0207695_100182138 255
1070 3300025913 Ga0207695_10019425 Ga0207695_100194255 255
1071 3300025913 Ga0207695_10038992 Ga0207695_100389923 255
1072 3300025913 Ga0207695_10238868 Ga0207695_102388681 255
1073 3300025913 Ga0207695_10284273 Ga0207695_102842731 255
1074 3300025914 Ga0207671_10000262 Ga0207671_1000026225 255
1075 3300025914 Ga0207671_10000651 Ga0207671_1000065122 255
1076 3300025914 Ga0207671_10003316 Ga0207671_1000331612 255
1077 3300025914 Ga0207671_10009242 Ga0207671_100092427 255
1078 3300025914 Ga0207671_10055929 Ga0207671_100559293 255
1079 3300025914 Ga0207671_10103554 Ga0207671_101035542 255
1080 3300025914 Ga0207671_10499279 Ga0207671_104992792 255
1081 3300025917 Ga0207660_10028247 Ga0207660_100282472 255
1082 3300025919 Ga0207657_10031930 Ga0207657_100319302 255
1083 3300025919 Ga0207657_10065191 Ga0207657_100651915 255
1084 3300025921 Ga0207652_10000697 Ga0207652_100006976 255
1085 3300025921 Ga0207652_10001189 Ga0207652_1000118910 255
1086 3300025921 Ga0207652_10011595 Ga0207652_100115952 255
1087 3300025923 Ga0207681_10195596 Ga0207681_101955962 255
1088 3300025924 Ga0207694_10119113 Ga0207694_101191133 255
1089 3300025925 Ga0207650_10332486 Ga0207650_103324861 255
1090 3300025926 Ga0207659_10145995 Ga0207659_101459951 255
1091 3300025927 Ga0207687_10596631 Ga0207687_105966311 255
1092 3300025937 Ga0207669_10050000 Ga0207669_100500003 255
1093 3300025938 Ga0207704_10000042 Ga0207704_1000004216 255
1094 3300025940 Ga0207691_10007169 Ga0207691_100071692 255
1095 3300025940 Ga0207691_10070864 Ga0207691_100708642 255
1096 3300025940 Ga0207691_10166309 Ga0207691_101663092 255
1097 3300025940 Ga0207691_10332745 Ga0207691_103327452 255
1098 3300025942 Ga0207689_10295319 Ga0207689_102953191 255
1099 3300025944 Ga0207661_10064891 Ga0207661_100648911 255
1100 3300025944 Ga0207661_10584133 Ga0207661_105841332 255
1101 3300025949 Ga0207667_10004375 Ga0207667_1000437513 255
1102 3300025949 Ga0207667_10005684 Ga0207667_100056848 255
1103 3300025949 Ga0207667_10060111 Ga0207667_100601114 255
1104 3300025949 Ga0207667_10087799 Ga0207667_100877992 255
1105 3300025949 Ga0207667_10222152 Ga0207667_102221522 255
1106 3300025949 Ga0207667_10256539 Ga0207667_102565392 255
1107 3300025960 Ga0207651_10010254 Ga0207651_100102544 255
1108 3300025960 Ga0207651_10014573 Ga0207651_100145733 255
1109 3300025981 Ga0207640_10093308 Ga0207640_100933082 255
1110 3300025981 Ga0207640_10114491 Ga0207640_101144912 255
1111 3300025981 Ga0207640_10226768 Ga0207640_102267681 255
1112 3300025981 Ga0207640_10459248 Ga0207640_104592481 255
1113 3300025986 Ga0207658_10434495 Ga0207658_104344951 255
1114 3300026023 Ga0207677_10037430 Ga0207677_100374302 255
1115 3300026023 Ga0207677_10374559 Ga0207677_103745591 255
1116 3300026041 Ga0207639_10016487 Ga0207639_100164872 255
1117 3300026067 Ga0207678_10008521 Ga0207678_100085214 255
1118 3300026067 Ga0207678_10069354 Ga0207678_100693544 255
1119 3300026078 Ga0207702_10006154 Ga0207702_100061545 255
1120 3300026078 Ga0207702_10041908 Ga0207702_100419082 255
1121 3300026078 Ga0207702_10562336 Ga0207702_105623361 255
1122 3300026089 Ga0207648_10001034 Ga0207648_100010347 255
1123 3300026089 Ga0207648_10070808 Ga0207648_100708081 255
1124 3300026116 Ga0207674_10180493 Ga0207674_101804933 255
1125 3300026116 Ga0207674_10227596 Ga0207674_102275961 255
1126 3300026121 Ga0207683_10001842 Ga0207683_100018429 255
1127 3300026121 Ga0207683_10013467 Ga0207683_100134674 255
1128 3300026121 Ga0207683_10470219 Ga0207683_104702191 255
1129 3300026142 Ga0207698_10002645 Ga0207698_100026454 255
1130 3300026142 Ga0207698_10036983 Ga0207698_100369832 255
1131 3300027907 Ga0207428_10483522 Ga0207428_104835222 255
1132 3300028379 Ga0268266_10000030 Ga0268266_10000030310 255
1133 3300028379 Ga0268266_10029062 Ga0268266_100290624 255
1134 3300028380 Ga0268265_10186707 Ga0268265_101867072 255
1135 3300028381 Ga0268264_10001619 Ga0268264_100016193 255
1136 3300028381 Ga0268264_10006791 Ga0268264_100067914 255
1137 3300028786 Ga0307517_10002485 Ga0307517_100024859 255
1138 3300031251 Ga0265327_10000055 Ga0265327_10000055100 255
1139 3300031251 Ga0265327_10000577 Ga0265327_1000057730 255
1140 3300031507 Ga0307509_10258430 Ga0307509_102584302 255
1141 3300031507 Ga0307509_10360768 Ga0307509_103607682 255
1142 3300031548 Ga0307408_100000984 Ga0307408_1000009847 255
1143 3300031548 Ga0307408_100320861 Ga0307408_1003208612 255
1144 3300031731 Ga0307405_10010137 Ga0307405_100101378 255
1145 3300031911 Ga0307412_10002839 Ga0307412_100028394 255
1146 3300032002 Ga0307416_100109594 Ga0307416_1001095942 255
1147 3300032004 Ga0307414_10030435 Ga0307414_100304355 255
1148 3300032004 Ga0307414_10441218 Ga0307414_104412181 255
1149 3300033180 Ga0307510_10152016 Ga0307510_101520162 255
1150 3300035691 Ga0373931_0038054 Ga0373931_0038054_684_1484 255
1151 3300036401 Ga0373937_0081483 Ga0373937_0081483_1753_2544 255
1152 3300037312 Ga0395899_0000136 Ga0395899_0000136_64674_65510 255
1153 3300037312 Ga0395899_0071954 Ga0395899_0071954_738_1550 255
1154 3300037312 Ga0395899_0086313 Ga0395899_0086313_942_1724 255
1155 3300037312 Ga0395899_0229765 Ga0395899_0229765_285_1097 255
1156 3300037418 Ga0395900_0148838 Ga0395900_0148838_959_1771 255
1157 3300037418 Ga0395900_0187474 Ga0395900_0187474_164_976 255
1158 3300037418 Ga0395900_0212394 Ga0395900_0212394_643_1425 255
1159 3300037418 Ga0395900_0348970 Ga0395900_0348970_225_1007 255
1160 3300037418 Ga0395900_0418773 Ga0395900_0418773_179_991 255
1161 3300037466 Ga0395898_0041168 Ga0395898_0041168_2598_3380 255
1162 3300037466 Ga0395898_0049581 Ga0395898_0049581_193_1005 255
1163 3300037466 Ga0395898_0102470 Ga0395898_0102470_1760_2548 255
1164 3300037466 Ga0395898_0108487 Ga0395898_0108487_781_1593 255
1165 3300037466 Ga0395898_0220400 Ga0395898_0220400_284_1066 255
1166 3300037471 Ga0395905_0106202 Ga0395905_0106202_80_862 255
1167 3300037471 Ga0395905_0144335 Ga0395905_0144335_1203_2015 255
1168 3300037471 Ga0395905_0146888 Ga0395905_0146888_1386_2171 255
1169 3300038443 Ga0395901_0007368 Ga0395901_0007368_6104_6886 255
1170 3300038443 Ga0395901_0116887 Ga0395901_0116887_69_881 255
1171 3300042007 Ga0439449_0125708 Ga0439449_0125708_70_858 255
1172 3300042015 Ga0439462_0026471 Ga0439462_0026471_645_1478 255
1173 3300042876 Ga0451577_0002283 Ga0451577_0002283_7872_8639 255
1174 3300042876 Ga0451577_0006025 Ga0451577_0006025_3349_4197 255
1175 3300042876 Ga0451577_0030795 Ga0451577_0030795_3251_4033 255
1176 3300042876 Ga0451577_0729629 Ga0451577_0729629_35_862 255
1177 3300044656 Ga0466969_0012582 Ga0466969_0012582_2274_3110 255
1178 3300044656 Ga0466969_0076579 Ga0466969_0076579_417_1184 255
1179 3300044673 Ga0453683_0122800 Ga0453683_0122800_800_1582 255
1180 3300044684 Ga0466966_0044889 Ga0466966_0044889_180_1016 255
1181 3300044693 Ga0466961_0268557 Ga0466961_0268557_77_913 255
1182 3300044712 Ga0453684_0002802 Ga0453684_0002802_26250_27017 255
1183 3300044712 Ga0453684_0113589 Ga0453684_0113589_66_848 255
1184 3300044765 Ga0466970_0017449 Ga0466970_0017449_2921_3688 255
1185 3300045049 Ga0466959_0145688 Ga0466959_0145688_883_1650 255
1186 3300045051 Ga0451576_0001459 Ga0451576_0001459_8086_8868 255
1187 3300045051 Ga0451576_0107160 Ga0451576_0107160_1154_1945 255
1188 3300045051 Ga0451576_0347377 Ga0451576_0347377_206_988 255
1189 3300045836 Ga0466958_0191661 Ga0466958_0191661_334_1170 255
1190 3300046460 Ga0495638_0000004 Ga0495638_0000004_264348_265118 255
1191 3300046462 Ga0495651_0093658 Ga0495651_0093658_1437_2234 255
1192 3300046507 Ga0495606_0036909 Ga0495606_0036909_995_1783 255
1193 3300046518 Ga0495631_0035208 Ga0495631_0035208_965_1768 255
1194 3300046529 Ga0495652_0068583 Ga0495652_0068583_154_951 255
1195 3300046616 Ga0495668_0079098 Ga0495668_0079098_208_993 255
1196 3300046691 Ga0495670_0007986 Ga0495670_0007986_493_1284 255
1197 3300047318 Ga0495636_0000020 Ga0495636_0000020_8139_8921 255
1198 3300048907 Ga0496104_0103851 Ga0496104_0103851_69_851 255
1199 3300048918 Ga0496115_0065188 Ga0496115_0065188_2041_2823 255
1200 3300048924 Ga0496121_0000007 Ga0496121_0000007_268570_269352 255
1201 3300049460 Ga0495682_0093812 Ga0495682_0093812_188_991 255
1202 3300049568 Ga0501031_0029299 Ga0501031_0029299_2311_3099 255
1203 3300049569 Ga0501032_0046898 Ga0501032_0046898_1947_2735 255
1204 3300049571 Ga0501034_0000017 Ga0501034_0000017_48049_48819 255
1205 3300049571 Ga0501034_0174542 Ga0501034_0174542_17_805 255
1206 3300049571 Ga0501034_0195727 Ga0501034_0195727_1086_1868 255
1207 3300049572 Ga0501036_0011056 Ga0501036_0011056_5060_5848 255
1208 3300049573 Ga0501037_0006584 Ga0501037_0006584_6356_7144 255
1209 3300049574 Ga0501038_0016450 Ga0501038_0016450_1747_2535 255
1210 3300049575 Ga0501039_0040623 Ga0501039_0040623_77_865 255
1211 3300049579 Ga0501043_0161509 Ga0501043_0161509_363_1151 255
1212 3300049580 Ga0501046_0024453 Ga0501046_0024453_2753_3541 255
1213 3300049581 Ga0501047_0287376 Ga0501047_0287376_404_1198 255
1214 3300049581 Ga0501047_0340209 Ga0501047_0340209_34_822 255
1215 3300049583 Ga0501067_0222391 Ga0501067_0222391_122_910 255
1216 3300049585 Ga0501069_0041446 Ga0501069_0041446_881_1669 255
1217 3300049586 Ga0501070_0085635 Ga0501070_0085635_1451_2239 255
1218 3300049589 Ga0501073_0208216 Ga0501073_0208216_345_1133 255
1219 3300049661 Ga0501217_088849 Ga0501217_088849_27_830 255
1220 3300049665 Ga0501227_051643 Ga0501227_051643_183_980 255
1221 3300049669 Ga0501235_011272 Ga0501235_011272_1063_1911 255
1222 3300049686 Ga0501257_013189 Ga0501257_013189_735_1505 255
1223 3300049688 Ga0501259_000124 Ga0501259_000124_3147_3995 255
1224 3300049742 Ga0501080_0033155 Ga0501080_0033155_386_1174 255
1225 3300049742 Ga0501080_0639454 Ga0501080_0639454_129_911 255
1226 3300049763 Ga0501266_000169 Ga0501266_000169_5814_6662 255
1227 3300049822 Ga0501035_0183140 Ga0501035_0183140_704_1486 255
1228 3300049823 Ga0501044_0101383 Ga0501044_0101383_43_831 255
1229 3300049823 Ga0501044_0439212 Ga0501044_0439212_187_975 255
1230 3300049823 Ga0501044_0687508 Ga0501044_0687508_13_792 255
1231 3300050493 nmdc:mga0k408_184157_c1 nmdc:mga0k408_184157_c1_68_835 255
1232 3300050509 nmdc:mga0qj67_204136_c1 nmdc:mga0qj67_204136_c1_674_1474 255
1233 3300050511 nmdc:mga08y16_25409_c1 nmdc:mga08y16_25409_c1_4874_5674 255
1234 3300053080 Ga0500635_0021275 Ga0500635_0021275_116_934 255
1235 3300053088 Ga0500644_0024211 Ga0500644_0024211_208_1008 255
1236 3300053092 Ga0500583_0023070 Ga0500583_0023070_337_1107 255
1237 3300053104 Ga0500556_0069307 Ga0500556_0069307_140_934 255
1238 3300053134 Ga0500658_0110602 Ga0500658_0110602_399_1181 255
1239 3300053139 Ga0500568_0102573 Ga0500568_0102573_116_883 255
1240 3300053153 Ga0500616_0000015 Ga0500616_0000015_562451_563221 255
1241 3300053153 Ga0500616_0029000 Ga0500616_0029000_839_1639 255
1242 3300053156 Ga0500622_0012215 Ga0500622_0012215_2680_3462 255
1243 3300053156 Ga0500622_0013565 Ga0500622_0013565_1779_2579 255
1244 3300053727 Ga0500611_000092 Ga0500611_000092_14943_15725 255
1245 3300060353 Ga0501082_0118958 Ga0501082_0118958_65_853 255
1246 iso_pu_bacteria 2522125168 2522549073 255
1247 iso_pu_bacteria 2738541278 2738728252 255
1248 iso_pu_bacteria 2821136567 2821137884 255
1249 iso_pu_bacteria 2839989709 2839990503 255
1250 iso_pu_bacteria 2883068021 2883072188 255
1251 iso_pu_bacteria 2884634485 2884637517 255
1252 iso_pu_bacteria 2896085136 2896088735 255
1253 iso_pu_bacteria 2904467357 2904467363 255
1254 iso_pu_bacteria 2910245624 2910246798 255
1255 iso_pu_bacteria 2911138879 2911139472 255
1256 iso_pu_bacteria 2919692658 2919696245 255
1257 iso_pu_bacteria 2929921140 2929923963 255
1258 iso_pu_bacteria 8003151029 8003157780 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

18

104

0.96

PF02754

CCG

Cysteine-rich domain

144

232

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7082 10 252
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.6884 13 252
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.6763 10 252
5qzq-assembly1.cif.gz_A pandda analysis group deposition -- auto-refined data of aar2/rnaseh for ground state model 41 0.6752 200 244
4ilh-assembly1.cif.gz_A crystal structure of an aar2p c-terminal deletion mutant in conplex with prp8p rnaseh 0.6673 200 244
ID Description Score Start End Superfamily
af_O33268_477_569_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8694 14 99 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8087 14 99 3.40.30.10
af_O33268_477_569_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8018 14 99 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7924 14 99 3.40.30.10
af_A0A1D6HSW9_336_459_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7747 11 48 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A1F8NC63-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9573 11 127 GO:0005886
GO:0016491
GO:0046872
GO:0051539
AF-A0A536B484-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9549 11 128 GO:0005886
GO:0016491
GO:0046872
GO:0051539
AF-E7NDE5-F1-model_v4 Cysteine-rich domain protein 0.9517 11 128 GO:0005886
GO:0016491
GO:0046872
GO:0051539
AF-A0A1F3Y4N5-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.95 10 121 GO:0005886
GO:0016491
GO:0046872
GO:0051539
AF-A0A535KXY4-F1-model_v4 (Fe-S)-binding protein 0.947 11 128 GO:0005886
GO:0016491
GO:0051539

Feature Viewer

pLDDT pTM Quality
87.43 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map