F492259

General Info

Members Datasets Scaffolds Average Seq Length
1256 312 1254 213

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10138869|Ga0207668_101388692
Length 233
Sequence MEQESRPIACQAAGDLPTPAFASINLEPDLNATRANQLNGKRRHGLRAGRDRKSPRWQFLRGFLKHPVMVGSVIPSSRILIDKMLKPVDWSKTRLFVEYGPGVGTFTRPILDRLNRDAKLIAIDTNPDFIDYLNGDIDDERFIAVHGSAADVGFDHADYVLSGLPFSTLPPGVGNEIGAATGRAIRDGGAFLVYQFSPKVRDFIAPHFERIDRGFEWVNVPPATLFWAWRERD

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
222 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
223 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
224 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
225 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
226 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
234 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
273 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
274 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
275 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
276 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
282 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
283 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
284 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
285 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
286 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
287 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
288 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
289 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
290 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
291 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
292 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
293 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
294 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
295 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
296 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
297 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
298 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
309 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.64
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 2.23
Rhizosphere 96.34
Stem 0
Stem Tuber 0.08
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1021283 3300001904 Bacteria 1017
2 JGI24747J21853_1005347 3300001978 Bacteria 1182
3 JGI24740J21852_10001279 3300001979 Bacteria 11425
4 JGI24740J21852_10017742 3300001979 Bacteria 2538
5 JGI24740J21852_10029589 3300001979 Bacteria 1796
6 JGI24740J21852_10034457 3300001979 Bacteria 1595
7 JGI24740J21852_10040530 3300001979 Bacteria 1411
8 JGI24739J22299_10000632 3300001989 Bacteria 12645
9 JGI24739J22299_10014931 3300001989 Bacteria 2824
10 JGI24737J22298_10000103 3300001990 Bacteria 25390
11 JGI24737J22298_10002837 3300001990 Bacteria 6139
12 JGI24737J22298_10008811 3300001990 Bacteria 3368
13 JGI24737J22298_10020867 3300001990 Bacteria 2089
14 JGI24743J22301_10007298 3300001991 Bacteria 1912
15 JGI24735J21928_10005631 3300002067 Bacteria 4146
16 JGI24735J21928_10013104 3300002067 Bacteria 2612
17 JGI24735J21928_10015456 3300002067 Bacteria 2381
18 JGI24735J21928_10019675 3300002067 Bacteria 2074
19 JGI24735J21928_10036351 3300002067 Bacteria 1445
20 JGI24735J21928_10061071 3300002067 Bacteria 1083
21 JGI24738J21930_10000018 3300002075 Bacteria 30549
22 JGI24738J21930_10001758 3300002075 Bacteria 5909
23 JGI24738J21930_10029998 3300002075 Bacteria 1111
24 JGI24749J21850_1006451 3300002076 Bacteria 1636
25 JGI24035J26624_1006773 3300002126 Bacteria 1109
26 JGI24742J22300_10010583 3300002244 Bacteria 1527
27 Ga0065712_10085019 3300005290 Bacteria 2725
28 Ga0065712_10152525 3300005290 Bacteria 1359
29 Ga0065715_10002336 3300005293 Bacteria 9950
30 Ga0065715_10337381 3300005293 Bacteria 945
31 Ga0065715_10353554 3300005293 Bacteria 947
32 Ga0070658_10000107 3300005327 Bacteria 73895
33 Ga0070658_10008488 3300005327 Bacteria 8260
34 Ga0070658_10022681 3300005327 Bacteria 5038
35 Ga0070658_10040519 3300005327 Bacteria 3758
36 Ga0070658_10163593 3300005327 Bacteria 1867
37 Ga0070658_10304851 3300005327 Bacteria 1358
38 Ga0070658_10596792 3300005327 Bacteria 957
39 Ga0070658_11138869 3300005327 Bacteria 678
40 Ga0070676_10004980 3300005328 Bacteria 7031
41 Ga0070676_10019208 3300005328 Bacteria 3799
42 Ga0070676_10124010 3300005328 Bacteria 1625
43 Ga0070676_10357970 3300005328 Bacteria 1005
44 Ga0070683_100001635 3300005329 Bacteria 17347
45 Ga0070683_100055752 3300005329 Bacteria 3668
46 Ga0070683_100130614 3300005329 Bacteria 2377
47 Ga0070683_100295051 3300005329 Bacteria 1542
48 Ga0070683_100359425 3300005329 Bacteria 1387
49 Ga0070690_100008191 3300005330 Bacteria 6013
50 Ga0070690_100086788 3300005330 Bacteria 2054
51 Ga0070690_100097871 3300005330 Bacteria 1941
52 Ga0070670_100014993 3300005331 Bacteria 6651
53 Ga0070670_100030532 3300005331 Bacteria 4641
54 Ga0070670_100037551 3300005331 Bacteria 4167
55 Ga0070670_100056756 3300005331 Bacteria 3361
56 Ga0070670_100141126 3300005331 Bacteria 2083
57 Ga0070670_100479999 3300005331 Bacteria 1104
58 Ga0070677_10000942 3300005333 Bacteria 9456
59 Ga0070677_10125117 3300005333 Bacteria 1166
60 Ga0068869_100003378 3300005334 Bacteria 9741
61 Ga0068869_100093402 3300005334 Bacteria 2267
62 Ga0068869_100328730 3300005334 Bacteria 1242
63 Ga0070666_10001184 3300005335 Bacteria 15784
64 Ga0070666_10012233 3300005335 Bacteria 5408
65 Ga0070666_10012419 3300005335 Bacteria 5372
66 Ga0070666_10084148 3300005335 Bacteria 2177
67 Ga0070666_10138286 3300005335 Bacteria 1696
68 Ga0070680_100002652 3300005336 Bacteria 13265
69 Ga0070680_100046577 3300005336 Bacteria 3528
70 Ga0070680_100231845 3300005336 Bacteria 1559
71 Ga0070682_100300271 3300005337 Bacteria 1178
72 Ga0068868_100000734 3300005338 Bacteria 22184
73 Ga0068868_100019933 3300005338 Bacteria 5030
74 Ga0068868_100076179 3300005338 Bacteria 2682
75 Ga0068868_100095033 3300005338 Bacteria 2405
76 Ga0068868_100232000 3300005338 Bacteria 1548
77 Ga0068868_100338924 3300005338 Bacteria 1285
78 Ga0068868_100349399 3300005338 Bacteria 1266
79 Ga0068868_100696157 3300005338 Bacteria 909
80 Ga0068868_100772382 3300005338 Bacteria 865
81 Ga0070660_100001337 3300005339 Bacteria 16757
82 Ga0070660_100002346 3300005339 Bacteria 13006
83 Ga0070660_100003086 3300005339 Bacteria 11449
84 Ga0070660_100019319 3300005339 Bacteria 4991
85 Ga0070660_100020486 3300005339 Bacteria 4861
86 Ga0070660_100032154 3300005339 Bacteria 3946
87 Ga0070660_100064661 3300005339 Bacteria 2846
88 Ga0070660_100069452 3300005339 Bacteria 2747
89 Ga0070660_100109890 3300005339 Bacteria 2192
90 Ga0070660_100110094 3300005339 Bacteria 2190
91 Ga0070660_100123508 3300005339 Bacteria 2067
92 Ga0070660_100249033 3300005339 Bacteria 1448
93 Ga0070660_100272440 3300005339 Bacteria 1384
94 Ga0070660_100349155 3300005339 Bacteria 1218
95 Ga0070660_100371924 3300005339 Bacteria 1179
96 Ga0070660_100655853 3300005339 Bacteria 879
97 Ga0070689_100110367 3300005340 Bacteria 2187
98 Ga0070691_10027904 3300005341 Bacteria 2635
99 Ga0070661_100000101 3300005344 Bacteria 70279
100 Ga0070661_100004927 3300005344 Bacteria 9192
101 Ga0070661_100020369 3300005344 Bacteria 4729
102 Ga0070661_100079658 3300005344 Bacteria 2417
103 Ga0070661_100136364 3300005344 Bacteria 1847
104 Ga0070661_100176218 3300005344 Bacteria 1625
105 Ga0070661_100178381 3300005344 Bacteria 1615
106 Ga0070661_100255746 3300005344 Bacteria 1353
107 Ga0070661_100284215 3300005344 Bacteria 1284
108 Ga0070661_100320469 3300005344 Bacteria 1211
109 Ga0070661_100346457 3300005344 Bacteria 1165
110 Ga0070661_100369365 3300005344 Bacteria 1129
111 Ga0070692_10002449 3300005345 Bacteria 7211
112 Ga0070692_10029498 3300005345 Bacteria 2734
113 Ga0070692_10032211 3300005345 Bacteria 2634
114 Ga0070692_10106179 3300005345 Bacteria 1547
115 Ga0070668_100007897 3300005347 Bacteria 7900
116 Ga0070668_100008856 3300005347 Bacteria 7471
117 Ga0070668_100010460 3300005347 Bacteria 6896
118 Ga0070668_100015987 3300005347 Bacteria 5614
119 Ga0070668_100108867 3300005347 Bacteria 2204
120 Ga0070668_100120134 3300005347 Bacteria 2100
121 Ga0070668_100153776 3300005347 Bacteria 1863
122 Ga0070669_100000613 3300005353 Bacteria 26394
123 Ga0070669_100005378 3300005353 Bacteria 9240
124 Ga0070669_100435069 3300005353 Bacteria 1079
125 Ga0070675_100002232 3300005354 Bacteria 14371
126 Ga0070675_100041590 3300005354 Bacteria 3754
127 Ga0070675_100110034 3300005354 Bacteria 2329
128 Ga0070675_100117554 3300005354 Bacteria 2256
129 Ga0070675_100212019 3300005354 Bacteria 1684
130 Ga0070671_100000533 3300005355 Bacteria 26740
131 Ga0070671_100001226 3300005355 Bacteria 19207
132 Ga0070671_100001973 3300005355 Bacteria 15747
133 Ga0070671_100013491 3300005355 Bacteria 6587
134 Ga0070671_100021607 3300005355 Bacteria 5257
135 Ga0070671_100031172 3300005355 Bacteria 4404
136 Ga0070671_100034776 3300005355 Bacteria 4172
137 Ga0070671_100042697 3300005355 Bacteria 3769
138 Ga0070671_100054968 3300005355 Bacteria 3311
139 Ga0070671_100062453 3300005355 Bacteria 3102
140 Ga0070671_100258733 3300005355 Bacteria 1479
141 Ga0070671_100265097 3300005355 Bacteria 1460
142 Ga0070671_100569554 3300005355 Bacteria 977
143 Ga0070674_100002401 3300005356 Bacteria 10353
144 Ga0070674_100015082 3300005356 Bacteria 4817
145 Ga0070674_100028503 3300005356 Bacteria 3668
146 Ga0070674_100104318 3300005356 Bacteria 2071
147 Ga0070673_100000858 3300005364 Bacteria 17053
148 Ga0070673_100003291 3300005364 Bacteria 10030
149 Ga0070673_100026112 3300005364 Bacteria 4309
150 Ga0070673_100050546 3300005364 Bacteria 3251
151 Ga0070673_100052759 3300005364 Bacteria 3191
152 Ga0070673_100058719 3300005364 Bacteria 3043
153 Ga0070673_100372382 3300005364 Bacteria 1272
154 Ga0070673_100384306 3300005364 Bacteria 1252
155 Ga0070673_100390927 3300005364 Bacteria 1242
156 Ga0070688_100248639 3300005365 Bacteria 1265
157 Ga0070659_100000045 3300005366 Bacteria 101520
158 Ga0070659_100005279 3300005366 Bacteria 9272
159 Ga0070659_100005391 3300005366 Bacteria 9179
160 Ga0070659_100006698 3300005366 Bacteria 8330
161 Ga0070659_100018879 3300005366 Bacteria 5209
162 Ga0070659_100021294 3300005366 Bacteria 4935
163 Ga0070659_100030158 3300005366 Bacteria 4196
164 Ga0070659_100068416 3300005366 Bacteria 2816
165 Ga0070659_100080222 3300005366 Bacteria 2605
166 Ga0070659_100311767 3300005366 Bacteria 1314
167 Ga0070659_100323555 3300005366 Bacteria 1289
168 Ga0070659_100366802 3300005366 Bacteria 1211
169 Ga0070659_100442387 3300005366 Bacteria 1102
170 Ga0070667_100001174 3300005367 Bacteria 23830
171 Ga0070667_100001244 3300005367 Bacteria 23122
172 Ga0070667_100005894 3300005367 Bacteria 10205
173 Ga0070667_100005942 3300005367 Bacteria 10160
174 Ga0070667_100008179 3300005367 Bacteria 8670
175 Ga0070667_100012065 3300005367 Bacteria 7152
176 Ga0070667_100015715 3300005367 Bacteria 6258
177 Ga0070667_100020338 3300005367 Bacteria 5510
178 Ga0070667_100499234 3300005367 Bacteria 1115
179 Ga0070714_100023829 3300005435 Bacteria 5033
180 Ga0070714_100111291 3300005435 Bacteria 2425
181 Ga0070714_100334356 3300005435 Bacteria 1419
182 Ga0070713_100014377 3300005436 Bacteria 5876
183 Ga0070705_100252261 3300005440 Bacteria 1239
184 Ga0070700_100627083 3300005441 Bacteria 846
185 Ga0070694_100019081 3300005444 Bacteria 4358
186 Ga0070694_100020393 3300005444 Bacteria 4225
187 Ga0070663_100000549 3300005455 Bacteria 19942
188 Ga0070663_100032903 3300005455 Bacteria 3578
189 Ga0070663_100048496 3300005455 Bacteria 3012
190 Ga0070663_100252513 3300005455 Bacteria 1396
191 Ga0070678_100000740 3300005456 Bacteria 16284
192 Ga0070678_100068394 3300005456 Bacteria 2647
193 Ga0070678_100732564 3300005456 Bacteria 893
194 Ga0070662_100000036 3300005457 Bacteria 77190
195 Ga0070662_100000723 3300005457 Bacteria 20188
196 Ga0070662_100012862 3300005457 Bacteria 5559
197 Ga0070662_100028718 3300005457 Bacteria 3873
198 Ga0070662_100030276 3300005457 Bacteria 3786
199 Ga0070662_100117609 3300005457 Bacteria 2033
200 Ga0070662_100123364 3300005457 Bacteria 1988
201 Ga0070662_100124724 3300005457 Bacteria 1978
202 Ga0070662_100126657 3300005457 Bacteria 1964
203 Ga0070662_100139709 3300005457 Bacteria 1876
204 Ga0070662_100156980 3300005457 Bacteria 1777
205 Ga0070662_100170734 3300005457 Bacteria 1708
206 Ga0070662_100692188 3300005457 Bacteria 862
207 Ga0070681_10004074 3300005458 Bacteria 13800
208 Ga0070681_10116911 3300005458 Bacteria 2603
209 Ga0070681_10123246 3300005458 Bacteria 2524
210 Ga0070681_11141531 3300005458 Bacteria 700
211 Ga0068867_100001501 3300005459 Bacteria 16154
212 Ga0068867_100021582 3300005459 Bacteria 4596
213 Ga0068867_100066142 3300005459 Bacteria 2692
214 Ga0070685_10114873 3300005466 Bacteria 1664
215 Ga0070706_100242982 3300005467 Bacteria 1681
216 Ga0070679_100057160 3300005530 Bacteria 3888
217 Ga0070679_100060463 3300005530 Bacteria 3776
218 Ga0070679_100094609 3300005530 Bacteria 2975
219 Ga0070679_100183443 3300005530 Bacteria 2065
220 Ga0070679_100453307 3300005530 Bacteria 1227
221 Ga0070679_100577165 3300005530 Bacteria 1068
222 Ga0070679_100589796 3300005530 Bacteria 1055
223 Ga0070679_100783007 3300005530 Bacteria 897
224 Ga0070684_100326878 3300005535 Bacteria 1409
225 Ga0070684_100403608 3300005535 Bacteria 1260
226 Ga0068853_100000059 3300005539 Bacteria 78301
227 Ga0068853_100000570 3300005539 Bacteria 25231
228 Ga0068853_100013847 3300005539 Bacteria 6592
229 Ga0068853_100035581 3300005539 Bacteria 4230
230 Ga0068853_100077986 3300005539 Bacteria 2895
231 Ga0068853_100113998 3300005539 Bacteria 2404
232 Ga0068853_100152929 3300005539 Bacteria 2078
233 Ga0068853_100171158 3300005539 Bacteria 1965
234 Ga0068853_100198609 3300005539 Bacteria 1824
235 Ga0068853_100274592 3300005539 Bacteria 1553
236 Ga0068853_100408940 3300005539 Bacteria 1271
237 Ga0070672_100000866 3300005543 Bacteria 18097
238 Ga0070672_100015765 3300005543 Bacteria 5396
239 Ga0070672_100042739 3300005543 Bacteria 3490
240 Ga0070672_100048915 3300005543 Bacteria 3288
241 Ga0070672_100071375 3300005543 Bacteria 2762
242 Ga0070672_100118955 3300005543 Bacteria 2160
243 Ga0070672_100892647 3300005543 Bacteria 785
244 Ga0070686_100179492 3300005544 Bacteria 1503
245 Ga0070686_100300560 3300005544 Bacteria 1190
246 Ga0070695_100067295 3300005545 Bacteria 2336
247 Ga0070696_100012268 3300005546 Bacteria 5743
248 Ga0070693_100026646 3300005547 Bacteria 3123
249 Ga0070693_100103557 3300005547 Bacteria 1738
250 Ga0070693_100283100 3300005547 Bacteria 1111
251 Ga0070665_100004200 3300005548 Bacteria 15157
252 Ga0070665_100046088 3300005548 Bacteria 4379
253 Ga0070665_100130625 3300005548 Bacteria 2514
254 Ga0068855_100000644 3300005563 Bacteria 42733
255 Ga0068855_100004669 3300005563 Bacteria 16735
256 Ga0068855_100010268 3300005563 Bacteria 11292
257 Ga0068855_100060024 3300005563 Bacteria 4448
258 Ga0068855_100090911 3300005563 Bacteria 3521
259 Ga0068855_100091623 3300005563 Bacteria 3506
260 Ga0068855_100112755 3300005563 Bacteria 3120
261 Ga0068855_100171870 3300005563 Bacteria 2454
262 Ga0068855_100196953 3300005563 Bacteria 2269
263 Ga0068855_100242997 3300005563 Bacteria 2011
264 Ga0068855_100397190 3300005563 Bacteria 1511
265 Ga0068855_100965835 3300005563 Bacteria 897
266 Ga0070664_100000027 3300005564 Bacteria 90881
267 Ga0070664_100008671 3300005564 Bacteria 8229
268 Ga0070664_100013541 3300005564 Bacteria 6647
269 Ga0070664_100017909 3300005564 Bacteria 5816
270 Ga0070664_100019741 3300005564 Bacteria 5547
271 Ga0070664_100039327 3300005564 Bacteria 3985
272 Ga0070664_100089512 3300005564 Bacteria 2663
273 Ga0070664_100105558 3300005564 Bacteria 2454
274 Ga0070664_100171116 3300005564 Bacteria 1927
275 Ga0070664_100408919 3300005564 Bacteria 1242
276 Ga0070664_100584732 3300005564 Bacteria 1035
277 Ga0070664_100699579 3300005564 Bacteria 944
278 Ga0068857_100006503 3300005577 Bacteria 10025
279 Ga0068857_100015612 3300005577 Bacteria 6636
280 Ga0068857_100153852 3300005577 Bacteria 2085
281 Ga0068857_100348745 3300005577 Bacteria 1370
282 Ga0068857_100368762 3300005577 Bacteria 1332
283 Ga0068857_100534998 3300005577 Bacteria 1103
284 Ga0068854_100001986 3300005578 Bacteria 12512
285 Ga0068854_100046376 3300005578 Bacteria 3094
286 Ga0068854_100053810 3300005578 Bacteria 2892
287 Ga0068854_100093514 3300005578 Bacteria 2241
288 Ga0068854_100235812 3300005578 Bacteria 1454
289 Ga0068854_100377105 3300005578 Bacteria 1168
290 Ga0068854_100604482 3300005578 Bacteria 937
291 Ga0068856_100000705 3300005614 Bacteria 36291
292 Ga0068856_100047656 3300005614 Bacteria 4222
293 Ga0068856_100049050 3300005614 Bacteria 4161
294 Ga0068856_100218096 3300005614 Bacteria 1923
295 Ga0068856_100219484 3300005614 Bacteria 1917
296 Ga0068856_100223490 3300005614 Bacteria 1898
297 Ga0068856_100363517 3300005614 Bacteria 1466
298 Ga0068856_100518102 3300005614 Bacteria 1214
299 Ga0068856_100643600 3300005614 Bacteria 1081
300 Ga0068856_100676720 3300005614 Bacteria 1052
301 Ga0068852_100002112 3300005616 Bacteria 13601
302 Ga0068852_100006533 3300005616 Bacteria 8434
303 Ga0068852_100008892 3300005616 Bacteria 7430
304 Ga0068852_100009994 3300005616 Bacteria 7060
305 Ga0068852_100102510 3300005616 Bacteria 2586
306 Ga0068852_100102745 3300005616 Bacteria 2583
307 Ga0068852_100183487 3300005616 Bacteria 1969
308 Ga0068852_100191140 3300005616 Bacteria 1932
309 Ga0068852_100215265 3300005616 Bacteria 1825
310 Ga0068852_100275322 3300005616 Bacteria 1621
311 Ga0068852_100314831 3300005616 Bacteria 1518
312 Ga0068852_100625089 3300005616 Bacteria 1083
313 Ga0068852_100690987 3300005616 Bacteria 1030
314 Ga0068859_100001592 3300005617 Bacteria 23154
315 Ga0068859_100007430 3300005617 Bacteria 11119
316 Ga0068859_100008201 3300005617 Bacteria 10596
317 Ga0068859_100018885 3300005617 Bacteria 6926
318 Ga0068859_100043942 3300005617 Bacteria 4490
319 Ga0068859_100090631 3300005617 Bacteria 3108
320 Ga0068859_100423499 3300005617 Bacteria 1427
321 Ga0068859_100900312 3300005617 Bacteria 969
322 Ga0068864_100000247 3300005618 Bacteria 48323
323 Ga0068864_100000706 3300005618 Bacteria 28069
324 Ga0068864_100007944 3300005618 Bacteria 8743
325 Ga0068864_100011047 3300005618 Bacteria 7464
326 Ga0068864_100031428 3300005618 Bacteria 4505
327 Ga0068864_100032196 3300005618 Bacteria 4454
328 Ga0068864_100100250 3300005618 Bacteria 2567
329 Ga0068864_100117217 3300005618 Bacteria 2377
330 Ga0068864_100285352 3300005618 Bacteria 1542
331 Ga0068866_10050911 3300005718 Bacteria 2106
332 Ga0068866_10070148 3300005718 Bacteria 1849
333 Ga0068866_10127528 3300005718 Bacteria 1442
334 Ga0068866_10131754 3300005718 Bacteria 1423
335 Ga0068866_10210777 3300005718 Bacteria 1166
336 Ga0068861_100034027 3300005719 Bacteria 3765
337 Ga0068861_100192695 3300005719 Bacteria 1705
338 Ga0068851_10022640 3300005834 Bacteria 3064
339 Ga0068851_10040324 3300005834 Bacteria 2347
340 Ga0068851_10151010 3300005834 Bacteria 1270
341 Ga0068870_10176133 3300005840 Bacteria 1280
342 Ga0068870_10364408 3300005840 Bacteria 931
343 Ga0068863_100001264 3300005841 Bacteria 25207
344 Ga0068863_100004490 3300005841 Bacteria 13763
345 Ga0068863_100005577 3300005841 Bacteria 12367
346 Ga0068863_100006550 3300005841 Bacteria 11429
347 Ga0068863_100006818 3300005841 Bacteria 11199
348 Ga0068863_100013464 3300005841 Bacteria 7889
349 Ga0068863_100054224 3300005841 Bacteria 3799
350 Ga0068863_100093235 3300005841 Bacteria 2858
351 Ga0068863_100263386 3300005841 Bacteria 1667
352 Ga0068863_100337476 3300005841 Bacteria 1466
353 Ga0068858_100000971 3300005842 Bacteria 29668
354 Ga0068858_100006759 3300005842 Bacteria 11161
355 Ga0068858_100014145 3300005842 Bacteria 7525
356 Ga0068858_100040857 3300005842 Bacteria 4302
357 Ga0068858_100058430 3300005842 Bacteria 3566
358 Ga0068858_100091604 3300005842 Bacteria 2829
359 Ga0068858_100245283 3300005842 Bacteria 1700
360 Ga0068860_100010355 3300005843 Bacteria 9222
361 Ga0068860_100013497 3300005843 Bacteria 8009
362 Ga0068860_100029898 3300005843 Bacteria 5241
363 Ga0068860_100034483 3300005843 Bacteria 4854
364 Ga0068860_100036958 3300005843 Bacteria 4676
365 Ga0068860_100117054 3300005843 Bacteria 2550
366 Ga0068860_100130278 3300005843 Bacteria 2413
367 Ga0068860_100134181 3300005843 Bacteria 2377
368 Ga0068862_100002465 3300005844 Bacteria 16400
369 Ga0068862_100012798 3300005844 Bacteria 6943
370 Ga0068862_100014713 3300005844 Bacteria 6498
371 Ga0068862_100019598 3300005844 Bacteria 5648
372 Ga0068862_100049230 3300005844 Bacteria 3599
373 Ga0068862_100120404 3300005844 Bacteria 2313
374 Ga0068862_100276367 3300005844 Bacteria 1538
375 Ga0068862_100487882 3300005844 Bacteria 1167
376 Ga0068862_100999537 3300005844 Bacteria 827
377 Ga0081539_10034310 3300005985 Bacteria 3071
378 Ga0070717_10003959 3300006028 Bacteria 10658
379 Ga0075366_10160611 3300006195 Bacteria 1362
380 Ga0097621_100018038 3300006237 Bacteria 5380
381 Ga0097621_100116077 3300006237 Bacteria 2266
382 Ga0097621_100268313 3300006237 Bacteria 1499
383 Ga0097621_100323489 3300006237 Bacteria 1366
384 Ga0097621_100542954 3300006237 Bacteria 1057
385 Ga0097621_100713749 3300006237 Bacteria 924
386 Ga0068871_100020845 3300006358 Bacteria 5028
387 Ga0068871_100154747 3300006358 Bacteria 1957
388 Ga0068871_100909588 3300006358 Bacteria 816
389 Ga0075431_100026284 3300006847 Bacteria 5971
390 Ga0075433_10004399 3300006852 Bacteria 10963
391 Ga0068865_100002874 3300006881 Bacteria 10260
392 Ga0068865_100092174 3300006881 Bacteria 2201
393 Ga0068865_100096383 3300006881 Bacteria 2157
394 Ga0068865_101017920 3300006881 Bacteria 726
395 Ga0097620_100001592 3300006931 Bacteria 23154
396 Ga0097620_100007430 3300006931 Bacteria 11119
397 Ga0097620_100008201 3300006931 Bacteria 10596
398 Ga0097620_100018885 3300006931 Bacteria 6926
399 Ga0097620_100043943 3300006931 Bacteria 4490
400 Ga0097620_100090627 3300006931 Bacteria 3108
401 Ga0097620_100423502 3300006931 Bacteria 1427
402 Ga0097620_100900277 3300006931 Bacteria 969
403 Ga0105244_10098598 3300009036 Bacteria 1431
404 Ga0105250_10020298 3300009092 Bacteria 2687
405 Ga0105240_10044834 3300009093 Bacteria 5615
406 Ga0111539_10048620 3300009094 Bacteria 5063
407 Ga0105245_10000128 3300009098 Bacteria 72249
408 Ga0105245_10078361 3300009098 Bacteria 3015
409 Ga0105245_10176965 3300009098 Bacteria 2035
410 Ga0105247_10035556 3300009101 Bacteria 3037
411 Ga0114129_10418685 3300009147 Bacteria 1762
412 Ga0105243_10006165 3300009148 Bacteria 9272
413 Ga0105243_10084351 3300009148 Bacteria 2602
414 Ga0105243_10522298 3300009148 Bacteria 1129
415 Ga0105241_10040363 3300009174 Bacteria 3523
416 Ga0105241_10469742 3300009174 Bacteria 1116
417 Ga0105242_10447536 3300009176 Bacteria 1217
418 Ga0105248_10001371 3300009177 Bacteria 27204
419 Ga0105248_10001451 3300009177 Bacteria 26388
420 Ga0105248_10005525 3300009177 Bacteria 13885
421 Ga0105248_10005772 3300009177 Bacteria 13600
422 Ga0105248_10005852 3300009177 Bacteria 13514
423 Ga0105248_10012052 3300009177 Bacteria 9536
424 Ga0105248_10015837 3300009177 Bacteria 8311
425 Ga0105248_10021046 3300009177 Bacteria 7227
426 Ga0105248_10049427 3300009177 Bacteria 4717
427 Ga0105248_10088495 3300009177 Bacteria 3485
428 Ga0105248_10094681 3300009177 Bacteria 3363
429 Ga0105248_11273213 3300009177 Bacteria 832
430 Ga0105237_10010769 3300009545 Bacteria 9706
431 Ga0105237_10506389 3300009545 Bacteria 1214
432 Ga0105238_10014228 3300009551 Bacteria 8046
433 Ga0105238_10122108 3300009551 Bacteria 2584
434 Ga0105238_10146494 3300009551 Bacteria 2338
435 Ga0105249_10020574 3300009553 Bacteria 5900
436 Ga0105249_10020587 3300009553 Bacteria 5898
437 Ga0105249_10075966 3300009553 Bacteria 3112
438 Ga0105249_10181637 3300009553 Bacteria 2047
439 Ga0105032_102857 3300009979 Bacteria 1523
440 Ga0105239_10013539 3300010375 Bacteria 9055
441 Ga0105239_10034313 3300010375 Bacteria 5571
442 Ga0105239_10167471 3300010375 Bacteria 2457
443 Ga0105246_10038013 3300011119 Bacteria 3233
444 Ga0105246_10185980 3300011119 Bacteria 1604
445 Ga0105246_10721627 3300011119 Bacteria 876
446 Ga0157373_10001921 3300013100 Bacteria 15792
447 Ga0157373_10029657 3300013100 Bacteria 3939
448 Ga0157373_10040266 3300013100 Bacteria 3344
449 Ga0157373_10105277 3300013100 Bacteria 1984
450 Ga0157373_10107654 3300013100 Bacteria 1960
451 Ga0157373_10139243 3300013100 Bacteria 1706
452 Ga0157373_10209349 3300013100 Bacteria 1375
453 Ga0157371_10001392 3300013102 Bacteria 25245
454 Ga0157371_10002958 3300013102 Bacteria 15800
455 Ga0157371_10007477 3300013102 Bacteria 8842
456 Ga0157371_10064745 3300013102 Bacteria 2590
457 Ga0157371_10068751 3300013102 Bacteria 2507
458 Ga0157371_10223170 3300013102 Bacteria 1353
459 Ga0157371_10248129 3300013102 Bacteria 1281
460 Ga0157371_10321452 3300013102 Bacteria 1123
461 Ga0157371_10410148 3300013102 Bacteria 992
462 Ga0157370_10101199 3300013104 Bacteria 2699
463 Ga0157370_10124515 3300013104 Bacteria 2407
464 Ga0157370_10165271 3300013104 Bacteria 2058
465 Ga0157370_10249005 3300013104 Bacteria 1644
466 Ga0157369_10200863 3300013105 Bacteria 2093
467 Ga0157369_10390196 3300013105 Bacteria 1444
468 Ga0157369_10486956 3300013105 Bacteria 1276
469 Ga0157374_10195042 3300013296 Bacteria 1982
470 Ga0157374_10614277 3300013296 Bacteria 1098
471 Ga0157378_10002066 3300013297 Bacteria 17982
472 Ga0157378_10173401 3300013297 Bacteria 2024
473 Ga0157378_10237200 3300013297 Bacteria 1741
474 Ga0157378_10334813 3300013297 Bacteria 1474
475 Ga0157378_10357560 3300013297 Bacteria 1428
476 Ga0163162_10008660 3300013306 Bacteria 9903
477 Ga0163162_10034837 3300013306 Bacteria 5012
478 Ga0163162_10144003 3300013306 Bacteria 2498
479 Ga0163162_10226109 3300013306 Bacteria 2001
480 Ga0163162_10560526 3300013306 Bacteria 1270
481 Ga0157372_10020101 3300013307 Bacteria 7200
482 Ga0157372_10180075 3300013307 Bacteria 2446
483 Ga0157372_10186333 3300013307 Bacteria 2403
484 Ga0157372_10247193 3300013307 Bacteria 2070
485 Ga0157372_10434164 3300013307 Bacteria 1531
486 Ga0157375_10025132 3300013308 Bacteria 5526
487 Ga0163163_10000187 3300014325 Bacteria 63661
488 Ga0163163_10004884 3300014325 Bacteria 11530
489 Ga0163163_10115723 3300014325 Bacteria 2713
490 Ga0157380_10024053 3300014326 Bacteria 4605
491 Ga0157380_10335735 3300014326 Bacteria 1407
492 Ga0182008_10009276 3300014497 Bacteria 5319
493 Ga0157379_10001895 3300014968 Bacteria 17285
494 Ga0163161_10032124 3300017792 Bacteria 3746
495 Ga0197907_10397631 3300020069 Bacteria 696
496 Ga0206350_10511030 3300020080 Bacteria 755
497 Ga0206353_10687052 3300020082 Bacteria 1484
498 Ga0207673_1001411 3300025290 Bacteria 2620
499 Ga0207426_1028265 3300025302 Bacteria 1861
500 Ga0207697_10000059 3300025315 Bacteria 45306
501 Ga0207697_10013380 3300025315 Bacteria 3424
502 Ga0207697_10016248 3300025315 Bacteria 3067
503 Ga0207697_10165081 3300025315 Bacteria 967
504 Ga0207656_10054258 3300025321 Bacteria 1742
505 Ga0207656_10083208 3300025321 Bacteria 1442
506 Ga0207656_10086677 3300025321 Bacteria 1415
507 Ga0207656_10278849 3300025321 Bacteria 824
508 Ga0207696_1021677 3300025711 Bacteria 2054
509 Ga0207682_10002495 3300025893 Bacteria 8222
510 Ga0207682_10008416 3300025893 Bacteria 4081
511 Ga0207682_10119264 3300025893 Bacteria 1169
512 Ga0207642_10032928 3300025899 Bacteria 2187
513 Ga0207642_10089597 3300025899 Bacteria 1516
514 Ga0207642_10467521 3300025899 Bacteria 767
515 Ga0207710_10159948 3300025900 Bacteria 1097
516 Ga0207688_10000721 3300025901 Bacteria 16387
517 Ga0207688_10027872 3300025901 Bacteria 3107
518 Ga0207688_10047124 3300025901 Bacteria 2407
519 Ga0207688_10051874 3300025901 Bacteria 2298
520 Ga0207680_10005938 3300025903 Bacteria 5867
521 Ga0207680_10091239 3300025903 Bacteria 1938
522 Ga0207680_10097415 3300025903 Bacteria 1883
523 Ga0207680_10104447 3300025903 Bacteria 1826
524 Ga0207680_10221008 3300025903 Bacteria 1299
525 Ga0207647_10000517 3300025904 Bacteria 30788
526 Ga0207647_10000968 3300025904 Bacteria 22267
527 Ga0207647_10001381 3300025904 Bacteria 18648
528 Ga0207647_10010206 3300025904 Bacteria 6636
529 Ga0207647_10016337 3300025904 Bacteria 5067
530 Ga0207647_10025102 3300025904 Bacteria 3922
531 Ga0207647_10055593 3300025904 Bacteria 2432
532 Ga0207647_10063273 3300025904 Bacteria 2250
533 Ga0207699_10457304 3300025906 Bacteria 917
534 Ga0207645_10002144 3300025907 Bacteria 15772
535 Ga0207645_10021236 3300025907 Bacteria 4236
536 Ga0207645_10118614 3300025907 Bacteria 1717
537 Ga0207645_10295748 3300025907 Bacteria 1077
538 Ga0207645_10506620 3300025907 Bacteria 817
539 Ga0207643_10163127 3300025908 Bacteria 1342
540 Ga0207705_10000086 3300025909 Bacteria 116132
541 Ga0207705_10000701 3300025909 Bacteria 27662
542 Ga0207705_10004131 3300025909 Bacteria 11008
543 Ga0207705_10006209 3300025909 Bacteria 8881
544 Ga0207705_10008363 3300025909 Bacteria 7554
545 Ga0207705_10011590 3300025909 Bacteria 6374
546 Ga0207705_10013290 3300025909 Bacteria 5941
547 Ga0207705_10023818 3300025909 Bacteria 4368
548 Ga0207705_10037207 3300025909 Bacteria 3482
549 Ga0207705_10069423 3300025909 Bacteria 2552
550 Ga0207705_10074316 3300025909 Bacteria 2467
551 Ga0207705_10616676 3300025909 Bacteria 844
552 Ga0207684_10340120 3300025910 Bacteria 1292
553 Ga0207654_10021100 3300025911 Bacteria 3460
554 Ga0207654_10243549 3300025911 Bacteria 1203
555 Ga0207707_10014330 3300025912 Bacteria 6904
556 Ga0207707_10075903 3300025912 Bacteria 2933
557 Ga0207707_10102083 3300025912 Bacteria 2507
558 Ga0207695_10035556 3300025913 Bacteria 5400
559 Ga0207695_10214801 3300025913 Bacteria 1833
560 Ga0207671_10024122 3300025914 Bacteria 4578
561 Ga0207671_10040914 3300025914 Bacteria 3430
562 Ga0207660_10085878 3300025917 Bacteria 2322
563 Ga0207660_10091953 3300025917 Bacteria 2251
564 Ga0207660_10241413 3300025917 Bacteria 1423
565 Ga0207660_10570244 3300025917 Bacteria 921
566 Ga0207660_10828579 3300025917 Bacteria 755
567 Ga0207657_10000133 3300025919 Bacteria 75282
568 Ga0207657_10000267 3300025919 Bacteria 55426
569 Ga0207657_10001177 3300025919 Bacteria 27752
570 Ga0207657_10002033 3300025919 Bacteria 21868
571 Ga0207657_10002077 3300025919 Bacteria 21670
572 Ga0207657_10005242 3300025919 Bacteria 13581
573 Ga0207657_10005850 3300025919 Bacteria 12810
574 Ga0207657_10007733 3300025919 Bacteria 10976
575 Ga0207657_10011286 3300025919 Bacteria 8873
576 Ga0207657_10012980 3300025919 Bacteria 8189
577 Ga0207657_10024605 3300025919 Bacteria 5570
578 Ga0207657_10032102 3300025919 Bacteria 4748
579 Ga0207657_10036355 3300025919 Bacteria 4408
580 Ga0207657_10089878 3300025919 Bacteria 2564
581 Ga0207657_10093889 3300025919 Bacteria 2499
582 Ga0207657_10112797 3300025919 Bacteria 2243
583 Ga0207657_10229600 3300025919 Bacteria 1484
584 Ga0207657_10328281 3300025919 Bacteria 1209
585 Ga0207657_10330157 3300025919 Bacteria 1205
586 Ga0207649_10000378 3300025920 Bacteria 33311
587 Ga0207649_10006156 3300025920 Bacteria 6513
588 Ga0207649_10013422 3300025920 Bacteria 4574
589 Ga0207649_10021465 3300025920 Bacteria 3718
590 Ga0207649_10055945 3300025920 Bacteria 2462
591 Ga0207649_10093156 3300025920 Bacteria 1976
592 Ga0207649_10128076 3300025920 Bacteria 1721
593 Ga0207649_10200651 3300025920 Bacteria 1409
594 Ga0207649_10213143 3300025920 Bacteria 1371
595 Ga0207649_10249602 3300025920 Bacteria 1278
596 Ga0207649_10284368 3300025920 Bacteria 1204
597 Ga0207649_10551628 3300025920 Bacteria 882
598 Ga0207652_10087026 3300025921 Bacteria 2740
599 Ga0207652_10099875 3300025921 Bacteria 2561
600 Ga0207652_10160314 3300025921 Bacteria 2016
601 Ga0207652_10225460 3300025921 Bacteria 1689
602 Ga0207652_10548568 3300025921 Bacteria 1039
603 Ga0207681_10000737 3300025923 Bacteria 21451
604 Ga0207681_10005272 3300025923 Bacteria 7941
605 Ga0207681_10015499 3300025923 Bacteria 4754
606 Ga0207681_10028893 3300025923 Bacteria 3595
607 Ga0207681_10079727 3300025923 Bacteria 2308
608 Ga0207681_10083656 3300025923 Bacteria 2259
609 Ga0207681_10294507 3300025923 Bacteria 1282
610 Ga0207681_10301533 3300025923 Bacteria 1268
611 Ga0207681_10505218 3300025923 Bacteria 990
612 Ga0207694_10001964 3300025924 Bacteria 17016
613 Ga0207694_10035054 3300025924 Bacteria 3848
614 Ga0207694_10048303 3300025924 Bacteria 3293
615 Ga0207694_10353031 3300025924 Bacteria 1217
616 Ga0207650_10002036 3300025925 Bacteria 14153
617 Ga0207650_10024731 3300025925 Bacteria 4273
618 Ga0207650_10028056 3300025925 Bacteria 4034
619 Ga0207650_10036551 3300025925 Bacteria 3574
620 Ga0207650_10059204 3300025925 Bacteria 2854
621 Ga0207650_10067988 3300025925 Bacteria 2675
622 Ga0207650_10069349 3300025925 Bacteria 2649
623 Ga0207650_10081899 3300025925 Bacteria 2449
624 Ga0207650_10407823 3300025925 Bacteria 1126
625 Ga0207659_10032626 3300025926 Bacteria 3576
626 Ga0207659_10090813 3300025926 Bacteria 2281
627 Ga0207659_10104718 3300025926 Bacteria 2140
628 Ga0207659_10245532 3300025926 Bacteria 1450
629 Ga0207687_10000688 3300025927 Bacteria 22793
630 Ga0207687_10189407 3300025927 Bacteria 1600
631 Ga0207700_10194610 3300025928 Bacteria 1705
632 Ga0207700_10380620 3300025928 Bacteria 1234
633 Ga0207664_10016045 3300025929 Bacteria 5456
634 Ga0207664_10036027 3300025929 Bacteria 3822
635 Ga0207664_10293670 3300025929 Bacteria 1429
636 Ga0207664_10313174 3300025929 Bacteria 1383
637 Ga0207644_10000810 3300025931 Bacteria 19859
638 Ga0207644_10000892 3300025931 Bacteria 18859
639 Ga0207644_10009781 3300025931 Bacteria 6305
640 Ga0207644_10015229 3300025931 Bacteria 5159
641 Ga0207644_10015386 3300025931 Bacteria 5133
642 Ga0207644_10039524 3300025931 Bacteria 3330
643 Ga0207644_10044604 3300025931 Bacteria 3151
644 Ga0207644_10071172 3300025931 Bacteria 2543
645 Ga0207644_10122119 3300025931 Bacteria 1984
646 Ga0207644_10282828 3300025931 Bacteria 1332
647 Ga0207690_10000080 3300025932 Bacteria 82082
648 Ga0207690_10001597 3300025932 Bacteria 14142
649 Ga0207690_10008792 3300025932 Bacteria 5995
650 Ga0207690_10020418 3300025932 Bacteria 4093
651 Ga0207690_10020974 3300025932 Bacteria 4046
652 Ga0207690_10066664 3300025932 Bacteria 2466
653 Ga0207690_10218251 3300025932 Bacteria 1458
654 Ga0207690_10260010 3300025932 Bacteria 1344
655 Ga0207690_10371348 3300025932 Bacteria 1135
656 Ga0207690_10545514 3300025932 Bacteria 942
657 Ga0207706_10000159 3300025933 Bacteria 75284
658 Ga0207706_10000426 3300025933 Bacteria 45291
659 Ga0207706_10000489 3300025933 Bacteria 42307
660 Ga0207706_10015017 3300025933 Bacteria 7012
661 Ga0207706_10023413 3300025933 Bacteria 5546
662 Ga0207706_10027599 3300025933 Bacteria 5075
663 Ga0207706_10043389 3300025933 Bacteria 3985
664 Ga0207706_10060056 3300025933 Bacteria 3348
665 Ga0207706_10084481 3300025933 Bacteria 2791
666 Ga0207706_10086933 3300025933 Bacteria 2748
667 Ga0207706_10132833 3300025933 Bacteria 2189
668 Ga0207706_10164574 3300025933 Bacteria 1949
669 Ga0207706_10221489 3300025933 Bacteria 1656
670 Ga0207706_10349561 3300025933 Bacteria 1286
671 Ga0207706_10541464 3300025933 Bacteria 1003
672 Ga0207686_10170042 3300025934 Bacteria 1536
673 Ga0207686_10357874 3300025934 Bacteria 1101
674 Ga0207686_10667120 3300025934 Bacteria 824
675 Ga0207709_10068733 3300025935 Bacteria 2240
676 Ga0207709_10133938 3300025935 Bacteria 1693
677 Ga0207670_10085972 3300025936 Bacteria 2211
678 Ga0207669_10021661 3300025937 Bacteria 3398
679 Ga0207669_10024724 3300025937 Bacteria 3233
680 Ga0207669_10041189 3300025937 Bacteria 2686
681 Ga0207669_10047307 3300025937 Bacteria 2547
682 Ga0207669_10118040 3300025937 Bacteria 1794
683 Ga0207704_10001297 3300025938 Bacteria 11173
684 Ga0207704_10033735 3300025938 Bacteria 2914
685 Ga0207665_10131781 3300025939 Bacteria 1775
686 Ga0207691_10000563 3300025940 Bacteria 37125
687 Ga0207691_10000784 3300025940 Bacteria 31530
688 Ga0207691_10000926 3300025940 Bacteria 29127
689 Ga0207691_10006995 3300025940 Bacteria 10886
690 Ga0207691_10037512 3300025940 Bacteria 4488
691 Ga0207691_10047937 3300025940 Bacteria 3918
692 Ga0207691_10148727 3300025940 Bacteria 2060
693 Ga0207691_10344460 3300025940 Bacteria 1275
694 Ga0207691_10405257 3300025940 Bacteria 1163
695 Ga0207711_10000673 3300025941 Bacteria 33946
696 Ga0207711_10000744 3300025941 Bacteria 31965
697 Ga0207711_10002355 3300025941 Bacteria 16937
698 Ga0207711_10003449 3300025941 Bacteria 13681
699 Ga0207711_10003526 3300025941 Bacteria 13544
700 Ga0207711_10004881 3300025941 Bacteria 11381
701 Ga0207711_10008994 3300025941 Bacteria 8350
702 Ga0207711_10012570 3300025941 Bacteria 7034
703 Ga0207711_10019022 3300025941 Bacteria 5715
704 Ga0207711_10038596 3300025941 Bacteria 4062
705 Ga0207711_10200502 3300025941 Bacteria 1821
706 Ga0207711_10226254 3300025941 Bacteria 1712
707 Ga0207711_10438158 3300025941 Bacteria 1216
708 Ga0207711_10568771 3300025941 Bacteria 1057
709 Ga0207689_10000128 3300025942 Bacteria 64122
710 Ga0207689_10005679 3300025942 Bacteria 11099
711 Ga0207689_10072020 3300025942 Bacteria 2839
712 Ga0207661_10001549 3300025944 Bacteria 15638
713 Ga0207661_10101206 3300025944 Bacteria 2420
714 Ga0207679_10000155 3300025945 Bacteria 56504
715 Ga0207679_10011077 3300025945 Bacteria 5823
716 Ga0207679_10024415 3300025945 Bacteria 4145
717 Ga0207679_10025281 3300025945 Bacteria 4081
718 Ga0207679_10070785 3300025945 Bacteria 2629
719 Ga0207679_10083608 3300025945 Bacteria 2447
720 Ga0207679_10252160 3300025945 Bacteria 1501
721 Ga0207667_10002247 3300025949 Bacteria 24260
722 Ga0207667_10004592 3300025949 Bacteria 16934
723 Ga0207667_10011412 3300025949 Bacteria 10327
724 Ga0207667_10020128 3300025949 Bacteria 7431
725 Ga0207667_10028475 3300025949 Bacteria 6068
726 Ga0207667_10072862 3300025949 Bacteria 3570
727 Ga0207667_10088525 3300025949 Bacteria 3202
728 Ga0207667_10093985 3300025949 Bacteria 3096
729 Ga0207667_10116741 3300025949 Bacteria 2750
730 Ga0207667_10174009 3300025949 Bacteria 2212
731 Ga0207667_10220077 3300025949 Bacteria 1945
732 Ga0207667_10315474 3300025949 Bacteria 1597
733 Ga0207667_10400130 3300025949 Bacteria 1398
734 Ga0207667_10460903 3300025949 Bacteria 1291
735 Ga0207667_10678891 3300025949 Bacteria 1034
736 Ga0207667_10768019 3300025949 Bacteria 962
737 Ga0207651_10000814 3300025960 Bacteria 13453
738 Ga0207651_10016227 3300025960 Bacteria 4356
739 Ga0207651_10027483 3300025960 Bacteria 3573
740 Ga0207651_10050373 3300025960 Bacteria 2827
741 Ga0207651_10092360 3300025960 Bacteria 2219
742 Ga0207651_10155883 3300025960 Bacteria 1784
743 Ga0207651_10216932 3300025960 Bacteria 1544
744 Ga0207651_10283282 3300025960 Bacteria 1371
745 Ga0207651_10447028 3300025960 Bacteria 1108
746 Ga0207651_10568904 3300025960 Bacteria 987
747 Ga0207712_10011834 3300025961 Bacteria 5563
748 Ga0207712_10041946 3300025961 Bacteria 3149
749 Ga0207712_10226271 3300025961 Bacteria 1498
750 Ga0207668_10000325 3300025972 Bacteria 30851
751 Ga0207668_10005131 3300025972 Bacteria 7703
752 Ga0207668_10024770 3300025972 Bacteria 3877
753 Ga0207668_10058376 3300025972 Bacteria 2697
754 Ga0207668_10072571 3300025972 Bacteria 2463
755 Ga0207668_10097143 3300025972 Bacteria 2179
756 Ga0207668_10113530 3300025972 Bacteria 2037
757 Ga0207668_10138869 3300025972 Bacteria 1866
758 Ga0207668_10671192 3300025972 Bacteria 909
759 Ga0207640_10000589 3300025981 Bacteria 21653
760 Ga0207640_10075861 3300025981 Bacteria 2280
761 Ga0207640_10167451 3300025981 Bacteria 1633
762 Ga0207640_10209305 3300025981 Bacteria 1484
763 Ga0207640_10234562 3300025981 Bacteria 1414
764 Ga0207640_10275885 3300025981 Bacteria 1318
765 Ga0207640_10291548 3300025981 Bacteria 1287
766 Ga0207640_10367294 3300025981 Bacteria 1162
767 Ga0207640_10559545 3300025981 Bacteria 962
768 Ga0207640_10894015 3300025981 Bacteria 775
769 Ga0207658_10001589 3300025986 Bacteria 17512
770 Ga0207658_10008238 3300025986 Bacteria 7100
771 Ga0207658_10022828 3300025986 Bacteria 4359
772 Ga0207658_10026021 3300025986 Bacteria 4099
773 Ga0207658_10125712 3300025986 Unclassified 2052
774 Ga0207658_10222558 3300025986 Bacteria 1588
775 Ga0207658_10577115 3300025986 Bacteria 1008
776 Ga0207658_10676359 3300025986 Bacteria 931
777 Ga0207677_10003986 3300026023 Bacteria 7877
778 Ga0207677_10009115 3300026023 Bacteria 5571
779 Ga0207677_10051253 3300026023 Bacteria 2797
780 Ga0207677_10053108 3300026023 Bacteria 2757
781 Ga0207677_10308143 3300026023 Bacteria 1311
782 Ga0207677_10667568 3300026023 Bacteria 919
783 Ga0207703_10005013 3300026035 Bacteria 10734
784 Ga0207703_10006221 3300026035 Bacteria 9556
785 Ga0207703_10036191 3300026035 Bacteria 3927
786 Ga0207703_10041285 3300026035 Bacteria 3695
787 Ga0207703_10112236 3300026035 Bacteria 2328
788 Ga0207703_10121406 3300026035 Bacteria 2243
789 Ga0207703_10122520 3300026035 Bacteria 2234
790 Ga0207703_10205329 3300026035 Bacteria 1753
791 Ga0207703_10412074 3300026035 Bacteria 1256
792 Ga0207639_10000137 3300026041 Bacteria 54378
793 Ga0207639_10001284 3300026041 Bacteria 16946
794 Ga0207639_10004961 3300026041 Bacteria 8966
795 Ga0207639_10054027 3300026041 Bacteria 3068
796 Ga0207639_10117074 3300026041 Bacteria 2183
797 Ga0207639_10121086 3300026041 Bacteria 2150
798 Ga0207639_10194607 3300026041 Bacteria 1734
799 Ga0207639_10277430 3300026041 Bacteria 1473
800 Ga0207639_10353931 3300026041 Bacteria 1312
801 Ga0207678_10000973 3300026067 Bacteria 26103
802 Ga0207678_10003440 3300026067 Bacteria 14260
803 Ga0207678_10004764 3300026067 Bacteria 12179
804 Ga0207678_10011000 3300026067 Bacteria 7948
805 Ga0207678_10013248 3300026067 Bacteria 7236
806 Ga0207678_10026389 3300026067 Bacteria 5069
807 Ga0207678_10097436 3300026067 Bacteria 2513
808 Ga0207678_10268166 3300026067 Bacteria 1464
809 Ga0207678_10366395 3300026067 Bacteria 1244
810 Ga0207678_10399631 3300026067 Bacteria 1190
811 Ga0207678_10403057 3300026067 Bacteria 1184
812 Ga0207678_10506796 3300026067 Bacteria 1052
813 Ga0207702_10000246 3300026078 Bacteria 63201
814 Ga0207702_10009045 3300026078 Bacteria 8386
815 Ga0207702_10019937 3300026078 Bacteria 5556
816 Ga0207702_10052269 3300026078 Bacteria 3457
817 Ga0207702_10095937 3300026078 Bacteria 2607
818 Ga0207702_10165035 3300026078 Bacteria 2025
819 Ga0207702_10169353 3300026078 Bacteria 2001
820 Ga0207702_10397466 3300026078 Bacteria 1328
821 Ga0207641_10000887 3300026088 Bacteria 31227
822 Ga0207641_10012073 3300026088 Bacteria 7084
823 Ga0207641_10015098 3300026088 Bacteria 6328
824 Ga0207641_10016859 3300026088 Bacteria 5981
825 Ga0207641_10030030 3300026088 Bacteria 4499
826 Ga0207641_10037919 3300026088 Bacteria 4027
827 Ga0207641_10140155 3300026088 Bacteria 2181
828 Ga0207641_10157875 3300026088 Bacteria 2059
829 Ga0207641_10179086 3300026088 Bacteria 1940
830 Ga0207641_10603978 3300026088 Bacteria 1074
831 Ga0207648_10002960 3300026089 Bacteria 17950
832 Ga0207648_10003309 3300026089 Bacteria 16928
833 Ga0207648_10005935 3300026089 Bacteria 12215
834 Ga0207648_10154315 3300026089 Bacteria 2026
835 Ga0207648_10485719 3300026089 Bacteria 1128
836 Ga0207676_10000220 3300026095 Bacteria 49329
837 Ga0207676_10003309 3300026095 Bacteria 11437
838 Ga0207676_10027929 3300026095 Bacteria 4209
839 Ga0207676_10042598 3300026095 Bacteria 3492
840 Ga0207676_10049111 3300026095 Bacteria 3280
841 Ga0207676_10084560 3300026095 Bacteria 2586
842 Ga0207676_10151054 3300026095 Bacteria 2000
843 Ga0207676_10226580 3300026095 Bacteria 1668
844 Ga0207674_10000827 3300026116 Bacteria 40278
845 Ga0207674_10000989 3300026116 Bacteria 37099
846 Ga0207674_10012197 3300026116 Bacteria 9614
847 Ga0207674_10017536 3300026116 Bacteria 7811
848 Ga0207674_10018670 3300026116 Bacteria 7532
849 Ga0207674_10056440 3300026116 Bacteria 3988
850 Ga0207674_10185447 3300026116 Bacteria 2031
851 Ga0207674_10625750 3300026116 Bacteria 1039
852 Ga0207675_100014870 3300026118 Bacteria 7264
853 Ga0207675_100064677 3300026118 Bacteria 3419
854 Ga0207675_100500953 3300026118 Bacteria 1209
855 Ga0207683_10004561 3300026121 Bacteria 11929
856 Ga0207683_10007564 3300026121 Bacteria 9307
857 Ga0207683_10065797 3300026121 Bacteria 3196
858 Ga0207683_10084691 3300026121 Bacteria 2818
859 Ga0207683_10203750 3300026121 Bacteria 1799
860 Ga0207683_10763126 3300026121 Bacteria 897
861 Ga0207698_10000913 3300026142 Bacteria 17183
862 Ga0207698_10001619 3300026142 Bacteria 13098
863 Ga0207698_10018711 3300026142 Bacteria 4728
864 Ga0207698_10030911 3300026142 Bacteria 3858
865 Ga0207698_10053397 3300026142 Bacteria 3102
866 Ga0207698_10101609 3300026142 Bacteria 2385
867 Ga0207698_10102938 3300026142 Bacteria 2372
868 Ga0207698_10109091 3300026142 Bacteria 2315
869 Ga0207698_10163002 3300026142 Bacteria 1953
870 Ga0207698_10238829 3300026142 Bacteria 1655
871 Ga0207698_10476802 3300026142 Bacteria 1209
872 Ga0207698_10494058 3300026142 Bacteria 1190
873 Ga0209969_1032434 3300027360 Bacteria 800
874 Ga0209971_1016234 3300027682 Bacteria 1765
875 Ga0209974_10003160 3300027876 Bacteria 5961
876 Ga0209974_10095334 3300027876 Bacteria 1035
877 Ga0207428_10127265 3300027907 Bacteria 1950
878 Ga0268266_10003568 3300028379 Bacteria 15419
879 Ga0268266_10006664 3300028379 Bacteria 10537
880 Ga0268266_10007897 3300028379 Bacteria 9527
881 Ga0268266_10101357 3300028379 Bacteria 2538
882 Ga0268266_10357325 3300028379 Bacteria 1374
883 Ga0268266_11072627 3300028379 Bacteria 779
884 Ga0268265_10001197 3300028380 Bacteria 22605
885 Ga0268265_10001950 3300028380 Bacteria 16391
886 Ga0268265_10002912 3300028380 Bacteria 12558
887 Ga0268265_10036883 3300028380 Bacteria 3584
888 Ga0268265_10042243 3300028380 Bacteria 3381
889 Ga0268265_10088421 3300028380 Bacteria 2468
890 Ga0268265_10197882 3300028380 Bacteria 1740
891 Ga0268265_10536997 3300028380 Bacteria 1108
892 Ga0268265_10667235 3300028380 Bacteria 1001
893 Ga0268264_10005021 3300028381 Bacteria 11202
894 Ga0268264_10007348 3300028381 Bacteria 9205
895 Ga0268264_10014538 3300028381 Bacteria 6466
896 Ga0268264_10016781 3300028381 Bacteria 5992
897 Ga0268264_10036974 3300028381 Bacteria 4024
898 Ga0268264_10054925 3300028381 Bacteria 3327
899 Ga0268264_10126996 3300028381 Bacteria 2255
900 Ga0268264_10127274 3300028381 Bacteria 2253
901 Ga0268264_10219054 3300028381 Bacteria 1751
902 Ga0268264_10222738 3300028381 Bacteria 1737
903 Ga0307408_100029311 3300031548 Bacteria 3812
904 Ga0307408_100049946 3300031548 Bacteria 3006
905 Ga0307408_100207442 3300031548 Bacteria 1590
906 Ga0307408_100244138 3300031548 Bacteria 1477
907 Ga0307405_10001698 3300031731 Bacteria 9398
908 Ga0307405_10024143 3300031731 Bacteria 3468
909 Ga0307405_10282938 3300031731 Bacteria 1249
910 Ga0307405_10309622 3300031731 Bacteria 1202
911 Ga0307405_10421914 3300031731 Bacteria 1050
912 Ga0307413_10007129 3300031824 Bacteria 5162
913 Ga0307413_10011570 3300031824 Bacteria 4349
914 Ga0307413_10034292 3300031824 Bacteria 2899
915 Ga0307413_10062769 3300031824 Bacteria 2300
916 Ga0307413_10100687 3300031824 Bacteria 1908
917 Ga0307413_10153387 3300031824 Bacteria 1608
918 Ga0307413_10204342 3300031824 Bacteria 1429
919 Ga0307413_10692713 3300031824 Bacteria 845
920 Ga0307410_10005962 3300031852 Bacteria 6521
921 Ga0307410_10008886 3300031852 Bacteria 5603
922 Ga0307410_10018848 3300031852 Bacteria 4180
923 Ga0307410_10027298 3300031852 Bacteria 3607
924 Ga0307410_10642021 3300031852 Bacteria 889
925 Ga0307410_10684358 3300031852 Bacteria 863
926 Ga0307410_10767564 3300031852 Bacteria 817
927 Ga0307406_10029120 3300031901 Bacteria 3342
928 Ga0307406_10047190 3300031901 Bacteria 2713
929 Ga0307406_10110698 3300031901 Bacteria 1890
930 Ga0307406_10323006 3300031901 Bacteria 1195
931 Ga0307406_10670881 3300031901 Bacteria 863
932 Ga0307407_10007950 3300031903 Bacteria 4834
933 Ga0307407_10013464 3300031903 Bacteria 3971
934 Ga0307407_10071115 3300031903 Bacteria 2070
935 Ga0307407_10215021 3300031903 Bacteria 1296
936 Ga0307407_10267806 3300031903 Bacteria 1178
937 Ga0307407_10623911 3300031903 Bacteria 805
938 Ga0307412_10011818 3300031911 Bacteria 5068
939 Ga0307412_10028607 3300031911 Bacteria 3489
940 Ga0307412_10047706 3300031911 Bacteria 2814
941 Ga0307412_10058670 3300031911 Bacteria 2575
942 Ga0307412_10059543 3300031911 Bacteria 2560
943 Ga0307409_100023968 3300031995 Bacteria 4243
944 Ga0307409_100050232 3300031995 Bacteria 3184
945 Ga0307409_100095990 3300031995 Bacteria 2444
946 Ga0307409_100100174 3300031995 Bacteria 2401
947 Ga0307409_100157069 3300031995 Bacteria 1983
948 Ga0307409_100322649 3300031995 Bacteria 1446
949 Ga0307416_100000617 3300032002 Bacteria 18324
950 Ga0307416_100030102 3300032002 Bacteria 4069
951 Ga0307416_100071952 3300032002 Bacteria 2875
952 Ga0307416_100172592 3300032002 Bacteria 2015
953 Ga0307416_100208991 3300032002 Bacteria 1860
954 Ga0307416_100259235 3300032002 Bacteria 1698
955 Ga0307416_100358318 3300032002 Bacteria 1479
956 Ga0307416_100524581 3300032002 Bacteria 1253
957 Ga0307414_10001122 3300032004 Bacteria 13688
958 Ga0307414_10080243 3300032004 Bacteria 2385
959 Ga0307414_10109941 3300032004 Bacteria 2095
960 Ga0307414_10187684 3300032004 Bacteria 1669
961 Ga0307414_10207308 3300032004 Bacteria 1599
962 Ga0307414_10334836 3300032004 Bacteria 1293
963 Ga0307414_10503159 3300032004 Bacteria 1072
964 Ga0307414_11117364 3300032004 Bacteria 728
965 Ga0307411_10008325 3300032005 Bacteria 5363
966 Ga0307411_10022826 3300032005 Bacteria 3693
967 Ga0307411_10023027 3300032005 Bacteria 3680
968 Ga0307411_10028304 3300032005 Bacteria 3405
969 Ga0307411_10042340 3300032005 Bacteria 2904
970 Ga0307411_10093862 3300032005 Bacteria 2102
971 Ga0307411_10094296 3300032005 Bacteria 2098
972 Ga0307411_10129054 3300032005 Bacteria 1844
973 Ga0307411_10166998 3300032005 Bacteria 1655
974 Ga0307411_10256300 3300032005 Bacteria 1379
975 Ga0307411_10527701 3300032005 Bacteria 1003
976 Ga0307415_100013944 3300032126 Bacteria 4708
977 Ga0307415_100021070 3300032126 Bacteria 3997
978 Ga0307415_100041855 3300032126 Bacteria 3044
979 Ga0307415_100055902 3300032126 Bacteria 2703
980 Ga0307415_100073764 3300032126 Bacteria 2409
981 Ga0307415_100134655 3300032126 Bacteria 1877
982 Ga0307415_100159552 3300032126 Bacteria 1746
983 Ga0307415_101074552 3300032126 Bacteria 752
984 Ga0307510_10101239 3300033180 Bacteria 2670
985 Ga0373950_0009561 3300034818 Bacteria 1551
986 Ga0373951_0039388 3300035091 Bacteria 1136
987 Ga0373923_0034501 3300035111 Bacteria 2054
988 Ga0373939_0024615 3300035114 Bacteria 1679
989 Ga0373956_0035184 3300035119 Bacteria 2208
990 Ga0373960_0032719 3300035121 Bacteria 1462
991 Ga0373955_0002938 3300035172 Bacteria 7470
992 Ga0373942_0038904 3300035207 Bacteria 1291
993 Ga0373931_0028070 3300035691 Bacteria 2878
994 Ga0373935_0057913 3300035692 Bacteria 2473
995 Ga0373935_0205828 3300035692 Bacteria 1362
996 Ga0373933_0017201 3300035724 Bacteria 4054
997 Ga0373937_0008086 3300036401 Bacteria 9130
998 Ga0395899_0001906 3300037312 Bacteria 17205
999 Ga0395899_0002038 3300037312 Bacteria 16634
1000 Ga0395899_0004378 3300037312 Bacteria 11010
1001 Ga0395899_0009083 3300037312 Bacteria 7637
1002 Ga0395899_0014470 3300037312 Bacteria 6022
1003 Ga0395899_0019423 3300037312 Bacteria 5163
1004 Ga0395899_0024559 3300037312 Bacteria 4556
1005 Ga0395899_0034693 3300037312 Bacteria 3789
1006 Ga0395899_0037906 3300037312 Bacteria 3613
1007 Ga0395899_0085892 3300037312 Bacteria 2286
1008 Ga0395899_0095354 3300037312 Bacteria 2152
1009 Ga0395899_0132058 3300037312 Bacteria 1782
1010 Ga0395899_0157459 3300037312 Bacteria 1606
1011 Ga0395899_0166442 3300037312 Bacteria 1555
1012 Ga0395899_0237663 3300037312 Bacteria 1255
1013 Ga0395900_0000192 3300037418 Bacteria 98186
1014 Ga0395900_0000380 3300037418 Bacteria 64150
1015 Ga0395900_0000447 3300037418 Bacteria 59069
1016 Ga0395900_0000605 3300037418 Bacteria 49062
1017 Ga0395900_0009079 3300037418 Bacteria 10190
1018 Ga0395900_0026266 3300037418 Bacteria 5963
1019 Ga0395900_0027115 3300037418 Bacteria 5865
1020 Ga0395900_0036057 3300037418 Bacteria 5096
1021 Ga0395900_0054345 3300037418 Bacteria 4124
1022 Ga0395900_0074540 3300037418 Bacteria 3488
1023 Ga0395900_0076801 3300037418 Bacteria 3432
1024 Ga0395900_0083414 3300037418 Bacteria 3283
1025 Ga0395900_0088878 3300037418 Bacteria 3176
1026 Ga0395900_0131699 3300037418 Bacteria 2562
1027 Ga0395900_0226465 3300037418 Bacteria 1882
1028 Ga0395900_0242436 3300037418 Bacteria 1808
1029 Ga0395900_0322659 3300037418 Bacteria 1524
1030 Ga0395900_0322704 3300037418 Bacteria 1524
1031 Ga0395900_0332734 3300037418 Bacteria 1496
1032 Ga0395900_0419845 3300037418 Bacteria 1298
1033 Ga0395900_0455058 3300037418 Bacteria 1236
1034 Ga0395900_0502690 3300037418 Bacteria 1162
1035 Ga0395900_0700414 3300037418 Bacteria 946
1036 Ga0395898_0003738 3300037466 Bacteria 16877
1037 Ga0395898_0005548 3300037466 Bacteria 13612
1038 Ga0395898_0011697 3300037466 Bacteria 9100
1039 Ga0395898_0013296 3300037466 Bacteria 8477
1040 Ga0395898_0014191 3300037466 Bacteria 8192
1041 Ga0395898_0025266 3300037466 Bacteria 5987
1042 Ga0395898_0038819 3300037466 Bacteria 4716
1043 Ga0395898_0071174 3300037466 Bacteria 3361
1044 Ga0395898_0089205 3300037466 Bacteria 2967
1045 Ga0395898_0146665 3300037466 Bacteria 2258
1046 Ga0395898_0252965 3300037466 Bacteria 1680
1047 Ga0395898_0506897 3300037466 Bacteria 1148
1048 Ga0395898_0554983 3300037466 Bacteria 1091
1049 Ga0395898_0584565 3300037466 Bacteria 1059
1050 Ga0395898_0609476 3300037466 Bacteria 1034
1051 Ga0395898_1103296 3300037466 Bacteria 727
1052 Ga0395905_0000109 3300037471 Bacteria 137754
1053 Ga0395905_0000187 3300037471 Bacteria 98895
1054 Ga0395905_0001357 3300037471 Bacteria 29810
1055 Ga0395905_0002154 3300037471 Bacteria 22324
1056 Ga0395905_0006340 3300037471 Bacteria 11919
1057 Ga0395905_0011160 3300037471 Bacteria 8688
1058 Ga0395905_0011454 3300037471 Bacteria 8570
1059 Ga0395905_0014637 3300037471 Bacteria 7483
1060 Ga0395905_0025102 3300037471 Bacteria 5621
1061 Ga0395905_0032713 3300037471 Bacteria 4889
1062 Ga0395905_0036667 3300037471 Bacteria 4606
1063 Ga0395905_0042141 3300037471 Bacteria 4283
1064 Ga0395905_0042710 3300037471 Bacteria 4253
1065 Ga0395905_0060088 3300037471 Bacteria 3554
1066 Ga0395905_0072478 3300037471 Bacteria 3229
1067 Ga0395905_0082203 3300037471 Bacteria 3019
1068 Ga0395905_0092740 3300037471 Bacteria 2832
1069 Ga0395905_0101576 3300037471 Bacteria 2699
1070 Ga0395905_0114027 3300037471 Bacteria 2539
1071 Ga0395905_0121122 3300037471 Bacteria 2459
1072 Ga0395905_0214803 3300037471 Bacteria 1801
1073 Ga0395905_0315626 3300037471 Bacteria 1452
1074 Ga0395905_0360955 3300037471 Bacteria 1345
1075 Ga0395905_0400586 3300037471 Bacteria 1267
1076 Ga0395901_0000181 3300038443 Bacteria 81816
1077 Ga0395901_0000324 3300038443 Bacteria 59134
1078 Ga0395901_0013360 3300038443 Bacteria 8344
1079 Ga0395901_0017029 3300038443 Bacteria 7407
1080 Ga0395901_0018270 3300038443 Bacteria 7159
1081 Ga0395901_0031771 3300038443 Bacteria 5444
1082 Ga0395901_0040845 3300038443 Bacteria 4805
1083 Ga0395901_0060578 3300038443 Bacteria 3938
1084 Ga0395901_0069323 3300038443 Bacteria 3673
1085 Ga0395901_0073398 3300038443 Bacteria 3568
1086 Ga0395901_0099462 3300038443 Bacteria 3050
1087 Ga0395901_0131996 3300038443 Bacteria 2624
1088 Ga0395901_0138041 3300038443 Bacteria 2562
1089 Ga0395901_0142824 3300038443 Bacteria 2516
1090 Ga0395901_0158348 3300038443 Bacteria 2378
1091 Ga0395901_0215534 3300038443 Bacteria 2008
1092 Ga0395901_0292435 3300038443 Bacteria 1690
1093 Ga0395901_0304696 3300038443 Bacteria 1651
1094 Ga0439448_0016190 3300042005 Bacteria 2267
1095 Ga0439448_0103258 3300042005 Bacteria 970
1096 Ga0439432_039002 3300042006 Bacteria 1511
1097 Ga0439455_0004214 3300042012 Bacteria 2832
1098 Ga0439455_0065263 3300042012 Bacteria 971
1099 Ga0450917_003954 3300042120 Bacteria 1074
1100 Ga0450889_000027 3300042144 Bacteria 12498
1101 Ga0439458_0000134 3300042157 Bacteria 15726
1102 Ga0439458_0003409 3300042157 Bacteria 3722
1103 Ga0466969_0013849 3300044656 Bacteria 4245
1104 Ga0466969_0021021 3300044656 Bacteria 3376
1105 Ga0466972_0211859 3300044658 Bacteria 907
1106 Ga0466972_0276118 3300044658 Bacteria 785
1107 Ga0466966_0004143 3300044684 Bacteria 9576
1108 Ga0466966_0013022 3300044684 Bacteria 5506
1109 Ga0466966_0054344 3300044684 Bacteria 2538
1110 Ga0466966_0058491 3300044684 Bacteria 2436
1111 Ga0466961_0078081 3300044693 Bacteria 2097
1112 Ga0466961_0095330 3300044693 Bacteria 1877
1113 Ga0466961_0111292 3300044693 Bacteria 1723
1114 Ga0466961_0175450 3300044693 Bacteria 1332
1115 Ga0466961_0355353 3300044693 Bacteria 891
1116 Ga0466963_0008779 3300044694 Bacteria 6070
1117 Ga0466963_0010173 3300044694 Bacteria 5688
1118 Ga0466963_0067617 3300044694 Bacteria 2398
1119 Ga0466963_0096103 3300044694 Bacteria 2023
1120 Ga0466963_0279511 3300044694 Bacteria 1173
1121 Ga0466964_0004332 3300044706 Bacteria 5229
1122 Ga0466964_0102347 3300044706 Bacteria 1265
1123 Ga0466964_0203949 3300044706 Bacteria 951
1124 Ga0466971_0092625 3300044719 Bacteria 1384
1125 Ga0466971_0134830 3300044719 Bacteria 1148
1126 Ga0466971_0217408 3300044719 Bacteria 905
1127 Ga0466968_0018604 3300044735 Bacteria 2788
1128 Ga0466970_0003329 3300044765 Bacteria 7817
1129 Ga0466970_0026093 3300044765 Bacteria 3062
1130 Ga0466970_0174104 3300044765 Bacteria 1193
1131 Ga0466970_0453396 3300044765 Bacteria 735
1132 Ga0466957_0005122 3300044842 Bacteria 7323
1133 Ga0466957_0009707 3300044842 Bacteria 5496
1134 Ga0466957_0090175 3300044842 Bacteria 1920
1135 Ga0466957_0203781 3300044842 Bacteria 1300
1136 Ga0466957_0243751 3300044842 Bacteria 1193
1137 Ga0466957_0360575 3300044842 Bacteria 988
1138 Ga0466960_0067701 3300044901 Bacteria 1769
1139 Ga0466959_0045044 3300045049 Bacteria 3249
1140 Ga0466959_0045338 3300045049 Bacteria 3238
1141 Ga0466959_0051911 3300045049 Bacteria 3004
1142 Ga0466959_0062106 3300045049 Bacteria 2716
1143 Ga0466958_0044527 3300045836 Bacteria 2675
1144 Ga0466958_0046012 3300045836 Bacteria 2633
1145 Ga0466958_0098942 3300045836 Bacteria 1811
1146 Ga0466958_0342717 3300045836 Bacteria 961
1147 Ga0466967_0004539 3300045976 Bacteria 9393
1148 Ga0466967_0017060 3300045976 Bacteria 5749
1149 Ga0466967_0029120 3300045976 Bacteria 4618
1150 Ga0466967_0072971 3300045976 Bacteria 3078
1151 Ga0466967_0088193 3300045976 Bacteria 2814
1152 Ga0466967_0124900 3300045976 Bacteria 2382
1153 Ga0466967_0153022 3300045976 Bacteria 2158
1154 Ga0466967_0422473 3300045976 Bacteria 1299
1155 Ga0466967_1096768 3300045976 Unclassified 793
1156 Ga0495627_082805 3300046453 Bacteria 928
1157 Ga0495648_0027699 3300046524 Bacteria 3789
1158 Ga0495642_0033263 3300046528 Bacteria 2073
1159 Ga0495642_0038141 3300046528 Bacteria 1947
1160 Ga0495668_0003378 3300046616 Bacteria 12014
1161 Ga0495668_0005794 3300046616 Bacteria 8258
1162 Ga0495668_0169622 3300046616 Bacteria 1196
1163 Ga0495668_0206741 3300046616 Bacteria 1075
1164 Ga0495625_0083477 3300046660 Bacteria 2221
1165 Ga0495625_0144741 3300046660 Bacteria 1601
1166 Ga0495623_0030352 3300046679 Bacteria 3477
1167 Ga0495647_0058708 3300046681 Bacteria 1513
1168 Ga0495669_0001675 3300046684 Bacteria 9076
1169 Ga0495669_0002861 3300046684 Bacteria 7079
1170 Ga0495669_0022783 3300046684 Bacteria 2722
1171 Ga0495669_0058134 3300046684 Bacteria 1745
1172 Ga0495669_0085489 3300046684 Bacteria 1451
1173 Ga0495669_0088818 3300046684 Bacteria 1425
1174 Ga0495671_0028517 3300046692 Bacteria 2874
1175 Ga0495677_0003362 3300047445 Bacteria 6223
1176 Ga0495677_0091639 3300047445 Bacteria 1146
1177 Ga0495685_150137 3300047447 Bacteria 757
1178 Ga0495686_0065237 3300047472 Bacteria 2251
1179 Ga0495602_0065312 3300048088 Bacteria 3141
1180 Ga0496101_0063926 3300048904 Bacteria 2680
1181 Ga0496103_0000197 3300048906 Bacteria 60344
1182 Ga0496103_0236261 3300048906 Bacteria 1176
1183 Ga0496104_0042527 3300048907 Bacteria 4265
1184 Ga0496104_0586466 3300048907 Bacteria 1025
1185 Ga0496106_0004149 3300048909 Bacteria 10801
1186 Ga0496106_0480475 3300048909 Bacteria 998
1187 Ga0496107_0004256 3300048910 Bacteria 9679
1188 Ga0496107_0013433 3300048910 Bacteria 5723
1189 Ga0496107_0051223 3300048910 Bacteria 2977
1190 Ga0496108_0011863 3300048911 Bacteria 7088
1191 Ga0496109_0003002 3300048912 Bacteria 14099
1192 Ga0496109_0060780 3300048912 Bacteria 3453
1193 Ga0496109_0590160 3300048912 Bacteria 1047
1194 Ga0496110_0098886 3300048913 Bacteria 2616
1195 Ga0496110_0161915 3300048913 Bacteria 2028
1196 Ga0496110_0218808 3300048913 Bacteria 1732
1197 Ga0496111_0022592 3300048914 Bacteria 4406
1198 Ga0496111_0108735 3300048914 Bacteria 2041
1199 Ga0496112_0007247 3300048915 Bacteria 9829
1200 Ga0496112_0194638 3300048915 Bacteria 1988
1201 Ga0496112_0362534 3300048915 Bacteria 1391
1202 Ga0496113_0043788 3300048916 Bacteria 3314
1203 Ga0496113_0140874 3300048916 Bacteria 1897
1204 Ga0496113_0193329 3300048916 Bacteria 1615
1205 Ga0496113_0676172 3300048916 Bacteria 825
1206 Ga0496114_0000029 3300048917 Bacteria 175132
1207 Ga0496114_0011356 3300048917 Bacteria 7114
1208 Ga0496116_0001609 3300048919 Bacteria 24823
1209 Ga0496117_0000467 3300048920 Bacteria 67483
1210 Ga0496118_0000459 3300048921 Bacteria 67483
1211 Ga0496119_0008785 3300048922 Bacteria 8804
1212 Ga0496124_0000499 3300048927 Bacteria 67483
1213 Ga0496126_0678629 3300048929 Bacteria 803
1214 Ga0501292_000013 3300049515 Bacteria 65866
1215 Ga0501294_000018 3300049517 Bacteria 17168
1216 Ga0501300_005687 3300049523 Bacteria 1836
1217 Ga0501301_000328 3300049524 Bacteria 2776
1218 Ga0501315_010179 3300049531 Bacteria 1125
1219 Ga0501317_043587 3300049533 Bacteria 693
1220 Ga0501333_009587 3300049549 Bacteria 681
1221 Ga0501069_0144401 3300049585 Bacteria 1366
1222 Ga0501202_003190 3300049652 Bacteria 2797
1223 Ga0501207_004706 3300049654 Bacteria 1867
1224 Ga0501222_001068 3300049662 Bacteria 3881
1225 Ga0501223_002998 3300049663 Bacteria 3703
1226 Ga0501224_003536 3300049664 Bacteria 2185
1227 Ga0501227_002581 3300049665 Bacteria 3978
1228 Ga0501233_070705 3300049668 Bacteria 884
1229 Ga0501249_030825 3300049679 Bacteria 1195
1230 Ga0501259_000783 3300049688 Bacteria 5196
1231 Ga0501261_000122 3300049690 Bacteria 11656
1232 Ga0501225_0007663 3300049705 Bacteria 3126
1233 Ga0501245_008303 3300049708 Bacteria 1478
1234 Ga0501264_001632 3300049761 Bacteria 2331
1235 Ga0501279_000004 3300049775 Bacteria 175612
1236 Ga0501280_000014 3300049776 Bacteria 57720
1237 Ga0501281_00278 3300049777 Bacteria 5311
1238 Ga0501282_000090 3300049778 Bacteria 10522
1239 Ga0501283_001678 3300049779 Bacteria 2887
1240 Ga0501284_00550 3300050005 Bacteria 1939
1241 nmdc:mga0k408_145762_c1 3300050493 Bacteria 1409
1242 nmdc:mga05p37_367594_c1 3300050507 Bacteria 1689
1243 nmdc:mga09592_213874_c1 3300050508 Bacteria 1670
1244 nmdc:mga08y16_42580_c1 3300050511 Bacteria 4755
1245 Ga0500643_000886 3300053087 Bacteria 18951
1246 Ga0500644_0091717 3300053088 Bacteria 1138
1247 Ga0500594_0011856 3300053118 Bacteria 2042
1248 Ga0500658_0000150 3300053134 Bacteria 33225
1249 Ga0500559_0006868 3300053136 Bacteria 5098
1250 Ga0500627_0000564 3300053158 Bacteria 9977
1251 Ga0590075_109362 3300059424 Bacteria 721
1252 Ga0587080_026240 3300059503 Bacteria 988
1253 Ga0587106_025996 3300059605 Bacteria 906
1254 Ga0466962_0005370 3300061719 Bacteria 6164

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0678629 Ga0496126_0678629_248_793 181
2 3300049533 Ga0501317_043587 Ga0501317_043587_60_605 181
3 3300049549 Ga0501333_009587 Ga0501333_009587_49_594 181
4 3300025302 Ga0207426_1028265 Ga0207426_10282652 189
5 3300046453 Ga0495627_082805 Ga0495627_082805_32_610 189
6 iso_pu_bacteria 2643221622 2644126374 199
7 3300013297 Ga0157378_10237200 Ga0157378_102372002 201
8 3300046616 Ga0495668_0005794 Ga0495668_0005794_391_1011 201
9 3300053158 Ga0500627_0000564 Ga0500627_0000564_355_975 201
10 3300005563 Ga0068855_100397190 Ga0068855_1003971902 203
11 3300025949 Ga0207667_10315474 Ga0207667_103154741 203
12 3300049515 Ga0501292_000013 Ga0501292_000013_2355_2978 203
13 3300049517 Ga0501294_000018 Ga0501294_000018_2361_2984 203
14 3300049523 Ga0501300_005687 Ga0501300_005687_852_1475 203
15 3300049524 Ga0501301_000328 Ga0501301_000328_550_1173 203
16 3300049531 Ga0501315_010179 Ga0501315_010179_148_771 203
17 3300049652 Ga0501202_003190 Ga0501202_003190_1671_2294 203
18 3300049654 Ga0501207_004706 Ga0501207_004706_807_1430 203
19 3300049662 Ga0501222_001068 Ga0501222_001068_1196_1819 203
20 3300049663 Ga0501223_002998 Ga0501223_002998_1196_1819 203
21 3300049664 Ga0501224_003536 Ga0501224_003536_851_1474 203
22 3300049665 Ga0501227_002581 Ga0501227_002581_11_634 203
23 3300049668 Ga0501233_070705 Ga0501233_070705_99_722 203
24 3300049688 Ga0501259_000783 Ga0501259_000783_2352_2975 203
25 3300049690 Ga0501261_000122 Ga0501261_000122_3153_3776 203
26 3300049705 Ga0501225_0007663 Ga0501225_0007663_688_1311 203
27 3300049708 Ga0501245_008303 Ga0501245_008303_145_768 203
28 3300049761 Ga0501264_001632 Ga0501264_001632_656_1279 203
29 3300049775 Ga0501279_000004 Ga0501279_000004_121749_122372 203
30 3300049776 Ga0501280_000014 Ga0501280_000014_1196_1819 203
31 3300049777 Ga0501281_00278 Ga0501281_00278_1806_2429 203
32 3300049778 Ga0501282_000090 Ga0501282_000090_4187_4810 203
33 3300049779 Ga0501283_001678 Ga0501283_001678_612_1235 203
34 3300050005 Ga0501284_00550 Ga0501284_00550_852_1475 203
35 3300005338 Ga0068868_100338924 Ga0068868_1003389241 204
36 3300005355 Ga0070671_100265097 Ga0070671_1002650972 204
37 3300005535 Ga0070684_100403608 Ga0070684_1004036082 204
38 3300005539 Ga0068853_100035581 Ga0068853_1000355812 204
39 3300005563 Ga0068855_100000644 Ga0068855_10000064412 204
40 3300005564 Ga0070664_100699579 Ga0070664_1006995792 204
41 3300005616 Ga0068852_100690987 Ga0068852_1006909872 204
42 3300005618 Ga0068864_100100250 Ga0068864_1001002503 204
43 3300005844 Ga0068862_100999537 Ga0068862_1009995371 204
44 3300006237 Ga0097621_100542954 Ga0097621_1005429542 204
45 3300009551 Ga0105238_10122108 Ga0105238_101221082 204
46 3300025924 Ga0207694_10048303 Ga0207694_100483031 204
47 3300025949 Ga0207667_10004592 Ga0207667_100045922 204
48 3300025972 Ga0207668_10138869 Ga0207668_101388692 204
49 3300026041 Ga0207639_10054027 Ga0207639_100540272 204
50 3300026078 Ga0207702_10095937 Ga0207702_100959372 204
51 3300026095 Ga0207676_10226580 Ga0207676_102265802 204
52 3300026142 Ga0207698_10102938 Ga0207698_101029382 204
53 3300026142 Ga0207698_10163002 Ga0207698_101630022 204
54 3300028380 Ga0268265_10667235 Ga0268265_106672351 204
55 3300033180 Ga0307510_10101239 Ga0307510_101012393 204
56 3300046524 Ga0495648_0027699 Ga0495648_0027699_1648_2274 204
57 3300046616 Ga0495668_0206741 Ga0495668_0206741_97_732 204
58 3300046660 Ga0495625_0144741 Ga0495625_0144741_359_985 204
59 3300046692 Ga0495671_0028517 Ga0495671_0028517_517_1143 204
60 3300047472 Ga0495686_0065237 Ga0495686_0065237_1395_2018 204
61 3300048906 Ga0496103_0000197 Ga0496103_0000197_19635_20264 204
62 3300048919 Ga0496116_0001609 Ga0496116_0001609_8926_9555 204
63 3300048920 Ga0496117_0000467 Ga0496117_0000467_19635_20264 204
64 3300048921 Ga0496118_0000459 Ga0496118_0000459_47220_47849 204
65 3300048922 Ga0496119_0008785 Ga0496119_0008785_8019_8648 204
66 3300048927 Ga0496124_0000499 Ga0496124_0000499_19635_20264 204
67 3300053088 Ga0500644_0091717 Ga0500644_0091717_169_795 204
68 3300053118 Ga0500594_0011856 Ga0500594_0011856_1170_1796 204
69 3300031731 Ga0307405_10309622 Ga0307405_103096222 208
70 3300031824 Ga0307413_10011570 Ga0307413_100115702 208
71 3300031901 Ga0307406_10110698 Ga0307406_101106982 208
72 3300031911 Ga0307412_10059543 Ga0307412_100595432 208
73 3300031995 Ga0307409_100157069 Ga0307409_1001570692 208
74 3300032002 Ga0307416_100259235 Ga0307416_1002592352 208
75 3300005293 Ga0065715_10337381 Ga0065715_103373812 209
76 3300005327 Ga0070658_10596792 Ga0070658_105967921 209
77 3300005329 Ga0070683_100130614 Ga0070683_1001306142 209
78 3300005331 Ga0070670_100479999 Ga0070670_1004799992 209
79 3300005339 Ga0070660_100001337 Ga0070660_1000013378 209
80 3300005339 Ga0070660_100019319 Ga0070660_1000193192 209
81 3300005345 Ga0070692_10029498 Ga0070692_100294984 209
82 3300005345 Ga0070692_10032211 Ga0070692_100322114 209
83 3300005354 Ga0070675_100041590 Ga0070675_1000415901 209
84 3300005455 Ga0070663_100032903 Ga0070663_1000329032 209
85 3300005455 Ga0070663_100048496 Ga0070663_1000484962 209
86 3300005456 Ga0070678_100732564 Ga0070678_1007325642 209
87 3300005530 Ga0070679_100060463 Ga0070679_1000604632 209
88 3300005530 Ga0070679_100577165 Ga0070679_1005771652 209
89 3300005563 Ga0068855_100004669 Ga0068855_1000046699 209
90 3300005563 Ga0068855_100091623 Ga0068855_1000916232 209
91 3300005617 Ga0068859_100090631 Ga0068859_1000906313 209
92 3300006931 Ga0097620_100090627 Ga0097620_1000906273 209
93 3300009101 Ga0105247_10035556 Ga0105247_100355562 209
94 3300009177 Ga0105248_10094681 Ga0105248_100946812 209
95 3300009979 Ga0105032_102857 Ga0105032_1028572 209
96 3300013102 Ga0157371_10007477 Ga0157371_100074778 209
97 3300013104 Ga0157370_10249005 Ga0157370_102490052 209
98 3300025315 Ga0207697_10016248 Ga0207697_100162482 209
99 3300025900 Ga0207710_10159948 Ga0207710_101599482 209
100 3300025909 Ga0207705_10000701 Ga0207705_100007018 209
101 3300025909 Ga0207705_10004131 Ga0207705_100041319 209
102 3300025909 Ga0207705_10013290 Ga0207705_100132906 209
103 3300025909 Ga0207705_10069423 Ga0207705_100694233 209
104 3300025917 Ga0207660_10828579 Ga0207660_108285791 209
105 3300025919 Ga0207657_10000267 Ga0207657_1000026735 209
106 3300025919 Ga0207657_10002033 Ga0207657_1000203310 209
107 3300025919 Ga0207657_10011286 Ga0207657_100112866 209
108 3300025921 Ga0207652_10548568 Ga0207652_105485682 209
109 3300025925 Ga0207650_10081899 Ga0207650_100818992 209
110 3300025926 Ga0207659_10245532 Ga0207659_102455322 209
111 3300025933 Ga0207706_10084481 Ga0207706_100844812 209
112 3300025941 Ga0207711_10438158 Ga0207711_104381582 209
113 3300025944 Ga0207661_10101206 Ga0207661_101012063 209
114 3300025949 Ga0207667_10002247 Ga0207667_100022476 209
115 3300025960 Ga0207651_10155883 Ga0207651_101558831 209
116 3300026067 Ga0207678_10004764 Ga0207678_100047645 209
117 3300026067 Ga0207678_10011000 Ga0207678_100110006 209
118 3300026121 Ga0207683_10763126 Ga0207683_107631262 209
119 3300031548 Ga0307408_100207442 Ga0307408_1002074422 209
120 3300031548 Ga0307408_100244138 Ga0307408_1002441382 209
121 3300031824 Ga0307413_10034292 Ga0307413_100342922 209
122 3300031852 Ga0307410_10642021 Ga0307410_106420212 209
123 3300031901 Ga0307406_10047190 Ga0307406_100471902 209
124 3300031903 Ga0307407_10013464 Ga0307407_100134646 209
125 3300031903 Ga0307407_10215021 Ga0307407_102150212 209
126 3300031911 Ga0307412_10028607 Ga0307412_100286073 209
127 3300031995 Ga0307409_100050232 Ga0307409_1000502322 209
128 3300032002 Ga0307416_100030102 Ga0307416_1000301023 209
129 3300032002 Ga0307416_100071952 Ga0307416_1000719522 209
130 3300032004 Ga0307414_10080243 Ga0307414_100802432 209
131 3300032005 Ga0307411_10023027 Ga0307411_100230273 209
132 3300032126 Ga0307415_100021070 Ga0307415_1000210702 209
133 3300037312 Ga0395899_0001906 Ga0395899_0001906_5492_6121 209
134 3300037312 Ga0395899_0037906 Ga0395899_0037906_1395_2024 209
135 3300037418 Ga0395900_0000447 Ga0395900_0000447_22111_22740 209
136 3300037418 Ga0395900_0026266 Ga0395900_0026266_2653_3282 209
137 3300037466 Ga0395898_0011697 Ga0395898_0011697_2665_3294 209
138 3300037466 Ga0395898_0013296 Ga0395898_0013296_6269_6898 209
139 3300037471 Ga0395905_0011454 Ga0395905_0011454_2105_2734 209
140 3300038443 Ga0395901_0000324 Ga0395901_0000324_22143_22772 209
141 3300038443 Ga0395901_0060578 Ga0395901_0060578_2609_3238 209
142 3300046681 Ga0495647_0058708 Ga0495647_0058708_189_869 209
143 3300001979 JGI24740J21852_10017742 JGI24740J21852_100177422 210
144 3300005327 Ga0070658_10304851 Ga0070658_103048511 210
145 3300005329 Ga0070683_100055752 Ga0070683_1000557522 210
146 3300005336 Ga0070680_100046577 Ga0070680_1000465772 210
147 3300005339 Ga0070660_100069452 Ga0070660_1000694522 210
148 3300005344 Ga0070661_100136364 Ga0070661_1001363642 210
149 3300005345 Ga0070692_10106179 Ga0070692_101061792 210
150 3300005458 Ga0070681_10123246 Ga0070681_101232462 210
151 3300005530 Ga0070679_100094609 Ga0070679_1000946092 210
152 3300005539 Ga0068853_100274592 Ga0068853_1002745922 210
153 3300005563 Ga0068855_100060024 Ga0068855_1000600243 210
154 3300005614 Ga0068856_100047656 Ga0068856_1000476562 210
155 3300020069 Ga0197907_10397631 Ga0197907_103976311 210
156 3300020080 Ga0206350_10511030 Ga0206350_105110301 210
157 3300020082 Ga0206353_10687052 Ga0206353_106870522 210
158 3300025904 Ga0207647_10063273 Ga0207647_100632732 210
159 3300025909 Ga0207705_10037207 Ga0207705_100372073 210
160 3300025912 Ga0207707_10075903 Ga0207707_100759032 210
161 3300025917 Ga0207660_10091953 Ga0207660_100919532 210
162 3300025919 Ga0207657_10036355 Ga0207657_100363556 210
163 3300025920 Ga0207649_10055945 Ga0207649_100559452 210
164 3300025921 Ga0207652_10087026 Ga0207652_100870262 210
165 3300025949 Ga0207667_10072862 Ga0207667_100728623 210
166 3300025981 Ga0207640_10291548 Ga0207640_102915482 210
167 3300026067 Ga0207678_10003440 Ga0207678_100034406 210
168 3300026078 Ga0207702_10165035 Ga0207702_101650352 210
169 3300027876 Ga0209974_10095334 Ga0209974_100953342 210
170 3300031731 Ga0307405_10421914 Ga0307405_104219142 210
171 3300031824 Ga0307413_10007129 Ga0307413_100071291 210
172 3300031824 Ga0307413_10153387 Ga0307413_101533872 210
173 3300031824 Ga0307413_10692713 Ga0307413_106927132 210
174 3300031852 Ga0307410_10018848 Ga0307410_100188483 210
175 3300031852 Ga0307410_10027298 Ga0307410_100272985 210
176 3300032004 Ga0307414_10001122 Ga0307414_100011223 210
177 3300032004 Ga0307414_10207308 Ga0307414_102073082 210
178 3300032005 Ga0307411_10028304 Ga0307411_100283044 210
179 3300032005 Ga0307411_10042340 Ga0307411_100423403 210
180 3300032005 Ga0307411_10129054 Ga0307411_101290542 210
181 3300032005 Ga0307411_10166998 Ga0307411_101669982 210
182 3300032126 Ga0307415_100134655 Ga0307415_1001346552 210
183 3300037312 Ga0395899_0085892 Ga0395899_0085892_1185_1817 210
184 3300037418 Ga0395900_0000380 Ga0395900_0000380_24400_25032 210
185 3300037418 Ga0395900_0502690 Ga0395900_0502690_428_1060 210
186 3300037466 Ga0395898_0071174 Ga0395898_0071174_965_1597 210
187 3300037471 Ga0395905_0001357 Ga0395905_0001357_22390_23022 210
188 3300037471 Ga0395905_0082203 Ga0395905_0082203_905_1537 210
189 3300038443 Ga0395901_0000181 Ga0395901_0000181_67692_68324 210
190 3300044694 Ga0466963_0096103 Ga0466963_0096103_1016_1648 210
191 3300045976 Ga0466967_0029120 Ga0466967_0029120_3580_4212 210
192 3300001978 JGI24747J21853_1005347 JGI24747J21853_10053472 211
193 3300002076 JGI24749J21850_1006451 JGI24749J21850_10064512 211
194 3300002244 JGI24742J22300_10010583 JGI24742J22300_100105832 211
195 3300005290 Ga0065712_10085019 Ga0065712_100850192 211
196 3300005293 Ga0065715_10002336 Ga0065715_100023363 211
197 3300005293 Ga0065715_10353554 Ga0065715_103535541 211
198 3300005327 Ga0070658_10008488 Ga0070658_100084886 211
199 3300005331 Ga0070670_100014993 Ga0070670_1000149936 211
200 3300005333 Ga0070677_10000942 Ga0070677_100009423 211
201 3300005338 Ga0068868_100772382 Ga0068868_1007723821 211
202 3300005339 Ga0070660_100064661 Ga0070660_1000646612 211
203 3300005339 Ga0070660_100371924 Ga0070660_1003719242 211
204 3300005344 Ga0070661_100369365 Ga0070661_1003693652 211
205 3300005347 Ga0070668_100007897 Ga0070668_1000078977 211
206 3300005353 Ga0070669_100005378 Ga0070669_1000053786 211
207 3300005354 Ga0070675_100002232 Ga0070675_1000022323 211
208 3300005355 Ga0070671_100001973 Ga0070671_1000019732 211
209 3300005355 Ga0070671_100034776 Ga0070671_1000347766 211
210 3300005356 Ga0070674_100002401 Ga0070674_1000024016 211
211 3300005366 Ga0070659_100080222 Ga0070659_1000802222 211
212 3300005367 Ga0070667_100012065 Ga0070667_1000120656 211
213 3300005440 Ga0070705_100252261 Ga0070705_1002522612 211
214 3300005441 Ga0070700_100627083 Ga0070700_1006270831 211
215 3300005444 Ga0070694_100020393 Ga0070694_1000203936 211
216 3300005455 Ga0070663_100252513 Ga0070663_1002525132 211
217 3300005457 Ga0070662_100028718 Ga0070662_1000287184 211
218 3300005457 Ga0070662_100170734 Ga0070662_1001707342 211
219 3300005467 Ga0070706_100242982 Ga0070706_1002429822 211
220 3300005530 Ga0070679_100453307 Ga0070679_1004533072 211
221 3300005530 Ga0070679_100783007 Ga0070679_1007830071 211
222 3300005539 Ga0068853_100198609 Ga0068853_1001986092 211
223 3300005539 Ga0068853_100408940 Ga0068853_1004089402 211
224 3300005543 Ga0070672_100015765 Ga0070672_1000157652 211
225 3300005543 Ga0070672_100892647 Ga0070672_1008926472 211
226 3300005545 Ga0070695_100067295 Ga0070695_1000672953 211
227 3300005546 Ga0070696_100012268 Ga0070696_1000122683 211
228 3300005548 Ga0070665_100130625 Ga0070665_1001306252 211
229 3300005563 Ga0068855_100171870 Ga0068855_1001718703 211
230 3300005564 Ga0070664_100089512 Ga0070664_1000895123 211
231 3300005577 Ga0068857_100153852 Ga0068857_1001538522 211
232 3300005578 Ga0068854_100046376 Ga0068854_1000463763 211
233 3300005578 Ga0068854_100093514 Ga0068854_1000935142 211
234 3300005617 Ga0068859_100008201 Ga0068859_1000082019 211
235 3300005617 Ga0068859_100018885 Ga0068859_1000188854 211
236 3300005719 Ga0068861_100034027 Ga0068861_1000340274 211
237 3300005840 Ga0068870_10176133 Ga0068870_101761332 211
238 3300005840 Ga0068870_10364408 Ga0068870_103644082 211
239 3300005841 Ga0068863_100054224 Ga0068863_1000542246 211
240 3300005843 Ga0068860_100036958 Ga0068860_1000369582 211
241 3300005844 Ga0068862_100002465 Ga0068862_1000024655 211
242 3300006358 Ga0068871_100909588 Ga0068871_1009095882 211
243 3300006881 Ga0068865_100096383 Ga0068865_1000963832 211
244 3300006931 Ga0097620_100008201 Ga0097620_1000082019 211
245 3300006931 Ga0097620_100018885 Ga0097620_1000188854 211
246 3300009094 Ga0111539_10048620 Ga0111539_100486206 211
247 3300009147 Ga0114129_10418685 Ga0114129_104186852 211
248 3300009148 Ga0105243_10084351 Ga0105243_100843513 211
249 3300009177 Ga0105248_10021046 Ga0105248_100210465 211
250 3300009553 Ga0105249_10020574 Ga0105249_100205746 211
251 3300013104 Ga0157370_10124515 Ga0157370_101245152 211
252 3300013306 Ga0163162_10560526 Ga0163162_105605262 211
253 3300014326 Ga0157380_10024053 Ga0157380_100240532 211
254 3300014326 Ga0157380_10335735 Ga0157380_103357351 211
255 3300017792 Ga0163161_10032124 Ga0163161_100321245 211
256 3300025315 Ga0207697_10013380 Ga0207697_100133802 211
257 3300025893 Ga0207682_10002495 Ga0207682_100024955 211
258 3300025901 Ga0207688_10051874 Ga0207688_100518742 211
259 3300025907 Ga0207645_10506620 Ga0207645_105066201 211
260 3300025908 Ga0207643_10163127 Ga0207643_101631272 211
261 3300025910 Ga0207684_10340120 Ga0207684_103401202 211
262 3300025917 Ga0207660_10241413 Ga0207660_102414132 211
263 3300025919 Ga0207657_10002077 Ga0207657_100020779 211
264 3300025919 Ga0207657_10229600 Ga0207657_102296002 211
265 3300025920 Ga0207649_10284368 Ga0207649_102843682 211
266 3300025923 Ga0207681_10005272 Ga0207681_100052726 211
267 3300025925 Ga0207650_10002036 Ga0207650_100020364 211
268 3300025926 Ga0207659_10032626 Ga0207659_100326264 211
269 3300025931 Ga0207644_10009781 Ga0207644_100097813 211
270 3300025931 Ga0207644_10122119 Ga0207644_101221192 211
271 3300025932 Ga0207690_10066664 Ga0207690_100666643 211
272 3300025932 Ga0207690_10260010 Ga0207690_102600101 211
273 3300025933 Ga0207706_10000489 Ga0207706_100004899 211
274 3300025933 Ga0207706_10027599 Ga0207706_100275995 211
275 3300025937 Ga0207669_10021661 Ga0207669_100216614 211
276 3300025940 Ga0207691_10000784 Ga0207691_1000078424 211
277 3300025940 Ga0207691_10405257 Ga0207691_104052572 211
278 3300025941 Ga0207711_10003449 Ga0207711_100034499 211
279 3300025945 Ga0207679_10083608 Ga0207679_100836083 211
280 3300025949 Ga0207667_10174009 Ga0207667_101740093 211
281 3300025949 Ga0207667_10768019 Ga0207667_107680192 211
282 3300025961 Ga0207712_10226271 Ga0207712_102262712 211
283 3300025972 Ga0207668_10005131 Ga0207668_100051314 211
284 3300025981 Ga0207640_10167451 Ga0207640_101674512 211
285 3300025986 Ga0207658_10022828 Ga0207658_100228284 211
286 3300025986 Ga0207658_10676359 Ga0207658_106763592 211
287 3300026041 Ga0207639_10117074 Ga0207639_101170743 211
288 3300026041 Ga0207639_10194607 Ga0207639_101946072 211
289 3300026041 Ga0207639_10277430 Ga0207639_102774302 211
290 3300026067 Ga0207678_10097436 Ga0207678_100974363 211
291 3300026095 Ga0207676_10049111 Ga0207676_100491112 211
292 3300026118 Ga0207675_100014870 Ga0207675_1000148704 211
293 3300026118 Ga0207675_100500953 Ga0207675_1005009532 211
294 3300027360 Ga0209969_1032434 Ga0209969_10324341 211
295 3300027907 Ga0207428_10127265 Ga0207428_101272651 211
296 3300028380 Ga0268265_10042243 Ga0268265_100422432 211
297 3300028381 Ga0268264_10036974 Ga0268264_100369743 211
298 3300028381 Ga0268264_10219054 Ga0268264_102190542 211
299 3300031852 Ga0307410_10767564 Ga0307410_107675642 211
300 3300031901 Ga0307406_10029120 Ga0307406_100291202 211
301 3300031903 Ga0307407_10623911 Ga0307407_106239111 211
302 3300031911 Ga0307412_10058670 Ga0307412_100586702 211
303 3300032002 Ga0307416_100358318 Ga0307416_1003583182 211
304 3300032004 Ga0307414_10109941 Ga0307414_101099412 211
305 3300032126 Ga0307415_100159552 Ga0307415_1001595521 211
306 3300037418 Ga0395900_0083414 Ga0395900_0083414_399_1034 211
307 3300037418 Ga0395900_0242436 Ga0395900_0242436_856_1626 211
308 3300037471 Ga0395905_0000187 Ga0395905_0000187_70980_71750 211
309 3300037471 Ga0395905_0072478 Ga0395905_0072478_2419_3054 211
310 3300038443 Ga0395901_0073398 Ga0395901_0073398_2723_3358 211
311 3300038443 Ga0395901_0304696 Ga0395901_0304696_110_745 211
312 3300042120 Ga0450917_003954 Ga0450917_003954_385_1020 211
313 3300042144 Ga0450889_000027 Ga0450889_000027_3890_4525 211
314 3300048909 Ga0496106_0480475 Ga0496106_0480475_183_818 211
315 3300050507 nmdc:mga05p37_367594_c1 nmdc:mga05p37_367594_c1_293_928 211
316 3300050508 nmdc:mga09592_213874_c1 nmdc:mga09592_213874_c1_790_1437 211
317 3300050511 nmdc:mga08y16_42580_c1 nmdc:mga08y16_42580_c1_642_1277 211
318 iso_pu_bacteria 2885427238 2885429141 211
319 3300001979 JGI24740J21852_10034457 JGI24740J21852_100344572 212
320 3300001989 JGI24739J22299_10014931 JGI24739J22299_100149313 212
321 3300001990 JGI24737J22298_10008811 JGI24737J22298_100088114 212
322 3300002075 JGI24738J21930_10001758 JGI24738J21930_100017585 212
323 3300005327 Ga0070658_10000107 Ga0070658_1000010713 212
324 3300005328 Ga0070676_10019208 Ga0070676_100192083 212
325 3300005329 Ga0070683_100001635 Ga0070683_10000163512 212
326 3300005334 Ga0068869_100328730 Ga0068869_1003287302 212
327 3300005335 Ga0070666_10001184 Ga0070666_1000118412 212
328 3300005338 Ga0068868_100696157 Ga0068868_1006961571 212
329 3300005339 Ga0070660_100002346 Ga0070660_1000023464 212
330 3300005344 Ga0070661_100000101 Ga0070661_10000010124 212
331 3300005347 Ga0070668_100008856 Ga0070668_1000088567 212
332 3300005355 Ga0070671_100021607 Ga0070671_1000216076 212
333 3300005366 Ga0070659_100000045 Ga0070659_10000004563 212
334 3300005455 Ga0070663_100000549 Ga0070663_10000054915 212
335 3300005456 Ga0070678_100068394 Ga0070678_1000683942 212
336 3300005457 Ga0070662_100000036 Ga0070662_10000003658 212
337 3300005457 Ga0070662_100030276 Ga0070662_1000302763 212
338 3300005457 Ga0070662_100692188 Ga0070662_1006921881 212
339 3300005539 Ga0068853_100000059 Ga0068853_10000005934 212
340 3300005543 Ga0070672_100042739 Ga0070672_1000427392 212
341 3300005548 Ga0070665_100004200 Ga0070665_1000042002 212
342 3300005564 Ga0070664_100000027 Ga0070664_10000002758 212
343 3300005578 Ga0068854_100053810 Ga0068854_1000538102 212
344 3300005614 Ga0068856_100000705 Ga0068856_10000070511 212
345 3300005616 Ga0068852_100002112 Ga0068852_10000211212 212
346 3300005841 Ga0068863_100337476 Ga0068863_1003374762 212
347 3300005842 Ga0068858_100014145 Ga0068858_1000141452 212
348 3300005843 Ga0068860_100034483 Ga0068860_1000344836 212
349 3300005844 Ga0068862_100012798 Ga0068862_1000127983 212
350 3300006237 Ga0097621_100268313 Ga0097621_1002683132 212
351 3300006237 Ga0097621_100323489 Ga0097621_1003234892 212
352 3300009174 Ga0105241_10040363 Ga0105241_100403634 212
353 3300009177 Ga0105248_10001451 Ga0105248_1000145127 212
354 3300009177 Ga0105248_10049427 Ga0105248_100494272 212
355 3300009553 Ga0105249_10181637 Ga0105249_101816372 212
356 3300013100 Ga0157373_10029657 Ga0157373_100296575 212
357 3300013102 Ga0157371_10002958 Ga0157371_100029589 212
358 3300013308 Ga0157375_10025132 Ga0157375_100251322 212
359 3300014325 Ga0163163_10000187 Ga0163163_1000018720 212
360 3300025903 Ga0207680_10005938 Ga0207680_100059387 212
361 3300025904 Ga0207647_10016337 Ga0207647_100163373 212
362 3300025907 Ga0207645_10021236 Ga0207645_100212362 212
363 3300025909 Ga0207705_10000086 Ga0207705_10000086113 212
364 3300025911 Ga0207654_10021100 Ga0207654_100211004 212
365 3300025919 Ga0207657_10000133 Ga0207657_1000013345 212
366 3300025920 Ga0207649_10000378 Ga0207649_1000037828 212
367 3300025923 Ga0207681_10015499 Ga0207681_100154996 212
368 3300025925 Ga0207650_10069349 Ga0207650_100693492 212
369 3300025929 Ga0207664_10016045 Ga0207664_100160455 212
370 3300025932 Ga0207690_10000080 Ga0207690_1000008034 212
371 3300025933 Ga0207706_10000159 Ga0207706_1000015945 212
372 3300025933 Ga0207706_10023413 Ga0207706_100234134 212
373 3300025933 Ga0207706_10349561 Ga0207706_103495612 212
374 3300025934 Ga0207686_10357874 Ga0207686_103578742 212
375 3300025940 Ga0207691_10006995 Ga0207691_1000699511 212
376 3300025941 Ga0207711_10003526 Ga0207711_100035268 212
377 3300025941 Ga0207711_10200502 Ga0207711_102005022 212
378 3300025944 Ga0207661_10001549 Ga0207661_1000154910 212
379 3300025945 Ga0207679_10000155 Ga0207679_1000015537 212
380 3300025945 Ga0207679_10252160 Ga0207679_102521602 212
381 3300025949 Ga0207667_10011412 Ga0207667_100114128 212
382 3300025960 Ga0207651_10092360 Ga0207651_100923602 212
383 3300025972 Ga0207668_10000325 Ga0207668_1000032529 212
384 3300026041 Ga0207639_10000137 Ga0207639_1000013712 212
385 3300026067 Ga0207678_10000973 Ga0207678_1000097315 212
386 3300026078 Ga0207702_10000246 Ga0207702_1000024646 212
387 3300026088 Ga0207641_10179086 Ga0207641_101790862 212
388 3300026089 Ga0207648_10002960 Ga0207648_1000296010 212
389 3300026121 Ga0207683_10084691 Ga0207683_100846912 212
390 3300028379 Ga0268266_10006664 Ga0268266_100066648 212
391 3300028380 Ga0268265_10001197 Ga0268265_100011977 212
392 3300028381 Ga0268264_10016781 Ga0268264_100167816 212
393 3300031824 Ga0307413_10100687 Ga0307413_101006872 212
394 3300031852 Ga0307410_10008886 Ga0307410_100088864 212
395 3300031852 Ga0307410_10684358 Ga0307410_106843581 212
396 3300031903 Ga0307407_10071115 Ga0307407_100711152 212
397 3300031903 Ga0307407_10267806 Ga0307407_102678061 212
398 3300031995 Ga0307409_100023968 Ga0307409_1000239683 212
399 3300031995 Ga0307409_100095990 Ga0307409_1000959902 212
400 3300032002 Ga0307416_100208991 Ga0307416_1002089912 212
401 3300032004 Ga0307414_10334836 Ga0307414_103348362 212
402 3300032005 Ga0307411_10022826 Ga0307411_100228263 212
403 3300032005 Ga0307411_10093862 Ga0307411_100938622 212
404 3300032126 Ga0307415_100073764 Ga0307415_1000737642 212
405 3300034818 Ga0373950_0009561 Ga0373950_0009561_325_963 212
406 3300035114 Ga0373939_0024615 Ga0373939_0024615_202_840 212
407 3300035207 Ga0373942_0038904 Ga0373942_0038904_595_1233 212
408 3300035691 Ga0373931_0028070 Ga0373931_0028070_1683_2321 212
409 3300035692 Ga0373935_0057913 Ga0373935_0057913_1063_1701 212
410 3300037312 Ga0395899_0014470 Ga0395899_0014470_1159_1797 212
411 3300037312 Ga0395899_0024559 Ga0395899_0024559_1207_1944 212
412 3300037418 Ga0395900_0036057 Ga0395900_0036057_2635_3273 212
413 3300037418 Ga0395900_0076801 Ga0395900_0076801_809_1546 212
414 3300037418 Ga0395900_0226465 Ga0395900_0226465_288_929 212
415 3300037466 Ga0395898_0089205 Ga0395898_0089205_1583_2221 212
416 3300037466 Ga0395898_0506897 Ga0395898_0506897_305_946 212
417 3300037471 Ga0395905_0042710 Ga0395905_0042710_3121_3759 212
418 3300038443 Ga0395901_0138041 Ga0395901_0138041_924_1562 212
419 3300044719 Ga0466971_0217408 Ga0466971_0217408_252_890 212
420 3300044842 Ga0466957_0203781 Ga0466957_0203781_509_1147 212
421 3300045976 Ga0466967_0153022 Ga0466967_0153022_1298_1936 212
422 3300048907 Ga0496104_0586466 Ga0496104_0586466_358_996 212
423 3300048913 Ga0496110_0218808 Ga0496110_0218808_501_1139 212
424 3300059424 Ga0590075_109362 Ga0590075_109362_14_655 212
425 3300001979 JGI24740J21852_10001279 JGI24740J21852_100012795 213
426 3300001979 JGI24740J21852_10040530 JGI24740J21852_100405302 213
427 3300001989 JGI24739J22299_10000632 JGI24739J22299_1000063212 213
428 3300001990 JGI24737J22298_10000103 JGI24737J22298_100001038 213
429 3300001990 JGI24737J22298_10002837 JGI24737J22298_100028372 213
430 3300001990 JGI24737J22298_10020867 JGI24737J22298_100208672 213
431 3300001991 JGI24743J22301_10007298 JGI24743J22301_100072982 213
432 3300002067 JGI24735J21928_10005631 JGI24735J21928_100056315 213
433 3300002067 JGI24735J21928_10013104 JGI24735J21928_100131042 213
434 3300002067 JGI24735J21928_10036351 JGI24735J21928_100363512 213
435 3300002067 JGI24735J21928_10061071 JGI24735J21928_100610711 213
436 3300002075 JGI24738J21930_10000018 JGI24738J21930_1000001814 213
437 3300002075 JGI24738J21930_10029998 JGI24738J21930_100299981 213
438 3300002126 JGI24035J26624_1006773 JGI24035J26624_10067732 213
439 3300005290 Ga0065712_10152525 Ga0065712_101525252 213
440 3300005327 Ga0070658_10022681 Ga0070658_100226812 213
441 3300005327 Ga0070658_10163593 Ga0070658_101635932 213
442 3300005327 Ga0070658_11138869 Ga0070658_111388691 213
443 3300005328 Ga0070676_10004980 Ga0070676_100049806 213
444 3300005328 Ga0070676_10124010 Ga0070676_101240102 213
445 3300005328 Ga0070676_10357970 Ga0070676_103579701 213
446 3300005329 Ga0070683_100295051 Ga0070683_1002950511 213
447 3300005329 Ga0070683_100359425 Ga0070683_1003594252 213
448 3300005330 Ga0070690_100008191 Ga0070690_1000081912 213
449 3300005330 Ga0070690_100086788 Ga0070690_1000867882 213
450 3300005330 Ga0070690_100097871 Ga0070690_1000978712 213
451 3300005331 Ga0070670_100030532 Ga0070670_1000305321 213
452 3300005331 Ga0070670_100037551 Ga0070670_1000375513 213
453 3300005331 Ga0070670_100056756 Ga0070670_1000567562 213
454 3300005331 Ga0070670_100141126 Ga0070670_1001411262 213
455 3300005333 Ga0070677_10125117 Ga0070677_101251172 213
456 3300005334 Ga0068869_100003378 Ga0068869_10000337810 213
457 3300005334 Ga0068869_100093402 Ga0068869_1000934022 213
458 3300005335 Ga0070666_10012233 Ga0070666_100122331 213
459 3300005335 Ga0070666_10012419 Ga0070666_100124193 213
460 3300005335 Ga0070666_10084148 Ga0070666_100841482 213
461 3300005335 Ga0070666_10138286 Ga0070666_101382862 213
462 3300005336 Ga0070680_100002652 Ga0070680_10000265213 213
463 3300005336 Ga0070680_100231845 Ga0070680_1002318452 213
464 3300005337 Ga0070682_100300271 Ga0070682_1003002711 213
465 3300005338 Ga0068868_100000734 Ga0068868_1000007341 213
466 3300005338 Ga0068868_100019933 Ga0068868_1000199333 213
467 3300005338 Ga0068868_100076179 Ga0068868_1000761792 213
468 3300005338 Ga0068868_100095033 Ga0068868_1000950332 213
469 3300005338 Ga0068868_100232000 Ga0068868_1002320002 213
470 3300005338 Ga0068868_100349399 Ga0068868_1003493991 213
471 3300005339 Ga0070660_100020486 Ga0070660_1000204863 213
472 3300005339 Ga0070660_100032154 Ga0070660_1000321545 213
473 3300005339 Ga0070660_100109890 Ga0070660_1001098902 213
474 3300005339 Ga0070660_100110094 Ga0070660_1001100943 213
475 3300005339 Ga0070660_100123508 Ga0070660_1001235083 213
476 3300005339 Ga0070660_100249033 Ga0070660_1002490332 213
477 3300005339 Ga0070660_100272440 Ga0070660_1002724402 213
478 3300005339 Ga0070660_100349155 Ga0070660_1003491551 213
479 3300005339 Ga0070660_100655853 Ga0070660_1006558532 213
480 3300005340 Ga0070689_100110367 Ga0070689_1001103672 213
481 3300005344 Ga0070661_100020369 Ga0070661_1000203693 213
482 3300005344 Ga0070661_100079658 Ga0070661_1000796582 213
483 3300005344 Ga0070661_100176218 Ga0070661_1001762181 213
484 3300005344 Ga0070661_100178381 Ga0070661_1001783812 213
485 3300005344 Ga0070661_100255746 Ga0070661_1002557462 213
486 3300005344 Ga0070661_100284215 Ga0070661_1002842152 213
487 3300005344 Ga0070661_100320469 Ga0070661_1003204692 213
488 3300005344 Ga0070661_100346457 Ga0070661_1003464571 213
489 3300005345 Ga0070692_10002449 Ga0070692_100024493 213
490 3300005347 Ga0070668_100010460 Ga0070668_1000104605 213
491 3300005347 Ga0070668_100015987 Ga0070668_1000159872 213
492 3300005347 Ga0070668_100108867 Ga0070668_1001088672 213
493 3300005347 Ga0070668_100120134 Ga0070668_1001201342 213
494 3300005347 Ga0070668_100153776 Ga0070668_1001537762 213
495 3300005353 Ga0070669_100000613 Ga0070669_10000061310 213
496 3300005353 Ga0070669_100435069 Ga0070669_1004350691 213
497 3300005354 Ga0070675_100110034 Ga0070675_1001100342 213
498 3300005354 Ga0070675_100117554 Ga0070675_1001175542 213
499 3300005354 Ga0070675_100212019 Ga0070675_1002120192 213
500 3300005355 Ga0070671_100000533 Ga0070671_10000053318 213
501 3300005355 Ga0070671_100001226 Ga0070671_1000012266 213
502 3300005355 Ga0070671_100013491 Ga0070671_1000134912 213
503 3300005355 Ga0070671_100031172 Ga0070671_1000311724 213
504 3300005355 Ga0070671_100042697 Ga0070671_1000426974 213
505 3300005355 Ga0070671_100054968 Ga0070671_1000549682 213
506 3300005355 Ga0070671_100062453 Ga0070671_1000624532 213
507 3300005355 Ga0070671_100258733 Ga0070671_1002587332 213
508 3300005355 Ga0070671_100569554 Ga0070671_1005695541 213
509 3300005356 Ga0070674_100015082 Ga0070674_1000150824 213
510 3300005356 Ga0070674_100028503 Ga0070674_1000285032 213
511 3300005356 Ga0070674_100104318 Ga0070674_1001043182 213
512 3300005364 Ga0070673_100000858 Ga0070673_10000085811 213
513 3300005364 Ga0070673_100003291 Ga0070673_1000032919 213
514 3300005364 Ga0070673_100026112 Ga0070673_1000261122 213
515 3300005364 Ga0070673_100050546 Ga0070673_1000505462 213
516 3300005364 Ga0070673_100052759 Ga0070673_1000527593 213
517 3300005364 Ga0070673_100058719 Ga0070673_1000587192 213
518 3300005364 Ga0070673_100372382 Ga0070673_1003723822 213
519 3300005364 Ga0070673_100384306 Ga0070673_1003843061 213
520 3300005364 Ga0070673_100390927 Ga0070673_1003909272 213
521 3300005365 Ga0070688_100248639 Ga0070688_1002486392 213
522 3300005366 Ga0070659_100005279 Ga0070659_1000052796 213
523 3300005366 Ga0070659_100005391 Ga0070659_1000053913 213
524 3300005366 Ga0070659_100006698 Ga0070659_1000066985 213
525 3300005366 Ga0070659_100021294 Ga0070659_1000212942 213
526 3300005366 Ga0070659_100030158 Ga0070659_1000301582 213
527 3300005366 Ga0070659_100068416 Ga0070659_1000684162 213
528 3300005366 Ga0070659_100311767 Ga0070659_1003117672 213
529 3300005366 Ga0070659_100323555 Ga0070659_1003235552 213
530 3300005366 Ga0070659_100366802 Ga0070659_1003668021 213
531 3300005366 Ga0070659_100442387 Ga0070659_1004423871 213
532 3300005367 Ga0070667_100001174 Ga0070667_1000011748 213
533 3300005367 Ga0070667_100001244 Ga0070667_1000012449 213
534 3300005367 Ga0070667_100005894 Ga0070667_1000058942 213
535 3300005367 Ga0070667_100005942 Ga0070667_1000059422 213
536 3300005367 Ga0070667_100008179 Ga0070667_1000081794 213
537 3300005367 Ga0070667_100015715 Ga0070667_1000157152 213
538 3300005367 Ga0070667_100020338 Ga0070667_1000203386 213
539 3300005367 Ga0070667_100499234 Ga0070667_1004992341 213
540 3300005435 Ga0070714_100111291 Ga0070714_1001112912 213
541 3300005435 Ga0070714_100334356 Ga0070714_1003343562 213
542 3300005436 Ga0070713_100014377 Ga0070713_1000143775 213
543 3300005444 Ga0070694_100019081 Ga0070694_1000190812 213
544 3300005456 Ga0070678_100000740 Ga0070678_10000074015 213
545 3300005457 Ga0070662_100000723 Ga0070662_10000072311 213
546 3300005457 Ga0070662_100012862 Ga0070662_1000128625 213
547 3300005457 Ga0070662_100117609 Ga0070662_1001176092 213
548 3300005457 Ga0070662_100124724 Ga0070662_1001247242 213
549 3300005457 Ga0070662_100126657 Ga0070662_1001266572 213
550 3300005457 Ga0070662_100139709 Ga0070662_1001397091 213
551 3300005457 Ga0070662_100156980 Ga0070662_1001569802 213
552 3300005458 Ga0070681_10004074 Ga0070681_100040743 213
553 3300005458 Ga0070681_11141531 Ga0070681_111415311 213
554 3300005459 Ga0068867_100001501 Ga0068867_1000015017 213
555 3300005459 Ga0068867_100021582 Ga0068867_1000215822 213
556 3300005459 Ga0068867_100066142 Ga0068867_1000661422 213
557 3300005466 Ga0070685_10114873 Ga0070685_101148732 213
558 3300005530 Ga0070679_100057160 Ga0070679_1000571602 213
559 3300005530 Ga0070679_100183443 Ga0070679_1001834432 213
560 3300005530 Ga0070679_100589796 Ga0070679_1005897962 213
561 3300005535 Ga0070684_100326878 Ga0070684_1003268782 213
562 3300005539 Ga0068853_100000570 Ga0068853_10000057011 213
563 3300005539 Ga0068853_100077986 Ga0068853_1000779862 213
564 3300005539 Ga0068853_100113998 Ga0068853_1001139982 213
565 3300005539 Ga0068853_100152929 Ga0068853_1001529292 213
566 3300005539 Ga0068853_100171158 Ga0068853_1001711582 213
567 3300005543 Ga0070672_100000866 Ga0070672_1000008669 213
568 3300005543 Ga0070672_100048915 Ga0070672_1000489152 213
569 3300005543 Ga0070672_100071375 Ga0070672_1000713752 213
570 3300005543 Ga0070672_100118955 Ga0070672_1001189552 213
571 3300005544 Ga0070686_100179492 Ga0070686_1001794922 213
572 3300005544 Ga0070686_100300560 Ga0070686_1003005602 213
573 3300005547 Ga0070693_100026646 Ga0070693_1000266462 213
574 3300005547 Ga0070693_100103557 Ga0070693_1001035572 213
575 3300005547 Ga0070693_100283100 Ga0070693_1002831002 213
576 3300005548 Ga0070665_100046088 Ga0070665_1000460883 213
577 3300005563 Ga0068855_100010268 Ga0068855_1000102684 213
578 3300005563 Ga0068855_100090911 Ga0068855_1000909112 213
579 3300005563 Ga0068855_100196953 Ga0068855_1001969532 213
580 3300005563 Ga0068855_100242997 Ga0068855_1002429973 213
581 3300005563 Ga0068855_100965835 Ga0068855_1009658351 213
582 3300005564 Ga0070664_100008671 Ga0070664_1000086716 213
583 3300005564 Ga0070664_100013541 Ga0070664_1000135416 213
584 3300005564 Ga0070664_100017909 Ga0070664_1000179097 213
585 3300005564 Ga0070664_100019741 Ga0070664_1000197416 213
586 3300005564 Ga0070664_100039327 Ga0070664_1000393273 213
587 3300005564 Ga0070664_100105558 Ga0070664_1001055581 213
588 3300005564 Ga0070664_100408919 Ga0070664_1004089192 213
589 3300005564 Ga0070664_100584732 Ga0070664_1005847322 213
590 3300005577 Ga0068857_100006503 Ga0068857_10000650310 213
591 3300005577 Ga0068857_100015612 Ga0068857_1000156122 213
592 3300005577 Ga0068857_100348745 Ga0068857_1003487452 213
593 3300005577 Ga0068857_100368762 Ga0068857_1003687622 213
594 3300005577 Ga0068857_100534998 Ga0068857_1005349982 213
595 3300005578 Ga0068854_100001986 Ga0068854_10000198610 213
596 3300005578 Ga0068854_100235812 Ga0068854_1002358121 213
597 3300005578 Ga0068854_100377105 Ga0068854_1003771052 213
598 3300005578 Ga0068854_100604482 Ga0068854_1006044821 213
599 3300005614 Ga0068856_100049050 Ga0068856_1000490502 213
600 3300005614 Ga0068856_100218096 Ga0068856_1002180962 213
601 3300005614 Ga0068856_100219484 Ga0068856_1002194842 213
602 3300005614 Ga0068856_100223490 Ga0068856_1002234902 213
603 3300005614 Ga0068856_100363517 Ga0068856_1003635172 213
604 3300005614 Ga0068856_100518102 Ga0068856_1005181022 213
605 3300005614 Ga0068856_100643600 Ga0068856_1006436001 213
606 3300005614 Ga0068856_100676720 Ga0068856_1006767202 213
607 3300005616 Ga0068852_100006533 Ga0068852_1000065332 213
608 3300005616 Ga0068852_100008892 Ga0068852_1000088927 213
609 3300005616 Ga0068852_100009994 Ga0068852_1000099942 213
610 3300005616 Ga0068852_100102510 Ga0068852_1001025102 213
611 3300005616 Ga0068852_100183487 Ga0068852_1001834872 213
612 3300005616 Ga0068852_100191140 Ga0068852_1001911402 213
613 3300005616 Ga0068852_100215265 Ga0068852_1002152652 213
614 3300005616 Ga0068852_100275322 Ga0068852_1002753222 213
615 3300005616 Ga0068852_100314831 Ga0068852_1003148311 213
616 3300005616 Ga0068852_100625089 Ga0068852_1006250892 213
617 3300005617 Ga0068859_100001592 Ga0068859_10000159212 213
618 3300005617 Ga0068859_100007430 Ga0068859_1000074304 213
619 3300005617 Ga0068859_100043942 Ga0068859_1000439422 213
620 3300005617 Ga0068859_100423499 Ga0068859_1004234992 213
621 3300005617 Ga0068859_100900312 Ga0068859_1009003121 213
622 3300005618 Ga0068864_100000247 Ga0068864_10000024746 213
623 3300005618 Ga0068864_100000706 Ga0068864_10000070610 213
624 3300005618 Ga0068864_100007944 Ga0068864_1000079447 213
625 3300005618 Ga0068864_100011047 Ga0068864_1000110472 213
626 3300005618 Ga0068864_100031428 Ga0068864_1000314283 213
627 3300005618 Ga0068864_100032196 Ga0068864_1000321961 213
628 3300005618 Ga0068864_100117217 Ga0068864_1001172173 213
629 3300005618 Ga0068864_100285352 Ga0068864_1002853522 213
630 3300005718 Ga0068866_10050911 Ga0068866_100509112 213
631 3300005718 Ga0068866_10070148 Ga0068866_100701482 213
632 3300005718 Ga0068866_10127528 Ga0068866_101275282 213
633 3300005718 Ga0068866_10131754 Ga0068866_101317542 213
634 3300005718 Ga0068866_10210777 Ga0068866_102107771 213
635 3300005719 Ga0068861_100192695 Ga0068861_1001926952 213
636 3300005834 Ga0068851_10022640 Ga0068851_100226401 213
637 3300005834 Ga0068851_10040324 Ga0068851_100403242 213
638 3300005834 Ga0068851_10151010 Ga0068851_101510101 213
639 3300005841 Ga0068863_100001264 Ga0068863_10000126418 213
640 3300005841 Ga0068863_100004490 Ga0068863_1000044908 213
641 3300005841 Ga0068863_100005577 Ga0068863_1000055774 213
642 3300005841 Ga0068863_100006550 Ga0068863_1000065503 213
643 3300005841 Ga0068863_100006818 Ga0068863_1000068187 213
644 3300005841 Ga0068863_100013464 Ga0068863_1000134647 213
645 3300005841 Ga0068863_100093235 Ga0068863_1000932352 213
646 3300005841 Ga0068863_100263386 Ga0068863_1002633862 213
647 3300005842 Ga0068858_100000971 Ga0068858_1000009717 213
648 3300005842 Ga0068858_100006759 Ga0068858_1000067595 213
649 3300005842 Ga0068858_100040857 Ga0068858_1000408572 213
650 3300005842 Ga0068858_100058430 Ga0068858_1000584303 213
651 3300005842 Ga0068858_100091604 Ga0068858_1000916044 213
652 3300005842 Ga0068858_100245283 Ga0068858_1002452832 213
653 3300005843 Ga0068860_100010355 Ga0068860_1000103556 213
654 3300005843 Ga0068860_100013497 Ga0068860_1000134972 213
655 3300005843 Ga0068860_100029898 Ga0068860_1000298982 213
656 3300005843 Ga0068860_100117054 Ga0068860_1001170542 213
657 3300005843 Ga0068860_100130278 Ga0068860_1001302782 213
658 3300005843 Ga0068860_100134181 Ga0068860_1001341812 213
659 3300005844 Ga0068862_100014713 Ga0068862_1000147133 213
660 3300005844 Ga0068862_100019598 Ga0068862_1000195986 213
661 3300005844 Ga0068862_100049230 Ga0068862_1000492302 213
662 3300005844 Ga0068862_100120404 Ga0068862_1001204042 213
663 3300005844 Ga0068862_100276367 Ga0068862_1002763672 213
664 3300005844 Ga0068862_100487882 Ga0068862_1004878822 213
665 3300005985 Ga0081539_10034310 Ga0081539_100343102 213
666 3300006028 Ga0070717_10003959 Ga0070717_100039598 213
667 3300006195 Ga0075366_10160611 Ga0075366_101606112 213
668 3300006237 Ga0097621_100018038 Ga0097621_1000180382 213
669 3300006237 Ga0097621_100116077 Ga0097621_1001160772 213
670 3300006237 Ga0097621_100713749 Ga0097621_1007137492 213
671 3300006358 Ga0068871_100020845 Ga0068871_1000208455 213
672 3300006358 Ga0068871_100154747 Ga0068871_1001547471 213
673 3300006847 Ga0075431_100026284 Ga0075431_1000262846 213
674 3300006852 Ga0075433_10004399 Ga0075433_100043995 213
675 3300006881 Ga0068865_100002874 Ga0068865_1000028749 213
676 3300006881 Ga0068865_100092174 Ga0068865_1000921742 213
677 3300006881 Ga0068865_101017920 Ga0068865_1010179201 213
678 3300006931 Ga0097620_100001592 Ga0097620_10000159212 213
679 3300006931 Ga0097620_100007430 Ga0097620_1000074304 213
680 3300006931 Ga0097620_100043943 Ga0097620_1000439432 213
681 3300006931 Ga0097620_100423502 Ga0097620_1004235022 213
682 3300006931 Ga0097620_100900277 Ga0097620_1009002771 213
683 3300009036 Ga0105244_10098598 Ga0105244_100985982 213
684 3300009092 Ga0105250_10020298 Ga0105250_100202982 213
685 3300009098 Ga0105245_10000128 Ga0105245_1000012813 213
686 3300009098 Ga0105245_10078361 Ga0105245_100783612 213
687 3300009098 Ga0105245_10176965 Ga0105245_101769652 213
688 3300009148 Ga0105243_10006165 Ga0105243_100061656 213
689 3300009148 Ga0105243_10522298 Ga0105243_105222982 213
690 3300009176 Ga0105242_10447536 Ga0105242_104475362 213
691 3300009177 Ga0105248_10001371 Ga0105248_100013718 213
692 3300009177 Ga0105248_10005525 Ga0105248_1000552512 213
693 3300009177 Ga0105248_10005772 Ga0105248_100057726 213
694 3300009177 Ga0105248_10005852 Ga0105248_1000585212 213
695 3300009177 Ga0105248_10012052 Ga0105248_100120527 213
696 3300009177 Ga0105248_10015837 Ga0105248_100158379 213
697 3300009177 Ga0105248_10088495 Ga0105248_100884953 213
698 3300009177 Ga0105248_11273213 Ga0105248_112732131 213
699 3300009545 Ga0105237_10506389 Ga0105237_105063891 213
700 3300009551 Ga0105238_10146494 Ga0105238_101464942 213
701 3300009553 Ga0105249_10020587 Ga0105249_100205874 213
702 3300009553 Ga0105249_10075966 Ga0105249_100759662 213
703 3300010375 Ga0105239_10034313 Ga0105239_100343132 213
704 3300010375 Ga0105239_10167471 Ga0105239_101674712 213
705 3300011119 Ga0105246_10038013 Ga0105246_100380132 213
706 3300011119 Ga0105246_10185980 Ga0105246_101859802 213
707 3300011119 Ga0105246_10721627 Ga0105246_107216272 213
708 3300013100 Ga0157373_10001921 Ga0157373_100019217 213
709 3300013100 Ga0157373_10040266 Ga0157373_100402663 213
710 3300013100 Ga0157373_10107654 Ga0157373_101076542 213
711 3300013100 Ga0157373_10139243 Ga0157373_101392432 213
712 3300013100 Ga0157373_10209349 Ga0157373_102093492 213
713 3300013102 Ga0157371_10001392 Ga0157371_100013929 213
714 3300013102 Ga0157371_10064745 Ga0157371_100647453 213
715 3300013102 Ga0157371_10223170 Ga0157371_102231702 213
716 3300013102 Ga0157371_10248129 Ga0157371_102481291 213
717 3300013102 Ga0157371_10321452 Ga0157371_103214522 213
718 3300013102 Ga0157371_10410148 Ga0157371_104101482 213
719 3300013104 Ga0157370_10101199 Ga0157370_101011992 213
720 3300013105 Ga0157369_10200863 Ga0157369_102008632 213
721 3300013105 Ga0157369_10486956 Ga0157369_104869562 213
722 3300013296 Ga0157374_10195042 Ga0157374_101950422 213
723 3300013296 Ga0157374_10614277 Ga0157374_106142772 213
724 3300013297 Ga0157378_10002066 Ga0157378_100020661 213
725 3300013297 Ga0157378_10173401 Ga0157378_101734012 213
726 3300013297 Ga0157378_10334813 Ga0157378_103348132 213
727 3300013297 Ga0157378_10357560 Ga0157378_103575602 213
728 3300013306 Ga0163162_10008660 Ga0163162_100086602 213
729 3300013306 Ga0163162_10034837 Ga0163162_100348372 213
730 3300013306 Ga0163162_10144003 Ga0163162_101440032 213
731 3300013306 Ga0163162_10226109 Ga0163162_102261092 213
732 3300013307 Ga0157372_10180075 Ga0157372_101800752 213
733 3300013307 Ga0157372_10186333 Ga0157372_101863331 213
734 3300013307 Ga0157372_10247193 Ga0157372_102471931 213
735 3300013307 Ga0157372_10434164 Ga0157372_104341642 213
736 3300014325 Ga0163163_10004884 Ga0163163_100048843 213
737 3300014325 Ga0163163_10115723 Ga0163163_101157232 213
738 3300014497 Ga0182008_10009276 Ga0182008_100092762 213
739 3300014968 Ga0157379_10001895 Ga0157379_1000189511 213
740 3300025290 Ga0207673_1001411 Ga0207673_10014112 213
741 3300025315 Ga0207697_10000059 Ga0207697_1000005933 213
742 3300025315 Ga0207697_10165081 Ga0207697_101650812 213
743 3300025321 Ga0207656_10054258 Ga0207656_100542581 213
744 3300025321 Ga0207656_10083208 Ga0207656_100832082 213
745 3300025321 Ga0207656_10086677 Ga0207656_100866772 213
746 3300025321 Ga0207656_10278849 Ga0207656_102788492 213
747 3300025711 Ga0207696_1021677 Ga0207696_10216772 213
748 3300025893 Ga0207682_10008416 Ga0207682_100084164 213
749 3300025893 Ga0207682_10119264 Ga0207682_101192642 213
750 3300025899 Ga0207642_10032928 Ga0207642_100329282 213
751 3300025899 Ga0207642_10089597 Ga0207642_100895972 213
752 3300025899 Ga0207642_10467521 Ga0207642_104675211 213
753 3300025901 Ga0207688_10000721 Ga0207688_1000072117 213
754 3300025901 Ga0207688_10027872 Ga0207688_100278722 213
755 3300025901 Ga0207688_10047124 Ga0207688_100471243 213
756 3300025903 Ga0207680_10091239 Ga0207680_100912392 213
757 3300025903 Ga0207680_10097415 Ga0207680_100974152 213
758 3300025903 Ga0207680_10104447 Ga0207680_101044472 213
759 3300025903 Ga0207680_10221008 Ga0207680_102210082 213
760 3300025904 Ga0207647_10000517 Ga0207647_100005173 213
761 3300025904 Ga0207647_10000968 Ga0207647_1000096810 213
762 3300025904 Ga0207647_10010206 Ga0207647_100102063 213
763 3300025904 Ga0207647_10025102 Ga0207647_100251026 213
764 3300025904 Ga0207647_10055593 Ga0207647_100555932 213
765 3300025906 Ga0207699_10457304 Ga0207699_104573042 213
766 3300025907 Ga0207645_10002144 Ga0207645_1000214412 213
767 3300025907 Ga0207645_10118614 Ga0207645_101186141 213
768 3300025907 Ga0207645_10295748 Ga0207645_102957482 213
769 3300025909 Ga0207705_10006209 Ga0207705_1000620912 213
770 3300025909 Ga0207705_10008363 Ga0207705_100083637 213
771 3300025909 Ga0207705_10011590 Ga0207705_100115906 213
772 3300025909 Ga0207705_10074316 Ga0207705_100743162 213
773 3300025909 Ga0207705_10616676 Ga0207705_106166761 213
774 3300025912 Ga0207707_10014330 Ga0207707_100143305 213
775 3300025913 Ga0207695_10214801 Ga0207695_102148012 213
776 3300025914 Ga0207671_10024122 Ga0207671_100241224 213
777 3300025917 Ga0207660_10085878 Ga0207660_100858783 213
778 3300025917 Ga0207660_10570244 Ga0207660_105702441 213
779 3300025919 Ga0207657_10001177 Ga0207657_1000117714 213
780 3300025919 Ga0207657_10005242 Ga0207657_100052426 213
781 3300025919 Ga0207657_10007733 Ga0207657_100077332 213
782 3300025919 Ga0207657_10012980 Ga0207657_100129804 213
783 3300025919 Ga0207657_10024605 Ga0207657_100246056 213
784 3300025919 Ga0207657_10032102 Ga0207657_100321023 213
785 3300025919 Ga0207657_10089878 Ga0207657_100898784 213
786 3300025919 Ga0207657_10093889 Ga0207657_100938892 213
787 3300025919 Ga0207657_10112797 Ga0207657_101127973 213
788 3300025919 Ga0207657_10328281 Ga0207657_103282811 213
789 3300025919 Ga0207657_10330157 Ga0207657_103301571 213
790 3300025920 Ga0207649_10013422 Ga0207649_100134223 213
791 3300025920 Ga0207649_10021465 Ga0207649_100214652 213
792 3300025920 Ga0207649_10093156 Ga0207649_100931562 213
793 3300025920 Ga0207649_10128076 Ga0207649_101280761 213
794 3300025920 Ga0207649_10200651 Ga0207649_102006512 213
795 3300025920 Ga0207649_10213143 Ga0207649_102131432 213
796 3300025920 Ga0207649_10249602 Ga0207649_102496021 213
797 3300025920 Ga0207649_10551628 Ga0207649_105516281 213
798 3300025921 Ga0207652_10099875 Ga0207652_100998754 213
799 3300025921 Ga0207652_10225460 Ga0207652_102254602 213
800 3300025923 Ga0207681_10000737 Ga0207681_100007373 213
801 3300025923 Ga0207681_10028893 Ga0207681_100288932 213
802 3300025923 Ga0207681_10079727 Ga0207681_100797272 213
803 3300025923 Ga0207681_10083656 Ga0207681_100836562 213
804 3300025923 Ga0207681_10294507 Ga0207681_102945071 213
805 3300025923 Ga0207681_10301533 Ga0207681_103015332 213
806 3300025923 Ga0207681_10505218 Ga0207681_105052181 213
807 3300025924 Ga0207694_10035054 Ga0207694_100350543 213
808 3300025924 Ga0207694_10353031 Ga0207694_103530312 213
809 3300025925 Ga0207650_10024731 Ga0207650_100247311 213
810 3300025925 Ga0207650_10028056 Ga0207650_100280563 213
811 3300025925 Ga0207650_10036551 Ga0207650_100365512 213
812 3300025925 Ga0207650_10059204 Ga0207650_100592042 213
813 3300025925 Ga0207650_10067988 Ga0207650_100679883 213
814 3300025925 Ga0207650_10407823 Ga0207650_104078232 213
815 3300025926 Ga0207659_10090813 Ga0207659_100908132 213
816 3300025926 Ga0207659_10104718 Ga0207659_101047181 213
817 3300025927 Ga0207687_10000688 Ga0207687_1000068826 213
818 3300025927 Ga0207687_10189407 Ga0207687_101894071 213
819 3300025928 Ga0207700_10194610 Ga0207700_101946101 213
820 3300025928 Ga0207700_10380620 Ga0207700_103806201 213
821 3300025929 Ga0207664_10036027 Ga0207664_100360272 213
822 3300025929 Ga0207664_10293670 Ga0207664_102936702 213
823 3300025931 Ga0207644_10000810 Ga0207644_1000081016 213
824 3300025931 Ga0207644_10000892 Ga0207644_100008925 213
825 3300025931 Ga0207644_10015229 Ga0207644_100152293 213
826 3300025931 Ga0207644_10015386 Ga0207644_100153863 213
827 3300025931 Ga0207644_10039524 Ga0207644_100395242 213
828 3300025931 Ga0207644_10044604 Ga0207644_100446042 213
829 3300025931 Ga0207644_10071172 Ga0207644_100711722 213
830 3300025931 Ga0207644_10282828 Ga0207644_102828281 213
831 3300025932 Ga0207690_10001597 Ga0207690_100015975 213
832 3300025932 Ga0207690_10008792 Ga0207690_100087924 213
833 3300025932 Ga0207690_10020418 Ga0207690_100204183 213
834 3300025932 Ga0207690_10218251 Ga0207690_102182512 213
835 3300025932 Ga0207690_10371348 Ga0207690_103713482 213
836 3300025932 Ga0207690_10545514 Ga0207690_105455141 213
837 3300025933 Ga0207706_10000426 Ga0207706_1000042633 213
838 3300025933 Ga0207706_10015017 Ga0207706_100150173 213
839 3300025933 Ga0207706_10043389 Ga0207706_100433893 213
840 3300025933 Ga0207706_10060056 Ga0207706_100600562 213
841 3300025933 Ga0207706_10086933 Ga0207706_100869332 213
842 3300025933 Ga0207706_10132833 Ga0207706_101328331 213
843 3300025933 Ga0207706_10164574 Ga0207706_101645742 213
844 3300025933 Ga0207706_10221489 Ga0207706_102214892 213
845 3300025933 Ga0207706_10541464 Ga0207706_105414642 213
846 3300025934 Ga0207686_10170042 Ga0207686_101700421 213
847 3300025934 Ga0207686_10667120 Ga0207686_106671201 213
848 3300025935 Ga0207709_10068733 Ga0207709_100687332 213
849 3300025935 Ga0207709_10133938 Ga0207709_101339382 213
850 3300025936 Ga0207670_10085972 Ga0207670_100859722 213
851 3300025937 Ga0207669_10024724 Ga0207669_100247242 213
852 3300025937 Ga0207669_10041189 Ga0207669_100411893 213
853 3300025937 Ga0207669_10047307 Ga0207669_100473072 213
854 3300025937 Ga0207669_10118040 Ga0207669_101180402 213
855 3300025938 Ga0207704_10001297 Ga0207704_100012972 213
856 3300025938 Ga0207704_10033735 Ga0207704_100337352 213
857 3300025939 Ga0207665_10131781 Ga0207665_101317812 213
858 3300025940 Ga0207691_10000563 Ga0207691_100005632 213
859 3300025940 Ga0207691_10000926 Ga0207691_1000092623 213
860 3300025940 Ga0207691_10037512 Ga0207691_100375126 213
861 3300025940 Ga0207691_10047937 Ga0207691_100479372 213
862 3300025940 Ga0207691_10148727 Ga0207691_101487271 213
863 3300025940 Ga0207691_10344460 Ga0207691_103444602 213
864 3300025941 Ga0207711_10000673 Ga0207711_1000067331 213
865 3300025941 Ga0207711_10000744 Ga0207711_100007448 213
866 3300025941 Ga0207711_10002355 Ga0207711_1000235513 213
867 3300025941 Ga0207711_10004881 Ga0207711_100048814 213
868 3300025941 Ga0207711_10008994 Ga0207711_100089946 213
869 3300025941 Ga0207711_10012570 Ga0207711_100125707 213
870 3300025941 Ga0207711_10019022 Ga0207711_100190223 213
871 3300025941 Ga0207711_10038596 Ga0207711_100385963 213
872 3300025941 Ga0207711_10226254 Ga0207711_102262542 213
873 3300025941 Ga0207711_10568771 Ga0207711_105687712 213
874 3300025942 Ga0207689_10000128 Ga0207689_1000012831 213
875 3300025942 Ga0207689_10005679 Ga0207689_100056796 213
876 3300025942 Ga0207689_10072020 Ga0207689_100720202 213
877 3300025945 Ga0207679_10011077 Ga0207679_100110773 213
878 3300025945 Ga0207679_10024415 Ga0207679_100244154 213
879 3300025945 Ga0207679_10025281 Ga0207679_100252816 213
880 3300025949 Ga0207667_10020128 Ga0207667_100201289 213
881 3300025949 Ga0207667_10028475 Ga0207667_100284754 213
882 3300025949 Ga0207667_10088525 Ga0207667_100885253 213
883 3300025949 Ga0207667_10093985 Ga0207667_100939853 213
884 3300025949 Ga0207667_10220077 Ga0207667_102200771 213
885 3300025949 Ga0207667_10400130 Ga0207667_104001302 213
886 3300025949 Ga0207667_10460903 Ga0207667_104609031 213
887 3300025949 Ga0207667_10678891 Ga0207667_106788911 213
888 3300025960 Ga0207651_10000814 Ga0207651_100008143 213
889 3300025960 Ga0207651_10016227 Ga0207651_100162272 213
890 3300025960 Ga0207651_10027483 Ga0207651_100274834 213
891 3300025960 Ga0207651_10050373 Ga0207651_100503732 213
892 3300025960 Ga0207651_10216932 Ga0207651_102169321 213
893 3300025960 Ga0207651_10283282 Ga0207651_102832822 213
894 3300025960 Ga0207651_10447028 Ga0207651_104470281 213
895 3300025960 Ga0207651_10568904 Ga0207651_105689042 213
896 3300025961 Ga0207712_10011834 Ga0207712_100118344 213
897 3300025961 Ga0207712_10041946 Ga0207712_100419462 213
898 3300025972 Ga0207668_10024770 Ga0207668_100247705 213
899 3300025972 Ga0207668_10058376 Ga0207668_100583762 213
900 3300025972 Ga0207668_10072571 Ga0207668_100725713 213
901 3300025972 Ga0207668_10097143 Ga0207668_100971432 213
902 3300025972 Ga0207668_10113530 Ga0207668_101135302 213
903 3300025972 Ga0207668_10671192 Ga0207668_106711921 213
904 3300025981 Ga0207640_10000589 Ga0207640_1000058915 213
905 3300025981 Ga0207640_10075861 Ga0207640_100758612 213
906 3300025981 Ga0207640_10209305 Ga0207640_102093051 213
907 3300025981 Ga0207640_10234562 Ga0207640_102345622 213
908 3300025981 Ga0207640_10275885 Ga0207640_102758852 213
909 3300025981 Ga0207640_10367294 Ga0207640_103672942 213
910 3300025981 Ga0207640_10559545 Ga0207640_105595451 213
911 3300025981 Ga0207640_10894015 Ga0207640_108940151 213
912 3300025986 Ga0207658_10001589 Ga0207658_100015898 213
913 3300025986 Ga0207658_10008238 Ga0207658_100082384 213
914 3300025986 Ga0207658_10026021 Ga0207658_100260217 213
915 3300025986 Ga0207658_10125712 Ga0207658_101257122 213
916 3300025986 Ga0207658_10222558 Ga0207658_102225582 213
917 3300025986 Ga0207658_10577115 Ga0207658_105771152 213
918 3300026023 Ga0207677_10003986 Ga0207677_100039866 213
919 3300026023 Ga0207677_10009115 Ga0207677_100091152 213
920 3300026023 Ga0207677_10051253 Ga0207677_100512532 213
921 3300026023 Ga0207677_10053108 Ga0207677_100531082 213
922 3300026023 Ga0207677_10308143 Ga0207677_103081432 213
923 3300026023 Ga0207677_10667568 Ga0207677_106675681 213
924 3300026035 Ga0207703_10005013 Ga0207703_100050137 213
925 3300026035 Ga0207703_10006221 Ga0207703_100062215 213
926 3300026035 Ga0207703_10036191 Ga0207703_100361912 213
927 3300026035 Ga0207703_10041285 Ga0207703_100412854 213
928 3300026035 Ga0207703_10112236 Ga0207703_101122362 213
929 3300026035 Ga0207703_10121406 Ga0207703_101214062 213
930 3300026035 Ga0207703_10122520 Ga0207703_101225201 213
931 3300026035 Ga0207703_10205329 Ga0207703_102053292 213
932 3300026035 Ga0207703_10412074 Ga0207703_104120742 213
933 3300026041 Ga0207639_10004961 Ga0207639_100049611 213
934 3300026041 Ga0207639_10121086 Ga0207639_101210862 213
935 3300026041 Ga0207639_10353931 Ga0207639_103539312 213
936 3300026067 Ga0207678_10013248 Ga0207678_100132483 213
937 3300026067 Ga0207678_10026389 Ga0207678_100263893 213
938 3300026067 Ga0207678_10268166 Ga0207678_102681662 213
939 3300026067 Ga0207678_10366395 Ga0207678_103663952 213
940 3300026067 Ga0207678_10399631 Ga0207678_103996312 213
941 3300026067 Ga0207678_10403057 Ga0207678_104030572 213
942 3300026067 Ga0207678_10506796 Ga0207678_105067962 213
943 3300026078 Ga0207702_10009045 Ga0207702_100090453 213
944 3300026078 Ga0207702_10019937 Ga0207702_100199372 213
945 3300026078 Ga0207702_10052269 Ga0207702_100522694 213
946 3300026078 Ga0207702_10169353 Ga0207702_101693531 213
947 3300026078 Ga0207702_10397466 Ga0207702_103974662 213
948 3300026088 Ga0207641_10000887 Ga0207641_1000088716 213
949 3300026088 Ga0207641_10012073 Ga0207641_100120737 213
950 3300026088 Ga0207641_10015098 Ga0207641_100150985 213
951 3300026088 Ga0207641_10016859 Ga0207641_100168595 213
952 3300026088 Ga0207641_10030030 Ga0207641_100300302 213
953 3300026088 Ga0207641_10037919 Ga0207641_100379192 213
954 3300026088 Ga0207641_10140155 Ga0207641_101401552 213
955 3300026088 Ga0207641_10157875 Ga0207641_101578752 213
956 3300026088 Ga0207641_10603978 Ga0207641_106039782 213
957 3300026089 Ga0207648_10003309 Ga0207648_100033097 213
958 3300026089 Ga0207648_10005935 Ga0207648_100059359 213
959 3300026089 Ga0207648_10154315 Ga0207648_101543152 213
960 3300026089 Ga0207648_10485719 Ga0207648_104857192 213
961 3300026095 Ga0207676_10000220 Ga0207676_100002207 213
962 3300026095 Ga0207676_10003309 Ga0207676_100033096 213
963 3300026095 Ga0207676_10027929 Ga0207676_100279292 213
964 3300026095 Ga0207676_10042598 Ga0207676_100425982 213
965 3300026095 Ga0207676_10084560 Ga0207676_100845602 213
966 3300026095 Ga0207676_10151054 Ga0207676_101510542 213
967 3300026116 Ga0207674_10000827 Ga0207674_1000082715 213
968 3300026116 Ga0207674_10000989 Ga0207674_1000098915 213
969 3300026116 Ga0207674_10012197 Ga0207674_100121976 213
970 3300026116 Ga0207674_10018670 Ga0207674_100186707 213
971 3300026116 Ga0207674_10056440 Ga0207674_100564403 213
972 3300026116 Ga0207674_10185447 Ga0207674_101854472 213
973 3300026116 Ga0207674_10625750 Ga0207674_106257502 213
974 3300026118 Ga0207675_100064677 Ga0207675_1000646772 213
975 3300026121 Ga0207683_10004561 Ga0207683_100045615 213
976 3300026121 Ga0207683_10007564 Ga0207683_100075645 213
977 3300026121 Ga0207683_10065797 Ga0207683_100657974 213
978 3300026121 Ga0207683_10203750 Ga0207683_102037502 213
979 3300026142 Ga0207698_10000913 Ga0207698_100009132 213
980 3300026142 Ga0207698_10018711 Ga0207698_100187112 213
981 3300026142 Ga0207698_10030911 Ga0207698_100309112 213
982 3300026142 Ga0207698_10053397 Ga0207698_100533972 213
983 3300026142 Ga0207698_10101609 Ga0207698_101016092 213
984 3300026142 Ga0207698_10109091 Ga0207698_101090913 213
985 3300026142 Ga0207698_10238829 Ga0207698_102388292 213
986 3300026142 Ga0207698_10476802 Ga0207698_104768022 213
987 3300026142 Ga0207698_10494058 Ga0207698_104940582 213
988 3300028379 Ga0268266_10003568 Ga0268266_100035684 213
989 3300028379 Ga0268266_10007897 Ga0268266_100078976 213
990 3300028379 Ga0268266_10101357 Ga0268266_101013572 213
991 3300028379 Ga0268266_10357325 Ga0268266_103573252 213
992 3300028379 Ga0268266_11072627 Ga0268266_110726271 213
993 3300028380 Ga0268265_10001950 Ga0268265_100019508 213
994 3300028380 Ga0268265_10002912 Ga0268265_100029128 213
995 3300028380 Ga0268265_10036883 Ga0268265_100368832 213
996 3300028380 Ga0268265_10088421 Ga0268265_100884212 213
997 3300028380 Ga0268265_10197882 Ga0268265_101978822 213
998 3300028380 Ga0268265_10536997 Ga0268265_105369972 213
999 3300028381 Ga0268264_10005021 Ga0268264_100050217 213
1000 3300028381 Ga0268264_10007348 Ga0268264_100073486 213
1001 3300028381 Ga0268264_10014538 Ga0268264_100145382 213
1002 3300028381 Ga0268264_10054925 Ga0268264_100549254 213
1003 3300028381 Ga0268264_10126996 Ga0268264_101269962 213
1004 3300028381 Ga0268264_10127274 Ga0268264_101272742 213
1005 3300028381 Ga0268264_10222738 Ga0268264_102227382 213
1006 3300031548 Ga0307408_100029311 Ga0307408_1000293113 213
1007 3300031731 Ga0307405_10024143 Ga0307405_100241433 213
1008 3300031824 Ga0307413_10204342 Ga0307413_102043422 213
1009 3300031901 Ga0307406_10323006 Ga0307406_103230062 213
1010 3300031901 Ga0307406_10670881 Ga0307406_106708811 213
1011 3300031911 Ga0307412_10047706 Ga0307412_100477062 213
1012 3300031995 Ga0307409_100100174 Ga0307409_1001001742 213
1013 3300031995 Ga0307409_100322649 Ga0307409_1003226492 213
1014 3300032002 Ga0307416_100000617 Ga0307416_1000006176 213
1015 3300032002 Ga0307416_100172592 Ga0307416_1001725922 213
1016 3300032004 Ga0307414_10503159 Ga0307414_105031592 213
1017 3300032004 Ga0307414_11117364 Ga0307414_111173641 213
1018 3300032005 Ga0307411_10094296 Ga0307411_100942962 213
1019 3300032005 Ga0307411_10256300 Ga0307411_102563002 213
1020 3300032005 Ga0307411_10527701 Ga0307411_105277011 213
1021 3300032126 Ga0307415_100013944 Ga0307415_1000139445 213
1022 3300032126 Ga0307415_100041855 Ga0307415_1000418552 213
1023 3300035091 Ga0373951_0039388 Ga0373951_0039388_365_1006 213
1024 3300035111 Ga0373923_0034501 Ga0373923_0034501_416_1057 213
1025 3300035119 Ga0373956_0035184 Ga0373956_0035184_1421_2062 213
1026 3300035121 Ga0373960_0032719 Ga0373960_0032719_309_950 213
1027 3300035172 Ga0373955_0002938 Ga0373955_0002938_2567_3208 213
1028 3300035692 Ga0373935_0205828 Ga0373935_0205828_710_1351 213
1029 3300035724 Ga0373933_0017201 Ga0373933_0017201_2859_3500 213
1030 3300036401 Ga0373937_0008086 Ga0373937_0008086_2424_3065 213
1031 3300037312 Ga0395899_0002038 Ga0395899_0002038_13749_14390 213
1032 3300037312 Ga0395899_0004378 Ga0395899_0004378_7261_7902 213
1033 3300037312 Ga0395899_0009083 Ga0395899_0009083_4145_4786 213
1034 3300037312 Ga0395899_0019423 Ga0395899_0019423_3399_4040 213
1035 3300037312 Ga0395899_0034693 Ga0395899_0034693_656_1297 213
1036 3300037312 Ga0395899_0095354 Ga0395899_0095354_414_1055 213
1037 3300037312 Ga0395899_0132058 Ga0395899_0132058_362_1003 213
1038 3300037312 Ga0395899_0166442 Ga0395899_0166442_245_886 213
1039 3300037312 Ga0395899_0237663 Ga0395899_0237663_130_771 213
1040 3300037418 Ga0395900_0000192 Ga0395900_0000192_88733_89374 213
1041 3300037418 Ga0395900_0000605 Ga0395900_0000605_41657_42298 213
1042 3300037418 Ga0395900_0009079 Ga0395900_0009079_9391_10032 213
1043 3300037418 Ga0395900_0027115 Ga0395900_0027115_1634_2275 213
1044 3300037418 Ga0395900_0054345 Ga0395900_0054345_453_1097 213
1045 3300037418 Ga0395900_0074540 Ga0395900_0074540_2654_3295 213
1046 3300037418 Ga0395900_0088878 Ga0395900_0088878_1465_2106 213
1047 3300037418 Ga0395900_0131699 Ga0395900_0131699_1350_1991 213
1048 3300037418 Ga0395900_0322659 Ga0395900_0322659_711_1352 213
1049 3300037418 Ga0395900_0322704 Ga0395900_0322704_830_1471 213
1050 3300037418 Ga0395900_0332734 Ga0395900_0332734_249_890 213
1051 3300037418 Ga0395900_0455058 Ga0395900_0455058_503_1144 213
1052 3300037418 Ga0395900_0700414 Ga0395900_0700414_82_723 213
1053 3300037466 Ga0395898_0003738 Ga0395898_0003738_3389_4030 213
1054 3300037466 Ga0395898_0005548 Ga0395898_0005548_8427_9068 213
1055 3300037466 Ga0395898_0014191 Ga0395898_0014191_7252_7893 213
1056 3300037466 Ga0395898_0025266 Ga0395898_0025266_1496_2137 213
1057 3300037466 Ga0395898_0038819 Ga0395898_0038819_2380_3021 213
1058 3300037466 Ga0395898_0252965 Ga0395898_0252965_646_1287 213
1059 3300037466 Ga0395898_0554983 Ga0395898_0554983_83_727 213
1060 3300037466 Ga0395898_0584565 Ga0395898_0584565_291_932 213
1061 3300037466 Ga0395898_0609476 Ga0395898_0609476_242_883 213
1062 3300037466 Ga0395898_1103296 Ga0395898_1103296_25_666 213
1063 3300037471 Ga0395905_0000109 Ga0395905_0000109_10110_10751 213
1064 3300037471 Ga0395905_0002154 Ga0395905_0002154_1263_1904 213
1065 3300037471 Ga0395905_0006340 Ga0395905_0006340_2273_2914 213
1066 3300037471 Ga0395905_0011160 Ga0395905_0011160_952_1593 213
1067 3300037471 Ga0395905_0014637 Ga0395905_0014637_6055_6696 213
1068 3300037471 Ga0395905_0025102 Ga0395905_0025102_4002_4643 213
1069 3300037471 Ga0395905_0032713 Ga0395905_0032713_3550_4191 213
1070 3300037471 Ga0395905_0036667 Ga0395905_0036667_2616_3257 213
1071 3300037471 Ga0395905_0042141 Ga0395905_0042141_3094_3735 213
1072 3300037471 Ga0395905_0060088 Ga0395905_0060088_2627_3268 213
1073 3300037471 Ga0395905_0092740 Ga0395905_0092740_25_666 213
1074 3300037471 Ga0395905_0101576 Ga0395905_0101576_155_796 213
1075 3300037471 Ga0395905_0114027 Ga0395905_0114027_152_793 213
1076 3300037471 Ga0395905_0121122 Ga0395905_0121122_451_1092 213
1077 3300037471 Ga0395905_0214803 Ga0395905_0214803_76_717 213
1078 3300037471 Ga0395905_0315626 Ga0395905_0315626_645_1286 213
1079 3300037471 Ga0395905_0360955 Ga0395905_0360955_208_849 213
1080 3300037471 Ga0395905_0400586 Ga0395905_0400586_266_907 213
1081 3300038443 Ga0395901_0013360 Ga0395901_0013360_1567_2208 213
1082 3300038443 Ga0395901_0017029 Ga0395901_0017029_5857_6498 213
1083 3300038443 Ga0395901_0018270 Ga0395901_0018270_2172_2813 213
1084 3300038443 Ga0395901_0031771 Ga0395901_0031771_4756_5397 213
1085 3300038443 Ga0395901_0040845 Ga0395901_0040845_3279_3920 213
1086 3300038443 Ga0395901_0069323 Ga0395901_0069323_1318_1959 213
1087 3300038443 Ga0395901_0099462 Ga0395901_0099462_1318_1959 213
1088 3300038443 Ga0395901_0131996 Ga0395901_0131996_1758_2399 213
1089 3300038443 Ga0395901_0142824 Ga0395901_0142824_471_1112 213
1090 3300038443 Ga0395901_0158348 Ga0395901_0158348_1039_1680 213
1091 3300038443 Ga0395901_0215534 Ga0395901_0215534_66_707 213
1092 3300038443 Ga0395901_0292435 Ga0395901_0292435_507_1148 213
1093 3300042005 Ga0439448_0016190 Ga0439448_0016190_807_1448 213
1094 3300042005 Ga0439448_0103258 Ga0439448_0103258_136_777 213
1095 3300042012 Ga0439455_0004214 Ga0439455_0004214_881_1522 213
1096 3300042157 Ga0439458_0000134 Ga0439458_0000134_2879_3520 213
1097 3300042157 Ga0439458_0003409 Ga0439458_0003409_2253_2894 213
1098 3300044656 Ga0466969_0013849 Ga0466969_0013849_2957_3598 213
1099 3300044656 Ga0466969_0021021 Ga0466969_0021021_668_1309 213
1100 3300044658 Ga0466972_0276118 Ga0466972_0276118_55_696 213
1101 3300044684 Ga0466966_0004143 Ga0466966_0004143_602_1243 213
1102 3300044684 Ga0466966_0054344 Ga0466966_0054344_1044_1685 213
1103 3300044684 Ga0466966_0058491 Ga0466966_0058491_1492_2133 213
1104 3300044693 Ga0466961_0095330 Ga0466961_0095330_1169_1810 213
1105 3300044693 Ga0466961_0111292 Ga0466961_0111292_1070_1711 213
1106 3300044693 Ga0466961_0175450 Ga0466961_0175450_79_720 213
1107 3300044693 Ga0466961_0355353 Ga0466961_0355353_147_788 213
1108 3300044694 Ga0466963_0008779 Ga0466963_0008779_961_1614 213
1109 3300044694 Ga0466963_0010173 Ga0466963_0010173_722_1363 213
1110 3300044694 Ga0466963_0067617 Ga0466963_0067617_1436_2077 213
1111 3300044694 Ga0466963_0279511 Ga0466963_0279511_86_727 213
1112 3300044706 Ga0466964_0004332 Ga0466964_0004332_3712_4353 213
1113 3300044706 Ga0466964_0102347 Ga0466964_0102347_563_1204 213
1114 3300044706 Ga0466964_0203949 Ga0466964_0203949_35_676 213
1115 3300044719 Ga0466971_0092625 Ga0466971_0092625_562_1203 213
1116 3300044719 Ga0466971_0134830 Ga0466971_0134830_277_918 213
1117 3300044735 Ga0466968_0018604 Ga0466968_0018604_339_980 213
1118 3300044765 Ga0466970_0003329 Ga0466970_0003329_1669_2310 213
1119 3300044765 Ga0466970_0026093 Ga0466970_0026093_402_1043 213
1120 3300044765 Ga0466970_0453396 Ga0466970_0453396_27_668 213
1121 3300044842 Ga0466957_0005122 Ga0466957_0005122_994_1635 213
1122 3300044842 Ga0466957_0009707 Ga0466957_0009707_4588_5229 213
1123 3300044842 Ga0466957_0090175 Ga0466957_0090175_394_1035 213
1124 3300044842 Ga0466957_0243751 Ga0466957_0243751_328_969 213
1125 3300044842 Ga0466957_0360575 Ga0466957_0360575_41_682 213
1126 3300044901 Ga0466960_0067701 Ga0466960_0067701_587_1228 213
1127 3300045049 Ga0466959_0045338 Ga0466959_0045338_1022_1663 213
1128 3300045049 Ga0466959_0051911 Ga0466959_0051911_803_1444 213
1129 3300045049 Ga0466959_0062106 Ga0466959_0062106_1317_1958 213
1130 3300045836 Ga0466958_0044527 Ga0466958_0044527_892_1533 213
1131 3300045836 Ga0466958_0046012 Ga0466958_0046012_1610_2263 213
1132 3300045836 Ga0466958_0098942 Ga0466958_0098942_624_1265 213
1133 3300045836 Ga0466958_0342717 Ga0466958_0342717_36_677 213
1134 3300045976 Ga0466967_0004539 Ga0466967_0004539_5680_6321 213
1135 3300045976 Ga0466967_0017060 Ga0466967_0017060_2265_2906 213
1136 3300045976 Ga0466967_0072971 Ga0466967_0072971_543_1184 213
1137 3300045976 Ga0466967_0088193 Ga0466967_0088193_1550_2191 213
1138 3300045976 Ga0466967_0124900 Ga0466967_0124900_340_981 213
1139 3300045976 Ga0466967_0422473 Ga0466967_0422473_107_748 213
1140 3300045976 Ga0466967_1096768 Ga0466967_1096768_16_657 213
1141 3300046528 Ga0495642_0033263 Ga0495642_0033263_353_1063 213
1142 3300046528 Ga0495642_0038141 Ga0495642_0038141_838_1479 213
1143 3300046616 Ga0495668_0169622 Ga0495668_0169622_259_900 213
1144 3300046660 Ga0495625_0083477 Ga0495625_0083477_262_903 213
1145 3300046679 Ga0495623_0030352 Ga0495623_0030352_940_1581 213
1146 3300046684 Ga0495669_0001675 Ga0495669_0001675_3718_4359 213
1147 3300046684 Ga0495669_0002861 Ga0495669_0002861_4537_5178 213
1148 3300046684 Ga0495669_0022783 Ga0495669_0022783_1052_1693 213
1149 3300046684 Ga0495669_0058134 Ga0495669_0058134_27_668 213
1150 3300046684 Ga0495669_0085489 Ga0495669_0085489_676_1317 213
1151 3300046684 Ga0495669_0088818 Ga0495669_0088818_643_1284 213
1152 3300047445 Ga0495677_0003362 Ga0495677_0003362_3825_4466 213
1153 3300047445 Ga0495677_0091639 Ga0495677_0091639_37_678 213
1154 3300047447 Ga0495685_150137 Ga0495685_150137_78_719 213
1155 3300048088 Ga0495602_0065312 Ga0495602_0065312_1879_2520 213
1156 3300048904 Ga0496101_0063926 Ga0496101_0063926_1874_2584 213
1157 3300048906 Ga0496103_0236261 Ga0496103_0236261_18_659 213
1158 3300048907 Ga0496104_0042527 Ga0496104_0042527_314_1069 213
1159 3300048909 Ga0496106_0004149 Ga0496106_0004149_10020_10730 213
1160 3300048910 Ga0496107_0004256 Ga0496107_0004256_7363_8073 213
1161 3300048910 Ga0496107_0013433 Ga0496107_0013433_915_1556 213
1162 3300048910 Ga0496107_0051223 Ga0496107_0051223_335_976 213
1163 3300048911 Ga0496108_0011863 Ga0496108_0011863_2487_3128 213
1164 3300048912 Ga0496109_0003002 Ga0496109_0003002_7124_7765 213
1165 3300048912 Ga0496109_0060780 Ga0496109_0060780_2782_3423 213
1166 3300048912 Ga0496109_0590160 Ga0496109_0590160_379_1020 213
1167 3300048913 Ga0496110_0098886 Ga0496110_0098886_49_690 213
1168 3300048913 Ga0496110_0161915 Ga0496110_0161915_453_1172 213
1169 3300048914 Ga0496111_0022592 Ga0496111_0022592_691_1332 213
1170 3300048914 Ga0496111_0108735 Ga0496111_0108735_481_1191 213
1171 3300048915 Ga0496112_0007247 Ga0496112_0007247_6792_7433 213
1172 3300048915 Ga0496112_0194638 Ga0496112_0194638_1073_1714 213
1173 3300048915 Ga0496112_0362534 Ga0496112_0362534_228_869 213
1174 3300048916 Ga0496113_0043788 Ga0496113_0043788_428_1069 213
1175 3300048916 Ga0496113_0140874 Ga0496113_0140874_19_729 213
1176 3300048916 Ga0496113_0193329 Ga0496113_0193329_768_1523 213
1177 3300048916 Ga0496113_0676172 Ga0496113_0676172_56_697 213
1178 3300048917 Ga0496114_0000029 Ga0496114_0000029_91957_92598 213
1179 3300048917 Ga0496114_0011356 Ga0496114_0011356_2306_2947 213
1180 3300049585 Ga0501069_0144401 Ga0501069_0144401_191_832 213
1181 3300050493 nmdc:mga0k408_145762_c1 nmdc:mga0k408_145762_c1_595_1236 213
1182 3300053087 Ga0500643_000886 Ga0500643_000886_6762_7415 213
1183 3300053136 Ga0500559_0006868 Ga0500559_0006868_1213_1866 213
1184 3300059503 Ga0587080_026240 Ga0587080_026240_218_859 213
1185 3300059605 Ga0587106_025996 Ga0587106_025996_108_749 213
1186 3300061719 Ga0466962_0005370 Ga0466962_0005370_5022_5663 213
1187 3300005457 Ga0070662_100123364 Ga0070662_1001233642 214
1188 3300031548 Ga0307408_100049946 Ga0307408_1000499462 214
1189 3300031731 Ga0307405_10282938 Ga0307405_102829382 214
1190 3300042012 Ga0439455_0065263 Ga0439455_0065263_294_938 214
1191 3300044765 Ga0466970_0174104 Ga0466970_0174104_308_955 215
1192 3300046616 Ga0495668_0003378 Ga0495668_0003378_11332_11979 215
1193 3300053134 Ga0500658_0000150 Ga0500658_0000150_24080_24727 215
1194 3300027682 Ga0209971_1016234 Ga0209971_10162342 216
1195 3300027876 Ga0209974_10003160 Ga0209974_100031602 216
1196 3300031731 Ga0307405_10001698 Ga0307405_100016986 216
1197 3300031824 Ga0307413_10062769 Ga0307413_100627693 216
1198 3300031852 Ga0307410_10005962 Ga0307410_100059624 216
1199 3300031903 Ga0307407_10007950 Ga0307407_100079502 216
1200 3300031911 Ga0307412_10011818 Ga0307412_100118182 216
1201 3300032002 Ga0307416_100524581 Ga0307416_1005245812 216
1202 3300032004 Ga0307414_10187684 Ga0307414_101876842 216
1203 3300032005 Ga0307411_10008325 Ga0307411_100083252 216
1204 3300032126 Ga0307415_100055902 Ga0307415_1000559023 216
1205 3300032126 Ga0307415_101074552 Ga0307415_1010745521 216
1206 3300042006 Ga0439432_039002 Ga0439432_039002_672_1322 216
1207 3300049679 Ga0501249_030825 Ga0501249_030825_469_1119 216
1208 3300037312 Ga0395899_0157459 Ga0395899_0157459_664_1317 217
1209 3300037418 Ga0395900_0419845 Ga0395900_0419845_233_886 217
1210 3300037466 Ga0395898_0146665 Ga0395898_0146665_644_1297 217
1211 3300005435 Ga0070714_100023829 Ga0070714_1000238294 218
1212 3300025929 Ga0207664_10313174 Ga0207664_103131742 218
1213 3300001904 JGI24736J21556_1021283 JGI24736J21556_10212832 219
1214 3300001979 JGI24740J21852_10029589 JGI24740J21852_100295891 219
1215 3300002067 JGI24735J21928_10015456 JGI24735J21928_100154561 219
1216 3300002067 JGI24735J21928_10019675 JGI24735J21928_100196752 219
1217 3300005327 Ga0070658_10040519 Ga0070658_100405192 219
1218 3300005339 Ga0070660_100003086 Ga0070660_1000030868 219
1219 3300005341 Ga0070691_10027904 Ga0070691_100279042 219
1220 3300005344 Ga0070661_100004927 Ga0070661_1000049273 219
1221 3300005366 Ga0070659_100018879 Ga0070659_1000188794 219
1222 3300005458 Ga0070681_10116911 Ga0070681_101169113 219
1223 3300005539 Ga0068853_100013847 Ga0068853_1000138475 219
1224 3300005563 Ga0068855_100112755 Ga0068855_1001127552 219
1225 3300005564 Ga0070664_100171116 Ga0070664_1001711161 219
1226 3300005616 Ga0068852_100102745 Ga0068852_1001027453 219
1227 3300009093 Ga0105240_10044834 Ga0105240_100448346 219
1228 3300009174 Ga0105241_10469742 Ga0105241_104697421 219
1229 3300009545 Ga0105237_10010769 Ga0105237_100107697 219
1230 3300009551 Ga0105238_10014228 Ga0105238_100142287 219
1231 3300010375 Ga0105239_10013539 Ga0105239_100135396 219
1232 3300013100 Ga0157373_10105277 Ga0157373_101052771 219
1233 3300013102 Ga0157371_10068751 Ga0157371_100687512 219
1234 3300013104 Ga0157370_10165271 Ga0157370_101652712 219
1235 3300013105 Ga0157369_10390196 Ga0157369_103901961 219
1236 3300013307 Ga0157372_10020101 Ga0157372_100201012 219
1237 3300025904 Ga0207647_10001381 Ga0207647_1000138111 219
1238 3300025909 Ga0207705_10023818 Ga0207705_100238182 219
1239 3300025911 Ga0207654_10243549 Ga0207654_102435492 219
1240 3300025912 Ga0207707_10102083 Ga0207707_101020833 219
1241 3300025913 Ga0207695_10035556 Ga0207695_100355562 219
1242 3300025914 Ga0207671_10040914 Ga0207671_100409145 219
1243 3300025919 Ga0207657_10005850 Ga0207657_1000585012 219
1244 3300025920 Ga0207649_10006156 Ga0207649_100061569 219
1245 3300025921 Ga0207652_10160314 Ga0207652_101603142 219
1246 3300025924 Ga0207694_10001964 Ga0207694_1000196412 219
1247 3300025932 Ga0207690_10020974 Ga0207690_100209743 219
1248 3300025945 Ga0207679_10070785 Ga0207679_100707852 219
1249 3300025949 Ga0207667_10116741 Ga0207667_101167414 219
1250 3300026041 Ga0207639_10001284 Ga0207639_100012849 219
1251 3300026116 Ga0207674_10017536 Ga0207674_100175362 219
1252 3300026142 Ga0207698_10001619 Ga0207698_1000161911 219
1253 3300044658 Ga0466972_0211859 Ga0466972_0211859_112_783 219
1254 3300044684 Ga0466966_0013022 Ga0466966_0013022_2920_3606 219
1255 3300044693 Ga0466961_0078081 Ga0466961_0078081_529_1215 219
1256 3300045049 Ga0466959_0045044 Ga0466959_0045044_1484_2170 219

Structural Annotation

Top 5 Hits

ID Description Score Start End
5doo-assembly1.cif.gz_A the structure of pkmt2 from rickettsia typhi 0.8593 64 172
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.8472 64 172
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8143 53 172
7q2g-assembly1.cif.gz_A mycolic acid methyltransferase hma (mmaa4) from mycobac-terium tuberculosis in complex with zt726 0.813 50 173
4htf-assembly1.cif.gz_A crystal structure of s-adenosylmethionine-dependent methyltransferase from escherichia coli in complex with s-adenosylmethionine. 0.8066 52 172
ID Description Score Start End Superfamily
1dl5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8142 51 171 3.40.50.150
af_A1Y9I9_44_257_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7996 47 209 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7982 65 208 3.40.50.150
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7968 51 209 3.40.50.150
af_P9WK03_7_174_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7914 48 171 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6G7ZQJ4-F1-model_v4 Methyltransferase domain-containing protein 0.9738 40 209 GO:0008168
GO:0032259
AF-A0A4Q3A7K2-F1-model_v4 Methyltransferase 0.9676 134 208 GO:0008168
GO:0032259
AF-A0A520JAB8-F1-model_v4 Methyltransferase 0.9675 97 209 GO:0008168
GO:0032259
AF-A0A848HWU9-F1-model_v4 Methyltransferase domain-containing protein 0.9663 56 208 GO:0008168
GO:0032259
AF-A0A6G7ZQJ4-F1-model_v4 Methyltransferase domain-containing protein 0.9627 40 209 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
79.77 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map