F492252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1255 | 1001 | 568 | 455 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2922386360|2922387161 |
| Length | 533 |
| Sequence | IGALAESCAKRRFEFERQWRASLKAGIRCRGDRQRKAKLPPSICCLGATAVFDILFWTRKHRDDRISVGVDLEDDMLSNSLIELDRAHLIHPVSSYRSHEAQGVRVLKSAKGATLTDVSGRQLLDGFAGLWCVNAGYGQDSIVEAAARQLRELPYATGYFGLGSDPAIRLAARLAELAPGDLNHVYFTLGGSDAVDSTIRFIRYYYHAKGRPQKDQFISVEYGYHGSSTAGSGLTALPAFHTGFGVPYSWQHKIPSHYAYRNPVGTHPQAIIAASVAALQAKISELGADRVAAFYVEPIQGSGGVLVPPPSWLKEMQAVCKEHDILFVADEVITGFGRVGPLFACEEDDVVPDLMTTAKGLTSGYVPMGAILMSDRVYNTIADGAGKTAVGHGYTYSAHPVSAAVGLACLDLYENGLLENGRKAGHRLMEGLRALADHPLVGDVRGRGMLAAIELVTDKKRKTPLPTEADAARRIFDRAWDNGLVIRAFAQGVLGFAPPLCCTDADIDGIIERTRSTLDQTLEDKDVRAAMKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 15 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 16 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 17 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 18 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 19 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 22 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 23 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 24 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 25 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 26 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 27 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 28 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 29 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 30 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 31 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 32 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 33 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 34 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 35 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 36 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 37 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 38 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 39 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 40 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 41 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 42 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 43 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 44 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 45 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 46 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 47 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 48 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 49 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 50 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 51 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 52 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 53 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 54 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 55 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 56 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 57 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 58 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 59 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 60 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 61 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 62 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 63 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 64 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 65 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 66 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 67 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 68 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 69 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 70 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 71 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 72 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 73 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 74 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 75 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 76 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 77 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 78 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 79 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 80 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 81 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 82 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 83 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 84 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 85 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 86 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 87 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 88 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 89 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 90 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 91 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 92 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 93 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 94 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 95 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 96 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 97 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 98 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 99 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 100 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 101 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 102 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 103 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 104 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 105 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 106 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 107 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 108 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 109 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 110 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 111 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 112 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 113 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 114 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 115 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 116 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 117 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 118 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 119 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 120 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 121 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 122 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 123 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 124 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 125 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 126 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 127 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 128 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 129 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 130 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 131 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 132 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 133 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 134 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 135 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 136 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 137 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 138 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 139 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 140 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 141 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 142 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 143 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 144 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 145 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 146 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 147 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 148 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 149 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 150 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 151 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 152 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 153 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 154 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 155 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 156 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 157 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 158 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 159 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 160 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 161 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 162 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 163 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 164 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 165 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 166 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 167 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 168 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 169 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 170 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 171 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 172 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 173 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 174 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 175 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 176 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 177 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 178 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 179 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 180 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 181 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 182 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 183 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 184 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 185 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 186 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 187 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 188 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 189 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 190 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 191 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 192 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 193 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 194 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 195 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 196 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 197 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 198 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 199 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 200 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 201 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 202 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 203 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 204 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 205 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 206 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 207 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 208 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 209 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 210 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 211 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 212 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 213 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 214 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 215 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 216 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 217 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 218 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 219 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 220 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 221 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 222 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 223 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 224 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 225 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 226 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 227 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 228 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 229 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 230 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 231 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 232 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 233 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 234 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 235 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 236 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 237 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 238 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 239 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 240 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 241 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 242 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 243 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 244 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 245 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 246 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 247 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 248 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 249 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 250 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 251 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 252 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 253 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 254 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 255 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 256 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 257 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 258 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 259 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 260 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 261 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 262 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 263 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 264 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 265 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 266 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 267 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 268 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 269 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 270 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 271 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 272 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 273 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 274 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 275 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 276 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 277 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 278 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 279 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 280 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 281 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 282 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 283 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 284 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 285 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 286 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 287 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 288 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 289 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 290 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 291 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 292 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 293 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 294 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 295 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 296 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 297 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 298 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 299 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 300 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 301 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 302 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 303 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 304 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 305 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 306 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 307 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 308 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 309 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 310 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 311 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 312 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 313 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 314 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 315 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 316 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 317 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 318 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 319 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 320 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 321 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 322 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 323 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 324 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 325 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 326 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 327 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 328 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 329 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 330 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 331 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 332 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 333 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 334 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 335 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 336 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 337 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 338 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 339 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 340 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 341 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 342 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 343 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 344 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 345 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 346 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 347 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 348 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 349 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 350 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 351 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 352 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 353 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 354 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 355 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 356 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 357 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 358 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 359 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 360 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 361 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 362 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 363 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 364 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 365 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 366 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 367 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 368 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 369 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 370 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 371 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 372 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 373 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 374 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 375 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 376 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 377 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 378 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 379 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 380 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 381 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 382 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 383 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 384 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 385 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 386 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 387 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 388 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 389 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 390 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 391 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 392 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 393 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 394 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 395 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 396 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 397 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 398 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 399 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 400 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 401 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 402 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 403 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 404 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 405 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 406 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 407 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 408 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 409 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 410 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 411 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 412 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 413 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 414 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 415 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 416 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 417 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 418 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 419 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 420 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 421 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 422 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 423 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 424 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 425 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 426 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 427 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 428 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 429 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 430 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 431 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 432 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 433 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 434 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 435 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 436 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 437 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 438 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 439 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 440 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 441 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 442 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 443 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 444 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 445 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 446 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 447 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 448 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 449 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 450 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 451 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 452 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 453 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 454 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 455 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 456 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 457 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 458 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 459 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 460 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 461 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 462 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 463 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 464 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 465 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 466 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 467 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 468 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 469 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 470 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 471 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 472 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 473 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 474 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 475 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 476 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 477 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 478 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 479 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 480 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 481 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 482 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 483 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 484 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 485 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 486 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 487 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 488 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 489 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 490 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 491 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 492 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 493 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 494 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 495 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 496 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 497 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 498 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 499 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 500 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 501 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 502 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 503 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 504 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 505 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 506 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 507 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 508 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 509 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 510 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 511 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 512 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 513 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 514 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 515 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 516 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 517 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 518 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 519 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 520 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 521 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 522 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 523 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 524 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 525 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 526 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 527 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 528 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 529 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 530 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 531 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 532 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 533 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 534 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 535 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 536 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 537 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 538 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 539 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 540 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 541 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 542 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 543 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 544 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 545 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 546 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 547 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 548 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 549 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 550 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 551 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 552 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 553 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 554 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 555 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 556 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 557 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 558 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 559 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 560 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 561 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 562 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 563 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 564 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 565 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 566 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 567 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 568 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 569 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 570 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 571 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 572 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 573 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 574 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 575 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 576 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 577 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 578 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 579 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 580 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 581 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 582 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 583 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 584 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 585 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 586 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 587 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 588 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 589 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 590 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 591 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 592 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 593 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 594 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 595 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 596 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 597 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 598 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 599 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 600 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 601 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 602 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 603 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 604 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 605 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 606 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 607 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 608 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 609 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 610 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 611 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 612 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 613 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 614 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 615 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 616 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 617 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 618 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 619 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 620 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 621 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 622 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 623 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 624 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 625 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 626 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 627 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 628 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 629 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 630 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 631 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 632 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 633 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 634 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 635 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 636 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 637 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 638 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 639 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 640 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 641 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 642 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 643 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 644 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 645 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 646 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 647 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 648 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 649 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 650 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 651 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 652 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 653 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 654 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 655 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 656 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 657 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 658 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 659 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 660 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 661 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 662 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 663 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 664 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 665 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 666 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 667 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 668 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 669 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 670 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 671 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 672 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 673 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 674 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 675 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 676 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 677 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 678 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 679 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 680 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 681 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 682 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 683 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 684 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 685 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 686 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 687 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 688 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 689 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 690 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 691 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 692 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 693 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 694 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 695 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 696 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 697 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 698 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 699 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 700 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 702 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 703 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 704 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 705 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 706 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 707 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 708 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 709 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 710 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 711 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 712 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 713 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 714 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 715 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 716 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 717 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 718 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 719 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 720 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 721 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 722 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 723 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 724 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 725 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 726 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 727 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 728 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 729 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 730 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 731 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 732 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 733 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 734 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 735 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 736 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 737 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 738 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 739 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 740 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 741 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 742 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 743 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 744 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 745 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 746 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 747 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 748 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 749 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 750 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 751 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 752 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 753 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 754 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 755 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 756 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 757 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 758 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 759 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 760 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 761 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 762 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 763 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 783 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 785 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 786 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 787 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 788 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 789 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 790 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 791 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 792 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 793 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 794 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 795 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 796 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 797 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 798 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 799 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 800 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 801 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 802 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 803 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 804 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 805 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 806 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 807 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 808 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 809 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 810 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 811 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 812 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 813 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 814 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 815 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 816 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 817 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 818 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 819 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 820 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 821 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 822 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 823 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 824 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 825 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 826 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 827 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 828 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 829 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 830 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 831 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 832 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 833 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 834 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 835 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 836 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 837 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 838 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 839 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 840 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 841 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 842 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 843 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 844 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 845 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 846 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 847 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 848 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 849 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 850 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 851 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 852 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 853 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 854 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 855 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 856 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 857 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 858 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 859 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 860 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 861 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 862 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 863 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 864 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 865 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 866 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 867 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 868 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 869 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 870 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 871 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 872 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 873 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 874 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 875 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 876 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 877 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 878 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 879 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 880 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 881 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 882 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 883 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 884 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 885 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 886 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 887 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 888 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 889 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 890 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 891 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 892 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 893 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 894 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 895 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 896 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 897 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 898 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 899 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 900 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 901 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 902 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 903 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 904 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 905 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 906 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 907 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 908 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 909 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 910 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 911 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 912 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 913 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 914 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 915 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 916 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 917 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 918 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 919 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 920 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 921 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 922 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 924 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 925 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 926 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 927 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 928 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 929 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 930 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 931 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 932 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 933 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 934 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 935 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 936 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 937 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 938 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 939 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 940 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 941 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 942 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 943 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 944 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 945 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 946 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 947 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 948 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 949 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 950 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 951 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 952 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 953 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 954 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 955 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 956 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 957 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 958 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 959 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 960 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 961 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 962 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 963 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 964 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 965 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 966 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 967 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 968 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 969 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 970 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 971 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 972 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 973 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 974 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 975 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 976 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 977 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 978 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 979 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 980 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 981 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 982 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 983 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 984 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 985 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 986 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 987 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 988 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 989 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 990 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 991 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 992 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 993 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 994 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 995 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 996 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 997 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 998 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 999 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 1000 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1001 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 45.34 |
| Metatranscriptomes | 0 |
| Isolates | 54.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 14.18 |
| Nodule | 44.7 |
| Rhizoplane | 1.91 |
| Rhizosphere | 25.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000196 | 3300001904 | Bacteria | 10841 |
| 2 | JGI24741J21665_1000024 | 3300001915 | Bacteria | 36239 |
| 3 | JGI24740J21852_10001594 | 3300001979 | Bacteria | 10423 |
| 4 | JGI24740J21852_10006396 | 3300001979 | Bacteria | 4883 |
| 5 | JGI24739J22299_10001518 | 3300001989 | Bacteria | 8763 |
| 6 | JGI24738J21930_10003743 | 3300002075 | Bacteria | 3801 |
| 7 | JGI25155J39150_1000003 | 3300002704 | Bacteria | 279666 |
| 8 | JGI25155J39150_1000729 | 3300002704 | Bacteria | 5708 |
| 9 | JGI25156J39149_1000004 | 3300002705 | Bacteria | 273027 |
| 10 | JGI25162J39368_1000069 | 3300002737 | Bacteria | 125244 |
| 11 | JGI25154J39366_1000013 | 3300002738 | Bacteria | 268260 |
| 12 | JGI25154J39366_1000772 | 3300002738 | Bacteria | 14196 |
| 13 | JGI25157J39369_1000004 | 3300002741 | Bacteria | 273009 |
| 14 | JGI25152J39213_1000186 | 3300002773 | Bacteria | 41823 |
| 15 | JGI25159J45721_1000019 | 3300002987 | Bacteria | 127304 |
| 16 | JGI25151J46595_10000867 | 3300003187 | Bacteria | 23973 |
| 17 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 18 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 19 | JGI25165J46597_1000372 | 3300003214 | Bacteria | 50057 |
| 20 | JGI25165J46597_1005415 | 3300003214 | Bacteria | 2462 |
| 21 | JGI25153J46596_10000200 | 3300003215 | Bacteria | 55694 |
| 22 | JGI25153J46596_10000829 | 3300003215 | Bacteria | 18882 |
| 23 | JGI25153J46596_10020305 | 3300003215 | Bacteria | 2515 |
| 24 | rootH1_10018479 | 3300003316 | Bacteria | 3044 |
| 25 | rootH1_10010878 | 3300003323 | Bacteria | 5360 |
| 26 | rootH1_10084286 | 3300003323 | Bacteria | 6026 |
| 27 | JGI25160J50197_1000054 | 3300003354 | Bacteria | 127304 |
| 28 | JGI25160J50197_1000203 | 3300003354 | Bacteria | 49418 |
| 29 | JGI25160J50197_1002223 | 3300003354 | Bacteria | 9111 |
| 30 | JGI25161J50226_1000570 | 3300003374 | Bacteria | 15614 |
| 31 | JGI25161J50226_1002643 | 3300003374 | Bacteria | 4485 |
| 32 | JGI25161J50226_1003970 | 3300003374 | Bacteria | 3214 |
| 33 | Ga0055538_1000008 | 3300003751 | Bacteria | 398547 |
| 34 | Ga0055538_1000302 | 3300003751 | Bacteria | 24606 |
| 35 | Ga0055539_1000012 | 3300003752 | Bacteria | 398547 |
| 36 | Ga0055533_1000015 | 3300003756 | Bacteria | 398547 |
| 37 | Ga0055525_1000017 | 3300003759 | Bacteria | 398547 |
| 38 | Ga0055542_1000068 | 3300003762 | Bacteria | 152353 |
| 39 | Ga0055526_1000308 | 3300003771 | Bacteria | 40807 |
| 40 | Ga0055526_1002146 | 3300003771 | Bacteria | 13527 |
| 41 | Ga0055524_1002400 | 3300003775 | Bacteria | 9714 |
| 42 | Ga0055524_1017598 | 3300003775 | Bacteria | 2517 |
| 43 | Ga0055536_1000640 | 3300003781 | Bacteria | 23814 |
| 44 | Ga0055536_1001374 | 3300003781 | Bacteria | 14794 |
| 45 | Ga0055536_1004941 | 3300003781 | Bacteria | 6642 |
| 46 | Ga0055528_1000054 | 3300003790 | Bacteria | 90334 |
| 47 | Ga0055528_1000611 | 3300003790 | Bacteria | 26673 |
| 48 | Ga0055540_1000131 | 3300003792 | Bacteria | 75615 |
| 49 | Ga0055531_10000207 | 3300003794 | Bacteria | 64818 |
| 50 | Ga0055531_10003719 | 3300003794 | Bacteria | 9591 |
| 51 | Ga0055531_10020782 | 3300003794 | Bacteria | 2579 |
| 52 | Ga0055541_1000009 | 3300003841 | Bacteria | 398547 |
| 53 | Ga0058692_1004401 | 3300003856 | Bacteria | 4182 |
| 54 | Ga0055543_1000150 | 3300004625 | Bacteria | 58353 |
| 55 | Ga0055543_1000349 | 3300004625 | Bacteria | 31437 |
| 56 | Ga0055543_1001165 | 3300004625 | Bacteria | 11186 |
| 57 | Ga0065165_1000136 | 3300005262 | Bacteria | 127754 |
| 58 | Ga0065165_1000672 | 3300005262 | Bacteria | 49172 |
| 59 | Ga0070670_100025939 | 3300005331 | Bacteria | 5043 |
| 60 | Ga0070666_10002707 | 3300005335 | Bacteria | 10698 |
| 61 | Ga0068868_100011890 | 3300005338 | Bacteria | 6347 |
| 62 | Ga0070660_100012565 | 3300005339 | Bacteria | 6048 |
| 63 | Ga0070661_100062021 | 3300005344 | Bacteria | 2745 |
| 64 | Ga0070668_100046856 | 3300005347 | Bacteria | 3322 |
| 65 | Ga0070671_100017186 | 3300005355 | Bacteria | 5855 |
| 66 | Ga0070674_100034053 | 3300005356 | Bacteria | 3398 |
| 67 | Ga0070667_100009753 | 3300005367 | Bacteria | 7961 |
| 68 | Ga0070709_10004117 | 3300005434 | Bacteria | 7841 |
| 69 | Ga0070713_100020550 | 3300005436 | Bacteria | 5065 |
| 70 | Ga0070710_10001455 | 3300005437 | Bacteria | 11172 |
| 71 | Ga0070663_100006884 | 3300005455 | Bacteria | 6881 |
| 72 | Ga0070663_100008174 | 3300005455 | Bacteria | 6420 |
| 73 | Ga0070681_10053293 | 3300005458 | Bacteria | 4031 |
| 74 | Ga0070685_10001923 | 3300005466 | Bacteria | 10778 |
| 75 | Ga0070699_100068180 | 3300005518 | Bacteria | 3089 |
| 76 | Ga0070665_100000227 | 3300005548 | Bacteria | 93439 |
| 77 | Ga0070665_100040698 | 3300005548 | Bacteria | 4671 |
| 78 | Ga0070665_100059322 | 3300005548 | Bacteria | 3836 |
| 79 | Ga0070665_100153116 | 3300005548 | Bacteria | 2308 |
| 80 | Ga0068855_100001019 | 3300005563 | Bacteria | 34917 |
| 81 | Ga0068855_100153664 | 3300005563 | Bacteria | 2615 |
| 82 | Ga0068855_100186637 | 3300005563 | Bacteria | 2341 |
| 83 | Ga0068857_100120684 | 3300005577 | Bacteria | 2360 |
| 84 | Ga0068857_100279867 | 3300005577 | Bacteria | 1534 |
| 85 | Ga0068854_100010398 | 3300005578 | Bacteria | 6033 |
| 86 | Ga0068854_100031331 | 3300005578 | Bacteria | 3694 |
| 87 | Ga0068854_100063002 | 3300005578 | Bacteria | 2691 |
| 88 | Ga0068856_100009010 | 3300005614 | Bacteria | 9709 |
| 89 | Ga0068856_100009837 | 3300005614 | Bacteria | 9287 |
| 90 | Ga0068856_100017742 | 3300005614 | Bacteria | 6902 |
| 91 | Ga0068856_100154918 | 3300005614 | Bacteria | 2301 |
| 92 | Ga0068852_100000915 | 3300005616 | Bacteria | 19555 |
| 93 | Ga0068852_100201722 | 3300005616 | Bacteria | 1882 |
| 94 | Ga0068852_100206905 | 3300005616 | Bacteria | 1859 |
| 95 | Ga0068864_100187555 | 3300005618 | Bacteria | 1894 |
| 96 | Ga0068851_10001399 | 3300005834 | Bacteria | 10544 |
| 97 | Ga0068863_100051283 | 3300005841 | Bacteria | 3911 |
| 98 | Ga0068863_100106350 | 3300005841 | Bacteria | 2670 |
| 99 | Ga0068858_100004031 | 3300005842 | Bacteria | 14495 |
| 100 | Ga0068862_100176133 | 3300005844 | Bacteria | 1917 |
| 101 | Ga0081540_1003849 | 3300005983 | Bacteria | 11723 |
| 102 | Ga0070717_10064195 | 3300006028 | Bacteria | 3049 |
| 103 | Ga0075365_10000531 | 3300006038 | Bacteria | 14672 |
| 104 | Ga0075365_10009053 | 3300006038 | Bacteria | 5695 |
| 105 | Ga0075365_10010720 | 3300006038 | Bacteria | 5353 |
| 106 | Ga0075365_10017374 | 3300006038 | Bacteria | 4400 |
| 107 | Ga0075365_10019715 | 3300006038 | Bacteria | 4169 |
| 108 | Ga0075365_10022527 | 3300006038 | Bacteria | 3948 |
| 109 | Ga0075365_10030791 | 3300006038 | Bacteria | 3440 |
| 110 | Ga0075365_10081484 | 3300006038 | Bacteria | 2193 |
| 111 | Ga0075368_10034284 | 3300006042 | Bacteria | 1977 |
| 112 | Ga0075363_100000058 | 3300006048 | Bacteria | 22322 |
| 113 | Ga0075364_10014932 | 3300006051 | Bacteria | 4808 |
| 114 | Ga0070712_100016628 | 3300006175 | Bacteria | 4752 |
| 115 | Ga0075362_10010898 | 3300006177 | Bacteria | 3567 |
| 116 | Ga0075362_10015935 | 3300006177 | Bacteria | 3068 |
| 117 | Ga0075362_10040411 | 3300006177 | Bacteria | 2053 |
| 118 | Ga0075367_10000241 | 3300006178 | Bacteria | 18607 |
| 119 | Ga0075367_10049377 | 3300006178 | Bacteria | 2480 |
| 120 | Ga0075367_10094119 | 3300006178 | Bacteria | 1826 |
| 121 | Ga0075369_10002765 | 3300006186 | Bacteria | 6298 |
| 122 | Ga0075369_10004181 | 3300006186 | Bacteria | 5319 |
| 123 | Ga0075369_10006567 | 3300006186 | Bacteria | 4402 |
| 124 | Ga0075369_10009584 | 3300006186 | Bacteria | 3766 |
| 125 | Ga0075366_10006620 | 3300006195 | Bacteria | 6359 |
| 126 | Ga0075370_10008090 | 3300006353 | Bacteria | 5396 |
| 127 | Ga0075428_100005444 | 3300006844 | Bacteria | 14149 |
| 128 | Ga0075428_100117841 | 3300006844 | Bacteria | 2892 |
| 129 | Ga0075430_100010143 | 3300006846 | Bacteria | 7973 |
| 130 | Ga0075430_100012612 | 3300006846 | Bacteria | 7197 |
| 131 | Ga0075431_100000183 | 3300006847 | Bacteria | 45154 |
| 132 | Ga0099825_1029359 | 3300006941 | Bacteria | 2561 |
| 133 | Ga0099824_1023232 | 3300006942 | Bacteria | 3891 |
| 134 | Ga0099822_1023504 | 3300006943 | Bacteria | 5663 |
| 135 | Ga0099826_10000665 | 3300006948 | Bacteria | 17773 |
| 136 | Ga0105251_10031549 | 3300009011 | Bacteria | 2650 |
| 137 | Ga0105244_10048482 | 3300009036 | Bacteria | 2174 |
| 138 | Ga0105240_10000217 | 3300009093 | Bacteria | 115649 |
| 139 | Ga0105240_10001044 | 3300009093 | Bacteria | 49217 |
| 140 | Ga0105240_10136724 | 3300009093 | Bacteria | 2934 |
| 141 | Ga0105240_10176549 | 3300009093 | Bacteria | 2525 |
| 142 | Ga0114129_10032402 | 3300009147 | Bacteria | 7386 |
| 143 | Ga0105243_10007647 | 3300009148 | Bacteria | 8304 |
| 144 | Ga0105243_10018759 | 3300009148 | Bacteria | 5240 |
| 145 | Ga0105241_10001102 | 3300009174 | Bacteria | 20563 |
| 146 | Ga0105242_10210522 | 3300009176 | Bacteria | 1732 |
| 147 | Ga0105248_10029402 | 3300009177 | Bacteria | 6129 |
| 148 | Ga0105237_10000978 | 3300009545 | Bacteria | 38384 |
| 149 | Ga0105237_10003836 | 3300009545 | Bacteria | 17674 |
| 150 | Ga0105237_10010892 | 3300009545 | Bacteria | 9648 |
| 151 | Ga0105237_10016626 | 3300009545 | Bacteria | 7642 |
| 152 | Ga0105237_10045493 | 3300009545 | Bacteria | 4416 |
| 153 | Ga0105237_10116983 | 3300009545 | Bacteria | 2659 |
| 154 | Ga0105238_10000111 | 3300009551 | Bacteria | 89931 |
| 155 | Ga0105238_10006969 | 3300009551 | Bacteria | 11292 |
| 156 | Ga0105238_10073563 | 3300009551 | Bacteria | 3412 |
| 157 | Ga0105238_10148003 | 3300009551 | Bacteria | 2324 |
| 158 | Ga0105238_10209138 | 3300009551 | Bacteria | 1927 |
| 159 | Ga0105249_10007119 | 3300009553 | Bacteria | 9765 |
| 160 | Ga0105249_10085551 | 3300009553 | Bacteria | 2939 |
| 161 | Ga0123341_1000093 | 3300009765 | Bacteria | 37635 |
| 162 | Ga0123342_1019635 | 3300009766 | Bacteria | 5107 |
| 163 | Ga0123342_1024823 | 3300009766 | Bacteria | 3698 |
| 164 | Ga0105239_10008101 | 3300010375 | Bacteria | 11995 |
| 165 | Ga0105239_10027600 | 3300010375 | Bacteria | 6247 |
| 166 | Ga0105239_10164192 | 3300010375 | Bacteria | 2483 |
| 167 | Ga0157373_10004938 | 3300013100 | Bacteria | 10032 |
| 168 | Ga0157373_10010185 | 3300013100 | Bacteria | 6925 |
| 169 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 170 | Ga0157370_10003627 | 3300013104 | Bacteria | 18062 |
| 171 | Ga0157370_10005183 | 3300013104 | Bacteria | 14691 |
| 172 | Ga0157369_10104600 | 3300013105 | Bacteria | 3014 |
| 173 | Ga0157369_10177423 | 3300013105 | Bacteria | 2243 |
| 174 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 175 | Ga0157374_10035329 | 3300013296 | Bacteria | 4573 |
| 176 | Ga0157372_10234891 | 3300013307 | Bacteria | 2126 |
| 177 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 178 | Ga0163163_10013631 | 3300014325 | Bacteria | 7444 |
| 179 | Ga0182007_10004509 | 3300015262 | Bacteria | 6295 |
| 180 | Ga0182005_1014944 | 3300015265 | Bacteria | 2168 |
| 181 | Ga0183363_1041 | 3300015690 | Bacteria | 42461 |
| 182 | Ga0163161_10043176 | 3300017792 | Bacteria | 3246 |
| 183 | Ga0214544_1000018 | 3300021320 | Bacteria | 187095 |
| 184 | Ga0214544_1009587 | 3300021320 | Bacteria | 15037 |
| 185 | Ga0214542_1000307 | 3300021321 | Bacteria | 83288 |
| 186 | Ga0214542_1001549 | 3300021321 | Bacteria | 47303 |
| 187 | Ga0214542_1018955 | 3300021321 | Bacteria | 5622 |
| 188 | Ga0214545_1005475 | 3300021324 | Bacteria | 22886 |
| 189 | Ga0214543_1000195 | 3300021327 | Bacteria | 89886 |
| 190 | Ga0214543_1007141 | 3300021327 | Bacteria | 19391 |
| 191 | Ga0214543_1011326 | 3300021327 | Bacteria | 12581 |
| 192 | Ga0228711_1004587 | 3300022739 | Bacteria | 21197 |
| 193 | Ga0228710_1004744 | 3300022740 | Bacteria | 21386 |
| 194 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 195 | Ga0209436_100404 | 3300025208 | Bacteria | 19502 |
| 196 | Ga0209436_102987 | 3300025208 | Bacteria | 4703 |
| 197 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 198 | Ga0209784_100312 | 3300025224 | Bacteria | 25509 |
| 199 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 200 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 201 | Ga0209672_105623 | 3300025228 | Bacteria | 2126 |
| 202 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 203 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 204 | Ga0207425_1002753 | 3300025245 | Bacteria | 5977 |
| 205 | Ga0207425_1003951 | 3300025245 | Bacteria | 4572 |
| 206 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 207 | Ga0209646_1000108 | 3300025246 | Bacteria | 158853 |
| 208 | Ga0209026_1000039 | 3300025250 | Bacteria | 280608 |
| 209 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 210 | Ga0209677_100826 | 3300025253 | Bacteria | 15447 |
| 211 | Ga0209148_1000078 | 3300025254 | Bacteria | 296101 |
| 212 | Ga0209148_1000790 | 3300025254 | Bacteria | 23555 |
| 213 | Ga0209148_1006123 | 3300025254 | Bacteria | 2643 |
| 214 | Ga0209148_1010791 | 3300025254 | Bacteria | 1721 |
| 215 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 216 | Ga0209759_1001092 | 3300025256 | Bacteria | 17633 |
| 217 | Ga0209759_1019371 | 3300025256 | Bacteria | 1615 |
| 218 | Ga0209129_1000255 | 3300025258 | Bacteria | 55335 |
| 219 | Ga0209129_1000669 | 3300025258 | Bacteria | 22694 |
| 220 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 221 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 222 | Ga0209233_1000324 | 3300025261 | Bacteria | 51086 |
| 223 | Ga0209233_1000330 | 3300025261 | Bacteria | 48662 |
| 224 | Ga0209233_1011262 | 3300025261 | Bacteria | 2640 |
| 225 | Ga0209455_1000193 | 3300025272 | Bacteria | 90413 |
| 226 | Ga0209455_1000641 | 3300025272 | Bacteria | 21437 |
| 227 | Ga0209455_1005792 | 3300025272 | Bacteria | 3755 |
| 228 | Ga0209455_1009389 | 3300025272 | Bacteria | 2573 |
| 229 | Ga0209673_1000067 | 3300025273 | Bacteria | 249077 |
| 230 | Ga0209673_1000291 | 3300025273 | Bacteria | 93803 |
| 231 | Ga0209673_1000473 | 3300025273 | Bacteria | 67570 |
| 232 | Ga0209673_1000642 | 3300025273 | Bacteria | 52672 |
| 233 | Ga0209673_1013619 | 3300025273 | Bacteria | 3198 |
| 234 | Ga0209130_1000120 | 3300025284 | Bacteria | 127890 |
| 235 | Ga0209130_1000242 | 3300025284 | Bacteria | 69580 |
| 236 | Ga0209675_1014646 | 3300025291 | Bacteria | 2375 |
| 237 | Ga0209676_1000470 | 3300025292 | Bacteria | 67541 |
| 238 | Ga0209676_1001059 | 3300025292 | Bacteria | 31510 |
| 239 | Ga0209676_1001988 | 3300025292 | Bacteria | 16222 |
| 240 | Ga0209676_1002891 | 3300025292 | Bacteria | 11278 |
| 241 | Ga0209676_1022144 | 3300025292 | Bacteria | 2113 |
| 242 | Ga0209025_1000240 | 3300025294 | Bacteria | 128397 |
| 243 | Ga0209025_1000430 | 3300025294 | Bacteria | 83230 |
| 244 | Ga0209025_1000708 | 3300025294 | Bacteria | 56788 |
| 245 | Ga0209025_1001534 | 3300025294 | Bacteria | 29500 |
| 246 | Ga0209025_1006332 | 3300025294 | Bacteria | 9231 |
| 247 | Ga0209564_1000092 | 3300025295 | Bacteria | 249018 |
| 248 | Ga0209564_1000338 | 3300025295 | Bacteria | 90246 |
| 249 | Ga0209564_1000876 | 3300025295 | Bacteria | 40029 |
| 250 | Ga0209564_1018490 | 3300025295 | Bacteria | 2652 |
| 251 | Ga0209758_1000131 | 3300025297 | Bacteria | 184259 |
| 252 | Ga0209758_1000490 | 3300025297 | Bacteria | 64714 |
| 253 | Ga0209758_1000508 | 3300025297 | Bacteria | 62735 |
| 254 | Ga0209758_1000610 | 3300025297 | Bacteria | 55335 |
| 255 | Ga0209758_1008376 | 3300025297 | Bacteria | 6719 |
| 256 | Ga0209050_1001238 | 3300025298 | Bacteria | 29567 |
| 257 | Ga0209050_1006857 | 3300025298 | Bacteria | 6611 |
| 258 | Ga0209050_1009556 | 3300025298 | Bacteria | 4944 |
| 259 | Ga0209050_1013160 | 3300025298 | Bacteria | 3706 |
| 260 | Ga0209256_1000788 | 3300025299 | Bacteria | 40932 |
| 261 | Ga0209256_1001230 | 3300025299 | Bacteria | 28470 |
| 262 | Ga0209256_1001843 | 3300025299 | Bacteria | 19673 |
| 263 | Ga0209256_1002067 | 3300025299 | Bacteria | 17689 |
| 264 | Ga0207426_1000075 | 3300025302 | Bacteria | 321337 |
| 265 | Ga0207426_1000206 | 3300025302 | Bacteria | 140737 |
| 266 | Ga0207426_1000483 | 3300025302 | Bacteria | 60265 |
| 267 | Ga0209051_1000038 | 3300025303 | Bacteria | 320926 |
| 268 | Ga0209051_1002802 | 3300025303 | Bacteria | 12031 |
| 269 | Ga0209051_1002894 | 3300025303 | Bacteria | 11792 |
| 270 | Ga0209051_1016836 | 3300025303 | Bacteria | 3285 |
| 271 | Ga0209257_1000545 | 3300025304 | Bacteria | 64769 |
| 272 | Ga0209257_1001781 | 3300025304 | Bacteria | 23741 |
| 273 | Ga0209257_1003568 | 3300025304 | Bacteria | 13193 |
| 274 | Ga0209257_1003646 | 3300025304 | Bacteria | 12935 |
| 275 | Ga0207656_10025224 | 3300025321 | Bacteria | 2411 |
| 276 | Ga0207655_1051164 | 3300025728 | Bacteria | 1672 |
| 277 | Ga0207713_1036400 | 3300025735 | Bacteria | 2111 |
| 278 | Ga0207692_10012086 | 3300025898 | Bacteria | 3697 |
| 279 | Ga0207680_10001300 | 3300025903 | Bacteria | 11819 |
| 280 | Ga0207647_10000500 | 3300025904 | Bacteria | 31386 |
| 281 | Ga0207647_10001555 | 3300025904 | Bacteria | 17635 |
| 282 | Ga0207647_10003982 | 3300025904 | Bacteria | 11020 |
| 283 | Ga0207699_10001044 | 3300025906 | Bacteria | 13060 |
| 284 | Ga0207654_10008998 | 3300025911 | Bacteria | 5067 |
| 285 | Ga0207654_10058718 | 3300025911 | Bacteria | 2241 |
| 286 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 287 | Ga0207695_10001205 | 3300025913 | Bacteria | 44411 |
| 288 | Ga0207695_10022351 | 3300025913 | Bacteria | 7182 |
| 289 | Ga0207695_10031196 | 3300025913 | Bacteria | 5851 |
| 290 | Ga0207695_10036514 | 3300025913 | Bacteria | 5312 |
| 291 | Ga0207695_10130548 | 3300025913 | Bacteria | 2471 |
| 292 | Ga0207671_10000793 | 3300025914 | Bacteria | 40024 |
| 293 | Ga0207671_10003510 | 3300025914 | Bacteria | 15568 |
| 294 | Ga0207671_10008685 | 3300025914 | Bacteria | 8577 |
| 295 | Ga0207671_10209851 | 3300025914 | Bacteria | 1523 |
| 296 | Ga0207693_10025190 | 3300025915 | Bacteria | 4717 |
| 297 | Ga0207657_10062390 | 3300025919 | Bacteria | 3191 |
| 298 | Ga0207694_10000199 | 3300025924 | Bacteria | 60220 |
| 299 | Ga0207694_10005080 | 3300025924 | Bacteria | 10170 |
| 300 | Ga0207694_10007856 | 3300025924 | Bacteria | 8077 |
| 301 | Ga0207694_10009453 | 3300025924 | Bacteria | 7349 |
| 302 | Ga0207694_10011666 | 3300025924 | Bacteria | 6628 |
| 303 | Ga0207694_10039024 | 3300025924 | Bacteria | 3653 |
| 304 | Ga0207650_10010601 | 3300025925 | Bacteria | 6329 |
| 305 | Ga0207644_10021404 | 3300025931 | Bacteria | 4404 |
| 306 | Ga0207706_10020155 | 3300025933 | Bacteria | 5992 |
| 307 | Ga0207706_10046067 | 3300025933 | Bacteria | 3862 |
| 308 | Ga0207706_10107587 | 3300025933 | Bacteria | 2454 |
| 309 | Ga0207706_10120797 | 3300025933 | Bacteria | 2304 |
| 310 | Ga0207669_10066859 | 3300025937 | Bacteria | 2237 |
| 311 | Ga0207704_10053054 | 3300025938 | Bacteria | 2462 |
| 312 | Ga0207665_10001859 | 3300025939 | Bacteria | 14230 |
| 313 | Ga0207691_10078053 | 3300025940 | Bacteria | 2981 |
| 314 | Ga0207711_10040250 | 3300025941 | Bacteria | 3976 |
| 315 | Ga0207667_10000028 | 3300025949 | Bacteria | 334510 |
| 316 | Ga0207667_10090804 | 3300025949 | Bacteria | 3156 |
| 317 | Ga0207712_10000169 | 3300025961 | Bacteria | 67461 |
| 318 | Ga0207712_10024258 | 3300025961 | Bacteria | 4014 |
| 319 | Ga0207668_10033246 | 3300025972 | Bacteria | 3414 |
| 320 | Ga0207668_10047884 | 3300025972 | Bacteria | 2930 |
| 321 | Ga0207640_10001595 | 3300025981 | Bacteria | 12185 |
| 322 | Ga0207640_10017441 | 3300025981 | Bacteria | 4200 |
| 323 | Ga0207658_10013181 | 3300025986 | Bacteria | 5645 |
| 324 | Ga0207703_10001066 | 3300026035 | Bacteria | 26163 |
| 325 | Ga0207639_10000560 | 3300026041 | Bacteria | 25545 |
| 326 | Ga0207678_10002324 | 3300026067 | Bacteria | 17232 |
| 327 | Ga0207678_10033763 | 3300026067 | Bacteria | 4456 |
| 328 | Ga0207678_10035730 | 3300026067 | Bacteria | 4327 |
| 329 | Ga0207702_10004405 | 3300026078 | Bacteria | 12541 |
| 330 | Ga0207702_10013019 | 3300026078 | Bacteria | 6918 |
| 331 | Ga0207702_10034297 | 3300026078 | Bacteria | 4242 |
| 332 | Ga0207641_10094135 | 3300026088 | Bacteria | 2627 |
| 333 | Ga0207648_10084397 | 3300026089 | Bacteria | 2770 |
| 334 | Ga0207674_10124592 | 3300026116 | Bacteria | 2543 |
| 335 | Ga0207674_10141337 | 3300026116 | Bacteria | 2366 |
| 336 | Ga0207675_100107710 | 3300026118 | Bacteria | 2628 |
| 337 | Ga0207683_10091692 | 3300026121 | Bacteria | 2707 |
| 338 | Ga0207683_10181519 | 3300026121 | Bacteria | 1908 |
| 339 | Ga0207698_10140736 | 3300026142 | Bacteria | 2078 |
| 340 | Ga0209281_1000491 | 3300027111 | Bacteria | 54084 |
| 341 | Ga0209281_1000981 | 3300027111 | Bacteria | 22781 |
| 342 | Ga0209389_1004138 | 3300027296 | Bacteria | 11968 |
| 343 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 344 | Ga0209371_1000324 | 3300027312 | Bacteria | 52237 |
| 345 | Ga0209589_1002342 | 3300027357 | Bacteria | 32707 |
| 346 | Ga0209589_1007145 | 3300027357 | Bacteria | 18101 |
| 347 | Ga0209489_106154 | 3300027361 | Bacteria | 19664 |
| 348 | Ga0209489_106733 | 3300027361 | Bacteria | 18101 |
| 349 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 350 | Ga0209282_1000108 | 3300027666 | Bacteria | 54085 |
| 351 | Ga0209282_1000604 | 3300027666 | Bacteria | 17667 |
| 352 | Ga0209813_10001351 | 3300027866 | Bacteria | 5499 |
| 353 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 354 | Ga0268266_10029411 | 3300028379 | Bacteria | 4671 |
| 355 | Ga0268266_10033739 | 3300028379 | Bacteria | 4351 |
| 356 | Ga0268266_10096000 | 3300028379 | Bacteria | 2604 |
| 357 | Ga0268264_10127213 | 3300028381 | Bacteria | 2254 |
| 358 | Ga0307515_10001625 | 3300028794 | Bacteria | 50019 |
| 359 | Ga0307515_10001999 | 3300028794 | Bacteria | 45141 |
| 360 | Ga0307515_10051586 | 3300028794 | Bacteria | 6128 |
| 361 | Ga0307515_10233095 | 3300028794 | Bacteria | 1629 |
| 362 | Ga0265338_10189785 | 3300028800 | Bacteria | 1559 |
| 363 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 364 | Ga0268256_1001615 | 3300030500 | Bacteria | 13064 |
| 365 | Ga0307513_10095186 | 3300031456 | Bacteria | 3020 |
| 366 | Ga0307408_100000948 | 3300031548 | Bacteria | 22509 |
| 367 | Ga0307514_10000850 | 3300031649 | Bacteria | 49169 |
| 368 | Ga0307405_10019055 | 3300031731 | Bacteria | 3801 |
| 369 | Ga0307406_10064691 | 3300031901 | Bacteria | 2374 |
| 370 | Ga0307412_10007012 | 3300031911 | Bacteria | 6395 |
| 371 | Ga0315914_1000427 | 3300031967 | Bacteria | 51660 |
| 372 | Ga0307416_100082647 | 3300032002 | Bacteria | 2721 |
| 373 | Ga0307414_10128900 | 3300032004 | Bacteria | 1960 |
| 374 | Ga0307411_10099176 | 3300032005 | Bacteria | 2055 |
| 375 | Ga0315913_1001358 | 3300033430 | Bacteria | 26703 |
| 376 | Ga0315915_1000032 | 3300033464 | Bacteria | 87024 |
| 377 | Ga0316574_0008040 | 3300035398 | Bacteria | 5830 |
| 378 | Ga0316574_0032447 | 3300035398 | Bacteria | 3174 |
| 379 | Ga0373927_0000581 | 3300035695 | Bacteria | 27838 |
| 380 | Ga0316584_0142313 | 3300036712 | Bacteria | 1788 |
| 381 | Ga0373925_0003311 | 3300037068 | Bacteria | 12517 |
| 382 | Ga0395900_0170554 | 3300037418 | Bacteria | 2216 |
| 383 | Ga0395905_0001624 | 3300037471 | Bacteria | 26721 |
| 384 | Ga0395905_0018526 | 3300037471 | Bacteria | 6608 |
| 385 | Ga0395905_0168297 | 3300037471 | Bacteria | 2059 |
| 386 | Ga0395901_0037069 | 3300038443 | Bacteria | 5043 |
| 387 | Ga0395901_0099665 | 3300038443 | Bacteria | 3047 |
| 388 | Ga0400487_39107 | 3300039110 | Bacteria | 2418 |
| 389 | Ga0436365_1690000 | 3300039437 | Bacteria | 1545 |
| 390 | Ga0436361_0082211 | 3300039447 | Bacteria | 2449 |
| 391 | Ga0436361_1160430 | 3300039447 | Bacteria | 8197 |
| 392 | Ga0439436_0032326 | 3300041404 | Bacteria | 1518 |
| 393 | Ga0439465_0001210 | 3300041413 | Bacteria | 8327 |
| 394 | Ga0439465_0008515 | 3300041413 | Bacteria | 3236 |
| 395 | Ga0451849_0513859 | 3300041505 | Bacteria | 2226 |
| 396 | Ga0451851_0276965 | 3300041507 | Bacteria | 1852 |
| 397 | Ga0451843_1077282 | 3300041509 | Bacteria | 2036 |
| 398 | Ga0451853_1283853 | 3300041512 | Bacteria | 2226 |
| 399 | Ga0439432_003974 | 3300042006 | Bacteria | 5431 |
| 400 | Ga0439449_0019041 | 3300042007 | Bacteria | 2574 |
| 401 | Ga0450906_003989 | 3300042145 | Bacteria | 3124 |
| 402 | Ga0450907_007441 | 3300042146 | Bacteria | 1828 |
| 403 | Ga0439446_0009399 | 3300042156 | Bacteria | 2617 |
| 404 | Ga0439434_0010852 | 3300042435 | Bacteria | 2690 |
| 405 | Ga0439434_0015659 | 3300042435 | Bacteria | 2261 |
| 406 | Ga0450918_000330 | 3300042531 | Bacteria | 10599 |
| 407 | Ga0466963_0008944 | 3300044694 | Bacteria | 6011 |
| 408 | Ga0466968_0006460 | 3300044735 | Bacteria | 4420 |
| 409 | Ga0466970_0000136 | 3300044765 | Bacteria | 33881 |
| 410 | Ga0466959_0056743 | 3300045049 | Bacteria | 2857 |
| 411 | Ga0451576_0121180 | 3300045051 | Bacteria | 2723 |
| 412 | Ga0466958_0004964 | 3300045836 | Bacteria | 7096 |
| 413 | Ga0495617_006379 | 3300046452 | Bacteria | 4139 |
| 414 | Ga0495629_0009432 | 3300046459 | Bacteria | 7137 |
| 415 | Ga0495638_0001519 | 3300046460 | Bacteria | 20885 |
| 416 | Ga0495650_0060858 | 3300046471 | Bacteria | 1515 |
| 417 | Ga0495605_0020476 | 3300046474 | Bacteria | 3514 |
| 418 | Ga0495585_0033722 | 3300046492 | Bacteria | 2897 |
| 419 | Ga0495585_0099629 | 3300046492 | Bacteria | 1555 |
| 420 | Ga0495606_0006572 | 3300046507 | Bacteria | 10689 |
| 421 | Ga0495606_0021433 | 3300046507 | Bacteria | 4733 |
| 422 | Ga0495606_0079141 | 3300046507 | Bacteria | 2048 |
| 423 | Ga0495610_0016880 | 3300046512 | Bacteria | 4183 |
| 424 | Ga0495620_0001877 | 3300046515 | Bacteria | 12353 |
| 425 | Ga0495637_0014296 | 3300046520 | Bacteria | 3744 |
| 426 | Ga0495643_0001015 | 3300046522 | Bacteria | 28687 |
| 427 | Ga0495643_0038695 | 3300046522 | Bacteria | 2611 |
| 428 | Ga0495648_0043713 | 3300046524 | Bacteria | 2805 |
| 429 | Ga0495654_0000920 | 3300046530 | Bacteria | 21891 |
| 430 | Ga0495597_0007987 | 3300046542 | Bacteria | 5324 |
| 431 | Ga0495622_0001480 | 3300046557 | Bacteria | 11803 |
| 432 | Ga0495633_0044363 | 3300046558 | Bacteria | 2107 |
| 433 | Ga0495633_0063020 | 3300046558 | Bacteria | 1735 |
| 434 | Ga0495668_0027729 | 3300046616 | Bacteria | 3209 |
| 435 | Ga0495625_0014937 | 3300046660 | Bacteria | 6173 |
| 436 | Ga0495625_0028129 | 3300046660 | Bacteria | 4219 |
| 437 | Ga0495625_0169879 | 3300046660 | Bacteria | 1456 |
| 438 | Ga0495635_0069085 | 3300046663 | Bacteria | 2422 |
| 439 | Ga0495661_0038541 | 3300046665 | Bacteria | 2976 |
| 440 | Ga0495588_0000630 | 3300046674 | Bacteria | 16434 |
| 441 | Ga0495600_0091745 | 3300046809 | Bacteria | 1981 |
| 442 | Ga0495604_0000886 | 3300047317 | Bacteria | 24880 |
| 443 | Ga0495672_0017946 | 3300047320 | Bacteria | 4716 |
| 444 | Ga0495672_0037928 | 3300047320 | Bacteria | 2945 |
| 445 | Ga0495687_008305 | 3300047443 | Bacteria | 5965 |
| 446 | Ga0495681_0002578 | 3300047470 | Bacteria | 12873 |
| 447 | Ga0495681_0009025 | 3300047470 | Bacteria | 6184 |
| 448 | Ga0496101_0015346 | 3300048904 | Bacteria | 5161 |
| 449 | Ga0496102_0003274 | 3300048905 | Bacteria | 13725 |
| 450 | Ga0496103_0005911 | 3300048906 | Bacteria | 7315 |
| 451 | Ga0496104_0012545 | 3300048907 | Bacteria | 7624 |
| 452 | Ga0496105_0003825 | 3300048908 | Bacteria | 11230 |
| 453 | Ga0496106_0006011 | 3300048909 | Bacteria | 8977 |
| 454 | Ga0496108_0026952 | 3300048911 | Bacteria | 4742 |
| 455 | Ga0496109_0018060 | 3300048912 | Bacteria | 6192 |
| 456 | Ga0496110_0010594 | 3300048913 | Bacteria | 7505 |
| 457 | Ga0496110_0020290 | 3300048913 | Bacteria | 5611 |
| 458 | Ga0496110_0031938 | 3300048913 | Bacteria | 4545 |
| 459 | Ga0496112_0010380 | 3300048915 | Bacteria | 8445 |
| 460 | Ga0496112_0084625 | 3300048915 | Bacteria | 3137 |
| 461 | Ga0496112_0090216 | 3300048915 | Bacteria | 3034 |
| 462 | Ga0496116_0031320 | 3300048919 | Bacteria | 3810 |
| 463 | Ga0496116_0144165 | 3300048919 | Bacteria | 1334 |
| 464 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 465 | Ga0496117_0041396 | 3300048920 | Bacteria | 3376 |
| 466 | Ga0496117_0077648 | 3300048920 | Bacteria | 2196 |
| 467 | Ga0496118_0000153 | 3300048921 | Bacteria | 122419 |
| 468 | Ga0496118_0001953 | 3300048921 | Bacteria | 29213 |
| 469 | Ga0496118_0023476 | 3300048921 | Bacteria | 5355 |
| 470 | Ga0496118_0060873 | 3300048921 | Bacteria | 2800 |
| 471 | Ga0496119_0007331 | 3300048922 | Bacteria | 9975 |
| 472 | Ga0496119_0021185 | 3300048922 | Bacteria | 4708 |
| 473 | Ga0496119_0026665 | 3300048922 | Bacteria | 3998 |
| 474 | Ga0496119_0045015 | 3300048922 | Bacteria | 2771 |
| 475 | Ga0496119_0053504 | 3300048922 | Bacteria | 2465 |
| 476 | Ga0496120_0000660 | 3300048923 | Bacteria | 50656 |
| 477 | Ga0496120_0004196 | 3300048923 | Bacteria | 12311 |
| 478 | Ga0496120_0006449 | 3300048923 | Bacteria | 9012 |
| 479 | Ga0496121_0000191 | 3300048924 | Bacteria | 136529 |
| 480 | Ga0496121_0001476 | 3300048924 | Bacteria | 39569 |
| 481 | Ga0496121_0016949 | 3300048924 | Bacteria | 7484 |
| 482 | Ga0496121_0023957 | 3300048924 | Bacteria | 5854 |
| 483 | Ga0496121_0077608 | 3300048924 | Bacteria | 2644 |
| 484 | Ga0496121_0159878 | 3300048924 | Bacteria | 1649 |
| 485 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 486 | Ga0496122_0002358 | 3300048925 | Bacteria | 27165 |
| 487 | Ga0496122_0002550 | 3300048925 | Bacteria | 25608 |
| 488 | Ga0496122_0003859 | 3300048925 | Bacteria | 19238 |
| 489 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 490 | Ga0496123_0021716 | 3300048926 | Bacteria | 4977 |
| 491 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 492 | Ga0496124_0004712 | 3300048927 | Bacteria | 15746 |
| 493 | Ga0496124_0008231 | 3300048927 | Bacteria | 10935 |
| 494 | Ga0496124_0011294 | 3300048927 | Bacteria | 8940 |
| 495 | Ga0496124_0029218 | 3300048927 | Bacteria | 4917 |
| 496 | Ga0496125_0000428 | 3300048928 | Bacteria | 77638 |
| 497 | Ga0496125_0001524 | 3300048928 | Bacteria | 33228 |
| 498 | Ga0496125_0014527 | 3300048928 | Bacteria | 7665 |
| 499 | Ga0496125_0014609 | 3300048928 | Bacteria | 7637 |
| 500 | Ga0496125_0023312 | 3300048928 | Bacteria | 5715 |
| 501 | Ga0496125_0050628 | 3300048928 | Bacteria | 3437 |
| 502 | Ga0496125_0065695 | 3300048928 | Bacteria | 2872 |
| 503 | Ga0496125_0120723 | 3300048928 | Bacteria | 1870 |
| 504 | Ga0496126_0001278 | 3300048929 | Bacteria | 40439 |
| 505 | Ga0496126_0109555 | 3300048929 | Bacteria | 2407 |
| 506 | Ga0501031_0139909 | 3300049568 | Bacteria | 1582 |
| 507 | Ga0501032_0008522 | 3300049569 | Bacteria | 7476 |
| 508 | Ga0501032_0041410 | 3300049569 | Bacteria | 3128 |
| 509 | Ga0501033_0002403 | 3300049570 | Bacteria | 15941 |
| 510 | Ga0501034_0000003 | 3300049571 | Bacteria | 471748 |
| 511 | Ga0501034_0267192 | 3300049571 | Bacteria | 1652 |
| 512 | Ga0501037_0000028 | 3300049573 | Bacteria | 139838 |
| 513 | Ga0501039_0073800 | 3300049575 | Bacteria | 2651 |
| 514 | Ga0501043_0000028 | 3300049579 | Bacteria | 144125 |
| 515 | Ga0501069_0000014 | 3300049585 | Bacteria | 146321 |
| 516 | Ga0501070_0000121 | 3300049586 | Bacteria | 69910 |
| 517 | Ga0501073_0021852 | 3300049589 | Bacteria | 4609 |
| 518 | Ga0501074_0000004 | 3300049590 | Bacteria | 114255 |
| 519 | Ga0501080_0000027 | 3300049742 | Bacteria | 89243 |
| 520 | Ga0501083_0000025 | 3300049744 | Bacteria | 121349 |
| 521 | Ga0501035_0000129 | 3300049822 | Bacteria | 92221 |
| 522 | Ga0501044_0000052 | 3300049823 | Bacteria | 143626 |
| 523 | nmdc:mga03683_12598_c1 | 3300050489 | Bacteria | 3094 |
| 524 | nmdc:mga03683_14537_c1 | 3300050489 | Bacteria | 2915 |
| 525 | nmdc:mga00v17_11453_c1 | 3300050491 | Bacteria | 4873 |
| 526 | nmdc:mga00v17_11939_c1 | 3300050491 | Bacteria | 4782 |
| 527 | nmdc:mga00v17_3_c1 | 3300050491 | Bacteria | 242367 |
| 528 | nmdc:mga0yw44_10540_c1 | 3300050492 | Bacteria | 2385 |
| 529 | nmdc:mga0yw44_31834_c1 | 3300050492 | Bacteria | 3070 |
| 530 | nmdc:mga0yw44_6443_c1 | 3300050492 | Bacteria | 5675 |
| 531 | nmdc:mga0yw44_9013_c1 | 3300050492 | Bacteria | 5014 |
| 532 | nmdc:mga0k408_1643_c1 | 3300050493 | Bacteria | 12092 |
| 533 | nmdc:mga0k408_28205_c1 | 3300050493 | Bacteria | 3192 |
| 534 | nmdc:mga06z11_19394_c1 | 3300050494 | Bacteria | 3126 |
| 535 | nmdc:mga06z11_42757_c1 | 3300050494 | Bacteria | 2275 |
| 536 | nmdc:mga06z11_98357_c1 | 3300050494 | Bacteria | 1601 |
| 537 | nmdc:mga07m45_40126_c1 | 3300050496 | Bacteria | 2619 |
| 538 | nmdc:mga07m45_7997_c1 | 3300050496 | Bacteria | 5420 |
| 539 | nmdc:mga05p37_114737_c1 | 3300050507 | Bacteria | 2377 |
| 540 | nmdc:mga05p37_602_c1 | 3300050507 | Bacteria | 39665 |
| 541 | nmdc:mga09592_1214_c1 | 3300050508 | Bacteria | 20659 |
| 542 | nmdc:mga0qj67_30261_c1 | 3300050509 | Bacteria | 4212 |
| 543 | nmdc:mga0qj67_41540_c1 | 3300050509 | Bacteria | 3618 |
| 544 | nmdc:mga06r32_2662_c1 | 3300050510 | Bacteria | 15970 |
| 545 | nmdc:mga0sz30_17402_c1 | 3300050516 | Bacteria | 2866 |
| 546 | nmdc:mga0sz30_28733_c1 | 3300050516 | Bacteria | 2290 |
| 547 | nmdc:mga0sz30_514_c1 | 3300050516 | Bacteria | 14418 |
| 548 | nmdc:mga0sz30_5788_c1 | 3300050516 | Bacteria | 4554 |
| 549 | Ga0500610_0019641 | 3300053079 | Bacteria | 3287 |
| 550 | Ga0495655_0007607 | 3300053083 | Bacteria | 2022 |
| 551 | Ga0500643_019909 | 3300053087 | Bacteria | 2203 |
| 552 | Ga0500560_001318 | 3300053107 | Bacteria | 4230 |
| 553 | Ga0500569_006377 | 3300053109 | Bacteria | 2588 |
| 554 | Ga0500618_006461 | 3300053125 | Bacteria | 3437 |
| 555 | Ga0500618_012616 | 3300053125 | Bacteria | 2207 |
| 556 | Ga0500658_0001866 | 3300053134 | Bacteria | 8273 |
| 557 | Ga0500561_0000133 | 3300053137 | Bacteria | 14162 |
| 558 | Ga0500568_0012171 | 3300053139 | Bacteria | 3963 |
| 559 | Ga0500573_0014457 | 3300053140 | Bacteria | 4468 |
| 560 | Ga0500590_002599 | 3300053148 | Bacteria | 8085 |
| 561 | Ga0500616_0005939 | 3300053153 | Bacteria | 8150 |
| 562 | Ga0500616_0038875 | 3300053153 | Bacteria | 2568 |
| 563 | Ga0500624_000016 | 3300053157 | Bacteria | 134804 |
| 564 | Ga0500624_000337 | 3300053157 | Bacteria | 15781 |
| 565 | Ga0500636_0000001 | 3300053177 | Bacteria | 324086 |
| 566 | Ga0500636_0056283 | 3300053177 | Bacteria | 2304 |
| 567 | Ga0500637_0000007 | 3300053178 | Bacteria | 93788 |
| 568 | Ga0590075_012034 | 3300059424 | Bacteria | 2098 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2906354277 | 2906355017 | 356 |
| 2 | 3300048919 | Ga0496116_0144165 | Ga0496116_0144165_11_1165 | 384 |
| 3 | 3300001989 | JGI24739J22299_10001518 | JGI24739J22299_100015187 | 415 |
| 4 | iso_pu_bacteria | 2840878972 | 2840881958 | 421 |
| 5 | iso_pu_bacteria | 2551306089 | 2551714289 | 427 |
| 6 | iso_pu_bacteria | 8019678201 | 8019680335 | 427 |
| 7 | 3300002704 | JGI25155J39150_1000729 | JGI25155J39150_10007291 | 428 |
| 8 | 3300002738 | JGI25154J39366_1000772 | JGI25154J39366_10007728 | 428 |
| 9 | 3300009545 | Ga0105237_10116983 | Ga0105237_101169832 | 428 |
| 10 | 3300025246 | Ga0209646_1000108 | Ga0209646_10001085 | 428 |
| 11 | 3300025256 | Ga0209759_1001092 | Ga0209759_100109211 | 428 |
| 12 | 3300047320 | Ga0495672_0037928 | Ga0495672_0037928_1031_2416 | 428 |
| 13 | 3300049571 | Ga0501034_0000003 | Ga0501034_0000003_343239_344618 | 428 |
| 14 | iso_pu_bacteria | 2856741275 | 2856745978 | 429 |
| 15 | iso_pu_bacteria | 2891395885 | 2891398135 | 429 |
| 16 | iso_pu_bacteria | 2891554331 | 2891556478 | 429 |
| 17 | iso_pu_bacteria | 2551306092 | 2551737641 | 431 |
| 18 | 3300003751 | Ga0055538_1000302 | Ga0055538_100030214 | 432 |
| 19 | 3300014325 | Ga0163163_10000004 | Ga0163163_10000004406 | 432 |
| 20 | 3300025224 | Ga0209784_100312 | Ga0209784_10031212 | 432 |
| 21 | 3300025292 | Ga0209676_1002891 | Ga0209676_10028913 | 432 |
| 22 | 3300025294 | Ga0209025_1006332 | Ga0209025_10063322 | 432 |
| 23 | 3300028800 | Ga0265338_10189785 | Ga0265338_101897852 | 432 |
| 24 | iso_pu_bacteria | 2551306087 | 2551697280 | 432 |
| 25 | iso_pu_bacteria | 2964636051 | 2964641392 | 432 |
| 26 | 3300035398 | Ga0316574_0008040 | Ga0316574_0008040_3352_4752 | 433 |
| 27 | 3300036712 | Ga0316584_0142313 | Ga0316584_0142313_74_1474 | 433 |
| 28 | 3300048913 | Ga0496110_0020290 | Ga0496110_0020290_1892_3271 | 433 |
| 29 | 3300059424 | Ga0590075_012034 | Ga0590075_012034_197_1579 | 433 |
| 30 | 3300025224 | Ga0209784_100005 | Ga0209784_100005308 | 434 |
| 31 | 3300025225 | Ga0209566_100005 | Ga0209566_100005308 | 434 |
| 32 | 3300025226 | Ga0209674_100009 | Ga0209674_100009308 | 434 |
| 33 | 3300025230 | Ga0209563_100012 | Ga0209563_100012308 | 434 |
| 34 | 3300025253 | Ga0209677_100006 | Ga0209677_100006308 | 434 |
| 35 | 3300005563 | Ga0068855_100001019 | Ga0068855_10000101914 | 435 |
| 36 | 3300025949 | Ga0207667_10000028 | Ga0207667_1000002863 | 435 |
| 37 | 3300003751 | Ga0055538_1000008 | Ga0055538_1000008310 | 436 |
| 38 | 3300003752 | Ga0055539_1000012 | Ga0055539_1000012310 | 436 |
| 39 | 3300003756 | Ga0055533_1000015 | Ga0055533_1000015310 | 436 |
| 40 | 3300003759 | Ga0055525_1000017 | Ga0055525_100001733 | 436 |
| 41 | 3300003841 | Ga0055541_1000009 | Ga0055541_1000009310 | 436 |
| 42 | 3300006844 | Ga0075428_100005444 | Ga0075428_1000054449 | 436 |
| 43 | 3300006846 | Ga0075430_100010143 | Ga0075430_1000101439 | 436 |
| 44 | 3300006846 | Ga0075430_100012612 | Ga0075430_1000126124 | 436 |
| 45 | 3300006847 | Ga0075431_100000183 | Ga0075431_10000018318 | 436 |
| 46 | 3300009147 | Ga0114129_10032402 | Ga0114129_100324028 | 436 |
| 47 | 3300050507 | nmdc:mga05p37_602_c1 | nmdc:mga05p37_602_c1_31917_33281 | 436 |
| 48 | 3300050508 | nmdc:mga09592_1214_c1 | nmdc:mga09592_1214_c1_6849_8213 | 436 |
| 49 | 3300050509 | nmdc:mga0qj67_30261_c1 | nmdc:mga0qj67_30261_c1_2018_3382 | 436 |
| 50 | 3300050509 | nmdc:mga0qj67_41540_c1 | nmdc:mga0qj67_41540_c1_2139_3503 | 436 |
| 51 | 3300050510 | nmdc:mga06r32_2662_c1 | nmdc:mga06r32_2662_c1_9328_10692 | 436 |
| 52 | iso_pu_bacteria | 2811994881 | 2812370262 | 436 |
| 53 | iso_pu_bacteria | 2923519811 | 2923524350 | 436 |
| 54 | 3300035398 | Ga0316574_0032447 | Ga0316574_0032447_1118_2527 | 437 |
| 55 | iso_pu_bacteria | 8011350971 | 8011356275 | 437 |
| 56 | 3300005331 | Ga0070670_100025939 | Ga0070670_1000259391 | 438 |
| 57 | 3300005335 | Ga0070666_10002707 | Ga0070666_100027077 | 438 |
| 58 | 3300005338 | Ga0068868_100011890 | Ga0068868_1000118903 | 438 |
| 59 | 3300005344 | Ga0070661_100062021 | Ga0070661_1000620212 | 438 |
| 60 | 3300005458 | Ga0070681_10053293 | Ga0070681_100532934 | 438 |
| 61 | 3300005548 | Ga0070665_100000227 | Ga0070665_10000022766 | 438 |
| 62 | 3300005578 | Ga0068854_100010398 | Ga0068854_1000103984 | 438 |
| 63 | 3300005614 | Ga0068856_100154918 | Ga0068856_1001549182 | 438 |
| 64 | 3300005616 | Ga0068852_100206905 | Ga0068852_1002069051 | 438 |
| 65 | 3300005834 | Ga0068851_10001399 | Ga0068851_100013993 | 438 |
| 66 | 3300005842 | Ga0068858_100004031 | Ga0068858_1000040317 | 438 |
| 67 | 3300009553 | Ga0105249_10007119 | Ga0105249_100071193 | 438 |
| 68 | 3300025903 | Ga0207680_10001300 | Ga0207680_100013002 | 438 |
| 69 | 3300025913 | Ga0207695_10022351 | Ga0207695_100223514 | 438 |
| 70 | 3300025914 | Ga0207671_10008685 | Ga0207671_100086852 | 438 |
| 71 | 3300025924 | Ga0207694_10007856 | Ga0207694_100078567 | 438 |
| 72 | 3300025925 | Ga0207650_10010601 | Ga0207650_100106015 | 438 |
| 73 | 3300025933 | Ga0207706_10020155 | Ga0207706_100201553 | 438 |
| 74 | 3300025961 | Ga0207712_10000169 | Ga0207712_1000016915 | 438 |
| 75 | 3300025981 | Ga0207640_10001595 | Ga0207640_100015953 | 438 |
| 76 | 3300026035 | Ga0207703_10001066 | Ga0207703_1000106617 | 438 |
| 77 | 3300026067 | Ga0207678_10035730 | Ga0207678_100357303 | 438 |
| 78 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006636 | 438 |
| 79 | 3300005518 | Ga0070699_100068180 | Ga0070699_1000681802 | 439 |
| 80 | 3300005578 | Ga0068854_100031331 | Ga0068854_1000313313 | 439 |
| 81 | 3300009036 | Ga0105244_10048482 | Ga0105244_100484822 | 439 |
| 82 | 3300009551 | Ga0105238_10000111 | Ga0105238_1000011133 | 439 |
| 83 | 3300010375 | Ga0105239_10008101 | Ga0105239_100081013 | 439 |
| 84 | 3300025728 | Ga0207655_1051164 | Ga0207655_10511642 | 439 |
| 85 | 3300025913 | Ga0207695_10130548 | Ga0207695_101305482 | 439 |
| 86 | 3300025914 | Ga0207671_10003510 | Ga0207671_100035107 | 439 |
| 87 | 3300025924 | Ga0207694_10000199 | Ga0207694_100001993 | 439 |
| 88 | 3300042006 | Ga0439432_003974 | Ga0439432_003974_707_2125 | 439 |
| 89 | 3300042156 | Ga0439446_0009399 | Ga0439446_0009399_572_1990 | 439 |
| 90 | 3300042435 | Ga0439434_0015659 | Ga0439434_0015659_792_2210 | 439 |
| 91 | 3300049569 | Ga0501032_0041410 | Ga0501032_0041410_889_2307 | 439 |
| 92 | 3300049571 | Ga0501034_0267192 | Ga0501034_0267192_173_1591 | 439 |
| 93 | 3300049575 | Ga0501039_0073800 | Ga0501039_0073800_60_1478 | 439 |
| 94 | iso_pu_bacteria | 2512047086 | 2512531411 | 439 |
| 95 | iso_pu_bacteria | 2582581866 | 2585396262 | 439 |
| 96 | iso_pu_bacteria | 2600254931 | 2600362990 | 439 |
| 97 | iso_pu_bacteria | 2838122688 | 2838129598 | 439 |
| 98 | iso_pu_bacteria | 2841966195 | 2841967914 | 439 |
| 99 | iso_pu_bacteria | 3000017691 | 3000020403 | 439 |
| 100 | iso_pu_bacteria | 8056120720 | 8056123618 | 439 |
| 101 | iso_pu_bacteria | 2503198000 | 2503200940 | 440 |
| 102 | iso_pu_bacteria | 2508501042 | 2508697127 | 440 |
| 103 | iso_pu_bacteria | 2508501050 | 2508731299 | 440 |
| 104 | iso_pu_bacteria | 2508501122 | 2509110597 | 440 |
| 105 | iso_pu_bacteria | 2509276021 | 2509390882 | 440 |
| 106 | iso_pu_bacteria | 2509276033 | 2509441942 | 440 |
| 107 | iso_pu_bacteria | 2510065019 | 2510136131 | 440 |
| 108 | iso_pu_bacteria | 2510065057 | 2510306054 | 440 |
| 109 | iso_pu_bacteria | 2510461076 | 2510892866 | 440 |
| 110 | iso_pu_bacteria | 2510917022 | 2511135584 | 440 |
| 111 | iso_pu_bacteria | 2510917028 | 2511184947 | 440 |
| 112 | iso_pu_bacteria | 2510917030 | 2511195131 | 440 |
| 113 | iso_pu_bacteria | 2511231052 | 2511500084 | 440 |
| 114 | iso_pu_bacteria | 2511231221 | 2512036700 | 440 |
| 115 | iso_pu_bacteria | 2512047086 | 2512530307 | 440 |
| 116 | iso_pu_bacteria | 2512875016 | 2512929141 | 440 |
| 117 | iso_pu_bacteria | 2512875026 | 2512975259 | 440 |
| 118 | iso_pu_bacteria | 2513237084 | 2513568432 | 440 |
| 119 | iso_pu_bacteria | 2513237085 | 2513579469 | 440 |
| 120 | iso_pu_bacteria | 2513237086 | 2513584457 | 440 |
| 121 | iso_pu_bacteria | 2513237089 | 2513606794 | 440 |
| 122 | iso_pu_bacteria | 2513237090 | 2513611562 | 440 |
| 123 | iso_pu_bacteria | 2513237091 | 2513619603 | 440 |
| 124 | iso_pu_bacteria | 2513237092 | 2513624778 | 440 |
| 125 | iso_pu_bacteria | 2513237093 | 2513630711 | 440 |
| 126 | iso_pu_bacteria | 2513237103 | 2513711937 | 440 |
| 127 | iso_pu_bacteria | 2513237139 | 2513876258 | 440 |
| 128 | iso_pu_bacteria | 2513237140 | 2513883181 | 440 |
| 129 | iso_pu_bacteria | 2513237143 | 2513904255 | 440 |
| 130 | iso_pu_bacteria | 2513237159 | 2514001812 | 440 |
| 131 | iso_pu_bacteria | 2513237160 | 2514006996 | 440 |
| 132 | iso_pu_bacteria | 2513237161 | 2514017071 | 440 |
| 133 | iso_pu_bacteria | 2513237162 | 2514018266 | 440 |
| 134 | iso_pu_bacteria | 2513237164 | 2514035816 | 440 |
| 135 | iso_pu_bacteria | 2513237305 | 2514423386 | 440 |
| 136 | iso_pu_bacteria | 2513237351 | 2514592343 | 440 |
| 137 | iso_pu_bacteria | 2515075009 | 2515108942 | 440 |
| 138 | iso_pu_bacteria | 2515154107 | 2515613292 | 440 |
| 139 | iso_pu_bacteria | 2515154112 | 2515624310 | 440 |
| 140 | iso_pu_bacteria | 2515154113 | 2515633053 | 440 |
| 141 | iso_pu_bacteria | 2515154114 | 2515640258 | 440 |
| 142 | iso_pu_bacteria | 2515154116 | 2515656339 | 440 |
| 143 | iso_pu_bacteria | 2515154134 | 2515738477 | 440 |
| 144 | iso_pu_bacteria | 2516143018 | 2516207161 | 440 |
| 145 | iso_pu_bacteria | 2516653046 | 2516897615 | 440 |
| 146 | iso_pu_bacteria | 2516653077 | 2517040883 | 440 |
| 147 | iso_pu_bacteria | 2516653085 | 2517080514 | 440 |
| 148 | iso_pu_bacteria | 2517093000 | 2517098483 | 440 |
| 149 | iso_pu_bacteria | 2517287029 | 2517409967 | 440 |
| 150 | iso_pu_bacteria | 2517487022 | 2517566663 | 440 |
| 151 | iso_pu_bacteria | 2524023207 | 2524453369 | 440 |
| 152 | iso_pu_bacteria | 2524023209 | 2524459173 | 440 |
| 153 | iso_pu_bacteria | 2529292951 | 2530648702 | 440 |
| 154 | iso_pu_bacteria | 2537561587 | 2537877487 | 440 |
| 155 | iso_pu_bacteria | 2551306084 | 2551674840 | 440 |
| 156 | iso_pu_bacteria | 2551306085 | 2551687092 | 440 |
| 157 | iso_pu_bacteria | 2554235003 | 2554245480 | 440 |
| 158 | iso_pu_bacteria | 2554235132 | 2554817817 | 440 |
| 159 | iso_pu_bacteria | 2558860100 | 2558864946 | 440 |
| 160 | iso_pu_bacteria | 2558860242 | 2559296690 | 440 |
| 161 | iso_pu_bacteria | 2582581299 | 2585232684 | 440 |
| 162 | iso_pu_bacteria | 2582581306 | 2585268269 | 440 |
| 163 | iso_pu_bacteria | 2582581307 | 2585272659 | 440 |
| 164 | iso_pu_bacteria | 2582581308 | 2585281209 | 440 |
| 165 | iso_pu_bacteria | 2582581315 | 2585327295 | 440 |
| 166 | iso_pu_bacteria | 2582581316 | 2585334519 | 440 |
| 167 | iso_pu_bacteria | 2582581865 | 2585391165 | 440 |
| 168 | iso_pu_bacteria | 2585427526 | 2585526838 | 440 |
| 169 | iso_pu_bacteria | 2585427527 | 2585536131 | 440 |
| 170 | iso_pu_bacteria | 2585427528 | 2585542400 | 440 |
| 171 | iso_pu_bacteria | 2585427530 | 2585557616 | 440 |
| 172 | iso_pu_bacteria | 2585427531 | 2585562327 | 440 |
| 173 | iso_pu_bacteria | 2585427593 | 2585841872 | 440 |
| 174 | iso_pu_bacteria | 2585427608 | 2585896767 | 440 |
| 175 | iso_pu_bacteria | 2585427609 | 2585906506 | 440 |
| 176 | iso_pu_bacteria | 2585427633 | 2585993365 | 440 |
| 177 | iso_pu_bacteria | 2585427634 | 2586004005 | 440 |
| 178 | iso_pu_bacteria | 2585428125 | 2587981928 | 440 |
| 179 | iso_pu_bacteria | 2588253730 | 2588514384 | 440 |
| 180 | iso_pu_bacteria | 2597489875 | 2597813921 | 440 |
| 181 | iso_pu_bacteria | 2599185210 | 2599602806 | 440 |
| 182 | iso_pu_bacteria | 2599185301 | 2599940080 | 440 |
| 183 | iso_pu_bacteria | 2599185352 | 2600197381 | 440 |
| 184 | iso_pu_bacteria | 2600255279 | 2601610439 | 440 |
| 185 | iso_pu_bacteria | 2600255308 | 2601747231 | 440 |
| 186 | iso_pu_bacteria | 2606217733 | 2608380858 | 440 |
| 187 | iso_pu_bacteria | 2615840624 | 2616298025 | 440 |
| 188 | iso_pu_bacteria | 2615840626 | 2616310989 | 440 |
| 189 | iso_pu_bacteria | 2615840698 | 2616555589 | 440 |
| 190 | iso_pu_bacteria | 2617270735 | 2617353962 | 440 |
| 191 | iso_pu_bacteria | 2617270741 | 2617378920 | 440 |
| 192 | iso_pu_bacteria | 2617270742 | 2617385521 | 440 |
| 193 | iso_pu_bacteria | 2643221582 | 2643917329 | 440 |
| 194 | iso_pu_bacteria | 2643221595 | 2643984692 | 440 |
| 195 | iso_pu_bacteria | 2643221627 | 2644153017 | 440 |
| 196 | iso_pu_bacteria | 2643221693 | 2644520818 | 440 |
| 197 | iso_pu_bacteria | 2643221723 | 2644673434 | 440 |
| 198 | iso_pu_bacteria | 2657244999 | 2657685739 | 440 |
| 199 | iso_pu_bacteria | 2667528174 | 2671113169 | 440 |
| 200 | iso_pu_bacteria | 2690316117 | 2692318306 | 440 |
| 201 | iso_pu_bacteria | 2718217882 | 2719184850 | 440 |
| 202 | iso_pu_bacteria | 2718217927 | 2719389825 | 440 |
| 203 | iso_pu_bacteria | 2718217997 | 2719668850 | 440 |
| 204 | iso_pu_bacteria | 2718218009 | 2719728870 | 440 |
| 205 | iso_pu_bacteria | 2718218199 | 2720489543 | 440 |
| 206 | iso_pu_bacteria | 2718218232 | 2720610218 | 440 |
| 207 | iso_pu_bacteria | 2718218233 | 2720617642 | 440 |
| 208 | iso_pu_bacteria | 2718218235 | 2720628784 | 440 |
| 209 | iso_pu_bacteria | 2718218269 | 2720772733 | 440 |
| 210 | iso_pu_bacteria | 2718218363 | 2721144561 | 440 |
| 211 | iso_pu_bacteria | 2718218365 | 2721156053 | 440 |
| 212 | iso_pu_bacteria | 2718218366 | 2721161931 | 440 |
| 213 | iso_pu_bacteria | 2718218423 | 2721403468 | 440 |
| 214 | iso_pu_bacteria | 2721755514 | 2722843076 | 440 |
| 215 | iso_pu_bacteria | 2721755556 | 2723030173 | 440 |
| 216 | iso_pu_bacteria | 2721755684 | 2723564578 | 440 |
| 217 | iso_pu_bacteria | 2721755685 | 2723569780 | 440 |
| 218 | iso_pu_bacteria | 2721755686 | 2723575019 | 440 |
| 219 | iso_pu_bacteria | 2721755809 | 2724035044 | 440 |
| 220 | iso_pu_bacteria | 2721755810 | 2724041895 | 440 |
| 221 | iso_pu_bacteria | 2721755819 | 2724092762 | 440 |
| 222 | iso_pu_bacteria | 2721755822 | 2724101327 | 440 |
| 223 | iso_pu_bacteria | 2721755823 | 2724113149 | 440 |
| 224 | iso_pu_bacteria | 2724679232 | 2725949400 | 440 |
| 225 | iso_pu_bacteria | 2728369352 | 2730110706 | 440 |
| 226 | iso_pu_bacteria | 2728369365 | 2730160965 | 440 |
| 227 | iso_pu_bacteria | 2728369397 | 2730295586 | 440 |
| 228 | iso_pu_bacteria | 2738541333 | 2739038466 | 440 |
| 229 | iso_pu_bacteria | 2751185800 | 2753357764 | 440 |
| 230 | iso_pu_bacteria | 2751185821 | 2753462802 | 440 |
| 231 | iso_pu_bacteria | 2758568016 | 2758638030 | 440 |
| 232 | iso_pu_bacteria | 2765235802 | 2765468807 | 440 |
| 233 | iso_pu_bacteria | 2765235942 | 2766068870 | 440 |
| 234 | iso_pu_bacteria | 2767802442 | 2770198471 | 440 |
| 235 | iso_pu_bacteria | 2773857925 | 2774873147 | 440 |
| 236 | iso_pu_bacteria | 2775507049 | 2776910705 | 440 |
| 237 | iso_pu_bacteria | 2775507266 | 2778174844 | 440 |
| 238 | iso_pu_bacteria | 2791355082 | 2792583722 | 440 |
| 239 | iso_pu_bacteria | 2791355091 | 2792619363 | 440 |
| 240 | iso_pu_bacteria | 2791355092 | 2792627135 | 440 |
| 241 | iso_pu_bacteria | 2791355094 | 2792640931 | 440 |
| 242 | iso_pu_bacteria | 2791355123 | 2792752212 | 440 |
| 243 | iso_pu_bacteria | 2791355256 | 2793299129 | 440 |
| 244 | iso_pu_bacteria | 2791355259 | 2793312722 | 440 |
| 245 | iso_pu_bacteria | 2791355260 | 2793324244 | 440 |
| 246 | iso_pu_bacteria | 2791355261 | 2793329904 | 440 |
| 247 | iso_pu_bacteria | 2791355262 | 2793333871 | 440 |
| 248 | iso_pu_bacteria | 2791355263 | 2793340789 | 440 |
| 249 | iso_pu_bacteria | 2791355264 | 2793345739 | 440 |
| 250 | iso_pu_bacteria | 2791355266 | 2793361865 | 440 |
| 251 | iso_pu_bacteria | 2791355267 | 2793367418 | 440 |
| 252 | iso_pu_bacteria | 2802428858 | 2802720137 | 440 |
| 253 | iso_pu_bacteria | 2802428859 | 2802723824 | 440 |
| 254 | iso_pu_bacteria | 2802428860 | 2802734149 | 440 |
| 255 | iso_pu_bacteria | 2802428861 | 2802739611 | 440 |
| 256 | iso_pu_bacteria | 2802428862 | 2802746003 | 440 |
| 257 | iso_pu_bacteria | 2802428863 | 2802753402 | 440 |
| 258 | iso_pu_bacteria | 2802429268 | 2804754997 | 440 |
| 259 | iso_pu_bacteria | 2802429606 | 2805935169 | 440 |
| 260 | iso_pu_bacteria | 2802429633 | 2806048809 | 440 |
| 261 | iso_pu_bacteria | 2802429634 | 2806056012 | 440 |
| 262 | iso_pu_bacteria | 2802429635 | 2806062841 | 440 |
| 263 | iso_pu_bacteria | 2802429636 | 2806070263 | 440 |
| 264 | iso_pu_bacteria | 2802429637 | 2806077249 | 440 |
| 265 | iso_pu_bacteria | 2808606387 | 2808987143 | 440 |
| 266 | iso_pu_bacteria | 2818991439 | 2819557519 | 440 |
| 267 | iso_pu_bacteria | 2818991448 | 2819613183 | 440 |
| 268 | iso_pu_bacteria | 2818991453 | 2819641745 | 440 |
| 269 | iso_pu_bacteria | 2818991461 | 2819683579 | 440 |
| 270 | iso_pu_bacteria | 2824679649 | 2824681602 | 440 |
| 271 | iso_pu_bacteria | 2838016132 | 2838020495 | 440 |
| 272 | iso_pu_bacteria | 2838029111 | 2838031685 | 440 |
| 273 | iso_pu_bacteria | 2838048938 | 2838049936 | 440 |
| 274 | iso_pu_bacteria | 2838061910 | 2838062204 | 440 |
| 275 | iso_pu_bacteria | 2838068647 | 2838069438 | 440 |
| 276 | iso_pu_bacteria | 2838074704 | 2838078636 | 440 |
| 277 | iso_pu_bacteria | 2838675328 | 2838677968 | 440 |
| 278 | iso_pu_bacteria | 2838680041 | 2838686166 | 440 |
| 279 | iso_pu_bacteria | 2838686498 | 2838690474 | 440 |
| 280 | iso_pu_bacteria | 2838694306 | 2838700463 | 440 |
| 281 | iso_pu_bacteria | 2838707686 | 2838713742 | 440 |
| 282 | iso_pu_bacteria | 2838714209 | 2838717126 | 440 |
| 283 | iso_pu_bacteria | 2838719591 | 2838722263 | 440 |
| 284 | iso_pu_bacteria | 2838724970 | 2838727875 | 440 |
| 285 | iso_pu_bacteria | 2838729681 | 2838733169 | 440 |
| 286 | iso_pu_bacteria | 2838742623 | 2838747242 | 440 |
| 287 | iso_pu_bacteria | 2840764183 | 2840770218 | 440 |
| 288 | iso_pu_bacteria | 2840878972 | 2840882554 | 440 |
| 289 | iso_pu_bacteria | 2841846520 | 2841849533 | 440 |
| 290 | iso_pu_bacteria | 2841851746 | 2841855395 | 440 |
| 291 | iso_pu_bacteria | 2841859092 | 2841861427 | 440 |
| 292 | iso_pu_bacteria | 2841864319 | 2841865785 | 440 |
| 293 | iso_pu_bacteria | 2841941048 | 2841946245 | 440 |
| 294 | iso_pu_bacteria | 2841949485 | 2841952271 | 440 |
| 295 | iso_pu_bacteria | 2841974524 | 2841982754 | 440 |
| 296 | iso_pu_bacteria | 2842077413 | 2842083105 | 440 |
| 297 | iso_pu_bacteria | 2842110456 | 2842116975 | 440 |
| 298 | iso_pu_bacteria | 2842118031 | 2842124087 | 440 |
| 299 | iso_pu_bacteria | 2842124991 | 2842127719 | 440 |
| 300 | iso_pu_bacteria | 2842130223 | 2842132861 | 440 |
| 301 | iso_pu_bacteria | 2842152218 | 2842154854 | 440 |
| 302 | iso_pu_bacteria | 2842156927 | 2842160898 | 440 |
| 303 | iso_pu_bacteria | 2842163707 | 2842164427 | 440 |
| 304 | iso_pu_bacteria | 2842170452 | 2842173353 | 440 |
| 305 | iso_pu_bacteria | 2842175837 | 2842178475 | 440 |
| 306 | iso_pu_bacteria | 2842180545 | 2842184514 | 440 |
| 307 | iso_pu_bacteria | 2842187318 | 2842190234 | 440 |
| 308 | iso_pu_bacteria | 2842211629 | 2842214548 | 440 |
| 309 | iso_pu_bacteria | 2842217011 | 2842219660 | 440 |
| 310 | iso_pu_bacteria | 2842224351 | 2842227267 | 440 |
| 311 | iso_pu_bacteria | 2842229732 | 2842232097 | 440 |
| 312 | iso_pu_bacteria | 2842237096 | 2842243155 | 440 |
| 313 | iso_pu_bacteria | 2842243621 | 2842248501 | 440 |
| 314 | iso_pu_bacteria | 2842257432 | 2842262691 | 440 |
| 315 | iso_pu_bacteria | 2842264693 | 2842264815 | 440 |
| 316 | iso_pu_bacteria | 2842271015 | 2842275212 | 440 |
| 317 | iso_pu_bacteria | 2842291075 | 2842297364 | 440 |
| 318 | iso_pu_bacteria | 2842298080 | 2842300960 | 440 |
| 319 | iso_pu_bacteria | 2842304105 | 2842307352 | 440 |
| 320 | iso_pu_bacteria | 2842341865 | 2842345763 | 440 |
| 321 | iso_pu_bacteria | 2842357229 | 2842360024 | 440 |
| 322 | iso_pu_bacteria | 2842363717 | 2842364031 | 440 |
| 323 | iso_pu_bacteria | 2842370503 | 2842376215 | 440 |
| 324 | iso_pu_bacteria | 2842377471 | 2842383758 | 440 |
| 325 | iso_pu_bacteria | 2842384541 | 2842390897 | 440 |
| 326 | iso_pu_bacteria | 2842402390 | 2842405945 | 440 |
| 327 | iso_pu_bacteria | 2842409023 | 2842412529 | 440 |
| 328 | iso_pu_bacteria | 2842415677 | 2842419173 | 440 |
| 329 | iso_pu_bacteria | 2842422224 | 2842422629 | 440 |
| 330 | iso_pu_bacteria | 2842428310 | 2842429132 | 440 |
| 331 | iso_pu_bacteria | 2842434925 | 2842435745 | 440 |
| 332 | iso_pu_bacteria | 2842441272 | 2842441393 | 440 |
| 333 | iso_pu_bacteria | 2842447887 | 2842449790 | 440 |
| 334 | iso_pu_bacteria | 2842462802 | 2842463558 | 440 |
| 335 | iso_pu_bacteria | 2842469257 | 2842470075 | 440 |
| 336 | iso_pu_bacteria | 2842475841 | 2842478417 | 440 |
| 337 | iso_pu_bacteria | 2842502639 | 2842505637 | 440 |
| 338 | iso_pu_bacteria | 2842509118 | 2842513861 | 440 |
| 339 | iso_pu_bacteria | 2842515876 | 2842518306 | 440 |
| 340 | iso_pu_bacteria | 2842521101 | 2842527322 | 440 |
| 341 | iso_pu_bacteria | 2844002411 | 2844004716 | 440 |
| 342 | iso_pu_bacteria | 2844454524 | 2844460130 | 440 |
| 343 | iso_pu_bacteria | 2847417321 | 2847423190 | 440 |
| 344 | iso_pu_bacteria | 2847670302 | 2847674871 | 440 |
| 345 | iso_pu_bacteria | 2848992105 | 2848997414 | 440 |
| 346 | iso_pu_bacteria | 2850079185 | 2850084669 | 440 |
| 347 | iso_pu_bacteria | 2852387548 | 2852394165 | 440 |
| 348 | iso_pu_bacteria | 2854916844 | 2854922459 | 440 |
| 349 | iso_pu_bacteria | 2855825444 | 2855830471 | 440 |
| 350 | iso_pu_bacteria | 2855839649 | 2855845757 | 440 |
| 351 | iso_pu_bacteria | 2855872281 | 2855874179 | 440 |
| 352 | iso_pu_bacteria | 2856314179 | 2856317245 | 440 |
| 353 | iso_pu_bacteria | 2856342000 | 2856344135 | 440 |
| 354 | iso_pu_bacteria | 2856349417 | 2856353638 | 440 |
| 355 | iso_pu_bacteria | 2856364286 | 2856366199 | 440 |
| 356 | iso_pu_bacteria | 2857349434 | 2857350039 | 440 |
| 357 | iso_pu_bacteria | 2857349434 | 2857354406 | 440 |
| 358 | iso_pu_bacteria | 2857516855 | 2857517696 | 440 |
| 359 | iso_pu_bacteria | 2858800743 | 2858805149 | 440 |
| 360 | iso_pu_bacteria | 2869162929 | 2869163894 | 440 |
| 361 | iso_pu_bacteria | 2869256925 | 2869257483 | 440 |
| 362 | iso_pu_bacteria | 2869285874 | 2869287233 | 440 |
| 363 | iso_pu_bacteria | 2871429161 | 2871430533 | 440 |
| 364 | iso_pu_bacteria | 2871488783 | 2871489473 | 440 |
| 365 | iso_pu_bacteria | 2871495908 | 2871496301 | 440 |
| 366 | iso_pu_bacteria | 2874102143 | 2874103466 | 440 |
| 367 | iso_pu_bacteria | 2874123672 | 2874128221 | 440 |
| 368 | iso_pu_bacteria | 2874146452 | 2874149190 | 440 |
| 369 | iso_pu_bacteria | 2874155637 | 2874156025 | 440 |
| 370 | iso_pu_bacteria | 2874168670 | 2874170187 | 440 |
| 371 | iso_pu_bacteria | 2874590934 | 2874595402 | 440 |
| 372 | iso_pu_bacteria | 2874645413 | 2874651828 | 440 |
| 373 | iso_pu_bacteria | 2876363079 | 2876367301 | 440 |
| 374 | iso_pu_bacteria | 2876369609 | 2876373607 | 440 |
| 375 | iso_pu_bacteria | 2876392853 | 2876393653 | 440 |
| 376 | iso_pu_bacteria | 2876413966 | 2876415387 | 440 |
| 377 | iso_pu_bacteria | 2876771140 | 2876775596 | 440 |
| 378 | iso_pu_bacteria | 2876818435 | 2876823588 | 440 |
| 379 | iso_pu_bacteria | 2878035449 | 2878038283 | 440 |
| 380 | iso_pu_bacteria | 2878738818 | 2878742314 | 440 |
| 381 | iso_pu_bacteria | 2878745973 | 2878746965 | 440 |
| 382 | iso_pu_bacteria | 2878753008 | 2878754122 | 440 |
| 383 | iso_pu_bacteria | 2878760144 | 2878760530 | 440 |
| 384 | iso_pu_bacteria | 2878767105 | 2878767493 | 440 |
| 385 | iso_pu_bacteria | 2879074833 | 2879079687 | 440 |
| 386 | iso_pu_bacteria | 2879127579 | 2879133909 | 440 |
| 387 | iso_pu_bacteria | 2879142872 | 2879145042 | 440 |
| 388 | iso_pu_bacteria | 2881147464 | 2881151121 | 440 |
| 389 | iso_pu_bacteria | 2881155292 | 2881161511 | 440 |
| 390 | iso_pu_bacteria | 2881161766 | 2881163414 | 440 |
| 391 | iso_pu_bacteria | 2881665667 | 2881668843 | 440 |
| 392 | iso_pu_bacteria | 2881845957 | 2881849006 | 440 |
| 393 | iso_pu_bacteria | 2881861095 | 2881868083 | 440 |
| 394 | iso_pu_bacteria | 2882456835 | 2882463174 | 440 |
| 395 | iso_pu_bacteria | 2882632389 | 2882637520 | 440 |
| 396 | iso_pu_bacteria | 2882912400 | 2882919046 | 440 |
| 397 | iso_pu_bacteria | 2885305155 | 2885305845 | 440 |
| 398 | iso_pu_bacteria | 2885318864 | 2885324123 | 440 |
| 399 | iso_pu_bacteria | 2885326080 | 2885327741 | 440 |
| 400 | iso_pu_bacteria | 2885334103 | 2885340061 | 440 |
| 401 | iso_pu_bacteria | 2885342637 | 2885350136 | 440 |
| 402 | iso_pu_bacteria | 2885350715 | 2885353215 | 440 |
| 403 | iso_pu_bacteria | 2885366525 | 2885367994 | 440 |
| 404 | iso_pu_bacteria | 2885409591 | 2885416464 | 440 |
| 405 | iso_pu_bacteria | 2888337043 | 2888338835 | 440 |
| 406 | iso_pu_bacteria | 2888343758 | 2888347647 | 440 |
| 407 | iso_pu_bacteria | 2888350351 | 2888352437 | 440 |
| 408 | iso_pu_bacteria | 2889016732 | 2889020772 | 440 |
| 409 | iso_pu_bacteria | 2889033259 | 2889034635 | 440 |
| 410 | iso_pu_bacteria | 2896384573 | 2896387521 | 440 |
| 411 | iso_pu_bacteria | 2899792073 | 2899796470 | 440 |
| 412 | iso_pu_bacteria | 2899845264 | 2899849998 | 440 |
| 413 | iso_pu_bacteria | 2903448605 | 2903453229 | 440 |
| 414 | iso_pu_bacteria | 2903492973 | 2903494575 | 440 |
| 415 | iso_pu_bacteria | 2903492973 | 2903500518 | 440 |
| 416 | iso_pu_bacteria | 2903521522 | 2903526792 | 440 |
| 417 | iso_pu_bacteria | 2903528002 | 2903530589 | 440 |
| 418 | iso_pu_bacteria | 2903540706 | 2903541095 | 440 |
| 419 | iso_pu_bacteria | 2904659560 | 2904660161 | 440 |
| 420 | iso_pu_bacteria | 2906308376 | 2906309779 | 440 |
| 421 | iso_pu_bacteria | 2906321335 | 2906322414 | 440 |
| 422 | iso_pu_bacteria | 2906328253 | 2906331868 | 440 |
| 423 | iso_pu_bacteria | 2906414383 | 2906417307 | 440 |
| 424 | iso_pu_bacteria | 2906626472 | 2906629032 | 440 |
| 425 | iso_pu_bacteria | 2906643746 | 2906646436 | 440 |
| 426 | iso_pu_bacteria | 2913295892 | 2913297014 | 440 |
| 427 | iso_pu_bacteria | 2915980308 | 2915984318 | 440 |
| 428 | iso_pu_bacteria | 2915986958 | 2915987020 | 440 |
| 429 | iso_pu_bacteria | 2915993759 | 2915999437 | 440 |
| 430 | iso_pu_bacteria | 2916000859 | 2916004071 | 440 |
| 431 | iso_pu_bacteria | 2916007675 | 2916012468 | 440 |
| 432 | iso_pu_bacteria | 2916014648 | 2916014704 | 440 |
| 433 | iso_pu_bacteria | 2916021584 | 2916026929 | 440 |
| 434 | iso_pu_bacteria | 2916028427 | 2916034040 | 440 |
| 435 | iso_pu_bacteria | 2916035215 | 2916038597 | 440 |
| 436 | iso_pu_bacteria | 2916041962 | 2916046326 | 440 |
| 437 | iso_pu_bacteria | 2916048683 | 2916050825 | 440 |
| 438 | iso_pu_bacteria | 2916055098 | 2916060592 | 440 |
| 439 | iso_pu_bacteria | 2916061851 | 2916066637 | 440 |
| 440 | iso_pu_bacteria | 2916068649 | 2916071650 | 440 |
| 441 | iso_pu_bacteria | 2916076590 | 2916079557 | 440 |
| 442 | iso_pu_bacteria | 2919114240 | 2919117384 | 440 |
| 443 | iso_pu_bacteria | 2919171160 | 2919176256 | 440 |
| 444 | iso_pu_bacteria | 2919408235 | 2919412937 | 440 |
| 445 | iso_pu_bacteria | 2920760137 | 2920763331 | 440 |
| 446 | iso_pu_bacteria | 2920822456 | 2920827226 | 440 |
| 447 | iso_pu_bacteria | 2921201388 | 2921205387 | 440 |
| 448 | iso_pu_bacteria | 2921208531 | 2921210709 | 440 |
| 449 | iso_pu_bacteria | 2921237296 | 2921240627 | 440 |
| 450 | iso_pu_bacteria | 2921244191 | 2921249603 | 440 |
| 451 | iso_pu_bacteria | 2921250672 | 2921254274 | 440 |
| 452 | iso_pu_bacteria | 2921257292 | 2921261697 | 440 |
| 453 | iso_pu_bacteria | 2921263974 | 2921269608 | 440 |
| 454 | iso_pu_bacteria | 2921282425 | 2921285052 | 440 |
| 455 | iso_pu_bacteria | 2921289301 | 2921294220 | 440 |
| 456 | iso_pu_bacteria | 2921296804 | 2921299008 | 440 |
| 457 | iso_pu_bacteria | 2922130491 | 2922138177 | 440 |
| 458 | iso_pu_bacteria | 2922158528 | 2922163056 | 440 |
| 459 | iso_pu_bacteria | 2922185730 | 2922189176 | 440 |
| 460 | iso_pu_bacteria | 2922393267 | 2922400154 | 440 |
| 461 | iso_pu_bacteria | 2924144063 | 2924144379 | 440 |
| 462 | iso_pu_bacteria | 2924150972 | 2924151613 | 440 |
| 463 | iso_pu_bacteria | 2924158325 | 2924159489 | 440 |
| 464 | iso_pu_bacteria | 2924165586 | 2924172618 | 440 |
| 465 | iso_pu_bacteria | 2924172951 | 2924178730 | 440 |
| 466 | iso_pu_bacteria | 2924179722 | 2924185771 | 440 |
| 467 | iso_pu_bacteria | 2924193448 | 2924196070 | 440 |
| 468 | iso_pu_bacteria | 2924200457 | 2924201328 | 440 |
| 469 | iso_pu_bacteria | 2924207177 | 2924210160 | 440 |
| 470 | iso_pu_bacteria | 2924214083 | 2924218921 | 440 |
| 471 | iso_pu_bacteria | 2924221636 | 2924227617 | 440 |
| 472 | iso_pu_bacteria | 2924228884 | 2924230877 | 440 |
| 473 | iso_pu_bacteria | 2924710171 | 2924712830 | 440 |
| 474 | iso_pu_bacteria | 2924726620 | 2924729552 | 440 |
| 475 | iso_pu_bacteria | 2924733363 | 2924737401 | 440 |
| 476 | iso_pu_bacteria | 2924754689 | 2924761777 | 440 |
| 477 | iso_pu_bacteria | 2924762789 | 2924769108 | 440 |
| 478 | iso_pu_bacteria | 2924776078 | 2924780114 | 440 |
| 479 | iso_pu_bacteria | 2924784321 | 2924788800 | 440 |
| 480 | iso_pu_bacteria | 2926754445 | 2926758831 | 440 |
| 481 | iso_pu_bacteria | 2926760298 | 2926763644 | 440 |
| 482 | iso_pu_bacteria | 2933006813 | 2933009764 | 440 |
| 483 | iso_pu_bacteria | 2933011516 | 2933013935 | 440 |
| 484 | iso_pu_bacteria | 2933570622 | 2933573992 | 440 |
| 485 | iso_pu_bacteria | 2933586486 | 2933593275 | 440 |
| 486 | iso_pu_bacteria | 2933594066 | 2933595745 | 440 |
| 487 | iso_pu_bacteria | 2933599457 | 2933600101 | 440 |
| 488 | iso_pu_bacteria | 2935894831 | 2935900780 | 440 |
| 489 | iso_pu_bacteria | 2935901341 | 2935906112 | 440 |
| 490 | iso_pu_bacteria | 2935975950 | 2935983010 | 440 |
| 491 | iso_pu_bacteria | 2935984226 | 2935988092 | 440 |
| 492 | iso_pu_bacteria | 2936367885 | 2936374683 | 440 |
| 493 | iso_pu_bacteria | 2936375103 | 2936375883 | 440 |
| 494 | iso_pu_bacteria | 2936381700 | 2936382415 | 440 |
| 495 | iso_pu_bacteria | 2937002841 | 2937005415 | 440 |
| 496 | iso_pu_bacteria | 2937009748 | 2937013000 | 440 |
| 497 | iso_pu_bacteria | 2937016420 | 2937018022 | 440 |
| 498 | iso_pu_bacteria | 2937023124 | 2937029536 | 440 |
| 499 | iso_pu_bacteria | 2937029754 | 2937033952 | 440 |
| 500 | iso_pu_bacteria | 2937036028 | 2937037251 | 440 |
| 501 | iso_pu_bacteria | 2937042894 | 2937043398 | 440 |
| 502 | iso_pu_bacteria | 2937049772 | 2937051951 | 440 |
| 503 | iso_pu_bacteria | 2937063883 | 2937066249 | 440 |
| 504 | iso_pu_bacteria | 2937071275 | 2937077054 | 440 |
| 505 | iso_pu_bacteria | 2937078374 | 2937080488 | 440 |
| 506 | iso_pu_bacteria | 2937084907 | 2937091509 | 440 |
| 507 | iso_pu_bacteria | 2937091812 | 2937096443 | 440 |
| 508 | iso_pu_bacteria | 2937098957 | 2937105700 | 440 |
| 509 | iso_pu_bacteria | 2937106411 | 2937110939 | 440 |
| 510 | iso_pu_bacteria | 2937113482 | 2937116806 | 440 |
| 511 | iso_pu_bacteria | 2937119839 | 2937125029 | 440 |
| 512 | iso_pu_bacteria | 2937126314 | 2937132860 | 440 |
| 513 | iso_pu_bacteria | 2937813078 | 2937814924 | 440 |
| 514 | iso_pu_bacteria | 2937848649 | 2937848802 | 440 |
| 515 | iso_pu_bacteria | 2937877337 | 2937882634 | 440 |
| 516 | iso_pu_bacteria | 2937891427 | 2937891539 | 440 |
| 517 | iso_pu_bacteria | 2937994558 | 2937994948 | 440 |
| 518 | iso_pu_bacteria | 2941499720 | 2941505433 | 440 |
| 519 | iso_pu_bacteria | 2957375807 | 2957379797 | 440 |
| 520 | iso_pu_bacteria | 2957382221 | 2957385597 | 440 |
| 521 | iso_pu_bacteria | 2957388812 | 2957390216 | 440 |
| 522 | iso_pu_bacteria | 2957395598 | 2957398852 | 440 |
| 523 | iso_pu_bacteria | 2957402308 | 2957405756 | 440 |
| 524 | iso_pu_bacteria | 2957408893 | 2957412877 | 440 |
| 525 | iso_pu_bacteria | 2957415311 | 2957420486 | 440 |
| 526 | iso_pu_bacteria | 2957422303 | 2957426825 | 440 |
| 527 | iso_pu_bacteria | 2957430029 | 2957430298 | 440 |
| 528 | iso_pu_bacteria | 2957437181 | 2957442729 | 440 |
| 529 | iso_pu_bacteria | 2957450854 | 2957453808 | 440 |
| 530 | iso_pu_bacteria | 2957457609 | 2957459975 | 440 |
| 531 | iso_pu_bacteria | 2957464669 | 2957464996 | 440 |
| 532 | iso_pu_bacteria | 2957471148 | 2957475224 | 440 |
| 533 | iso_pu_bacteria | 2957478035 | 2957483530 | 440 |
| 534 | iso_pu_bacteria | 2957484790 | 2957486866 | 440 |
| 535 | iso_pu_bacteria | 2957491536 | 2957492908 | 440 |
| 536 | iso_pu_bacteria | 2957498199 | 2957500200 | 440 |
| 537 | iso_pu_bacteria | 2957505466 | 2957506059 | 440 |
| 538 | iso_pu_bacteria | 2958041894 | 2958043392 | 440 |
| 539 | iso_pu_bacteria | 2958064165 | 2958064855 | 440 |
| 540 | iso_pu_bacteria | 2958084443 | 2958089759 | 440 |
| 541 | iso_pu_bacteria | 2958092219 | 2958100446 | 440 |
| 542 | iso_pu_bacteria | 2958115193 | 2958121517 | 440 |
| 543 | iso_pu_bacteria | 2958130278 | 2958131733 | 440 |
| 544 | iso_pu_bacteria | 2958144490 | 2958145578 | 440 |
| 545 | iso_pu_bacteria | 2958165035 | 2958165428 | 440 |
| 546 | iso_pu_bacteria | 2958179912 | 2958180793 | 440 |
| 547 | iso_pu_bacteria | 2960584000 | 2960585366 | 440 |
| 548 | iso_pu_bacteria | 2960591022 | 2960591738 | 440 |
| 549 | iso_pu_bacteria | 2960597568 | 2960601440 | 440 |
| 550 | iso_pu_bacteria | 2960603979 | 2960608269 | 440 |
| 551 | iso_pu_bacteria | 2960610863 | 2960615940 | 440 |
| 552 | iso_pu_bacteria | 2960624210 | 2960630158 | 440 |
| 553 | iso_pu_bacteria | 2960631154 | 2960637792 | 440 |
| 554 | iso_pu_bacteria | 2960637947 | 2960641159 | 440 |
| 555 | iso_pu_bacteria | 2960645483 | 2960652617 | 440 |
| 556 | iso_pu_bacteria | 2960652885 | 2960658452 | 440 |
| 557 | iso_pu_bacteria | 2960667422 | 2960668919 | 440 |
| 558 | iso_pu_bacteria | 2960680706 | 2960685172 | 440 |
| 559 | iso_pu_bacteria | 2960687367 | 2960691025 | 440 |
| 560 | iso_pu_bacteria | 2960693952 | 2960700900 | 440 |
| 561 | iso_pu_bacteria | 2961077736 | 2961078631 | 440 |
| 562 | iso_pu_bacteria | 2961114664 | 2961115486 | 440 |
| 563 | iso_pu_bacteria | 2961127735 | 2961129806 | 440 |
| 564 | iso_pu_bacteria | 2961163497 | 2961163886 | 440 |
| 565 | iso_pu_bacteria | 2961170736 | 2961171754 | 440 |
| 566 | iso_pu_bacteria | 2963644680 | 2963650094 | 440 |
| 567 | iso_pu_bacteria | 2964615318 | 2964619239 | 440 |
| 568 | iso_pu_bacteria | 2964621998 | 2964624587 | 440 |
| 569 | iso_pu_bacteria | 2964628898 | 2964634167 | 440 |
| 570 | iso_pu_bacteria | 2964643177 | 2964649769 | 440 |
| 571 | iso_pu_bacteria | 2964649959 | 2964655629 | 440 |
| 572 | iso_pu_bacteria | 2964656573 | 2964658343 | 440 |
| 573 | iso_pu_bacteria | 2964663802 | 2964666744 | 440 |
| 574 | iso_pu_bacteria | 2964670856 | 2964672956 | 440 |
| 575 | iso_pu_bacteria | 2964678106 | 2964678902 | 440 |
| 576 | iso_pu_bacteria | 2964685014 | 2964690223 | 440 |
| 577 | iso_pu_bacteria | 2964691889 | 2964695378 | 440 |
| 578 | iso_pu_bacteria | 2964698721 | 2964701842 | 440 |
| 579 | iso_pu_bacteria | 2964705432 | 2964708431 | 440 |
| 580 | iso_pu_bacteria | 2964712639 | 2964715924 | 440 |
| 581 | iso_pu_bacteria | 2964719344 | 2964725585 | 440 |
| 582 | iso_pu_bacteria | 2965018300 | 2965018691 | 440 |
| 583 | iso_pu_bacteria | 2965032056 | 2965033482 | 440 |
| 584 | iso_pu_bacteria | 2965062239 | 2965069599 | 440 |
| 585 | iso_pu_bacteria | 2965119406 | 2965126612 | 440 |
| 586 | iso_pu_bacteria | 2967664464 | 2967670130 | 440 |
| 587 | iso_pu_bacteria | 2967671571 | 2967675018 | 440 |
| 588 | iso_pu_bacteria | 2967678726 | 2967685509 | 440 |
| 589 | iso_pu_bacteria | 2967686174 | 2967690717 | 440 |
| 590 | iso_pu_bacteria | 2967693043 | 2967694124 | 440 |
| 591 | iso_pu_bacteria | 2967699805 | 2967702777 | 440 |
| 592 | iso_pu_bacteria | 2967706974 | 2967709662 | 440 |
| 593 | iso_pu_bacteria | 2967714385 | 2967715922 | 440 |
| 594 | iso_pu_bacteria | 2967721400 | 2967722778 | 440 |
| 595 | iso_pu_bacteria | 2967728569 | 2967728668 | 440 |
| 596 | iso_pu_bacteria | 2967735183 | 2967739739 | 440 |
| 597 | iso_pu_bacteria | 2967742019 | 2967744235 | 440 |
| 598 | iso_pu_bacteria | 2967748971 | 2967750245 | 440 |
| 599 | iso_pu_bacteria | 2967755722 | 2967760386 | 440 |
| 600 | iso_pu_bacteria | 2967762386 | 2967764761 | 440 |
| 601 | iso_pu_bacteria | 2967769361 | 2967770066 | 440 |
| 602 | iso_pu_bacteria | 2967775926 | 2967781907 | 440 |
| 603 | iso_pu_bacteria | 2967996073 | 2967996541 | 440 |
| 604 | iso_pu_bacteria | 2968003550 | 2968010248 | 440 |
| 605 | iso_pu_bacteria | 2968083720 | 2968086595 | 440 |
| 606 | iso_pu_bacteria | 2968091066 | 2968095338 | 440 |
| 607 | iso_pu_bacteria | 2968097103 | 2968103086 | 440 |
| 608 | iso_pu_bacteria | 2968110612 | 2968111217 | 440 |
| 609 | iso_pu_bacteria | 2968117919 | 2968118894 | 440 |
| 610 | iso_pu_bacteria | 2968128360 | 2968128545 | 440 |
| 611 | iso_pu_bacteria | 2968171901 | 2968172292 | 440 |
| 612 | iso_pu_bacteria | 2970019648 | 2970025208 | 440 |
| 613 | iso_pu_bacteria | 2970026789 | 2970033067 | 440 |
| 614 | iso_pu_bacteria | 2970033650 | 2970035863 | 440 |
| 615 | iso_pu_bacteria | 2970040964 | 2970043236 | 440 |
| 616 | iso_pu_bacteria | 2970047711 | 2970050321 | 440 |
| 617 | iso_pu_bacteria | 2970054988 | 2970060717 | 440 |
| 618 | iso_pu_bacteria | 2970061556 | 2970063004 | 440 |
| 619 | iso_pu_bacteria | 2970068827 | 2970072410 | 440 |
| 620 | iso_pu_bacteria | 2970076120 | 2970077775 | 440 |
| 621 | iso_pu_bacteria | 2970088815 | 2970095079 | 440 |
| 622 | iso_pu_bacteria | 2970095765 | 2970099563 | 440 |
| 623 | iso_pu_bacteria | 2970102677 | 2970109066 | 440 |
| 624 | iso_pu_bacteria | 2970109326 | 2970113992 | 440 |
| 625 | iso_pu_bacteria | 2970116247 | 2970119854 | 440 |
| 626 | iso_pu_bacteria | 2970122695 | 2970129080 | 440 |
| 627 | iso_pu_bacteria | 2970129317 | 2970130759 | 440 |
| 628 | iso_pu_bacteria | 2970136068 | 2970139253 | 440 |
| 629 | iso_pu_bacteria | 2970143518 | 2970147212 | 440 |
| 630 | iso_pu_bacteria | 2970149975 | 2970152704 | 440 |
| 631 | iso_pu_bacteria | 2970156795 | 2970161249 | 440 |
| 632 | iso_pu_bacteria | 2970164137 | 2970165150 | 440 |
| 633 | iso_pu_bacteria | 2970170962 | 2970176300 | 440 |
| 634 | iso_pu_bacteria | 2970184632 | 2970184721 | 440 |
| 635 | iso_pu_bacteria | 2970191845 | 2970194055 | 440 |
| 636 | iso_pu_bacteria | 2970503327 | 2970504350 | 440 |
| 637 | iso_pu_bacteria | 2970524798 | 2970530276 | 440 |
| 638 | iso_pu_bacteria | 2970540015 | 2970547793 | 440 |
| 639 | iso_pu_bacteria | 2970554993 | 2970555382 | 440 |
| 640 | iso_pu_bacteria | 2977516862 | 2977519925 | 440 |
| 641 | iso_pu_bacteria | 2977523885 | 2977525249 | 440 |
| 642 | iso_pu_bacteria | 2977530762 | 2977536923 | 440 |
| 643 | iso_pu_bacteria | 2977537788 | 2977539336 | 440 |
| 644 | iso_pu_bacteria | 2977544691 | 2977546576 | 440 |
| 645 | iso_pu_bacteria | 2977551784 | 2977558702 | 440 |
| 646 | iso_pu_bacteria | 2977558990 | 2977564279 | 440 |
| 647 | iso_pu_bacteria | 2977565890 | 2977568651 | 440 |
| 648 | iso_pu_bacteria | 2977572785 | 2977575064 | 440 |
| 649 | iso_pu_bacteria | 2977579622 | 2977580664 | 440 |
| 650 | iso_pu_bacteria | 2977821940 | 2977823337 | 440 |
| 651 | iso_pu_bacteria | 2977828996 | 2977831310 | 440 |
| 652 | iso_pu_bacteria | 2977843712 | 2977845616 | 440 |
| 653 | iso_pu_bacteria | 2977858184 | 2977864090 | 440 |
| 654 | iso_pu_bacteria | 2977864932 | 2977866033 | 440 |
| 655 | iso_pu_bacteria | 2977872689 | 2977880162 | 440 |
| 656 | iso_pu_bacteria | 2977898635 | 2977899518 | 440 |
| 657 | iso_pu_bacteria | 2977922695 | 2977928381 | 440 |
| 658 | iso_pu_bacteria | 2977957713 | 2977962517 | 440 |
| 659 | iso_pu_bacteria | 2977971508 | 2977973239 | 440 |
| 660 | iso_pu_bacteria | 2977986579 | 2977987710 | 440 |
| 661 | iso_pu_bacteria | 2979089926 | 2979091316 | 440 |
| 662 | iso_pu_bacteria | 2979095461 | 2979096840 | 440 |
| 663 | iso_pu_bacteria | 2979100975 | 2979102560 | 440 |
| 664 | iso_pu_bacteria | 2979742915 | 2979747980 | 440 |
| 665 | iso_pu_bacteria | 2979779861 | 2979784863 | 440 |
| 666 | iso_pu_bacteria | 2979793036 | 2979793850 | 440 |
| 667 | iso_pu_bacteria | 2979808191 | 2979808987 | 440 |
| 668 | iso_pu_bacteria | 2984509177 | 2984509555 | 440 |
| 669 | iso_pu_bacteria | 2984518228 | 2984519747 | 440 |
| 670 | iso_pu_bacteria | 2984537506 | 2984537890 | 440 |
| 671 | iso_pu_bacteria | 2984601300 | 2984604635 | 440 |
| 672 | iso_pu_bacteria | 2987636660 | 2987637138 | 440 |
| 673 | iso_pu_bacteria | 2987636660 | 2987642185 | 440 |
| 674 | iso_pu_bacteria | 2987659509 | 2987659898 | 440 |
| 675 | iso_pu_bacteria | 2987666974 | 2987672960 | 440 |
| 676 | iso_pu_bacteria | 2987673487 | 2987678871 | 440 |
| 677 | iso_pu_bacteria | 2996341866 | 2996345381 | 440 |
| 678 | iso_pu_bacteria | 2996386984 | 2996393825 | 440 |
| 679 | iso_pu_bacteria | 2996887358 | 2996893022 | 440 |
| 680 | iso_pu_bacteria | 3000135777 | 3000140977 | 440 |
| 681 | iso_pu_bacteria | 3004188549 | 3004188945 | 440 |
| 682 | iso_pu_bacteria | 3004203850 | 3004204107 | 440 |
| 683 | iso_pu_bacteria | 3004211236 | 3004215612 | 440 |
| 684 | iso_pu_bacteria | 3004218560 | 3004222084 | 440 |
| 685 | iso_pu_bacteria | 3004239961 | 3004243612 | 440 |
| 686 | iso_pu_bacteria | 3005416602 | 3005416652 | 440 |
| 687 | iso_pu_bacteria | 3005483717 | 3005488727 | 440 |
| 688 | iso_pu_bacteria | 3005587118 | 3005592095 | 440 |
| 689 | iso_pu_bacteria | 637000159 | 637078901 | 440 |
| 690 | iso_pu_bacteria | 639633055 | 639645372 | 440 |
| 691 | iso_pu_bacteria | 643348564 | 643600620 | 440 |
| 692 | iso_pu_bacteria | 643692032 | 643822490 | 440 |
| 693 | iso_pu_bacteria | 648276728 | 648738626 | 440 |
| 694 | iso_pu_bacteria | 650716007 | 650843111 | 440 |
| 695 | iso_pu_bacteria | 8003570095 | 8003575458 | 440 |
| 696 | iso_pu_bacteria | 8003992118 | 8003997749 | 440 |
| 697 | iso_pu_bacteria | 8003999396 | 8004005444 | 440 |
| 698 | iso_pu_bacteria | 8004312739 | 8004313825 | 440 |
| 699 | iso_pu_bacteria | 8004374579 | 8004375698 | 440 |
| 700 | iso_pu_bacteria | 8004387939 | 8004389070 | 440 |
| 701 | iso_pu_bacteria | 8004445564 | 8004451938 | 440 |
| 702 | iso_pu_bacteria | 8004695233 | 8004697539 | 440 |
| 703 | iso_pu_bacteria | 8004703790 | 8004713250 | 440 |
| 704 | iso_pu_bacteria | 8004714634 | 8004716133 | 440 |
| 705 | iso_pu_bacteria | 8005275841 | 8005275948 | 440 |
| 706 | iso_pu_bacteria | 8005282627 | 8005285833 | 440 |
| 707 | iso_pu_bacteria | 8005289223 | 8005290849 | 440 |
| 708 | iso_pu_bacteria | 8005301065 | 8005301274 | 440 |
| 709 | iso_pu_bacteria | 8005307578 | 8005308298 | 440 |
| 710 | iso_pu_bacteria | 8005314921 | 8005320705 | 440 |
| 711 | iso_pu_bacteria | 8005321885 | 8005327549 | 440 |
| 712 | iso_pu_bacteria | 8005376324 | 8005380556 | 440 |
| 713 | iso_pu_bacteria | 8005382845 | 8005383381 | 440 |
| 714 | iso_pu_bacteria | 8005395548 | 8005398975 | 440 |
| 715 | iso_pu_bacteria | 8005430974 | 8005436582 | 440 |
| 716 | iso_pu_bacteria | 8005460587 | 8005467567 | 440 |
| 717 | iso_pu_bacteria | 8005484373 | 8005487620 | 440 |
| 718 | iso_pu_bacteria | 8005497431 | 8005501997 | 440 |
| 719 | iso_pu_bacteria | 8005556819 | 8005559482 | 440 |
| 720 | iso_pu_bacteria | 8005563573 | 8005566471 | 440 |
| 721 | iso_pu_bacteria | 8005570704 | 8005571150 | 440 |
| 722 | iso_pu_bacteria | 8005619151 | 8005624239 | 440 |
| 723 | iso_pu_bacteria | 8005626139 | 8005629505 | 440 |
| 724 | iso_pu_bacteria | 8005645114 | 8005651808 | 440 |
| 725 | iso_pu_bacteria | 8005668836 | 8005673419 | 440 |
| 726 | iso_pu_bacteria | 8005682033 | 8005686028 | 440 |
| 727 | iso_pu_bacteria | 8005688590 | 8005688911 | 440 |
| 728 | iso_pu_bacteria | 8005695170 | 8005695467 | 440 |
| 729 | iso_pu_bacteria | 8018127388 | 8018132286 | 440 |
| 730 | iso_pu_bacteria | 8018150411 | 8018151249 | 440 |
| 731 | iso_pu_bacteria | 8018163183 | 8018163745 | 440 |
| 732 | iso_pu_bacteria | 8018176218 | 8018180836 | 440 |
| 733 | iso_pu_bacteria | 8019619141 | 8019623694 | 440 |
| 734 | iso_pu_bacteria | 8019629233 | 8019638340 | 440 |
| 735 | iso_pu_bacteria | 8019638758 | 8019641298 | 440 |
| 736 | iso_pu_bacteria | 8019648815 | 8019656845 | 440 |
| 737 | iso_pu_bacteria | 8019659431 | 8019666265 | 440 |
| 738 | iso_pu_bacteria | 8019668869 | 8019675761 | 440 |
| 739 | iso_pu_bacteria | 8023680758 | 8023681567 | 440 |
| 740 | iso_pu_bacteria | 8024479707 | 8024481439 | 440 |
| 741 | iso_pu_bacteria | 8024486573 | 8024493049 | 440 |
| 742 | iso_pu_bacteria | 8046767195 | 8046774208 | 440 |
| 743 | iso_pu_bacteria | 8049293176 | 8049298101 | 440 |
| 744 | iso_pu_bacteria | 8054002106 | 8054005274 | 440 |
| 745 | iso_pu_bacteria | 8054558443 | 8054563375 | 440 |
| 746 | iso_pu_bacteria | 8055617313 | 8055621713 | 440 |
| 747 | iso_pu_bacteria | 8056375014 | 8056381771 | 440 |
| 748 | iso_pu_bacteria | 8057874678 | 8057881300 | 440 |
| 749 | 3300005466 | Ga0070685_10001923 | Ga0070685_100019234 | 441 |
| 750 | 3300009093 | Ga0105240_10001044 | Ga0105240_1000104439 | 441 |
| 751 | 3300009551 | Ga0105238_10006969 | Ga0105238_1000696912 | 441 |
| 752 | 3300025904 | Ga0207647_10000500 | Ga0207647_100005008 | 441 |
| 753 | 3300025913 | Ga0207695_10000007 | Ga0207695_10000007191 | 441 |
| 754 | 3300025924 | Ga0207694_10005080 | Ga0207694_100050802 | 441 |
| 755 | iso_pu_bacteria | 2521172590 | 2521557009 | 442 |
| 756 | iso_pu_bacteria | 2551306416 | 2553004808 | 442 |
| 757 | iso_pu_bacteria | 2775506901 | 2776265227 | 442 |
| 758 | iso_pu_bacteria | 2818991449 | 2819616808 | 442 |
| 759 | iso_pu_bacteria | 2904439833 | 2904440286 | 442 |
| 760 | iso_pu_bacteria | 2904530477 | 2904530801 | 442 |
| 761 | iso_pu_bacteria | 2904584206 | 2904585784 | 442 |
| 762 | iso_pu_bacteria | 2904589729 | 2904592403 | 442 |
| 763 | iso_pu_bacteria | 2904601388 | 2904601464 | 442 |
| 764 | iso_pu_bacteria | 2919079590 | 2919082886 | 442 |
| 765 | iso_pu_bacteria | 2923510766 | 2923515641 | 442 |
| 766 | iso_pu_bacteria | 2928130867 | 2928134541 | 442 |
| 767 | 3300049568 | Ga0501031_0139909 | Ga0501031_0139909_87_1457 | 443 |
| 768 | 3300001979 | JGI24740J21852_10006396 | JGI24740J21852_100063965 | 444 |
| 769 | 3300002704 | JGI25155J39150_1000003 | JGI25155J39150_1000003192 | 444 |
| 770 | 3300002705 | JGI25156J39149_1000004 | JGI25156J39149_1000004186 | 444 |
| 771 | 3300002737 | JGI25162J39368_1000069 | JGI25162J39368_100006986 | 444 |
| 772 | 3300002738 | JGI25154J39366_1000013 | JGI25154J39366_1000013269 | 444 |
| 773 | 3300002741 | JGI25157J39369_1000004 | JGI25157J39369_100000491 | 444 |
| 774 | 3300002773 | JGI25152J39213_1000186 | JGI25152J39213_100018625 | 444 |
| 775 | 3300002987 | JGI25159J45721_1000019 | JGI25159J45721_100001980 | 444 |
| 776 | 3300003187 | JGI25151J46595_10000867 | JGI25151J46595_1000086714 | 444 |
| 777 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_100001863 | 444 |
| 778 | 3300003214 | JGI25165J46597_1000020 | JGI25165J46597_1000020169 | 444 |
| 779 | 3300003214 | JGI25165J46597_1000372 | JGI25165J46597_100037216 | 444 |
| 780 | 3300003214 | JGI25165J46597_1005415 | JGI25165J46597_10054151 | 444 |
| 781 | 3300003215 | JGI25153J46596_10000200 | JGI25153J46596_1000020013 | 444 |
| 782 | 3300003215 | JGI25153J46596_10000829 | JGI25153J46596_1000082914 | 444 |
| 783 | 3300003215 | JGI25153J46596_10020305 | JGI25153J46596_100203051 | 444 |
| 784 | 3300003316 | rootH1_10018479 | rootH1_100184792 | 444 |
| 785 | 3300003323 | rootH1_10010878 | rootH1_100108785 | 444 |
| 786 | 3300003323 | rootH1_10084286 | rootH1_100842865 | 444 |
| 787 | 3300003354 | JGI25160J50197_1000054 | JGI25160J50197_100005480 | 444 |
| 788 | 3300003354 | JGI25160J50197_1000203 | JGI25160J50197_100020315 | 444 |
| 789 | 3300003354 | JGI25160J50197_1002223 | JGI25160J50197_10022232 | 444 |
| 790 | 3300003374 | JGI25161J50226_1000570 | JGI25161J50226_10005704 | 444 |
| 791 | 3300003374 | JGI25161J50226_1002643 | JGI25161J50226_10026434 | 444 |
| 792 | 3300003374 | JGI25161J50226_1003970 | JGI25161J50226_10039702 | 444 |
| 793 | 3300003762 | Ga0055542_1000068 | Ga0055542_100006812 | 444 |
| 794 | 3300003771 | Ga0055526_1000308 | Ga0055526_100030817 | 444 |
| 795 | 3300003771 | Ga0055526_1002146 | Ga0055526_10021462 | 444 |
| 796 | 3300003775 | Ga0055524_1002400 | Ga0055524_100240010 | 444 |
| 797 | 3300003775 | Ga0055524_1017598 | Ga0055524_10175982 | 444 |
| 798 | 3300003781 | Ga0055536_1000640 | Ga0055536_10006409 | 444 |
| 799 | 3300003781 | Ga0055536_1001374 | Ga0055536_10013748 | 444 |
| 800 | 3300003781 | Ga0055536_1004941 | Ga0055536_10049413 | 444 |
| 801 | 3300003790 | Ga0055528_1000054 | Ga0055528_100005434 | 444 |
| 802 | 3300003790 | Ga0055528_1000611 | Ga0055528_100061122 | 444 |
| 803 | 3300003792 | Ga0055540_1000131 | Ga0055540_100013110 | 444 |
| 804 | 3300003794 | Ga0055531_10000207 | Ga0055531_1000020733 | 444 |
| 805 | 3300003794 | Ga0055531_10003719 | Ga0055531_100037195 | 444 |
| 806 | 3300003794 | Ga0055531_10020782 | Ga0055531_100207822 | 444 |
| 807 | 3300003856 | Ga0058692_1004401 | Ga0058692_10044013 | 444 |
| 808 | 3300004625 | Ga0055543_1000150 | Ga0055543_10001504 | 444 |
| 809 | 3300004625 | Ga0055543_1000349 | Ga0055543_10003493 | 444 |
| 810 | 3300004625 | Ga0055543_1001165 | Ga0055543_10011659 | 444 |
| 811 | 3300005262 | Ga0065165_1000136 | Ga0065165_100013680 | 444 |
| 812 | 3300005262 | Ga0065165_1000672 | Ga0065165_100067215 | 444 |
| 813 | 3300005347 | Ga0070668_100046856 | Ga0070668_1000468564 | 444 |
| 814 | 3300005355 | Ga0070671_100017186 | Ga0070671_1000171863 | 444 |
| 815 | 3300005356 | Ga0070674_100034053 | Ga0070674_1000340532 | 444 |
| 816 | 3300005367 | Ga0070667_100009753 | Ga0070667_1000097532 | 444 |
| 817 | 3300005434 | Ga0070709_10004117 | Ga0070709_100041176 | 444 |
| 818 | 3300005436 | Ga0070713_100020550 | Ga0070713_1000205503 | 444 |
| 819 | 3300005437 | Ga0070710_10001455 | Ga0070710_100014552 | 444 |
| 820 | 3300005455 | Ga0070663_100006884 | Ga0070663_1000068845 | 444 |
| 821 | 3300005548 | Ga0070665_100040698 | Ga0070665_1000406985 | 444 |
| 822 | 3300005548 | Ga0070665_100153116 | Ga0070665_1001531163 | 444 |
| 823 | 3300005563 | Ga0068855_100153664 | Ga0068855_1001536643 | 444 |
| 824 | 3300005577 | Ga0068857_100120684 | Ga0068857_1001206842 | 444 |
| 825 | 3300005578 | Ga0068854_100063002 | Ga0068854_1000630022 | 444 |
| 826 | 3300005614 | Ga0068856_100009837 | Ga0068856_1000098374 | 444 |
| 827 | 3300005614 | Ga0068856_100017742 | Ga0068856_1000177424 | 444 |
| 828 | 3300005616 | Ga0068852_100000915 | Ga0068852_10000091510 | 444 |
| 829 | 3300005616 | Ga0068852_100201722 | Ga0068852_1002017222 | 444 |
| 830 | 3300005618 | Ga0068864_100187555 | Ga0068864_1001875552 | 444 |
| 831 | 3300005841 | Ga0068863_100106350 | Ga0068863_1001063503 | 444 |
| 832 | 3300005844 | Ga0068862_100176133 | Ga0068862_1001761332 | 444 |
| 833 | 3300005983 | Ga0081540_1003849 | Ga0081540_10038497 | 444 |
| 834 | 3300006028 | Ga0070717_10064195 | Ga0070717_100641953 | 444 |
| 835 | 3300006038 | Ga0075365_10000531 | Ga0075365_100005313 | 444 |
| 836 | 3300006038 | Ga0075365_10009053 | Ga0075365_100090535 | 444 |
| 837 | 3300006038 | Ga0075365_10010720 | Ga0075365_100107205 | 444 |
| 838 | 3300006038 | Ga0075365_10017374 | Ga0075365_100173743 | 444 |
| 839 | 3300006038 | Ga0075365_10019715 | Ga0075365_100197154 | 444 |
| 840 | 3300006038 | Ga0075365_10022527 | Ga0075365_100225272 | 444 |
| 841 | 3300006038 | Ga0075365_10030791 | Ga0075365_100307912 | 444 |
| 842 | 3300006038 | Ga0075365_10081484 | Ga0075365_100814841 | 444 |
| 843 | 3300006042 | Ga0075368_10034284 | Ga0075368_100342842 | 444 |
| 844 | 3300006048 | Ga0075363_100000058 | Ga0075363_1000000584 | 444 |
| 845 | 3300006051 | Ga0075364_10014932 | Ga0075364_100149325 | 444 |
| 846 | 3300006175 | Ga0070712_100016628 | Ga0070712_1000166284 | 444 |
| 847 | 3300006177 | Ga0075362_10010898 | Ga0075362_100108984 | 444 |
| 848 | 3300006177 | Ga0075362_10015935 | Ga0075362_100159353 | 444 |
| 849 | 3300006177 | Ga0075362_10040411 | Ga0075362_100404112 | 444 |
| 850 | 3300006178 | Ga0075367_10000241 | Ga0075367_1000024112 | 444 |
| 851 | 3300006178 | Ga0075367_10049377 | Ga0075367_100493772 | 444 |
| 852 | 3300006178 | Ga0075367_10094119 | Ga0075367_100941192 | 444 |
| 853 | 3300006186 | Ga0075369_10002765 | Ga0075369_100027653 | 444 |
| 854 | 3300006186 | Ga0075369_10004181 | Ga0075369_100041811 | 444 |
| 855 | 3300006186 | Ga0075369_10006567 | Ga0075369_100065674 | 444 |
| 856 | 3300006186 | Ga0075369_10009584 | Ga0075369_100095844 | 444 |
| 857 | 3300006195 | Ga0075366_10006620 | Ga0075366_100066204 | 444 |
| 858 | 3300006353 | Ga0075370_10008090 | Ga0075370_100080904 | 444 |
| 859 | 3300006844 | Ga0075428_100117841 | Ga0075428_1001178412 | 444 |
| 860 | 3300006941 | Ga0099825_1029359 | Ga0099825_10293592 | 444 |
| 861 | 3300006942 | Ga0099824_1023232 | Ga0099824_10232323 | 444 |
| 862 | 3300006943 | Ga0099822_1023504 | Ga0099822_10235046 | 444 |
| 863 | 3300006948 | Ga0099826_10000665 | Ga0099826_100006655 | 444 |
| 864 | 3300009093 | Ga0105240_10000217 | Ga0105240_1000021733 | 444 |
| 865 | 3300009093 | Ga0105240_10176549 | Ga0105240_101765492 | 444 |
| 866 | 3300009148 | Ga0105243_10007647 | Ga0105243_100076477 | 444 |
| 867 | 3300009148 | Ga0105243_10018759 | Ga0105243_100187594 | 444 |
| 868 | 3300009176 | Ga0105242_10210522 | Ga0105242_102105221 | 444 |
| 869 | 3300009177 | Ga0105248_10029402 | Ga0105248_100294022 | 444 |
| 870 | 3300009545 | Ga0105237_10000978 | Ga0105237_100009785 | 444 |
| 871 | 3300009545 | Ga0105237_10016626 | Ga0105237_100166265 | 444 |
| 872 | 3300009545 | Ga0105237_10045493 | Ga0105237_100454934 | 444 |
| 873 | 3300009551 | Ga0105238_10073563 | Ga0105238_100735633 | 444 |
| 874 | 3300009551 | Ga0105238_10148003 | Ga0105238_101480032 | 444 |
| 875 | 3300009551 | Ga0105238_10209138 | Ga0105238_102091381 | 444 |
| 876 | 3300009553 | Ga0105249_10085551 | Ga0105249_100855513 | 444 |
| 877 | 3300009765 | Ga0123341_1000093 | Ga0123341_100009323 | 444 |
| 878 | 3300009766 | Ga0123342_1019635 | Ga0123342_10196353 | 444 |
| 879 | 3300009766 | Ga0123342_1024823 | Ga0123342_10248233 | 444 |
| 880 | 3300010375 | Ga0105239_10027600 | Ga0105239_100276005 | 444 |
| 881 | 3300010375 | Ga0105239_10164192 | Ga0105239_101641922 | 444 |
| 882 | 3300013100 | Ga0157373_10004938 | Ga0157373_100049384 | 444 |
| 883 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002359 | 444 |
| 884 | 3300013104 | Ga0157370_10003627 | Ga0157370_100036276 | 444 |
| 885 | 3300013104 | Ga0157370_10005183 | Ga0157370_100051833 | 444 |
| 886 | 3300013249 | Ga0171463_1002 | Ga0171463_1002504 | 444 |
| 887 | 3300013296 | Ga0157374_10035329 | Ga0157374_100353293 | 444 |
| 888 | 3300014325 | Ga0163163_10013631 | Ga0163163_100136316 | 444 |
| 889 | 3300015262 | Ga0182007_10004509 | Ga0182007_100045094 | 444 |
| 890 | 3300015265 | Ga0182005_1014944 | Ga0182005_10149442 | 444 |
| 891 | 3300015690 | Ga0183363_1041 | Ga0183363_104122 | 444 |
| 892 | 3300021320 | Ga0214544_1000018 | Ga0214544_1000018166 | 444 |
| 893 | 3300021320 | Ga0214544_1009587 | Ga0214544_10095877 | 444 |
| 894 | 3300021321 | Ga0214542_1000307 | Ga0214542_100030776 | 444 |
| 895 | 3300021321 | Ga0214542_1001549 | Ga0214542_100154928 | 444 |
| 896 | 3300021321 | Ga0214542_1018955 | Ga0214542_10189555 | 444 |
| 897 | 3300021324 | Ga0214545_1005475 | Ga0214545_100547518 | 444 |
| 898 | 3300021327 | Ga0214543_1000195 | Ga0214543_100019511 | 444 |
| 899 | 3300021327 | Ga0214543_1007141 | Ga0214543_100714113 | 444 |
| 900 | 3300021327 | Ga0214543_1011326 | Ga0214543_101132610 | 444 |
| 901 | 3300022739 | Ga0228711_1004587 | Ga0228711_100458712 | 444 |
| 902 | 3300022740 | Ga0228710_1004744 | Ga0228710_100474413 | 444 |
| 903 | 3300025206 | Ga0209435_100006 | Ga0209435_10000690 | 444 |
| 904 | 3300025208 | Ga0209436_100404 | Ga0209436_10040412 | 444 |
| 905 | 3300025208 | Ga0209436_102987 | Ga0209436_1029874 | 444 |
| 906 | 3300025228 | Ga0209672_105623 | Ga0209672_1056232 | 444 |
| 907 | 3300025233 | Ga0209437_100022 | Ga0209437_100022128 | 444 |
| 908 | 3300025245 | Ga0207425_1002753 | Ga0207425_10027533 | 444 |
| 909 | 3300025245 | Ga0207425_1003951 | Ga0207425_10039512 | 444 |
| 910 | 3300025246 | Ga0209646_1000015 | Ga0209646_1000015444 | 444 |
| 911 | 3300025250 | Ga0209026_1000039 | Ga0209026_100003990 | 444 |
| 912 | 3300025253 | Ga0209677_100826 | Ga0209677_10082611 | 444 |
| 913 | 3300025254 | Ga0209148_1000078 | Ga0209148_1000078147 | 444 |
| 914 | 3300025254 | Ga0209148_1000790 | Ga0209148_100079021 | 444 |
| 915 | 3300025254 | Ga0209148_1006123 | Ga0209148_10061232 | 444 |
| 916 | 3300025254 | Ga0209148_1010791 | Ga0209148_10107911 | 444 |
| 917 | 3300025256 | Ga0209759_1000005 | Ga0209759_100000590 | 444 |
| 918 | 3300025256 | Ga0209759_1019371 | Ga0209759_10193711 | 444 |
| 919 | 3300025258 | Ga0209129_1000255 | Ga0209129_100025516 | 444 |
| 920 | 3300025258 | Ga0209129_1000669 | Ga0209129_10006699 | 444 |
| 921 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031128 | 444 |
| 922 | 3300025261 | Ga0209233_1000047 | Ga0209233_1000047165 | 444 |
| 923 | 3300025261 | Ga0209233_1000324 | Ga0209233_100032415 | 444 |
| 924 | 3300025261 | Ga0209233_1000330 | Ga0209233_100033018 | 444 |
| 925 | 3300025261 | Ga0209233_1011262 | Ga0209233_10112622 | 444 |
| 926 | 3300025272 | Ga0209455_1000193 | Ga0209455_100019336 | 444 |
| 927 | 3300025272 | Ga0209455_1000641 | Ga0209455_100064114 | 444 |
| 928 | 3300025272 | Ga0209455_1005792 | Ga0209455_10057922 | 444 |
| 929 | 3300025272 | Ga0209455_1009389 | Ga0209455_10093891 | 444 |
| 930 | 3300025273 | Ga0209673_1000067 | Ga0209673_1000067199 | 444 |
| 931 | 3300025273 | Ga0209673_1000291 | Ga0209673_100029142 | 444 |
| 932 | 3300025273 | Ga0209673_1000473 | Ga0209673_100047319 | 444 |
| 933 | 3300025273 | Ga0209673_1000642 | Ga0209673_100064249 | 444 |
| 934 | 3300025273 | Ga0209673_1013619 | Ga0209673_10136193 | 444 |
| 935 | 3300025284 | Ga0209130_1000120 | Ga0209130_100012053 | 444 |
| 936 | 3300025284 | Ga0209130_1000242 | Ga0209130_100024234 | 444 |
| 937 | 3300025291 | Ga0209675_1014646 | Ga0209675_10146462 | 444 |
| 938 | 3300025292 | Ga0209676_1000470 | Ga0209676_100047051 | 444 |
| 939 | 3300025292 | Ga0209676_1001059 | Ga0209676_100105913 | 444 |
| 940 | 3300025292 | Ga0209676_1001988 | Ga0209676_100198810 | 444 |
| 941 | 3300025292 | Ga0209676_1022144 | Ga0209676_10221442 | 444 |
| 942 | 3300025294 | Ga0209025_1000240 | Ga0209025_1000240145 | 444 |
| 943 | 3300025294 | Ga0209025_1000430 | Ga0209025_100043038 | 444 |
| 944 | 3300025294 | Ga0209025_1000708 | Ga0209025_100070816 | 444 |
| 945 | 3300025294 | Ga0209025_1001534 | Ga0209025_10015344 | 444 |
| 946 | 3300025295 | Ga0209564_1000092 | Ga0209564_1000092199 | 444 |
| 947 | 3300025295 | Ga0209564_1000338 | Ga0209564_100033875 | 444 |
| 948 | 3300025295 | Ga0209564_1000876 | Ga0209564_10008765 | 444 |
| 949 | 3300025295 | Ga0209564_1018490 | Ga0209564_10184902 | 444 |
| 950 | 3300025297 | Ga0209758_1000131 | Ga0209758_100013183 | 444 |
| 951 | 3300025297 | Ga0209758_1000490 | Ga0209758_100049021 | 444 |
| 952 | 3300025297 | Ga0209758_1000508 | Ga0209758_10005082 | 444 |
| 953 | 3300025297 | Ga0209758_1000610 | Ga0209758_100061016 | 444 |
| 954 | 3300025297 | Ga0209758_1008376 | Ga0209758_10083762 | 444 |
| 955 | 3300025298 | Ga0209050_1001238 | Ga0209050_10012385 | 444 |
| 956 | 3300025298 | Ga0209050_1006857 | Ga0209050_10068575 | 444 |
| 957 | 3300025298 | Ga0209050_1009556 | Ga0209050_10095562 | 444 |
| 958 | 3300025298 | Ga0209050_1013160 | Ga0209050_10131604 | 444 |
| 959 | 3300025299 | Ga0209256_1000788 | Ga0209256_10007887 | 444 |
| 960 | 3300025299 | Ga0209256_1001230 | Ga0209256_10012309 | 444 |
| 961 | 3300025299 | Ga0209256_1001843 | Ga0209256_10018436 | 444 |
| 962 | 3300025299 | Ga0209256_1002067 | Ga0209256_100206712 | 444 |
| 963 | 3300025302 | Ga0207426_1000075 | Ga0207426_1000075253 | 444 |
| 964 | 3300025302 | Ga0207426_1000206 | Ga0207426_100020653 | 444 |
| 965 | 3300025302 | Ga0207426_1000483 | Ga0207426_100048346 | 444 |
| 966 | 3300025303 | Ga0209051_1000038 | Ga0209051_1000038241 | 444 |
| 967 | 3300025303 | Ga0209051_1002802 | Ga0209051_10028023 | 444 |
| 968 | 3300025303 | Ga0209051_1002894 | Ga0209051_10028942 | 444 |
| 969 | 3300025303 | Ga0209051_1016836 | Ga0209051_10168362 | 444 |
| 970 | 3300025304 | Ga0209257_1000545 | Ga0209257_100054524 | 444 |
| 971 | 3300025304 | Ga0209257_1001781 | Ga0209257_10017818 | 444 |
| 972 | 3300025304 | Ga0209257_1003568 | Ga0209257_100356810 | 444 |
| 973 | 3300025304 | Ga0209257_1003646 | Ga0209257_100364610 | 444 |
| 974 | 3300025898 | Ga0207692_10012086 | Ga0207692_100120863 | 444 |
| 975 | 3300025904 | Ga0207647_10001555 | Ga0207647_100015556 | 444 |
| 976 | 3300025904 | Ga0207647_10003982 | Ga0207647_100039822 | 444 |
| 977 | 3300025906 | Ga0207699_10001044 | Ga0207699_100010441 | 444 |
| 978 | 3300025911 | Ga0207654_10058718 | Ga0207654_100587181 | 444 |
| 979 | 3300025913 | Ga0207695_10001205 | Ga0207695_1000120533 | 444 |
| 980 | 3300025914 | Ga0207671_10000793 | Ga0207671_100007939 | 444 |
| 981 | 3300025914 | Ga0207671_10209851 | Ga0207671_102098511 | 444 |
| 982 | 3300025915 | Ga0207693_10025190 | Ga0207693_100251905 | 444 |
| 983 | 3300025924 | Ga0207694_10009453 | Ga0207694_100094535 | 444 |
| 984 | 3300025924 | Ga0207694_10039024 | Ga0207694_100390242 | 444 |
| 985 | 3300025931 | Ga0207644_10021404 | Ga0207644_100214043 | 444 |
| 986 | 3300025933 | Ga0207706_10107587 | Ga0207706_101075872 | 444 |
| 987 | 3300025937 | Ga0207669_10066859 | Ga0207669_100668591 | 444 |
| 988 | 3300025938 | Ga0207704_10053054 | Ga0207704_100530542 | 444 |
| 989 | 3300025939 | Ga0207665_10001859 | Ga0207665_1000185910 | 444 |
| 990 | 3300025940 | Ga0207691_10078053 | Ga0207691_100780531 | 444 |
| 991 | 3300025941 | Ga0207711_10040250 | Ga0207711_100402503 | 444 |
| 992 | 3300025961 | Ga0207712_10024258 | Ga0207712_100242583 | 444 |
| 993 | 3300025972 | Ga0207668_10033246 | Ga0207668_100332461 | 444 |
| 994 | 3300025972 | Ga0207668_10047884 | Ga0207668_100478843 | 444 |
| 995 | 3300025986 | Ga0207658_10013181 | Ga0207658_100131816 | 444 |
| 996 | 3300026067 | Ga0207678_10033763 | Ga0207678_100337634 | 444 |
| 997 | 3300026078 | Ga0207702_10013019 | Ga0207702_100130194 | 444 |
| 998 | 3300026078 | Ga0207702_10034297 | Ga0207702_100342972 | 444 |
| 999 | 3300026088 | Ga0207641_10094135 | Ga0207641_100941353 | 444 |
| 1000 | 3300026089 | Ga0207648_10084397 | Ga0207648_100843973 | 444 |
| 1001 | 3300026116 | Ga0207674_10124592 | Ga0207674_101245923 | 444 |
| 1002 | 3300026118 | Ga0207675_100107710 | Ga0207675_1001077102 | 444 |
| 1003 | 3300026121 | Ga0207683_10181519 | Ga0207683_101815192 | 444 |
| 1004 | 3300027111 | Ga0209281_1000491 | Ga0209281_100049136 | 444 |
| 1005 | 3300027111 | Ga0209281_1000981 | Ga0209281_100098112 | 444 |
| 1006 | 3300027296 | Ga0209389_1004138 | Ga0209389_100413810 | 444 |
| 1007 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003454 | 444 |
| 1008 | 3300027312 | Ga0209371_1000324 | Ga0209371_100032436 | 444 |
| 1009 | 3300027357 | Ga0209589_1002342 | Ga0209589_100234219 | 444 |
| 1010 | 3300027357 | Ga0209589_1007145 | Ga0209589_100714515 | 444 |
| 1011 | 3300027361 | Ga0209489_106154 | Ga0209489_1061549 | 444 |
| 1012 | 3300027361 | Ga0209489_106733 | Ga0209489_10673315 | 444 |
| 1013 | 3300027363 | Ga0209700_100005 | Ga0209700_100005507 | 444 |
| 1014 | 3300027666 | Ga0209282_1000108 | Ga0209282_100010822 | 444 |
| 1015 | 3300027666 | Ga0209282_1000604 | Ga0209282_10006045 | 444 |
| 1016 | 3300027866 | Ga0209813_10001351 | Ga0209813_100013513 | 444 |
| 1017 | 3300028379 | Ga0268266_10029411 | Ga0268266_100294115 | 444 |
| 1018 | 3300028379 | Ga0268266_10033739 | Ga0268266_100337393 | 444 |
| 1019 | 3300028381 | Ga0268264_10127213 | Ga0268264_101272132 | 444 |
| 1020 | 3300028794 | Ga0307515_10001625 | Ga0307515_1000162535 | 444 |
| 1021 | 3300028794 | Ga0307515_10001999 | Ga0307515_1000199936 | 444 |
| 1022 | 3300028794 | Ga0307515_10233095 | Ga0307515_102330951 | 444 |
| 1023 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004596 | 444 |
| 1024 | 3300030500 | Ga0268256_1001615 | Ga0268256_100161512 | 444 |
| 1025 | 3300031456 | Ga0307513_10095186 | Ga0307513_100951862 | 444 |
| 1026 | 3300031649 | Ga0307514_10000850 | Ga0307514_1000085035 | 444 |
| 1027 | 3300031967 | Ga0315914_1000427 | Ga0315914_100042733 | 444 |
| 1028 | 3300033430 | Ga0315913_1001358 | Ga0315913_100135819 | 444 |
| 1029 | 3300033464 | Ga0315915_1000032 | Ga0315915_100003275 | 444 |
| 1030 | 3300035695 | Ga0373927_0000581 | Ga0373927_0000581_8627_10000 | 444 |
| 1031 | 3300037068 | Ga0373925_0003311 | Ga0373925_0003311_3718_5091 | 444 |
| 1032 | 3300037418 | Ga0395900_0170554 | Ga0395900_0170554_808_2181 | 444 |
| 1033 | 3300037471 | Ga0395905_0001624 | Ga0395905_0001624_12638_14014 | 444 |
| 1034 | 3300037471 | Ga0395905_0018526 | Ga0395905_0018526_4150_5523 | 444 |
| 1035 | 3300037471 | Ga0395905_0168297 | Ga0395905_0168297_386_1762 | 444 |
| 1036 | 3300038443 | Ga0395901_0037069 | Ga0395901_0037069_324_1700 | 444 |
| 1037 | 3300038443 | Ga0395901_0099665 | Ga0395901_0099665_371_1747 | 444 |
| 1038 | 3300039437 | Ga0436365_1690000 | Ga0436365_1690000_16_1389 | 444 |
| 1039 | 3300039447 | Ga0436361_0082211 | Ga0436361_0082211_179_1552 | 444 |
| 1040 | 3300039447 | Ga0436361_1160430 | Ga0436361_1160430_5735_7108 | 444 |
| 1041 | 3300041404 | Ga0439436_0032326 | Ga0439436_0032326_110_1486 | 444 |
| 1042 | 3300041413 | Ga0439465_0001210 | Ga0439465_0001210_5976_7352 | 444 |
| 1043 | 3300041413 | Ga0439465_0008515 | Ga0439465_0008515_1659_3035 | 444 |
| 1044 | 3300041505 | Ga0451849_0513859 | Ga0451849_0513859_261_1637 | 444 |
| 1045 | 3300041507 | Ga0451851_0276965 | Ga0451851_0276965_87_1463 | 444 |
| 1046 | 3300041509 | Ga0451843_1077282 | Ga0451843_1077282_566_1942 | 444 |
| 1047 | 3300041512 | Ga0451853_1283853 | Ga0451853_1283853_207_1583 | 444 |
| 1048 | 3300042007 | Ga0439449_0019041 | Ga0439449_0019041_1143_2516 | 444 |
| 1049 | 3300042145 | Ga0450906_003989 | Ga0450906_003989_851_2227 | 444 |
| 1050 | 3300042146 | Ga0450907_007441 | Ga0450907_007441_88_1464 | 444 |
| 1051 | 3300042435 | Ga0439434_0010852 | Ga0439434_0010852_1187_2563 | 444 |
| 1052 | 3300042531 | Ga0450918_000330 | Ga0450918_000330_1175_2551 | 444 |
| 1053 | 3300044694 | Ga0466963_0008944 | Ga0466963_0008944_2732_4108 | 444 |
| 1054 | 3300044735 | Ga0466968_0006460 | Ga0466968_0006460_2683_4059 | 444 |
| 1055 | 3300044765 | Ga0466970_0000136 | Ga0466970_0000136_10999_12375 | 444 |
| 1056 | 3300045049 | Ga0466959_0056743 | Ga0466959_0056743_200_1576 | 444 |
| 1057 | 3300045051 | Ga0451576_0121180 | Ga0451576_0121180_399_1781 | 444 |
| 1058 | 3300045836 | Ga0466958_0004964 | Ga0466958_0004964_2306_3682 | 444 |
| 1059 | 3300046452 | Ga0495617_006379 | Ga0495617_006379_2034_3410 | 444 |
| 1060 | 3300046459 | Ga0495629_0009432 | Ga0495629_0009432_4941_6314 | 444 |
| 1061 | 3300046460 | Ga0495638_0001519 | Ga0495638_0001519_17973_19349 | 444 |
| 1062 | 3300046471 | Ga0495650_0060858 | Ga0495650_0060858_120_1496 | 444 |
| 1063 | 3300046474 | Ga0495605_0020476 | Ga0495605_0020476_1529_2905 | 444 |
| 1064 | 3300046492 | Ga0495585_0033722 | Ga0495585_0033722_531_1907 | 444 |
| 1065 | 3300046492 | Ga0495585_0099629 | Ga0495585_0099629_156_1532 | 444 |
| 1066 | 3300046507 | Ga0495606_0006572 | Ga0495606_0006572_2162_3535 | 444 |
| 1067 | 3300046507 | Ga0495606_0021433 | Ga0495606_0021433_1843_3219 | 444 |
| 1068 | 3300046507 | Ga0495606_0079141 | Ga0495606_0079141_147_1523 | 444 |
| 1069 | 3300046512 | Ga0495610_0016880 | Ga0495610_0016880_307_1680 | 444 |
| 1070 | 3300046515 | Ga0495620_0001877 | Ga0495620_0001877_1520_2896 | 444 |
| 1071 | 3300046520 | Ga0495637_0014296 | Ga0495637_0014296_576_1949 | 444 |
| 1072 | 3300046522 | Ga0495643_0001015 | Ga0495643_0001015_27253_28629 | 444 |
| 1073 | 3300046522 | Ga0495643_0038695 | Ga0495643_0038695_617_1990 | 444 |
| 1074 | 3300046524 | Ga0495648_0043713 | Ga0495648_0043713_327_1703 | 444 |
| 1075 | 3300046530 | Ga0495654_0000920 | Ga0495654_0000920_15132_16508 | 444 |
| 1076 | 3300046542 | Ga0495597_0007987 | Ga0495597_0007987_3840_5216 | 444 |
| 1077 | 3300046557 | Ga0495622_0001480 | Ga0495622_0001480_5828_7201 | 444 |
| 1078 | 3300046558 | Ga0495633_0044363 | Ga0495633_0044363_475_1851 | 444 |
| 1079 | 3300046558 | Ga0495633_0063020 | Ga0495633_0063020_343_1716 | 444 |
| 1080 | 3300046616 | Ga0495668_0027729 | Ga0495668_0027729_1532_2908 | 444 |
| 1081 | 3300046660 | Ga0495625_0014937 | Ga0495625_0014937_1780_3156 | 444 |
| 1082 | 3300046660 | Ga0495625_0028129 | Ga0495625_0028129_1409_2785 | 444 |
| 1083 | 3300046660 | Ga0495625_0169879 | Ga0495625_0169879_59_1432 | 444 |
| 1084 | 3300046663 | Ga0495635_0069085 | Ga0495635_0069085_552_1925 | 444 |
| 1085 | 3300046665 | Ga0495661_0038541 | Ga0495661_0038541_569_1945 | 444 |
| 1086 | 3300046674 | Ga0495588_0000630 | Ga0495588_0000630_1648_3021 | 444 |
| 1087 | 3300046809 | Ga0495600_0091745 | Ga0495600_0091745_140_1513 | 444 |
| 1088 | 3300047317 | Ga0495604_0000886 | Ga0495604_0000886_5323_6696 | 444 |
| 1089 | 3300047320 | Ga0495672_0017946 | Ga0495672_0017946_2253_3629 | 444 |
| 1090 | 3300047443 | Ga0495687_008305 | Ga0495687_008305_2197_3573 | 444 |
| 1091 | 3300047470 | Ga0495681_0002578 | Ga0495681_0002578_743_2116 | 444 |
| 1092 | 3300047470 | Ga0495681_0009025 | Ga0495681_0009025_1161_2534 | 444 |
| 1093 | 3300048904 | Ga0496101_0015346 | Ga0496101_0015346_1915_3291 | 444 |
| 1094 | 3300048905 | Ga0496102_0003274 | Ga0496102_0003274_2659_4035 | 444 |
| 1095 | 3300048906 | Ga0496103_0005911 | Ga0496103_0005911_3154_4530 | 444 |
| 1096 | 3300048907 | Ga0496104_0012545 | Ga0496104_0012545_3966_5342 | 444 |
| 1097 | 3300048908 | Ga0496105_0003825 | Ga0496105_0003825_1434_2810 | 444 |
| 1098 | 3300048911 | Ga0496108_0026952 | Ga0496108_0026952_976_2352 | 444 |
| 1099 | 3300048912 | Ga0496109_0018060 | Ga0496109_0018060_2856_4232 | 444 |
| 1100 | 3300048913 | Ga0496110_0010594 | Ga0496110_0010594_4550_5926 | 444 |
| 1101 | 3300048915 | Ga0496112_0010380 | Ga0496112_0010380_4874_6250 | 444 |
| 1102 | 3300048915 | Ga0496112_0084625 | Ga0496112_0084625_1684_3057 | 444 |
| 1103 | 3300048915 | Ga0496112_0090216 | Ga0496112_0090216_1576_2949 | 444 |
| 1104 | 3300048919 | Ga0496116_0031320 | Ga0496116_0031320_2183_3556 | 444 |
| 1105 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_225903_227276 | 444 |
| 1106 | 3300048920 | Ga0496117_0077648 | Ga0496117_0077648_74_1450 | 444 |
| 1107 | 3300048921 | Ga0496118_0000153 | Ga0496118_0000153_33149_34522 | 444 |
| 1108 | 3300048921 | Ga0496118_0001953 | Ga0496118_0001953_26097_27473 | 444 |
| 1109 | 3300048921 | Ga0496118_0060873 | Ga0496118_0060873_1385_2761 | 444 |
| 1110 | 3300048922 | Ga0496119_0007331 | Ga0496119_0007331_6921_8297 | 444 |
| 1111 | 3300048922 | Ga0496119_0021185 | Ga0496119_0021185_699_2075 | 444 |
| 1112 | 3300048922 | Ga0496119_0026665 | Ga0496119_0026665_1269_2642 | 444 |
| 1113 | 3300048922 | Ga0496119_0045015 | Ga0496119_0045015_811_2184 | 444 |
| 1114 | 3300048922 | Ga0496119_0053504 | Ga0496119_0053504_113_1489 | 444 |
| 1115 | 3300048923 | Ga0496120_0000660 | Ga0496120_0000660_37389_38762 | 444 |
| 1116 | 3300048923 | Ga0496120_0004196 | Ga0496120_0004196_9542_10915 | 444 |
| 1117 | 3300048923 | Ga0496120_0006449 | Ga0496120_0006449_3086_4462 | 444 |
| 1118 | 3300048924 | Ga0496121_0001476 | Ga0496121_0001476_33374_34747 | 444 |
| 1119 | 3300048924 | Ga0496121_0016949 | Ga0496121_0016949_4436_5812 | 444 |
| 1120 | 3300048924 | Ga0496121_0077608 | Ga0496121_0077608_1114_2490 | 444 |
| 1121 | 3300048924 | Ga0496121_0159878 | Ga0496121_0159878_170_1546 | 444 |
| 1122 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_226564_227937 | 444 |
| 1123 | 3300048925 | Ga0496122_0002358 | Ga0496122_0002358_20734_22110 | 444 |
| 1124 | 3300048925 | Ga0496122_0003859 | Ga0496122_0003859_9306_10679 | 444 |
| 1125 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1583746_1585119 | 444 |
| 1126 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_226564_227937 | 444 |
| 1127 | 3300048926 | Ga0496123_0021716 | Ga0496123_0021716_3049_4422 | 444 |
| 1128 | 3300048927 | Ga0496124_0008231 | Ga0496124_0008231_9380_10756 | 444 |
| 1129 | 3300048927 | Ga0496124_0011294 | Ga0496124_0011294_3874_5247 | 444 |
| 1130 | 3300048928 | Ga0496125_0000428 | Ga0496125_0000428_74141_75517 | 444 |
| 1131 | 3300048928 | Ga0496125_0014527 | Ga0496125_0014527_307_1680 | 444 |
| 1132 | 3300048928 | Ga0496125_0023312 | Ga0496125_0023312_1233_2606 | 444 |
| 1133 | 3300048928 | Ga0496125_0050628 | Ga0496125_0050628_810_2186 | 444 |
| 1134 | 3300048928 | Ga0496125_0065695 | Ga0496125_0065695_808_2184 | 444 |
| 1135 | 3300049569 | Ga0501032_0008522 | Ga0501032_0008522_3625_5001 | 444 |
| 1136 | 3300049570 | Ga0501033_0002403 | Ga0501033_0002403_8655_10031 | 444 |
| 1137 | 3300049573 | Ga0501037_0000028 | Ga0501037_0000028_48254_49630 | 444 |
| 1138 | 3300049579 | Ga0501043_0000028 | Ga0501043_0000028_50764_52140 | 444 |
| 1139 | 3300049585 | Ga0501069_0000014 | Ga0501069_0000014_93807_95183 | 444 |
| 1140 | 3300049586 | Ga0501070_0000121 | Ga0501070_0000121_19771_21147 | 444 |
| 1141 | 3300049589 | Ga0501073_0021852 | Ga0501073_0021852_3185_4561 | 444 |
| 1142 | 3300049590 | Ga0501074_0000004 | Ga0501074_0000004_85773_87149 | 444 |
| 1143 | 3300049742 | Ga0501080_0000027 | Ga0501080_0000027_38864_40240 | 444 |
| 1144 | 3300049744 | Ga0501083_0000025 | Ga0501083_0000025_91060_92436 | 444 |
| 1145 | 3300049822 | Ga0501035_0000129 | Ga0501035_0000129_41500_42876 | 444 |
| 1146 | 3300049823 | Ga0501044_0000052 | Ga0501044_0000052_26822_28198 | 444 |
| 1147 | 3300050489 | nmdc:mga03683_14537_c1 | nmdc:mga03683_14537_c1_1524_2897 | 444 |
| 1148 | 3300050491 | nmdc:mga00v17_11453_c1 | nmdc:mga00v17_11453_c1_906_2279 | 444 |
| 1149 | 3300050491 | nmdc:mga00v17_11939_c1 | nmdc:mga00v17_11939_c1_1406_2782 | 444 |
| 1150 | 3300050491 | nmdc:mga00v17_3_c1 | nmdc:mga00v17_3_c1_5777_7150 | 444 |
| 1151 | 3300050492 | nmdc:mga0yw44_10540_c1 | nmdc:mga0yw44_10540_c1_239_1615 | 444 |
| 1152 | 3300050492 | nmdc:mga0yw44_31834_c1 | nmdc:mga0yw44_31834_c1_1368_2741 | 444 |
| 1153 | 3300050492 | nmdc:mga0yw44_6443_c1 | nmdc:mga0yw44_6443_c1_2918_4291 | 444 |
| 1154 | 3300050493 | nmdc:mga0k408_1643_c1 | nmdc:mga0k408_1643_c1_10207_11583 | 444 |
| 1155 | 3300050493 | nmdc:mga0k408_28205_c1 | nmdc:mga0k408_28205_c1_400_1773 | 444 |
| 1156 | 3300050494 | nmdc:mga06z11_19394_c1 | nmdc:mga06z11_19394_c1_785_2161 | 444 |
| 1157 | 3300050494 | nmdc:mga06z11_42757_c1 | nmdc:mga06z11_42757_c1_716_2092 | 444 |
| 1158 | 3300050494 | nmdc:mga06z11_98357_c1 | nmdc:mga06z11_98357_c1_79_1455 | 444 |
| 1159 | 3300050496 | nmdc:mga07m45_40126_c1 | nmdc:mga07m45_40126_c1_142_1518 | 444 |
| 1160 | 3300050496 | nmdc:mga07m45_7997_c1 | nmdc:mga07m45_7997_c1_3272_4648 | 444 |
| 1161 | 3300050516 | nmdc:mga0sz30_17402_c1 | nmdc:mga0sz30_17402_c1_1052_2428 | 444 |
| 1162 | 3300050516 | nmdc:mga0sz30_28733_c1 | nmdc:mga0sz30_28733_c1_635_2011 | 444 |
| 1163 | 3300050516 | nmdc:mga0sz30_514_c1 | nmdc:mga0sz30_514_c1_7100_8473 | 444 |
| 1164 | 3300050516 | nmdc:mga0sz30_5788_c1 | nmdc:mga0sz30_5788_c1_2019_3395 | 444 |
| 1165 | 3300053079 | Ga0500610_0019641 | Ga0500610_0019641_357_1730 | 444 |
| 1166 | 3300053083 | Ga0495655_0007607 | Ga0495655_0007607_505_1878 | 444 |
| 1167 | 3300053107 | Ga0500560_001318 | Ga0500560_001318_1539_2912 | 444 |
| 1168 | 3300053109 | Ga0500569_006377 | Ga0500569_006377_1007_2383 | 444 |
| 1169 | 3300053125 | Ga0500618_006461 | Ga0500618_006461_937_2313 | 444 |
| 1170 | 3300053125 | Ga0500618_012616 | Ga0500618_012616_10_1386 | 444 |
| 1171 | 3300053134 | Ga0500658_0001866 | Ga0500658_0001866_121_1497 | 444 |
| 1172 | 3300053137 | Ga0500561_0000133 | Ga0500561_0000133_1366_2739 | 444 |
| 1173 | 3300053139 | Ga0500568_0012171 | Ga0500568_0012171_1291_2667 | 444 |
| 1174 | 3300053148 | Ga0500590_002599 | Ga0500590_002599_3453_4826 | 444 |
| 1175 | 3300053153 | Ga0500616_0005939 | Ga0500616_0005939_1353_2729 | 444 |
| 1176 | 3300053157 | Ga0500624_000337 | Ga0500624_000337_10084_11457 | 444 |
| 1177 | 3300053177 | Ga0500636_0000001 | Ga0500636_0000001_62622_63995 | 444 |
| 1178 | 3300053177 | Ga0500636_0056283 | Ga0500636_0056283_445_1821 | 444 |
| 1179 | iso_pu_bacteria | 2874628541 | 2874634384 | 444 |
| 1180 | iso_pu_bacteria | 8002869464 | 8002869582 | 444 |
| 1181 | 3300005548 | Ga0070665_100059322 | Ga0070665_1000593223 | 445 |
| 1182 | 3300005841 | Ga0068863_100051283 | Ga0068863_1000512834 | 445 |
| 1183 | 3300026121 | Ga0207683_10091692 | Ga0207683_100916922 | 445 |
| 1184 | 3300028379 | Ga0268266_10096000 | Ga0268266_100960001 | 445 |
| 1185 | 3300039110 | Ga0400487_39107 | Ga0400487_39107_1004_2386 | 445 |
| 1186 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_660041_661432 | 445 |
| 1187 | 3300053153 | Ga0500616_0038875 | Ga0500616_0038875_147_1523 | 445 |
| 1188 | 3300053157 | Ga0500624_000016 | Ga0500624_000016_31869_33251 | 445 |
| 1189 | 3300053178 | Ga0500637_0000007 | Ga0500637_0000007_31887_33269 | 445 |
| 1190 | iso_pu_bacteria | 2919679072 | 2919682597 | 445 |
| 1191 | 3300009545 | Ga0105237_10003836 | Ga0105237_100038368 | 446 |
| 1192 | 3300025913 | Ga0207695_10031196 | Ga0207695_100311964 | 446 |
| 1193 | 3300048909 | Ga0496106_0006011 | Ga0496106_0006011_6470_7870 | 446 |
| 1194 | 3300048920 | Ga0496117_0041396 | Ga0496117_0041396_1346_2746 | 446 |
| 1195 | 3300048921 | Ga0496118_0023476 | Ga0496118_0023476_1722_3122 | 446 |
| 1196 | 3300048924 | Ga0496121_0000191 | Ga0496121_0000191_89387_90787 | 446 |
| 1197 | 3300048927 | Ga0496124_0029218 | Ga0496124_0029218_1353_2753 | 446 |
| 1198 | 3300048928 | Ga0496125_0120723 | Ga0496125_0120723_420_1820 | 446 |
| 1199 | 3300048929 | Ga0496126_0001278 | Ga0496126_0001278_9376_10776 | 446 |
| 1200 | 3300048929 | Ga0496126_0109555 | Ga0496126_0109555_25_1413 | 446 |
| 1201 | 3300050489 | nmdc:mga03683_12598_c1 | nmdc:mga03683_12598_c1_1649_3037 | 446 |
| 1202 | 3300050492 | nmdc:mga0yw44_9013_c1 | nmdc:mga0yw44_9013_c1_1915_3303 | 446 |
| 1203 | 3300050507 | nmdc:mga05p37_114737_c1 | nmdc:mga05p37_114737_c1_482_1906 | 446 |
| 1204 | 3300053087 | Ga0500643_019909 | Ga0500643_019909_694_2076 | 446 |
| 1205 | 3300053140 | Ga0500573_0014457 | Ga0500573_0014457_559_1938 | 446 |
| 1206 | iso_pu_bacteria | 2922386360 | 2922387161 | 446 |
| 1207 | iso_pu_bacteria | 8016583857 | 8016587319 | 446 |
| 1208 | 3300031548 | Ga0307408_100000948 | Ga0307408_1000009484 | 447 |
| 1209 | 3300031731 | Ga0307405_10019055 | Ga0307405_100190553 | 447 |
| 1210 | 3300031901 | Ga0307406_10064691 | Ga0307406_100646912 | 447 |
| 1211 | 3300031911 | Ga0307412_10007012 | Ga0307412_100070123 | 447 |
| 1212 | 3300032002 | Ga0307416_100082647 | Ga0307416_1000826472 | 447 |
| 1213 | 3300032005 | Ga0307411_10099176 | Ga0307411_100991761 | 447 |
| 1214 | 3300048928 | Ga0496125_0014609 | Ga0496125_0014609_1863_3317 | 447 |
| 1215 | 3300009093 | Ga0105240_10136724 | Ga0105240_101367242 | 448 |
| 1216 | 3300028794 | Ga0307515_10051586 | Ga0307515_100515863 | 448 |
| 1217 | 3300048924 | Ga0496121_0023957 | Ga0496121_0023957_1817_3226 | 448 |
| 1218 | iso_pu_bacteria | 2919046199 | 2919049819 | 448 |
| 1219 | 3300001904 | JGI24736J21556_1000196 | JGI24736J21556_10001967 | 449 |
| 1220 | 3300001915 | JGI24741J21665_1000024 | JGI24741J21665_100002419 | 449 |
| 1221 | 3300001979 | JGI24740J21852_10001594 | JGI24740J21852_100015948 | 449 |
| 1222 | 3300002075 | JGI24738J21930_10003743 | JGI24738J21930_100037432 | 449 |
| 1223 | 3300005339 | Ga0070660_100012565 | Ga0070660_1000125653 | 449 |
| 1224 | 3300005455 | Ga0070663_100008174 | Ga0070663_1000081744 | 449 |
| 1225 | 3300005563 | Ga0068855_100186637 | Ga0068855_1001866372 | 449 |
| 1226 | 3300005577 | Ga0068857_100279867 | Ga0068857_1002798671 | 449 |
| 1227 | 3300005614 | Ga0068856_100009010 | Ga0068856_1000090101 | 449 |
| 1228 | 3300009011 | Ga0105251_10031549 | Ga0105251_100315492 | 449 |
| 1229 | 3300009174 | Ga0105241_10001102 | Ga0105241_100011027 | 449 |
| 1230 | 3300009545 | Ga0105237_10010892 | Ga0105237_100108926 | 449 |
| 1231 | 3300013100 | Ga0157373_10010185 | Ga0157373_100101852 | 449 |
| 1232 | 3300013105 | Ga0157369_10104600 | Ga0157369_101046002 | 449 |
| 1233 | 3300013105 | Ga0157369_10177423 | Ga0157369_101774232 | 449 |
| 1234 | 3300013307 | Ga0157372_10234891 | Ga0157372_102348912 | 449 |
| 1235 | 3300017792 | Ga0163161_10043176 | Ga0163161_100431763 | 449 |
| 1236 | 3300025321 | Ga0207656_10025224 | Ga0207656_100252242 | 449 |
| 1237 | 3300025735 | Ga0207713_1036400 | Ga0207713_10364002 | 449 |
| 1238 | 3300025911 | Ga0207654_10008998 | Ga0207654_100089983 | 449 |
| 1239 | 3300025913 | Ga0207695_10036514 | Ga0207695_100365143 | 449 |
| 1240 | 3300025919 | Ga0207657_10062390 | Ga0207657_100623902 | 449 |
| 1241 | 3300025924 | Ga0207694_10011666 | Ga0207694_100116661 | 449 |
| 1242 | 3300025933 | Ga0207706_10046067 | Ga0207706_100460673 | 449 |
| 1243 | 3300025933 | Ga0207706_10120797 | Ga0207706_101207972 | 449 |
| 1244 | 3300025949 | Ga0207667_10090804 | Ga0207667_100908043 | 449 |
| 1245 | 3300025981 | Ga0207640_10017441 | Ga0207640_100174413 | 449 |
| 1246 | 3300026041 | Ga0207639_10000560 | Ga0207639_100005606 | 449 |
| 1247 | 3300026067 | Ga0207678_10002324 | Ga0207678_1000232418 | 449 |
| 1248 | 3300026078 | Ga0207702_10004405 | Ga0207702_100044053 | 449 |
| 1249 | 3300026116 | Ga0207674_10141337 | Ga0207674_101413372 | 449 |
| 1250 | 3300026142 | Ga0207698_10140736 | Ga0207698_101407362 | 449 |
| 1251 | 3300032004 | Ga0307414_10128900 | Ga0307414_101289002 | 449 |
| 1252 | 3300048913 | Ga0496110_0031938 | Ga0496110_0031938_391_1776 | 449 |
| 1253 | 3300048925 | Ga0496122_0002550 | Ga0496122_0002550_17479_18864 | 449 |
| 1254 | 3300048927 | Ga0496124_0004712 | Ga0496124_0004712_4767_6152 | 449 |
| 1255 | 3300048928 | Ga0496125_0001524 | Ga0496125_0001524_6235_7620 | 449 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kqw-assembly2.cif.gz_D | directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries | 0.9721 | 9 | 442 |
| 5kr3-assembly1.cif.gz_B | directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries | 0.9717 | 7 | 442 |
| 5kr5-assembly1.cif.gz_B | directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries | 0.9715 | 9 | 440 |
| 5kr6-assembly1.cif.gz_A | directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries | 0.971 | 9 | 440 |
| 5kqu-assembly1.cif.gz_A | directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries | 0.9704 | 9 | 442 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5kquA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9765 | 55 | 329 | 3.40.640.10 |
| af_A0A1D6DZK7_115_400_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.974 | 58 | 329 | 3.40.640.10 |
| 6fyqA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9708 | 55 | 331 | 3.40.640.10 |
| 6io1A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.97 | 55 | 331 | 3.40.640.10 |
| 5lhaB02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9683 | 55 | 329 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534ARV6-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.9917 | 333 | 449 |
GO:0008483
GO:0030170 |
| AF-A0A149SA99-F1-model_v4 | deleted | 0.9836 | 9 | 365 |
|
| AF-A0A3M1GGM4-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.976 | 1 | 300 |
GO:0005829
GO:0008483 GO:0030170 |
| AF-A0A534ARV6-F1-model_v4 | Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | 0.9752 | 333 | 449 |
GO:0008483
GO:0030170 |
| AF-A0A7C3AS51-F1-model_v4 | Aspartate aminotransferase family protein | 0.9732 | 52 | 439 |
GO:0008483
GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar