F492252

General Info

Members Datasets Scaffolds Average Seq Length
1255 1001 568 455

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2922386360|2922387161
Length 533
Sequence IGALAESCAKRRFEFERQWRASLKAGIRCRGDRQRKAKLPPSICCLGATAVFDILFWTRKHRDDRISVGVDLEDDMLSNSLIELDRAHLIHPVSSYRSHEAQGVRVLKSAKGATLTDVSGRQLLDGFAGLWCVNAGYGQDSIVEAAARQLRELPYATGYFGLGSDPAIRLAARLAELAPGDLNHVYFTLGGSDAVDSTIRFIRYYYHAKGRPQKDQFISVEYGYHGSSTAGSGLTALPAFHTGFGVPYSWQHKIPSHYAYRNPVGTHPQAIIAASVAALQAKISELGADRVAAFYVEPIQGSGGVLVPPPSWLKEMQAVCKEHDILFVADEVITGFGRVGPLFACEEDDVVPDLMTTAKGLTSGYVPMGAILMSDRVYNTIADGAGKTAVGHGYTYSAHPVSAAVGLACLDLYENGLLENGRKAGHRLMEGLRALADHPLVGDVRGRGMLAAIELVTDKKRKTPLPTEADAARRIFDRAWDNGLVIRAFAQGVLGFAPPLCCTDADIDGIIERTRSTLDQTLEDKDVRAAMKG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
25 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
33 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
34 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
35 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
36 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
37 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
38 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
39 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516143018 Ensifer sp. BR816 Isolate Nodule
45 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
46 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
47 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
48 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
49 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
50 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
51 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
52 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
53 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
54 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
57 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
58 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
59 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
60 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
61 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
62 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
63 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
64 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
65 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
66 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
70 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
71 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
72 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
73 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
74 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
75 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
78 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
79 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
80 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
81 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
82 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
83 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
84 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
85 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
86 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
87 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
88 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
89 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
90 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
91 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
92 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
93 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
94 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
95 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
96 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
97 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
98 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
99 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
100 2643221582 Rhizobium sp. Root651 Isolate Unclassified
101 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
102 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
103 2643221693 Rhizobium sp. Root491 Isolate Unclassified
104 2643221723 Ensifer sp. Root278 Isolate Unclassified
105 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
106 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
107 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
108 2718217882 Rhizobium sp. N741 Isolate Nodule
109 2718217927 Rhizobium sp. N324 Isolate Nodule
110 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
111 2718218009 Rhizobium sp. N561 Isolate Nodule
112 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
113 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
114 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
115 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
116 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
117 2718218363 Rhizobium sp. N113 Isolate Nodule
118 2718218365 Rhizobium sp. N731 Isolate Nodule
119 2718218366 Rhizobium sp. N621 Isolate Nodule
120 2718218423 Rhizobium sp. N941 Isolate Nodule
121 2721755514 Rhizobium sp. N6212 Isolate Nodule
122 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
123 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
124 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
125 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
126 2721755809 Rhizobium sp. N541 Isolate Nodule
127 2721755810 Rhizobium sp. N871 Isolate Nodule
128 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
129 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
130 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
131 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
132 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
133 2728369365 Rhizobium sp. N1341 Isolate Nodule
134 2728369397 Rhizobium sp. N1314 Isolate Nodule
135 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
136 2751185800 Brucella pituitosa AA2 Isolate Unclassified
137 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
138 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
139 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
140 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
141 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
142 2773857925 Microvirga vignae BR3299 Isolate Unclassified
143 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
144 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
145 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
146 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
147 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
148 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
149 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
150 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
151 2791355256 Rhizobium sp. M10 Isolate Nodule
152 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
153 2791355260 Rhizobium sp. L9 Isolate Nodule
154 2791355261 Rhizobium sp. J15 Isolate Nodule
155 2791355262 Rhizobium sp. M1 Isolate Nodule
156 2791355263 Rhizobium chutanense C5 Isolate Nodule
157 2791355264 Rhizobium sp. S9 Isolate Nodule
158 2791355266 Rhizobium sp. L43 Isolate Nodule
159 2791355267 Rhizobium sp. L18 Isolate Nodule
160 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
161 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
162 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
163 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
164 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
165 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
166 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
167 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
168 2802429633 Rhizobium anhuiense J3 Isolate Nodule
169 2802429634 Rhizobium anhuiense S10 Isolate Nodule
170 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
171 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
172 2802429637 Rhizobium anhuiense C15 Isolate Nodule
173 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
174 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
175 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
176 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
177 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
178 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
179 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
180 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
181 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
182 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
183 2838048938 Rhizobium pisi 27/80 Isolate Nodule
184 2838061910 Rhizobium phaseoli L15 Isolate Nodule
185 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
186 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
187 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
188 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
189 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
190 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
191 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
192 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
193 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
194 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
195 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
196 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
197 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
198 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
199 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
200 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
201 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
202 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
203 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
204 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
205 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
206 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
207 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
208 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
209 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
210 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
211 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
212 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
213 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
214 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
215 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
216 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
217 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
218 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
219 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
220 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
221 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
222 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
223 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
224 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
225 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
226 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
227 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
228 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
229 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
230 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
231 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
232 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
233 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
234 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
235 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
236 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
237 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
238 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
239 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
240 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
241 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
242 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
243 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
244 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
245 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
246 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
247 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
248 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
249 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
250 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
251 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
252 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
253 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
254 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
255 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
256 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
257 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
258 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
259 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
260 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
261 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
262 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
263 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
264 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
265 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
266 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
267 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
268 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
269 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
270 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
271 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
272 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
273 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
274 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
275 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
276 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
277 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
278 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
279 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
280 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
281 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
282 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
283 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
284 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
285 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
286 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
287 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
288 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
289 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
290 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
291 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
292 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
293 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
294 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
295 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
296 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
297 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
298 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
299 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
300 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
301 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
302 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
303 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
304 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
305 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
306 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
307 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
308 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
309 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
310 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
311 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
312 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
313 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
314 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
315 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
316 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
317 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
318 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
319 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
320 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
321 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
322 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
323 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
324 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
325 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
326 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
327 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
328 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
329 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
330 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
331 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
332 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
333 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
334 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
335 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
336 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
337 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
338 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
339 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
340 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
341 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
342 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
343 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
344 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
345 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
346 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
347 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
348 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
349 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
350 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
351 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
352 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
353 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
354 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
355 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
356 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
357 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
358 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
359 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
360 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
361 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
362 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
363 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
364 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
365 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
366 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
367 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
368 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
369 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
370 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
371 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
372 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
373 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
374 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
375 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
376 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
377 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
378 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
379 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
380 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
381 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
382 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
383 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
384 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
385 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
386 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
387 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
388 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
389 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
390 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
391 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
392 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
393 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
394 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
395 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
396 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
397 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
398 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
399 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
400 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
401 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
402 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
403 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
404 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
405 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
406 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
407 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
408 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
409 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
410 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
411 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
412 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
413 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
414 2933599457 Rhizobium phaseoli M3 Isolate Nodule
415 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
416 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
417 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
418 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
419 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
420 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
421 2936381700 Rhizobium chutanense C16 Isolate Unclassified
422 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
423 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
424 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
425 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
426 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
427 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
428 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
429 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
430 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
431 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
432 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
433 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
434 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
435 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
436 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
437 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
438 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
439 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
440 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
441 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
442 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
443 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
444 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
445 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
446 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
447 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
448 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
449 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
450 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
451 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
452 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
453 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
454 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
455 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
456 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
457 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
458 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
459 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
460 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
461 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
462 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
463 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
464 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
465 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
466 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
467 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
468 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
469 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
470 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
471 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
472 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
473 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
474 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
475 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
476 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
477 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
478 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
479 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
480 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
481 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
482 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
483 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
484 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
485 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
486 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
487 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
488 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
489 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
490 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
491 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
492 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
493 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
494 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
495 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
496 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
497 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
498 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
499 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
500 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
501 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
502 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
503 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
504 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
505 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
506 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
507 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
508 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
509 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
510 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
511 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
512 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
513 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
514 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
515 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
516 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
517 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
518 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
519 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
520 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
521 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
522 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
523 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
524 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
525 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
526 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
527 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
528 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
529 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
530 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
531 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
532 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
533 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
534 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
535 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
536 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
537 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
538 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
539 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
540 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
541 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
542 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
543 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
544 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
545 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
546 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
547 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
548 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
549 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
550 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
551 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
552 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
553 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
554 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
555 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
556 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
557 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
558 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
559 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
560 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
561 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
562 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
563 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
564 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
565 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
566 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
567 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
568 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
569 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
570 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
571 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
572 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
573 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
574 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
575 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
576 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
577 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
578 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
579 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
580 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
581 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
582 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
583 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
584 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
585 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
586 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
587 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
588 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
589 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
590 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
591 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
592 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
593 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
594 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
595 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
596 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
597 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
598 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
599 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
600 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
601 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
602 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
603 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
604 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
605 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
606 2996887358 Rhizobium sp. R711 Isolate Nodule
607 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
608 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
609 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
610 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
611 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
612 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
613 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
614 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
615 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
616 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
617 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
618 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
619 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
620 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
621 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
622 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
623 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
624 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
625 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
626 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
627 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
628 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
629 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
630 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
631 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
632 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
633 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
634 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
635 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
636 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
637 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
638 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
639 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
640 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
641 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
642 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
643 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
644 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
645 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
646 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
647 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
648 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
649 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
650 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
651 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
652 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
653 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
654 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
655 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
656 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
657 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
658 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
659 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
660 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
661 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
662 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
663 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
664 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
665 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
666 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
667 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
668 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
669 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
670 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
671 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
672 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
673 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
674 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
675 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
676 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
677 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
678 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
679 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
680 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
681 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
682 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
683 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
684 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
685 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
686 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
687 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
688 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
689 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
690 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
691 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
692 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
693 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
694 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
695 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
696 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
697 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
698 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
699 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
700 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
701 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
702 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
703 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
704 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
705 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
706 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
707 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
708 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
709 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
710 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
711 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
712 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
713 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
714 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
715 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
716 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
717 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
718 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
719 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
720 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
721 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
722 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
723 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
724 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
725 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
726 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
727 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
728 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
729 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
730 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
731 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
732 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
733 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
734 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
735 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
736 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
737 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
738 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
739 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
740 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
741 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
742 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
743 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
744 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
745 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
746 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
747 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
748 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
749 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
750 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
751 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
752 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
753 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
754 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
755 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
756 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
757 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
758 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
774 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
775 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
776 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
778 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
779 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
780 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
781 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
782 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
783 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
784 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
785 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
786 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
788 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
790 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
791 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
792 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
793 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
794 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
795 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
796 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
797 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
798 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
799 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
800 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
801 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
802 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
803 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
804 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
805 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
806 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
807 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
808 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
809 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
810 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
811 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
812 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
813 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
814 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
815 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
816 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
817 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
818 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
819 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
820 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
821 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
822 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
823 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
824 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
825 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
826 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
827 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
828 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
829 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
830 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
831 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
832 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
833 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
834 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
835 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
836 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
837 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
838 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
839 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
840 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
841 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
842 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
843 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
844 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
845 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
846 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
847 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
848 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
849 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
850 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
851 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
852 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
853 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
854 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
855 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
856 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
857 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
858 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
859 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
860 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
861 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
862 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
863 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
864 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
865 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
866 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
867 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
868 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
869 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
870 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
871 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
872 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
873 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
874 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
875 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
876 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
877 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
878 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
879 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
880 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
881 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
882 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
883 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
884 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
885 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
886 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
887 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
888 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
889 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
890 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
891 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
892 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
893 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
894 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
895 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
896 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
897 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
898 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
899 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
900 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
901 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
902 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
903 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
904 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
905 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
906 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
907 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
908 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
909 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
910 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
911 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
912 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
913 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
914 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
915 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
916 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
917 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
918 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
919 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
920 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
921 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
922 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
923 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
924 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
925 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
926 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
927 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
928 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
929 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
930 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
931 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
932 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
933 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
934 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
935 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
936 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
937 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
938 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
939 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
940 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
941 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
942 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
943 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
944 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
945 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
946 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
947 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
948 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
949 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
950 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
951 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
952 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
953 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
954 8005275841 Rhizobium sp. N4311 Isolate Nodule
955 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
956 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
957 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
958 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
959 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
960 8005321885 Rhizobium sp. R72 Isolate Nodule
961 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
962 8005382845 Rhizobium sp. R634 Isolate Nodule
963 8005395548 Rhizobium sp. R339 Isolate Nodule
964 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
965 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
966 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
967 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
968 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
969 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
970 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
971 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
972 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
973 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
974 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
975 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
976 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
977 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
978 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
979 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
980 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
981 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
982 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
983 8018176218 Rhizobium sp. N122 Isolate Nodule
984 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
985 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
986 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
987 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
988 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
989 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
990 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
991 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
992 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
993 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
994 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
995 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
996 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
997 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
998 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
999 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1000 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1001 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.34
Metatranscriptomes 0
Isolates 54.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 14.18
Nodule 44.7
Rhizoplane 1.91
Rhizosphere 25.42
Stem 0
Stem Tuber 0
Unclassified 13.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000196 3300001904 Bacteria 10841
2 JGI24741J21665_1000024 3300001915 Bacteria 36239
3 JGI24740J21852_10001594 3300001979 Bacteria 10423
4 JGI24740J21852_10006396 3300001979 Bacteria 4883
5 JGI24739J22299_10001518 3300001989 Bacteria 8763
6 JGI24738J21930_10003743 3300002075 Bacteria 3801
7 JGI25155J39150_1000003 3300002704 Bacteria 279666
8 JGI25155J39150_1000729 3300002704 Bacteria 5708
9 JGI25156J39149_1000004 3300002705 Bacteria 273027
10 JGI25162J39368_1000069 3300002737 Bacteria 125244
11 JGI25154J39366_1000013 3300002738 Bacteria 268260
12 JGI25154J39366_1000772 3300002738 Bacteria 14196
13 JGI25157J39369_1000004 3300002741 Bacteria 273009
14 JGI25152J39213_1000186 3300002773 Bacteria 41823
15 JGI25159J45721_1000019 3300002987 Bacteria 127304
16 JGI25151J46595_10000867 3300003187 Bacteria 23973
17 JGI25165J46597_1000018 3300003214 Bacteria 374701
18 JGI25165J46597_1000020 3300003214 Bacteria 370477
19 JGI25165J46597_1000372 3300003214 Bacteria 50057
20 JGI25165J46597_1005415 3300003214 Bacteria 2462
21 JGI25153J46596_10000200 3300003215 Bacteria 55694
22 JGI25153J46596_10000829 3300003215 Bacteria 18882
23 JGI25153J46596_10020305 3300003215 Bacteria 2515
24 rootH1_10018479 3300003316 Bacteria 3044
25 rootH1_10010878 3300003323 Bacteria 5360
26 rootH1_10084286 3300003323 Bacteria 6026
27 JGI25160J50197_1000054 3300003354 Bacteria 127304
28 JGI25160J50197_1000203 3300003354 Bacteria 49418
29 JGI25160J50197_1002223 3300003354 Bacteria 9111
30 JGI25161J50226_1000570 3300003374 Bacteria 15614
31 JGI25161J50226_1002643 3300003374 Bacteria 4485
32 JGI25161J50226_1003970 3300003374 Bacteria 3214
33 Ga0055538_1000008 3300003751 Bacteria 398547
34 Ga0055538_1000302 3300003751 Bacteria 24606
35 Ga0055539_1000012 3300003752 Bacteria 398547
36 Ga0055533_1000015 3300003756 Bacteria 398547
37 Ga0055525_1000017 3300003759 Bacteria 398547
38 Ga0055542_1000068 3300003762 Bacteria 152353
39 Ga0055526_1000308 3300003771 Bacteria 40807
40 Ga0055526_1002146 3300003771 Bacteria 13527
41 Ga0055524_1002400 3300003775 Bacteria 9714
42 Ga0055524_1017598 3300003775 Bacteria 2517
43 Ga0055536_1000640 3300003781 Bacteria 23814
44 Ga0055536_1001374 3300003781 Bacteria 14794
45 Ga0055536_1004941 3300003781 Bacteria 6642
46 Ga0055528_1000054 3300003790 Bacteria 90334
47 Ga0055528_1000611 3300003790 Bacteria 26673
48 Ga0055540_1000131 3300003792 Bacteria 75615
49 Ga0055531_10000207 3300003794 Bacteria 64818
50 Ga0055531_10003719 3300003794 Bacteria 9591
51 Ga0055531_10020782 3300003794 Bacteria 2579
52 Ga0055541_1000009 3300003841 Bacteria 398547
53 Ga0058692_1004401 3300003856 Bacteria 4182
54 Ga0055543_1000150 3300004625 Bacteria 58353
55 Ga0055543_1000349 3300004625 Bacteria 31437
56 Ga0055543_1001165 3300004625 Bacteria 11186
57 Ga0065165_1000136 3300005262 Bacteria 127754
58 Ga0065165_1000672 3300005262 Bacteria 49172
59 Ga0070670_100025939 3300005331 Bacteria 5043
60 Ga0070666_10002707 3300005335 Bacteria 10698
61 Ga0068868_100011890 3300005338 Bacteria 6347
62 Ga0070660_100012565 3300005339 Bacteria 6048
63 Ga0070661_100062021 3300005344 Bacteria 2745
64 Ga0070668_100046856 3300005347 Bacteria 3322
65 Ga0070671_100017186 3300005355 Bacteria 5855
66 Ga0070674_100034053 3300005356 Bacteria 3398
67 Ga0070667_100009753 3300005367 Bacteria 7961
68 Ga0070709_10004117 3300005434 Bacteria 7841
69 Ga0070713_100020550 3300005436 Bacteria 5065
70 Ga0070710_10001455 3300005437 Bacteria 11172
71 Ga0070663_100006884 3300005455 Bacteria 6881
72 Ga0070663_100008174 3300005455 Bacteria 6420
73 Ga0070681_10053293 3300005458 Bacteria 4031
74 Ga0070685_10001923 3300005466 Bacteria 10778
75 Ga0070699_100068180 3300005518 Bacteria 3089
76 Ga0070665_100000227 3300005548 Bacteria 93439
77 Ga0070665_100040698 3300005548 Bacteria 4671
78 Ga0070665_100059322 3300005548 Bacteria 3836
79 Ga0070665_100153116 3300005548 Bacteria 2308
80 Ga0068855_100001019 3300005563 Bacteria 34917
81 Ga0068855_100153664 3300005563 Bacteria 2615
82 Ga0068855_100186637 3300005563 Bacteria 2341
83 Ga0068857_100120684 3300005577 Bacteria 2360
84 Ga0068857_100279867 3300005577 Bacteria 1534
85 Ga0068854_100010398 3300005578 Bacteria 6033
86 Ga0068854_100031331 3300005578 Bacteria 3694
87 Ga0068854_100063002 3300005578 Bacteria 2691
88 Ga0068856_100009010 3300005614 Bacteria 9709
89 Ga0068856_100009837 3300005614 Bacteria 9287
90 Ga0068856_100017742 3300005614 Bacteria 6902
91 Ga0068856_100154918 3300005614 Bacteria 2301
92 Ga0068852_100000915 3300005616 Bacteria 19555
93 Ga0068852_100201722 3300005616 Bacteria 1882
94 Ga0068852_100206905 3300005616 Bacteria 1859
95 Ga0068864_100187555 3300005618 Bacteria 1894
96 Ga0068851_10001399 3300005834 Bacteria 10544
97 Ga0068863_100051283 3300005841 Bacteria 3911
98 Ga0068863_100106350 3300005841 Bacteria 2670
99 Ga0068858_100004031 3300005842 Bacteria 14495
100 Ga0068862_100176133 3300005844 Bacteria 1917
101 Ga0081540_1003849 3300005983 Bacteria 11723
102 Ga0070717_10064195 3300006028 Bacteria 3049
103 Ga0075365_10000531 3300006038 Bacteria 14672
104 Ga0075365_10009053 3300006038 Bacteria 5695
105 Ga0075365_10010720 3300006038 Bacteria 5353
106 Ga0075365_10017374 3300006038 Bacteria 4400
107 Ga0075365_10019715 3300006038 Bacteria 4169
108 Ga0075365_10022527 3300006038 Bacteria 3948
109 Ga0075365_10030791 3300006038 Bacteria 3440
110 Ga0075365_10081484 3300006038 Bacteria 2193
111 Ga0075368_10034284 3300006042 Bacteria 1977
112 Ga0075363_100000058 3300006048 Bacteria 22322
113 Ga0075364_10014932 3300006051 Bacteria 4808
114 Ga0070712_100016628 3300006175 Bacteria 4752
115 Ga0075362_10010898 3300006177 Bacteria 3567
116 Ga0075362_10015935 3300006177 Bacteria 3068
117 Ga0075362_10040411 3300006177 Bacteria 2053
118 Ga0075367_10000241 3300006178 Bacteria 18607
119 Ga0075367_10049377 3300006178 Bacteria 2480
120 Ga0075367_10094119 3300006178 Bacteria 1826
121 Ga0075369_10002765 3300006186 Bacteria 6298
122 Ga0075369_10004181 3300006186 Bacteria 5319
123 Ga0075369_10006567 3300006186 Bacteria 4402
124 Ga0075369_10009584 3300006186 Bacteria 3766
125 Ga0075366_10006620 3300006195 Bacteria 6359
126 Ga0075370_10008090 3300006353 Bacteria 5396
127 Ga0075428_100005444 3300006844 Bacteria 14149
128 Ga0075428_100117841 3300006844 Bacteria 2892
129 Ga0075430_100010143 3300006846 Bacteria 7973
130 Ga0075430_100012612 3300006846 Bacteria 7197
131 Ga0075431_100000183 3300006847 Bacteria 45154
132 Ga0099825_1029359 3300006941 Bacteria 2561
133 Ga0099824_1023232 3300006942 Bacteria 3891
134 Ga0099822_1023504 3300006943 Bacteria 5663
135 Ga0099826_10000665 3300006948 Bacteria 17773
136 Ga0105251_10031549 3300009011 Bacteria 2650
137 Ga0105244_10048482 3300009036 Bacteria 2174
138 Ga0105240_10000217 3300009093 Bacteria 115649
139 Ga0105240_10001044 3300009093 Bacteria 49217
140 Ga0105240_10136724 3300009093 Bacteria 2934
141 Ga0105240_10176549 3300009093 Bacteria 2525
142 Ga0114129_10032402 3300009147 Bacteria 7386
143 Ga0105243_10007647 3300009148 Bacteria 8304
144 Ga0105243_10018759 3300009148 Bacteria 5240
145 Ga0105241_10001102 3300009174 Bacteria 20563
146 Ga0105242_10210522 3300009176 Bacteria 1732
147 Ga0105248_10029402 3300009177 Bacteria 6129
148 Ga0105237_10000978 3300009545 Bacteria 38384
149 Ga0105237_10003836 3300009545 Bacteria 17674
150 Ga0105237_10010892 3300009545 Bacteria 9648
151 Ga0105237_10016626 3300009545 Bacteria 7642
152 Ga0105237_10045493 3300009545 Bacteria 4416
153 Ga0105237_10116983 3300009545 Bacteria 2659
154 Ga0105238_10000111 3300009551 Bacteria 89931
155 Ga0105238_10006969 3300009551 Bacteria 11292
156 Ga0105238_10073563 3300009551 Bacteria 3412
157 Ga0105238_10148003 3300009551 Bacteria 2324
158 Ga0105238_10209138 3300009551 Bacteria 1927
159 Ga0105249_10007119 3300009553 Bacteria 9765
160 Ga0105249_10085551 3300009553 Bacteria 2939
161 Ga0123341_1000093 3300009765 Bacteria 37635
162 Ga0123342_1019635 3300009766 Bacteria 5107
163 Ga0123342_1024823 3300009766 Bacteria 3698
164 Ga0105239_10008101 3300010375 Bacteria 11995
165 Ga0105239_10027600 3300010375 Bacteria 6247
166 Ga0105239_10164192 3300010375 Bacteria 2483
167 Ga0157373_10004938 3300013100 Bacteria 10032
168 Ga0157373_10010185 3300013100 Bacteria 6925
169 Ga0157371_10000002 3300013102 Bacteria 665040
170 Ga0157370_10003627 3300013104 Bacteria 18062
171 Ga0157370_10005183 3300013104 Bacteria 14691
172 Ga0157369_10104600 3300013105 Bacteria 3014
173 Ga0157369_10177423 3300013105 Bacteria 2243
174 Ga0171463_1002 3300013249 Bacteria 1274851
175 Ga0157374_10035329 3300013296 Bacteria 4573
176 Ga0157372_10234891 3300013307 Bacteria 2126
177 Ga0163163_10000004 3300014325 Bacteria 416569
178 Ga0163163_10013631 3300014325 Bacteria 7444
179 Ga0182007_10004509 3300015262 Bacteria 6295
180 Ga0182005_1014944 3300015265 Bacteria 2168
181 Ga0183363_1041 3300015690 Bacteria 42461
182 Ga0163161_10043176 3300017792 Bacteria 3246
183 Ga0214544_1000018 3300021320 Bacteria 187095
184 Ga0214544_1009587 3300021320 Bacteria 15037
185 Ga0214542_1000307 3300021321 Bacteria 83288
186 Ga0214542_1001549 3300021321 Bacteria 47303
187 Ga0214542_1018955 3300021321 Bacteria 5622
188 Ga0214545_1005475 3300021324 Bacteria 22886
189 Ga0214543_1000195 3300021327 Bacteria 89886
190 Ga0214543_1007141 3300021327 Bacteria 19391
191 Ga0214543_1011326 3300021327 Bacteria 12581
192 Ga0228711_1004587 3300022739 Bacteria 21197
193 Ga0228710_1004744 3300022740 Bacteria 21386
194 Ga0209435_100006 3300025206 Bacteria 542459
195 Ga0209436_100404 3300025208 Bacteria 19502
196 Ga0209436_102987 3300025208 Bacteria 4703
197 Ga0209784_100005 3300025224 Bacteria 1040422
198 Ga0209784_100312 3300025224 Bacteria 25509
199 Ga0209566_100005 3300025225 Bacteria 1040422
200 Ga0209674_100009 3300025226 Bacteria 1040422
201 Ga0209672_105623 3300025228 Bacteria 2126
202 Ga0209563_100012 3300025230 Bacteria 1040422
203 Ga0209437_100022 3300025233 Bacteria 625694
204 Ga0207425_1002753 3300025245 Bacteria 5977
205 Ga0207425_1003951 3300025245 Bacteria 4572
206 Ga0209646_1000015 3300025246 Bacteria 542459
207 Ga0209646_1000108 3300025246 Bacteria 158853
208 Ga0209026_1000039 3300025250 Bacteria 280608
209 Ga0209677_100006 3300025253 Bacteria 1040422
210 Ga0209677_100826 3300025253 Bacteria 15447
211 Ga0209148_1000078 3300025254 Bacteria 296101
212 Ga0209148_1000790 3300025254 Bacteria 23555
213 Ga0209148_1006123 3300025254 Bacteria 2643
214 Ga0209148_1010791 3300025254 Bacteria 1721
215 Ga0209759_1000005 3300025256 Bacteria 542459
216 Ga0209759_1001092 3300025256 Bacteria 17633
217 Ga0209759_1019371 3300025256 Bacteria 1615
218 Ga0209129_1000255 3300025258 Bacteria 55335
219 Ga0209129_1000669 3300025258 Bacteria 22694
220 Ga0209233_1000031 3300025261 Bacteria 624646
221 Ga0209233_1000047 3300025261 Bacteria 459614
222 Ga0209233_1000324 3300025261 Bacteria 51086
223 Ga0209233_1000330 3300025261 Bacteria 48662
224 Ga0209233_1011262 3300025261 Bacteria 2640
225 Ga0209455_1000193 3300025272 Bacteria 90413
226 Ga0209455_1000641 3300025272 Bacteria 21437
227 Ga0209455_1005792 3300025272 Bacteria 3755
228 Ga0209455_1009389 3300025272 Bacteria 2573
229 Ga0209673_1000067 3300025273 Bacteria 249077
230 Ga0209673_1000291 3300025273 Bacteria 93803
231 Ga0209673_1000473 3300025273 Bacteria 67570
232 Ga0209673_1000642 3300025273 Bacteria 52672
233 Ga0209673_1013619 3300025273 Bacteria 3198
234 Ga0209130_1000120 3300025284 Bacteria 127890
235 Ga0209130_1000242 3300025284 Bacteria 69580
236 Ga0209675_1014646 3300025291 Bacteria 2375
237 Ga0209676_1000470 3300025292 Bacteria 67541
238 Ga0209676_1001059 3300025292 Bacteria 31510
239 Ga0209676_1001988 3300025292 Bacteria 16222
240 Ga0209676_1002891 3300025292 Bacteria 11278
241 Ga0209676_1022144 3300025292 Bacteria 2113
242 Ga0209025_1000240 3300025294 Bacteria 128397
243 Ga0209025_1000430 3300025294 Bacteria 83230
244 Ga0209025_1000708 3300025294 Bacteria 56788
245 Ga0209025_1001534 3300025294 Bacteria 29500
246 Ga0209025_1006332 3300025294 Bacteria 9231
247 Ga0209564_1000092 3300025295 Bacteria 249018
248 Ga0209564_1000338 3300025295 Bacteria 90246
249 Ga0209564_1000876 3300025295 Bacteria 40029
250 Ga0209564_1018490 3300025295 Bacteria 2652
251 Ga0209758_1000131 3300025297 Bacteria 184259
252 Ga0209758_1000490 3300025297 Bacteria 64714
253 Ga0209758_1000508 3300025297 Bacteria 62735
254 Ga0209758_1000610 3300025297 Bacteria 55335
255 Ga0209758_1008376 3300025297 Bacteria 6719
256 Ga0209050_1001238 3300025298 Bacteria 29567
257 Ga0209050_1006857 3300025298 Bacteria 6611
258 Ga0209050_1009556 3300025298 Bacteria 4944
259 Ga0209050_1013160 3300025298 Bacteria 3706
260 Ga0209256_1000788 3300025299 Bacteria 40932
261 Ga0209256_1001230 3300025299 Bacteria 28470
262 Ga0209256_1001843 3300025299 Bacteria 19673
263 Ga0209256_1002067 3300025299 Bacteria 17689
264 Ga0207426_1000075 3300025302 Bacteria 321337
265 Ga0207426_1000206 3300025302 Bacteria 140737
266 Ga0207426_1000483 3300025302 Bacteria 60265
267 Ga0209051_1000038 3300025303 Bacteria 320926
268 Ga0209051_1002802 3300025303 Bacteria 12031
269 Ga0209051_1002894 3300025303 Bacteria 11792
270 Ga0209051_1016836 3300025303 Bacteria 3285
271 Ga0209257_1000545 3300025304 Bacteria 64769
272 Ga0209257_1001781 3300025304 Bacteria 23741
273 Ga0209257_1003568 3300025304 Bacteria 13193
274 Ga0209257_1003646 3300025304 Bacteria 12935
275 Ga0207656_10025224 3300025321 Bacteria 2411
276 Ga0207655_1051164 3300025728 Bacteria 1672
277 Ga0207713_1036400 3300025735 Bacteria 2111
278 Ga0207692_10012086 3300025898 Bacteria 3697
279 Ga0207680_10001300 3300025903 Bacteria 11819
280 Ga0207647_10000500 3300025904 Bacteria 31386
281 Ga0207647_10001555 3300025904 Bacteria 17635
282 Ga0207647_10003982 3300025904 Bacteria 11020
283 Ga0207699_10001044 3300025906 Bacteria 13060
284 Ga0207654_10008998 3300025911 Bacteria 5067
285 Ga0207654_10058718 3300025911 Bacteria 2241
286 Ga0207695_10000007 3300025913 Bacteria 1092551
287 Ga0207695_10001205 3300025913 Bacteria 44411
288 Ga0207695_10022351 3300025913 Bacteria 7182
289 Ga0207695_10031196 3300025913 Bacteria 5851
290 Ga0207695_10036514 3300025913 Bacteria 5312
291 Ga0207695_10130548 3300025913 Bacteria 2471
292 Ga0207671_10000793 3300025914 Bacteria 40024
293 Ga0207671_10003510 3300025914 Bacteria 15568
294 Ga0207671_10008685 3300025914 Bacteria 8577
295 Ga0207671_10209851 3300025914 Bacteria 1523
296 Ga0207693_10025190 3300025915 Bacteria 4717
297 Ga0207657_10062390 3300025919 Bacteria 3191
298 Ga0207694_10000199 3300025924 Bacteria 60220
299 Ga0207694_10005080 3300025924 Bacteria 10170
300 Ga0207694_10007856 3300025924 Bacteria 8077
301 Ga0207694_10009453 3300025924 Bacteria 7349
302 Ga0207694_10011666 3300025924 Bacteria 6628
303 Ga0207694_10039024 3300025924 Bacteria 3653
304 Ga0207650_10010601 3300025925 Bacteria 6329
305 Ga0207644_10021404 3300025931 Bacteria 4404
306 Ga0207706_10020155 3300025933 Bacteria 5992
307 Ga0207706_10046067 3300025933 Bacteria 3862
308 Ga0207706_10107587 3300025933 Bacteria 2454
309 Ga0207706_10120797 3300025933 Bacteria 2304
310 Ga0207669_10066859 3300025937 Bacteria 2237
311 Ga0207704_10053054 3300025938 Bacteria 2462
312 Ga0207665_10001859 3300025939 Bacteria 14230
313 Ga0207691_10078053 3300025940 Bacteria 2981
314 Ga0207711_10040250 3300025941 Bacteria 3976
315 Ga0207667_10000028 3300025949 Bacteria 334510
316 Ga0207667_10090804 3300025949 Bacteria 3156
317 Ga0207712_10000169 3300025961 Bacteria 67461
318 Ga0207712_10024258 3300025961 Bacteria 4014
319 Ga0207668_10033246 3300025972 Bacteria 3414
320 Ga0207668_10047884 3300025972 Bacteria 2930
321 Ga0207640_10001595 3300025981 Bacteria 12185
322 Ga0207640_10017441 3300025981 Bacteria 4200
323 Ga0207658_10013181 3300025986 Bacteria 5645
324 Ga0207703_10001066 3300026035 Bacteria 26163
325 Ga0207639_10000560 3300026041 Bacteria 25545
326 Ga0207678_10002324 3300026067 Bacteria 17232
327 Ga0207678_10033763 3300026067 Bacteria 4456
328 Ga0207678_10035730 3300026067 Bacteria 4327
329 Ga0207702_10004405 3300026078 Bacteria 12541
330 Ga0207702_10013019 3300026078 Bacteria 6918
331 Ga0207702_10034297 3300026078 Bacteria 4242
332 Ga0207641_10094135 3300026088 Bacteria 2627
333 Ga0207648_10084397 3300026089 Bacteria 2770
334 Ga0207674_10124592 3300026116 Bacteria 2543
335 Ga0207674_10141337 3300026116 Bacteria 2366
336 Ga0207675_100107710 3300026118 Bacteria 2628
337 Ga0207683_10091692 3300026121 Bacteria 2707
338 Ga0207683_10181519 3300026121 Bacteria 1908
339 Ga0207698_10140736 3300026142 Bacteria 2078
340 Ga0209281_1000491 3300027111 Bacteria 54084
341 Ga0209281_1000981 3300027111 Bacteria 22781
342 Ga0209389_1004138 3300027296 Bacteria 11968
343 Ga0209371_1000003 3300027312 Bacteria 1122971
344 Ga0209371_1000324 3300027312 Bacteria 52237
345 Ga0209589_1002342 3300027357 Bacteria 32707
346 Ga0209589_1007145 3300027357 Bacteria 18101
347 Ga0209489_106154 3300027361 Bacteria 19664
348 Ga0209489_106733 3300027361 Bacteria 18101
349 Ga0209700_100005 3300027363 Bacteria 573969
350 Ga0209282_1000108 3300027666 Bacteria 54085
351 Ga0209282_1000604 3300027666 Bacteria 17667
352 Ga0209813_10001351 3300027866 Bacteria 5499
353 Ga0268266_10000006 3300028379 Bacteria 1410021
354 Ga0268266_10029411 3300028379 Bacteria 4671
355 Ga0268266_10033739 3300028379 Bacteria 4351
356 Ga0268266_10096000 3300028379 Bacteria 2604
357 Ga0268264_10127213 3300028381 Bacteria 2254
358 Ga0307515_10001625 3300028794 Bacteria 50019
359 Ga0307515_10001999 3300028794 Bacteria 45141
360 Ga0307515_10051586 3300028794 Bacteria 6128
361 Ga0307515_10233095 3300028794 Bacteria 1629
362 Ga0265338_10189785 3300028800 Bacteria 1559
363 Ga0268256_1000004 3300030500 Bacteria 1122967
364 Ga0268256_1001615 3300030500 Bacteria 13064
365 Ga0307513_10095186 3300031456 Bacteria 3020
366 Ga0307408_100000948 3300031548 Bacteria 22509
367 Ga0307514_10000850 3300031649 Bacteria 49169
368 Ga0307405_10019055 3300031731 Bacteria 3801
369 Ga0307406_10064691 3300031901 Bacteria 2374
370 Ga0307412_10007012 3300031911 Bacteria 6395
371 Ga0315914_1000427 3300031967 Bacteria 51660
372 Ga0307416_100082647 3300032002 Bacteria 2721
373 Ga0307414_10128900 3300032004 Bacteria 1960
374 Ga0307411_10099176 3300032005 Bacteria 2055
375 Ga0315913_1001358 3300033430 Bacteria 26703
376 Ga0315915_1000032 3300033464 Bacteria 87024
377 Ga0316574_0008040 3300035398 Bacteria 5830
378 Ga0316574_0032447 3300035398 Bacteria 3174
379 Ga0373927_0000581 3300035695 Bacteria 27838
380 Ga0316584_0142313 3300036712 Bacteria 1788
381 Ga0373925_0003311 3300037068 Bacteria 12517
382 Ga0395900_0170554 3300037418 Bacteria 2216
383 Ga0395905_0001624 3300037471 Bacteria 26721
384 Ga0395905_0018526 3300037471 Bacteria 6608
385 Ga0395905_0168297 3300037471 Bacteria 2059
386 Ga0395901_0037069 3300038443 Bacteria 5043
387 Ga0395901_0099665 3300038443 Bacteria 3047
388 Ga0400487_39107 3300039110 Bacteria 2418
389 Ga0436365_1690000 3300039437 Bacteria 1545
390 Ga0436361_0082211 3300039447 Bacteria 2449
391 Ga0436361_1160430 3300039447 Bacteria 8197
392 Ga0439436_0032326 3300041404 Bacteria 1518
393 Ga0439465_0001210 3300041413 Bacteria 8327
394 Ga0439465_0008515 3300041413 Bacteria 3236
395 Ga0451849_0513859 3300041505 Bacteria 2226
396 Ga0451851_0276965 3300041507 Bacteria 1852
397 Ga0451843_1077282 3300041509 Bacteria 2036
398 Ga0451853_1283853 3300041512 Bacteria 2226
399 Ga0439432_003974 3300042006 Bacteria 5431
400 Ga0439449_0019041 3300042007 Bacteria 2574
401 Ga0450906_003989 3300042145 Bacteria 3124
402 Ga0450907_007441 3300042146 Bacteria 1828
403 Ga0439446_0009399 3300042156 Bacteria 2617
404 Ga0439434_0010852 3300042435 Bacteria 2690
405 Ga0439434_0015659 3300042435 Bacteria 2261
406 Ga0450918_000330 3300042531 Bacteria 10599
407 Ga0466963_0008944 3300044694 Bacteria 6011
408 Ga0466968_0006460 3300044735 Bacteria 4420
409 Ga0466970_0000136 3300044765 Bacteria 33881
410 Ga0466959_0056743 3300045049 Bacteria 2857
411 Ga0451576_0121180 3300045051 Bacteria 2723
412 Ga0466958_0004964 3300045836 Bacteria 7096
413 Ga0495617_006379 3300046452 Bacteria 4139
414 Ga0495629_0009432 3300046459 Bacteria 7137
415 Ga0495638_0001519 3300046460 Bacteria 20885
416 Ga0495650_0060858 3300046471 Bacteria 1515
417 Ga0495605_0020476 3300046474 Bacteria 3514
418 Ga0495585_0033722 3300046492 Bacteria 2897
419 Ga0495585_0099629 3300046492 Bacteria 1555
420 Ga0495606_0006572 3300046507 Bacteria 10689
421 Ga0495606_0021433 3300046507 Bacteria 4733
422 Ga0495606_0079141 3300046507 Bacteria 2048
423 Ga0495610_0016880 3300046512 Bacteria 4183
424 Ga0495620_0001877 3300046515 Bacteria 12353
425 Ga0495637_0014296 3300046520 Bacteria 3744
426 Ga0495643_0001015 3300046522 Bacteria 28687
427 Ga0495643_0038695 3300046522 Bacteria 2611
428 Ga0495648_0043713 3300046524 Bacteria 2805
429 Ga0495654_0000920 3300046530 Bacteria 21891
430 Ga0495597_0007987 3300046542 Bacteria 5324
431 Ga0495622_0001480 3300046557 Bacteria 11803
432 Ga0495633_0044363 3300046558 Bacteria 2107
433 Ga0495633_0063020 3300046558 Bacteria 1735
434 Ga0495668_0027729 3300046616 Bacteria 3209
435 Ga0495625_0014937 3300046660 Bacteria 6173
436 Ga0495625_0028129 3300046660 Bacteria 4219
437 Ga0495625_0169879 3300046660 Bacteria 1456
438 Ga0495635_0069085 3300046663 Bacteria 2422
439 Ga0495661_0038541 3300046665 Bacteria 2976
440 Ga0495588_0000630 3300046674 Bacteria 16434
441 Ga0495600_0091745 3300046809 Bacteria 1981
442 Ga0495604_0000886 3300047317 Bacteria 24880
443 Ga0495672_0017946 3300047320 Bacteria 4716
444 Ga0495672_0037928 3300047320 Bacteria 2945
445 Ga0495687_008305 3300047443 Bacteria 5965
446 Ga0495681_0002578 3300047470 Bacteria 12873
447 Ga0495681_0009025 3300047470 Bacteria 6184
448 Ga0496101_0015346 3300048904 Bacteria 5161
449 Ga0496102_0003274 3300048905 Bacteria 13725
450 Ga0496103_0005911 3300048906 Bacteria 7315
451 Ga0496104_0012545 3300048907 Bacteria 7624
452 Ga0496105_0003825 3300048908 Bacteria 11230
453 Ga0496106_0006011 3300048909 Bacteria 8977
454 Ga0496108_0026952 3300048911 Bacteria 4742
455 Ga0496109_0018060 3300048912 Bacteria 6192
456 Ga0496110_0010594 3300048913 Bacteria 7505
457 Ga0496110_0020290 3300048913 Bacteria 5611
458 Ga0496110_0031938 3300048913 Bacteria 4545
459 Ga0496112_0010380 3300048915 Bacteria 8445
460 Ga0496112_0084625 3300048915 Bacteria 3137
461 Ga0496112_0090216 3300048915 Bacteria 3034
462 Ga0496116_0031320 3300048919 Bacteria 3810
463 Ga0496116_0144165 3300048919 Bacteria 1334
464 Ga0496117_0000016 3300048920 Bacteria 523642
465 Ga0496117_0041396 3300048920 Bacteria 3376
466 Ga0496117_0077648 3300048920 Bacteria 2196
467 Ga0496118_0000153 3300048921 Bacteria 122419
468 Ga0496118_0001953 3300048921 Bacteria 29213
469 Ga0496118_0023476 3300048921 Bacteria 5355
470 Ga0496118_0060873 3300048921 Bacteria 2800
471 Ga0496119_0007331 3300048922 Bacteria 9975
472 Ga0496119_0021185 3300048922 Bacteria 4708
473 Ga0496119_0026665 3300048922 Bacteria 3998
474 Ga0496119_0045015 3300048922 Bacteria 2771
475 Ga0496119_0053504 3300048922 Bacteria 2465
476 Ga0496120_0000660 3300048923 Bacteria 50656
477 Ga0496120_0004196 3300048923 Bacteria 12311
478 Ga0496120_0006449 3300048923 Bacteria 9012
479 Ga0496121_0000191 3300048924 Bacteria 136529
480 Ga0496121_0001476 3300048924 Bacteria 39569
481 Ga0496121_0016949 3300048924 Bacteria 7484
482 Ga0496121_0023957 3300048924 Bacteria 5854
483 Ga0496121_0077608 3300048924 Bacteria 2644
484 Ga0496121_0159878 3300048924 Bacteria 1649
485 Ga0496122_0000002 3300048925 Bacteria 905834
486 Ga0496122_0002358 3300048925 Bacteria 27165
487 Ga0496122_0002550 3300048925 Bacteria 25608
488 Ga0496122_0003859 3300048925 Bacteria 19238
489 Ga0496123_0000002 3300048926 Bacteria 1811682
490 Ga0496123_0021716 3300048926 Bacteria 4977
491 Ga0496124_0000006 3300048927 Bacteria 904259
492 Ga0496124_0004712 3300048927 Bacteria 15746
493 Ga0496124_0008231 3300048927 Bacteria 10935
494 Ga0496124_0011294 3300048927 Bacteria 8940
495 Ga0496124_0029218 3300048927 Bacteria 4917
496 Ga0496125_0000428 3300048928 Bacteria 77638
497 Ga0496125_0001524 3300048928 Bacteria 33228
498 Ga0496125_0014527 3300048928 Bacteria 7665
499 Ga0496125_0014609 3300048928 Bacteria 7637
500 Ga0496125_0023312 3300048928 Bacteria 5715
501 Ga0496125_0050628 3300048928 Bacteria 3437
502 Ga0496125_0065695 3300048928 Bacteria 2872
503 Ga0496125_0120723 3300048928 Bacteria 1870
504 Ga0496126_0001278 3300048929 Bacteria 40439
505 Ga0496126_0109555 3300048929 Bacteria 2407
506 Ga0501031_0139909 3300049568 Bacteria 1582
507 Ga0501032_0008522 3300049569 Bacteria 7476
508 Ga0501032_0041410 3300049569 Bacteria 3128
509 Ga0501033_0002403 3300049570 Bacteria 15941
510 Ga0501034_0000003 3300049571 Bacteria 471748
511 Ga0501034_0267192 3300049571 Bacteria 1652
512 Ga0501037_0000028 3300049573 Bacteria 139838
513 Ga0501039_0073800 3300049575 Bacteria 2651
514 Ga0501043_0000028 3300049579 Bacteria 144125
515 Ga0501069_0000014 3300049585 Bacteria 146321
516 Ga0501070_0000121 3300049586 Bacteria 69910
517 Ga0501073_0021852 3300049589 Bacteria 4609
518 Ga0501074_0000004 3300049590 Bacteria 114255
519 Ga0501080_0000027 3300049742 Bacteria 89243
520 Ga0501083_0000025 3300049744 Bacteria 121349
521 Ga0501035_0000129 3300049822 Bacteria 92221
522 Ga0501044_0000052 3300049823 Bacteria 143626
523 nmdc:mga03683_12598_c1 3300050489 Bacteria 3094
524 nmdc:mga03683_14537_c1 3300050489 Bacteria 2915
525 nmdc:mga00v17_11453_c1 3300050491 Bacteria 4873
526 nmdc:mga00v17_11939_c1 3300050491 Bacteria 4782
527 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
528 nmdc:mga0yw44_10540_c1 3300050492 Bacteria 2385
529 nmdc:mga0yw44_31834_c1 3300050492 Bacteria 3070
530 nmdc:mga0yw44_6443_c1 3300050492 Bacteria 5675
531 nmdc:mga0yw44_9013_c1 3300050492 Bacteria 5014
532 nmdc:mga0k408_1643_c1 3300050493 Bacteria 12092
533 nmdc:mga0k408_28205_c1 3300050493 Bacteria 3192
534 nmdc:mga06z11_19394_c1 3300050494 Bacteria 3126
535 nmdc:mga06z11_42757_c1 3300050494 Bacteria 2275
536 nmdc:mga06z11_98357_c1 3300050494 Bacteria 1601
537 nmdc:mga07m45_40126_c1 3300050496 Bacteria 2619
538 nmdc:mga07m45_7997_c1 3300050496 Bacteria 5420
539 nmdc:mga05p37_114737_c1 3300050507 Bacteria 2377
540 nmdc:mga05p37_602_c1 3300050507 Bacteria 39665
541 nmdc:mga09592_1214_c1 3300050508 Bacteria 20659
542 nmdc:mga0qj67_30261_c1 3300050509 Bacteria 4212
543 nmdc:mga0qj67_41540_c1 3300050509 Bacteria 3618
544 nmdc:mga06r32_2662_c1 3300050510 Bacteria 15970
545 nmdc:mga0sz30_17402_c1 3300050516 Bacteria 2866
546 nmdc:mga0sz30_28733_c1 3300050516 Bacteria 2290
547 nmdc:mga0sz30_514_c1 3300050516 Bacteria 14418
548 nmdc:mga0sz30_5788_c1 3300050516 Bacteria 4554
549 Ga0500610_0019641 3300053079 Bacteria 3287
550 Ga0495655_0007607 3300053083 Bacteria 2022
551 Ga0500643_019909 3300053087 Bacteria 2203
552 Ga0500560_001318 3300053107 Bacteria 4230
553 Ga0500569_006377 3300053109 Bacteria 2588
554 Ga0500618_006461 3300053125 Bacteria 3437
555 Ga0500618_012616 3300053125 Bacteria 2207
556 Ga0500658_0001866 3300053134 Bacteria 8273
557 Ga0500561_0000133 3300053137 Bacteria 14162
558 Ga0500568_0012171 3300053139 Bacteria 3963
559 Ga0500573_0014457 3300053140 Bacteria 4468
560 Ga0500590_002599 3300053148 Bacteria 8085
561 Ga0500616_0005939 3300053153 Bacteria 8150
562 Ga0500616_0038875 3300053153 Bacteria 2568
563 Ga0500624_000016 3300053157 Bacteria 134804
564 Ga0500624_000337 3300053157 Bacteria 15781
565 Ga0500636_0000001 3300053177 Bacteria 324086
566 Ga0500636_0056283 3300053177 Bacteria 2304
567 Ga0500637_0000007 3300053178 Bacteria 93788
568 Ga0590075_012034 3300059424 Bacteria 2098

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2906354277 2906355017 356
2 3300048919 Ga0496116_0144165 Ga0496116_0144165_11_1165 384
3 3300001989 JGI24739J22299_10001518 JGI24739J22299_100015187 415
4 iso_pu_bacteria 2840878972 2840881958 421
5 iso_pu_bacteria 2551306089 2551714289 427
6 iso_pu_bacteria 8019678201 8019680335 427
7 3300002704 JGI25155J39150_1000729 JGI25155J39150_10007291 428
8 3300002738 JGI25154J39366_1000772 JGI25154J39366_10007728 428
9 3300009545 Ga0105237_10116983 Ga0105237_101169832 428
10 3300025246 Ga0209646_1000108 Ga0209646_10001085 428
11 3300025256 Ga0209759_1001092 Ga0209759_100109211 428
12 3300047320 Ga0495672_0037928 Ga0495672_0037928_1031_2416 428
13 3300049571 Ga0501034_0000003 Ga0501034_0000003_343239_344618 428
14 iso_pu_bacteria 2856741275 2856745978 429
15 iso_pu_bacteria 2891395885 2891398135 429
16 iso_pu_bacteria 2891554331 2891556478 429
17 iso_pu_bacteria 2551306092 2551737641 431
18 3300003751 Ga0055538_1000302 Ga0055538_100030214 432
19 3300014325 Ga0163163_10000004 Ga0163163_10000004406 432
20 3300025224 Ga0209784_100312 Ga0209784_10031212 432
21 3300025292 Ga0209676_1002891 Ga0209676_10028913 432
22 3300025294 Ga0209025_1006332 Ga0209025_10063322 432
23 3300028800 Ga0265338_10189785 Ga0265338_101897852 432
24 iso_pu_bacteria 2551306087 2551697280 432
25 iso_pu_bacteria 2964636051 2964641392 432
26 3300035398 Ga0316574_0008040 Ga0316574_0008040_3352_4752 433
27 3300036712 Ga0316584_0142313 Ga0316584_0142313_74_1474 433
28 3300048913 Ga0496110_0020290 Ga0496110_0020290_1892_3271 433
29 3300059424 Ga0590075_012034 Ga0590075_012034_197_1579 433
30 3300025224 Ga0209784_100005 Ga0209784_100005308 434
31 3300025225 Ga0209566_100005 Ga0209566_100005308 434
32 3300025226 Ga0209674_100009 Ga0209674_100009308 434
33 3300025230 Ga0209563_100012 Ga0209563_100012308 434
34 3300025253 Ga0209677_100006 Ga0209677_100006308 434
35 3300005563 Ga0068855_100001019 Ga0068855_10000101914 435
36 3300025949 Ga0207667_10000028 Ga0207667_1000002863 435
37 3300003751 Ga0055538_1000008 Ga0055538_1000008310 436
38 3300003752 Ga0055539_1000012 Ga0055539_1000012310 436
39 3300003756 Ga0055533_1000015 Ga0055533_1000015310 436
40 3300003759 Ga0055525_1000017 Ga0055525_100001733 436
41 3300003841 Ga0055541_1000009 Ga0055541_1000009310 436
42 3300006844 Ga0075428_100005444 Ga0075428_1000054449 436
43 3300006846 Ga0075430_100010143 Ga0075430_1000101439 436
44 3300006846 Ga0075430_100012612 Ga0075430_1000126124 436
45 3300006847 Ga0075431_100000183 Ga0075431_10000018318 436
46 3300009147 Ga0114129_10032402 Ga0114129_100324028 436
47 3300050507 nmdc:mga05p37_602_c1 nmdc:mga05p37_602_c1_31917_33281 436
48 3300050508 nmdc:mga09592_1214_c1 nmdc:mga09592_1214_c1_6849_8213 436
49 3300050509 nmdc:mga0qj67_30261_c1 nmdc:mga0qj67_30261_c1_2018_3382 436
50 3300050509 nmdc:mga0qj67_41540_c1 nmdc:mga0qj67_41540_c1_2139_3503 436
51 3300050510 nmdc:mga06r32_2662_c1 nmdc:mga06r32_2662_c1_9328_10692 436
52 iso_pu_bacteria 2811994881 2812370262 436
53 iso_pu_bacteria 2923519811 2923524350 436
54 3300035398 Ga0316574_0032447 Ga0316574_0032447_1118_2527 437
55 iso_pu_bacteria 8011350971 8011356275 437
56 3300005331 Ga0070670_100025939 Ga0070670_1000259391 438
57 3300005335 Ga0070666_10002707 Ga0070666_100027077 438
58 3300005338 Ga0068868_100011890 Ga0068868_1000118903 438
59 3300005344 Ga0070661_100062021 Ga0070661_1000620212 438
60 3300005458 Ga0070681_10053293 Ga0070681_100532934 438
61 3300005548 Ga0070665_100000227 Ga0070665_10000022766 438
62 3300005578 Ga0068854_100010398 Ga0068854_1000103984 438
63 3300005614 Ga0068856_100154918 Ga0068856_1001549182 438
64 3300005616 Ga0068852_100206905 Ga0068852_1002069051 438
65 3300005834 Ga0068851_10001399 Ga0068851_100013993 438
66 3300005842 Ga0068858_100004031 Ga0068858_1000040317 438
67 3300009553 Ga0105249_10007119 Ga0105249_100071193 438
68 3300025903 Ga0207680_10001300 Ga0207680_100013002 438
69 3300025913 Ga0207695_10022351 Ga0207695_100223514 438
70 3300025914 Ga0207671_10008685 Ga0207671_100086852 438
71 3300025924 Ga0207694_10007856 Ga0207694_100078567 438
72 3300025925 Ga0207650_10010601 Ga0207650_100106015 438
73 3300025933 Ga0207706_10020155 Ga0207706_100201553 438
74 3300025961 Ga0207712_10000169 Ga0207712_1000016915 438
75 3300025981 Ga0207640_10001595 Ga0207640_100015953 438
76 3300026035 Ga0207703_10001066 Ga0207703_1000106617 438
77 3300026067 Ga0207678_10035730 Ga0207678_100357303 438
78 3300028379 Ga0268266_10000006 Ga0268266_10000006636 438
79 3300005518 Ga0070699_100068180 Ga0070699_1000681802 439
80 3300005578 Ga0068854_100031331 Ga0068854_1000313313 439
81 3300009036 Ga0105244_10048482 Ga0105244_100484822 439
82 3300009551 Ga0105238_10000111 Ga0105238_1000011133 439
83 3300010375 Ga0105239_10008101 Ga0105239_100081013 439
84 3300025728 Ga0207655_1051164 Ga0207655_10511642 439
85 3300025913 Ga0207695_10130548 Ga0207695_101305482 439
86 3300025914 Ga0207671_10003510 Ga0207671_100035107 439
87 3300025924 Ga0207694_10000199 Ga0207694_100001993 439
88 3300042006 Ga0439432_003974 Ga0439432_003974_707_2125 439
89 3300042156 Ga0439446_0009399 Ga0439446_0009399_572_1990 439
90 3300042435 Ga0439434_0015659 Ga0439434_0015659_792_2210 439
91 3300049569 Ga0501032_0041410 Ga0501032_0041410_889_2307 439
92 3300049571 Ga0501034_0267192 Ga0501034_0267192_173_1591 439
93 3300049575 Ga0501039_0073800 Ga0501039_0073800_60_1478 439
94 iso_pu_bacteria 2512047086 2512531411 439
95 iso_pu_bacteria 2582581866 2585396262 439
96 iso_pu_bacteria 2600254931 2600362990 439
97 iso_pu_bacteria 2838122688 2838129598 439
98 iso_pu_bacteria 2841966195 2841967914 439
99 iso_pu_bacteria 3000017691 3000020403 439
100 iso_pu_bacteria 8056120720 8056123618 439
101 iso_pu_bacteria 2503198000 2503200940 440
102 iso_pu_bacteria 2508501042 2508697127 440
103 iso_pu_bacteria 2508501050 2508731299 440
104 iso_pu_bacteria 2508501122 2509110597 440
105 iso_pu_bacteria 2509276021 2509390882 440
106 iso_pu_bacteria 2509276033 2509441942 440
107 iso_pu_bacteria 2510065019 2510136131 440
108 iso_pu_bacteria 2510065057 2510306054 440
109 iso_pu_bacteria 2510461076 2510892866 440
110 iso_pu_bacteria 2510917022 2511135584 440
111 iso_pu_bacteria 2510917028 2511184947 440
112 iso_pu_bacteria 2510917030 2511195131 440
113 iso_pu_bacteria 2511231052 2511500084 440
114 iso_pu_bacteria 2511231221 2512036700 440
115 iso_pu_bacteria 2512047086 2512530307 440
116 iso_pu_bacteria 2512875016 2512929141 440
117 iso_pu_bacteria 2512875026 2512975259 440
118 iso_pu_bacteria 2513237084 2513568432 440
119 iso_pu_bacteria 2513237085 2513579469 440
120 iso_pu_bacteria 2513237086 2513584457 440
121 iso_pu_bacteria 2513237089 2513606794 440
122 iso_pu_bacteria 2513237090 2513611562 440
123 iso_pu_bacteria 2513237091 2513619603 440
124 iso_pu_bacteria 2513237092 2513624778 440
125 iso_pu_bacteria 2513237093 2513630711 440
126 iso_pu_bacteria 2513237103 2513711937 440
127 iso_pu_bacteria 2513237139 2513876258 440
128 iso_pu_bacteria 2513237140 2513883181 440
129 iso_pu_bacteria 2513237143 2513904255 440
130 iso_pu_bacteria 2513237159 2514001812 440
131 iso_pu_bacteria 2513237160 2514006996 440
132 iso_pu_bacteria 2513237161 2514017071 440
133 iso_pu_bacteria 2513237162 2514018266 440
134 iso_pu_bacteria 2513237164 2514035816 440
135 iso_pu_bacteria 2513237305 2514423386 440
136 iso_pu_bacteria 2513237351 2514592343 440
137 iso_pu_bacteria 2515075009 2515108942 440
138 iso_pu_bacteria 2515154107 2515613292 440
139 iso_pu_bacteria 2515154112 2515624310 440
140 iso_pu_bacteria 2515154113 2515633053 440
141 iso_pu_bacteria 2515154114 2515640258 440
142 iso_pu_bacteria 2515154116 2515656339 440
143 iso_pu_bacteria 2515154134 2515738477 440
144 iso_pu_bacteria 2516143018 2516207161 440
145 iso_pu_bacteria 2516653046 2516897615 440
146 iso_pu_bacteria 2516653077 2517040883 440
147 iso_pu_bacteria 2516653085 2517080514 440
148 iso_pu_bacteria 2517093000 2517098483 440
149 iso_pu_bacteria 2517287029 2517409967 440
150 iso_pu_bacteria 2517487022 2517566663 440
151 iso_pu_bacteria 2524023207 2524453369 440
152 iso_pu_bacteria 2524023209 2524459173 440
153 iso_pu_bacteria 2529292951 2530648702 440
154 iso_pu_bacteria 2537561587 2537877487 440
155 iso_pu_bacteria 2551306084 2551674840 440
156 iso_pu_bacteria 2551306085 2551687092 440
157 iso_pu_bacteria 2554235003 2554245480 440
158 iso_pu_bacteria 2554235132 2554817817 440
159 iso_pu_bacteria 2558860100 2558864946 440
160 iso_pu_bacteria 2558860242 2559296690 440
161 iso_pu_bacteria 2582581299 2585232684 440
162 iso_pu_bacteria 2582581306 2585268269 440
163 iso_pu_bacteria 2582581307 2585272659 440
164 iso_pu_bacteria 2582581308 2585281209 440
165 iso_pu_bacteria 2582581315 2585327295 440
166 iso_pu_bacteria 2582581316 2585334519 440
167 iso_pu_bacteria 2582581865 2585391165 440
168 iso_pu_bacteria 2585427526 2585526838 440
169 iso_pu_bacteria 2585427527 2585536131 440
170 iso_pu_bacteria 2585427528 2585542400 440
171 iso_pu_bacteria 2585427530 2585557616 440
172 iso_pu_bacteria 2585427531 2585562327 440
173 iso_pu_bacteria 2585427593 2585841872 440
174 iso_pu_bacteria 2585427608 2585896767 440
175 iso_pu_bacteria 2585427609 2585906506 440
176 iso_pu_bacteria 2585427633 2585993365 440
177 iso_pu_bacteria 2585427634 2586004005 440
178 iso_pu_bacteria 2585428125 2587981928 440
179 iso_pu_bacteria 2588253730 2588514384 440
180 iso_pu_bacteria 2597489875 2597813921 440
181 iso_pu_bacteria 2599185210 2599602806 440
182 iso_pu_bacteria 2599185301 2599940080 440
183 iso_pu_bacteria 2599185352 2600197381 440
184 iso_pu_bacteria 2600255279 2601610439 440
185 iso_pu_bacteria 2600255308 2601747231 440
186 iso_pu_bacteria 2606217733 2608380858 440
187 iso_pu_bacteria 2615840624 2616298025 440
188 iso_pu_bacteria 2615840626 2616310989 440
189 iso_pu_bacteria 2615840698 2616555589 440
190 iso_pu_bacteria 2617270735 2617353962 440
191 iso_pu_bacteria 2617270741 2617378920 440
192 iso_pu_bacteria 2617270742 2617385521 440
193 iso_pu_bacteria 2643221582 2643917329 440
194 iso_pu_bacteria 2643221595 2643984692 440
195 iso_pu_bacteria 2643221627 2644153017 440
196 iso_pu_bacteria 2643221693 2644520818 440
197 iso_pu_bacteria 2643221723 2644673434 440
198 iso_pu_bacteria 2657244999 2657685739 440
199 iso_pu_bacteria 2667528174 2671113169 440
200 iso_pu_bacteria 2690316117 2692318306 440
201 iso_pu_bacteria 2718217882 2719184850 440
202 iso_pu_bacteria 2718217927 2719389825 440
203 iso_pu_bacteria 2718217997 2719668850 440
204 iso_pu_bacteria 2718218009 2719728870 440
205 iso_pu_bacteria 2718218199 2720489543 440
206 iso_pu_bacteria 2718218232 2720610218 440
207 iso_pu_bacteria 2718218233 2720617642 440
208 iso_pu_bacteria 2718218235 2720628784 440
209 iso_pu_bacteria 2718218269 2720772733 440
210 iso_pu_bacteria 2718218363 2721144561 440
211 iso_pu_bacteria 2718218365 2721156053 440
212 iso_pu_bacteria 2718218366 2721161931 440
213 iso_pu_bacteria 2718218423 2721403468 440
214 iso_pu_bacteria 2721755514 2722843076 440
215 iso_pu_bacteria 2721755556 2723030173 440
216 iso_pu_bacteria 2721755684 2723564578 440
217 iso_pu_bacteria 2721755685 2723569780 440
218 iso_pu_bacteria 2721755686 2723575019 440
219 iso_pu_bacteria 2721755809 2724035044 440
220 iso_pu_bacteria 2721755810 2724041895 440
221 iso_pu_bacteria 2721755819 2724092762 440
222 iso_pu_bacteria 2721755822 2724101327 440
223 iso_pu_bacteria 2721755823 2724113149 440
224 iso_pu_bacteria 2724679232 2725949400 440
225 iso_pu_bacteria 2728369352 2730110706 440
226 iso_pu_bacteria 2728369365 2730160965 440
227 iso_pu_bacteria 2728369397 2730295586 440
228 iso_pu_bacteria 2738541333 2739038466 440
229 iso_pu_bacteria 2751185800 2753357764 440
230 iso_pu_bacteria 2751185821 2753462802 440
231 iso_pu_bacteria 2758568016 2758638030 440
232 iso_pu_bacteria 2765235802 2765468807 440
233 iso_pu_bacteria 2765235942 2766068870 440
234 iso_pu_bacteria 2767802442 2770198471 440
235 iso_pu_bacteria 2773857925 2774873147 440
236 iso_pu_bacteria 2775507049 2776910705 440
237 iso_pu_bacteria 2775507266 2778174844 440
238 iso_pu_bacteria 2791355082 2792583722 440
239 iso_pu_bacteria 2791355091 2792619363 440
240 iso_pu_bacteria 2791355092 2792627135 440
241 iso_pu_bacteria 2791355094 2792640931 440
242 iso_pu_bacteria 2791355123 2792752212 440
243 iso_pu_bacteria 2791355256 2793299129 440
244 iso_pu_bacteria 2791355259 2793312722 440
245 iso_pu_bacteria 2791355260 2793324244 440
246 iso_pu_bacteria 2791355261 2793329904 440
247 iso_pu_bacteria 2791355262 2793333871 440
248 iso_pu_bacteria 2791355263 2793340789 440
249 iso_pu_bacteria 2791355264 2793345739 440
250 iso_pu_bacteria 2791355266 2793361865 440
251 iso_pu_bacteria 2791355267 2793367418 440
252 iso_pu_bacteria 2802428858 2802720137 440
253 iso_pu_bacteria 2802428859 2802723824 440
254 iso_pu_bacteria 2802428860 2802734149 440
255 iso_pu_bacteria 2802428861 2802739611 440
256 iso_pu_bacteria 2802428862 2802746003 440
257 iso_pu_bacteria 2802428863 2802753402 440
258 iso_pu_bacteria 2802429268 2804754997 440
259 iso_pu_bacteria 2802429606 2805935169 440
260 iso_pu_bacteria 2802429633 2806048809 440
261 iso_pu_bacteria 2802429634 2806056012 440
262 iso_pu_bacteria 2802429635 2806062841 440
263 iso_pu_bacteria 2802429636 2806070263 440
264 iso_pu_bacteria 2802429637 2806077249 440
265 iso_pu_bacteria 2808606387 2808987143 440
266 iso_pu_bacteria 2818991439 2819557519 440
267 iso_pu_bacteria 2818991448 2819613183 440
268 iso_pu_bacteria 2818991453 2819641745 440
269 iso_pu_bacteria 2818991461 2819683579 440
270 iso_pu_bacteria 2824679649 2824681602 440
271 iso_pu_bacteria 2838016132 2838020495 440
272 iso_pu_bacteria 2838029111 2838031685 440
273 iso_pu_bacteria 2838048938 2838049936 440
274 iso_pu_bacteria 2838061910 2838062204 440
275 iso_pu_bacteria 2838068647 2838069438 440
276 iso_pu_bacteria 2838074704 2838078636 440
277 iso_pu_bacteria 2838675328 2838677968 440
278 iso_pu_bacteria 2838680041 2838686166 440
279 iso_pu_bacteria 2838686498 2838690474 440
280 iso_pu_bacteria 2838694306 2838700463 440
281 iso_pu_bacteria 2838707686 2838713742 440
282 iso_pu_bacteria 2838714209 2838717126 440
283 iso_pu_bacteria 2838719591 2838722263 440
284 iso_pu_bacteria 2838724970 2838727875 440
285 iso_pu_bacteria 2838729681 2838733169 440
286 iso_pu_bacteria 2838742623 2838747242 440
287 iso_pu_bacteria 2840764183 2840770218 440
288 iso_pu_bacteria 2840878972 2840882554 440
289 iso_pu_bacteria 2841846520 2841849533 440
290 iso_pu_bacteria 2841851746 2841855395 440
291 iso_pu_bacteria 2841859092 2841861427 440
292 iso_pu_bacteria 2841864319 2841865785 440
293 iso_pu_bacteria 2841941048 2841946245 440
294 iso_pu_bacteria 2841949485 2841952271 440
295 iso_pu_bacteria 2841974524 2841982754 440
296 iso_pu_bacteria 2842077413 2842083105 440
297 iso_pu_bacteria 2842110456 2842116975 440
298 iso_pu_bacteria 2842118031 2842124087 440
299 iso_pu_bacteria 2842124991 2842127719 440
300 iso_pu_bacteria 2842130223 2842132861 440
301 iso_pu_bacteria 2842152218 2842154854 440
302 iso_pu_bacteria 2842156927 2842160898 440
303 iso_pu_bacteria 2842163707 2842164427 440
304 iso_pu_bacteria 2842170452 2842173353 440
305 iso_pu_bacteria 2842175837 2842178475 440
306 iso_pu_bacteria 2842180545 2842184514 440
307 iso_pu_bacteria 2842187318 2842190234 440
308 iso_pu_bacteria 2842211629 2842214548 440
309 iso_pu_bacteria 2842217011 2842219660 440
310 iso_pu_bacteria 2842224351 2842227267 440
311 iso_pu_bacteria 2842229732 2842232097 440
312 iso_pu_bacteria 2842237096 2842243155 440
313 iso_pu_bacteria 2842243621 2842248501 440
314 iso_pu_bacteria 2842257432 2842262691 440
315 iso_pu_bacteria 2842264693 2842264815 440
316 iso_pu_bacteria 2842271015 2842275212 440
317 iso_pu_bacteria 2842291075 2842297364 440
318 iso_pu_bacteria 2842298080 2842300960 440
319 iso_pu_bacteria 2842304105 2842307352 440
320 iso_pu_bacteria 2842341865 2842345763 440
321 iso_pu_bacteria 2842357229 2842360024 440
322 iso_pu_bacteria 2842363717 2842364031 440
323 iso_pu_bacteria 2842370503 2842376215 440
324 iso_pu_bacteria 2842377471 2842383758 440
325 iso_pu_bacteria 2842384541 2842390897 440
326 iso_pu_bacteria 2842402390 2842405945 440
327 iso_pu_bacteria 2842409023 2842412529 440
328 iso_pu_bacteria 2842415677 2842419173 440
329 iso_pu_bacteria 2842422224 2842422629 440
330 iso_pu_bacteria 2842428310 2842429132 440
331 iso_pu_bacteria 2842434925 2842435745 440
332 iso_pu_bacteria 2842441272 2842441393 440
333 iso_pu_bacteria 2842447887 2842449790 440
334 iso_pu_bacteria 2842462802 2842463558 440
335 iso_pu_bacteria 2842469257 2842470075 440
336 iso_pu_bacteria 2842475841 2842478417 440
337 iso_pu_bacteria 2842502639 2842505637 440
338 iso_pu_bacteria 2842509118 2842513861 440
339 iso_pu_bacteria 2842515876 2842518306 440
340 iso_pu_bacteria 2842521101 2842527322 440
341 iso_pu_bacteria 2844002411 2844004716 440
342 iso_pu_bacteria 2844454524 2844460130 440
343 iso_pu_bacteria 2847417321 2847423190 440
344 iso_pu_bacteria 2847670302 2847674871 440
345 iso_pu_bacteria 2848992105 2848997414 440
346 iso_pu_bacteria 2850079185 2850084669 440
347 iso_pu_bacteria 2852387548 2852394165 440
348 iso_pu_bacteria 2854916844 2854922459 440
349 iso_pu_bacteria 2855825444 2855830471 440
350 iso_pu_bacteria 2855839649 2855845757 440
351 iso_pu_bacteria 2855872281 2855874179 440
352 iso_pu_bacteria 2856314179 2856317245 440
353 iso_pu_bacteria 2856342000 2856344135 440
354 iso_pu_bacteria 2856349417 2856353638 440
355 iso_pu_bacteria 2856364286 2856366199 440
356 iso_pu_bacteria 2857349434 2857350039 440
357 iso_pu_bacteria 2857349434 2857354406 440
358 iso_pu_bacteria 2857516855 2857517696 440
359 iso_pu_bacteria 2858800743 2858805149 440
360 iso_pu_bacteria 2869162929 2869163894 440
361 iso_pu_bacteria 2869256925 2869257483 440
362 iso_pu_bacteria 2869285874 2869287233 440
363 iso_pu_bacteria 2871429161 2871430533 440
364 iso_pu_bacteria 2871488783 2871489473 440
365 iso_pu_bacteria 2871495908 2871496301 440
366 iso_pu_bacteria 2874102143 2874103466 440
367 iso_pu_bacteria 2874123672 2874128221 440
368 iso_pu_bacteria 2874146452 2874149190 440
369 iso_pu_bacteria 2874155637 2874156025 440
370 iso_pu_bacteria 2874168670 2874170187 440
371 iso_pu_bacteria 2874590934 2874595402 440
372 iso_pu_bacteria 2874645413 2874651828 440
373 iso_pu_bacteria 2876363079 2876367301 440
374 iso_pu_bacteria 2876369609 2876373607 440
375 iso_pu_bacteria 2876392853 2876393653 440
376 iso_pu_bacteria 2876413966 2876415387 440
377 iso_pu_bacteria 2876771140 2876775596 440
378 iso_pu_bacteria 2876818435 2876823588 440
379 iso_pu_bacteria 2878035449 2878038283 440
380 iso_pu_bacteria 2878738818 2878742314 440
381 iso_pu_bacteria 2878745973 2878746965 440
382 iso_pu_bacteria 2878753008 2878754122 440
383 iso_pu_bacteria 2878760144 2878760530 440
384 iso_pu_bacteria 2878767105 2878767493 440
385 iso_pu_bacteria 2879074833 2879079687 440
386 iso_pu_bacteria 2879127579 2879133909 440
387 iso_pu_bacteria 2879142872 2879145042 440
388 iso_pu_bacteria 2881147464 2881151121 440
389 iso_pu_bacteria 2881155292 2881161511 440
390 iso_pu_bacteria 2881161766 2881163414 440
391 iso_pu_bacteria 2881665667 2881668843 440
392 iso_pu_bacteria 2881845957 2881849006 440
393 iso_pu_bacteria 2881861095 2881868083 440
394 iso_pu_bacteria 2882456835 2882463174 440
395 iso_pu_bacteria 2882632389 2882637520 440
396 iso_pu_bacteria 2882912400 2882919046 440
397 iso_pu_bacteria 2885305155 2885305845 440
398 iso_pu_bacteria 2885318864 2885324123 440
399 iso_pu_bacteria 2885326080 2885327741 440
400 iso_pu_bacteria 2885334103 2885340061 440
401 iso_pu_bacteria 2885342637 2885350136 440
402 iso_pu_bacteria 2885350715 2885353215 440
403 iso_pu_bacteria 2885366525 2885367994 440
404 iso_pu_bacteria 2885409591 2885416464 440
405 iso_pu_bacteria 2888337043 2888338835 440
406 iso_pu_bacteria 2888343758 2888347647 440
407 iso_pu_bacteria 2888350351 2888352437 440
408 iso_pu_bacteria 2889016732 2889020772 440
409 iso_pu_bacteria 2889033259 2889034635 440
410 iso_pu_bacteria 2896384573 2896387521 440
411 iso_pu_bacteria 2899792073 2899796470 440
412 iso_pu_bacteria 2899845264 2899849998 440
413 iso_pu_bacteria 2903448605 2903453229 440
414 iso_pu_bacteria 2903492973 2903494575 440
415 iso_pu_bacteria 2903492973 2903500518 440
416 iso_pu_bacteria 2903521522 2903526792 440
417 iso_pu_bacteria 2903528002 2903530589 440
418 iso_pu_bacteria 2903540706 2903541095 440
419 iso_pu_bacteria 2904659560 2904660161 440
420 iso_pu_bacteria 2906308376 2906309779 440
421 iso_pu_bacteria 2906321335 2906322414 440
422 iso_pu_bacteria 2906328253 2906331868 440
423 iso_pu_bacteria 2906414383 2906417307 440
424 iso_pu_bacteria 2906626472 2906629032 440
425 iso_pu_bacteria 2906643746 2906646436 440
426 iso_pu_bacteria 2913295892 2913297014 440
427 iso_pu_bacteria 2915980308 2915984318 440
428 iso_pu_bacteria 2915986958 2915987020 440
429 iso_pu_bacteria 2915993759 2915999437 440
430 iso_pu_bacteria 2916000859 2916004071 440
431 iso_pu_bacteria 2916007675 2916012468 440
432 iso_pu_bacteria 2916014648 2916014704 440
433 iso_pu_bacteria 2916021584 2916026929 440
434 iso_pu_bacteria 2916028427 2916034040 440
435 iso_pu_bacteria 2916035215 2916038597 440
436 iso_pu_bacteria 2916041962 2916046326 440
437 iso_pu_bacteria 2916048683 2916050825 440
438 iso_pu_bacteria 2916055098 2916060592 440
439 iso_pu_bacteria 2916061851 2916066637 440
440 iso_pu_bacteria 2916068649 2916071650 440
441 iso_pu_bacteria 2916076590 2916079557 440
442 iso_pu_bacteria 2919114240 2919117384 440
443 iso_pu_bacteria 2919171160 2919176256 440
444 iso_pu_bacteria 2919408235 2919412937 440
445 iso_pu_bacteria 2920760137 2920763331 440
446 iso_pu_bacteria 2920822456 2920827226 440
447 iso_pu_bacteria 2921201388 2921205387 440
448 iso_pu_bacteria 2921208531 2921210709 440
449 iso_pu_bacteria 2921237296 2921240627 440
450 iso_pu_bacteria 2921244191 2921249603 440
451 iso_pu_bacteria 2921250672 2921254274 440
452 iso_pu_bacteria 2921257292 2921261697 440
453 iso_pu_bacteria 2921263974 2921269608 440
454 iso_pu_bacteria 2921282425 2921285052 440
455 iso_pu_bacteria 2921289301 2921294220 440
456 iso_pu_bacteria 2921296804 2921299008 440
457 iso_pu_bacteria 2922130491 2922138177 440
458 iso_pu_bacteria 2922158528 2922163056 440
459 iso_pu_bacteria 2922185730 2922189176 440
460 iso_pu_bacteria 2922393267 2922400154 440
461 iso_pu_bacteria 2924144063 2924144379 440
462 iso_pu_bacteria 2924150972 2924151613 440
463 iso_pu_bacteria 2924158325 2924159489 440
464 iso_pu_bacteria 2924165586 2924172618 440
465 iso_pu_bacteria 2924172951 2924178730 440
466 iso_pu_bacteria 2924179722 2924185771 440
467 iso_pu_bacteria 2924193448 2924196070 440
468 iso_pu_bacteria 2924200457 2924201328 440
469 iso_pu_bacteria 2924207177 2924210160 440
470 iso_pu_bacteria 2924214083 2924218921 440
471 iso_pu_bacteria 2924221636 2924227617 440
472 iso_pu_bacteria 2924228884 2924230877 440
473 iso_pu_bacteria 2924710171 2924712830 440
474 iso_pu_bacteria 2924726620 2924729552 440
475 iso_pu_bacteria 2924733363 2924737401 440
476 iso_pu_bacteria 2924754689 2924761777 440
477 iso_pu_bacteria 2924762789 2924769108 440
478 iso_pu_bacteria 2924776078 2924780114 440
479 iso_pu_bacteria 2924784321 2924788800 440
480 iso_pu_bacteria 2926754445 2926758831 440
481 iso_pu_bacteria 2926760298 2926763644 440
482 iso_pu_bacteria 2933006813 2933009764 440
483 iso_pu_bacteria 2933011516 2933013935 440
484 iso_pu_bacteria 2933570622 2933573992 440
485 iso_pu_bacteria 2933586486 2933593275 440
486 iso_pu_bacteria 2933594066 2933595745 440
487 iso_pu_bacteria 2933599457 2933600101 440
488 iso_pu_bacteria 2935894831 2935900780 440
489 iso_pu_bacteria 2935901341 2935906112 440
490 iso_pu_bacteria 2935975950 2935983010 440
491 iso_pu_bacteria 2935984226 2935988092 440
492 iso_pu_bacteria 2936367885 2936374683 440
493 iso_pu_bacteria 2936375103 2936375883 440
494 iso_pu_bacteria 2936381700 2936382415 440
495 iso_pu_bacteria 2937002841 2937005415 440
496 iso_pu_bacteria 2937009748 2937013000 440
497 iso_pu_bacteria 2937016420 2937018022 440
498 iso_pu_bacteria 2937023124 2937029536 440
499 iso_pu_bacteria 2937029754 2937033952 440
500 iso_pu_bacteria 2937036028 2937037251 440
501 iso_pu_bacteria 2937042894 2937043398 440
502 iso_pu_bacteria 2937049772 2937051951 440
503 iso_pu_bacteria 2937063883 2937066249 440
504 iso_pu_bacteria 2937071275 2937077054 440
505 iso_pu_bacteria 2937078374 2937080488 440
506 iso_pu_bacteria 2937084907 2937091509 440
507 iso_pu_bacteria 2937091812 2937096443 440
508 iso_pu_bacteria 2937098957 2937105700 440
509 iso_pu_bacteria 2937106411 2937110939 440
510 iso_pu_bacteria 2937113482 2937116806 440
511 iso_pu_bacteria 2937119839 2937125029 440
512 iso_pu_bacteria 2937126314 2937132860 440
513 iso_pu_bacteria 2937813078 2937814924 440
514 iso_pu_bacteria 2937848649 2937848802 440
515 iso_pu_bacteria 2937877337 2937882634 440
516 iso_pu_bacteria 2937891427 2937891539 440
517 iso_pu_bacteria 2937994558 2937994948 440
518 iso_pu_bacteria 2941499720 2941505433 440
519 iso_pu_bacteria 2957375807 2957379797 440
520 iso_pu_bacteria 2957382221 2957385597 440
521 iso_pu_bacteria 2957388812 2957390216 440
522 iso_pu_bacteria 2957395598 2957398852 440
523 iso_pu_bacteria 2957402308 2957405756 440
524 iso_pu_bacteria 2957408893 2957412877 440
525 iso_pu_bacteria 2957415311 2957420486 440
526 iso_pu_bacteria 2957422303 2957426825 440
527 iso_pu_bacteria 2957430029 2957430298 440
528 iso_pu_bacteria 2957437181 2957442729 440
529 iso_pu_bacteria 2957450854 2957453808 440
530 iso_pu_bacteria 2957457609 2957459975 440
531 iso_pu_bacteria 2957464669 2957464996 440
532 iso_pu_bacteria 2957471148 2957475224 440
533 iso_pu_bacteria 2957478035 2957483530 440
534 iso_pu_bacteria 2957484790 2957486866 440
535 iso_pu_bacteria 2957491536 2957492908 440
536 iso_pu_bacteria 2957498199 2957500200 440
537 iso_pu_bacteria 2957505466 2957506059 440
538 iso_pu_bacteria 2958041894 2958043392 440
539 iso_pu_bacteria 2958064165 2958064855 440
540 iso_pu_bacteria 2958084443 2958089759 440
541 iso_pu_bacteria 2958092219 2958100446 440
542 iso_pu_bacteria 2958115193 2958121517 440
543 iso_pu_bacteria 2958130278 2958131733 440
544 iso_pu_bacteria 2958144490 2958145578 440
545 iso_pu_bacteria 2958165035 2958165428 440
546 iso_pu_bacteria 2958179912 2958180793 440
547 iso_pu_bacteria 2960584000 2960585366 440
548 iso_pu_bacteria 2960591022 2960591738 440
549 iso_pu_bacteria 2960597568 2960601440 440
550 iso_pu_bacteria 2960603979 2960608269 440
551 iso_pu_bacteria 2960610863 2960615940 440
552 iso_pu_bacteria 2960624210 2960630158 440
553 iso_pu_bacteria 2960631154 2960637792 440
554 iso_pu_bacteria 2960637947 2960641159 440
555 iso_pu_bacteria 2960645483 2960652617 440
556 iso_pu_bacteria 2960652885 2960658452 440
557 iso_pu_bacteria 2960667422 2960668919 440
558 iso_pu_bacteria 2960680706 2960685172 440
559 iso_pu_bacteria 2960687367 2960691025 440
560 iso_pu_bacteria 2960693952 2960700900 440
561 iso_pu_bacteria 2961077736 2961078631 440
562 iso_pu_bacteria 2961114664 2961115486 440
563 iso_pu_bacteria 2961127735 2961129806 440
564 iso_pu_bacteria 2961163497 2961163886 440
565 iso_pu_bacteria 2961170736 2961171754 440
566 iso_pu_bacteria 2963644680 2963650094 440
567 iso_pu_bacteria 2964615318 2964619239 440
568 iso_pu_bacteria 2964621998 2964624587 440
569 iso_pu_bacteria 2964628898 2964634167 440
570 iso_pu_bacteria 2964643177 2964649769 440
571 iso_pu_bacteria 2964649959 2964655629 440
572 iso_pu_bacteria 2964656573 2964658343 440
573 iso_pu_bacteria 2964663802 2964666744 440
574 iso_pu_bacteria 2964670856 2964672956 440
575 iso_pu_bacteria 2964678106 2964678902 440
576 iso_pu_bacteria 2964685014 2964690223 440
577 iso_pu_bacteria 2964691889 2964695378 440
578 iso_pu_bacteria 2964698721 2964701842 440
579 iso_pu_bacteria 2964705432 2964708431 440
580 iso_pu_bacteria 2964712639 2964715924 440
581 iso_pu_bacteria 2964719344 2964725585 440
582 iso_pu_bacteria 2965018300 2965018691 440
583 iso_pu_bacteria 2965032056 2965033482 440
584 iso_pu_bacteria 2965062239 2965069599 440
585 iso_pu_bacteria 2965119406 2965126612 440
586 iso_pu_bacteria 2967664464 2967670130 440
587 iso_pu_bacteria 2967671571 2967675018 440
588 iso_pu_bacteria 2967678726 2967685509 440
589 iso_pu_bacteria 2967686174 2967690717 440
590 iso_pu_bacteria 2967693043 2967694124 440
591 iso_pu_bacteria 2967699805 2967702777 440
592 iso_pu_bacteria 2967706974 2967709662 440
593 iso_pu_bacteria 2967714385 2967715922 440
594 iso_pu_bacteria 2967721400 2967722778 440
595 iso_pu_bacteria 2967728569 2967728668 440
596 iso_pu_bacteria 2967735183 2967739739 440
597 iso_pu_bacteria 2967742019 2967744235 440
598 iso_pu_bacteria 2967748971 2967750245 440
599 iso_pu_bacteria 2967755722 2967760386 440
600 iso_pu_bacteria 2967762386 2967764761 440
601 iso_pu_bacteria 2967769361 2967770066 440
602 iso_pu_bacteria 2967775926 2967781907 440
603 iso_pu_bacteria 2967996073 2967996541 440
604 iso_pu_bacteria 2968003550 2968010248 440
605 iso_pu_bacteria 2968083720 2968086595 440
606 iso_pu_bacteria 2968091066 2968095338 440
607 iso_pu_bacteria 2968097103 2968103086 440
608 iso_pu_bacteria 2968110612 2968111217 440
609 iso_pu_bacteria 2968117919 2968118894 440
610 iso_pu_bacteria 2968128360 2968128545 440
611 iso_pu_bacteria 2968171901 2968172292 440
612 iso_pu_bacteria 2970019648 2970025208 440
613 iso_pu_bacteria 2970026789 2970033067 440
614 iso_pu_bacteria 2970033650 2970035863 440
615 iso_pu_bacteria 2970040964 2970043236 440
616 iso_pu_bacteria 2970047711 2970050321 440
617 iso_pu_bacteria 2970054988 2970060717 440
618 iso_pu_bacteria 2970061556 2970063004 440
619 iso_pu_bacteria 2970068827 2970072410 440
620 iso_pu_bacteria 2970076120 2970077775 440
621 iso_pu_bacteria 2970088815 2970095079 440
622 iso_pu_bacteria 2970095765 2970099563 440
623 iso_pu_bacteria 2970102677 2970109066 440
624 iso_pu_bacteria 2970109326 2970113992 440
625 iso_pu_bacteria 2970116247 2970119854 440
626 iso_pu_bacteria 2970122695 2970129080 440
627 iso_pu_bacteria 2970129317 2970130759 440
628 iso_pu_bacteria 2970136068 2970139253 440
629 iso_pu_bacteria 2970143518 2970147212 440
630 iso_pu_bacteria 2970149975 2970152704 440
631 iso_pu_bacteria 2970156795 2970161249 440
632 iso_pu_bacteria 2970164137 2970165150 440
633 iso_pu_bacteria 2970170962 2970176300 440
634 iso_pu_bacteria 2970184632 2970184721 440
635 iso_pu_bacteria 2970191845 2970194055 440
636 iso_pu_bacteria 2970503327 2970504350 440
637 iso_pu_bacteria 2970524798 2970530276 440
638 iso_pu_bacteria 2970540015 2970547793 440
639 iso_pu_bacteria 2970554993 2970555382 440
640 iso_pu_bacteria 2977516862 2977519925 440
641 iso_pu_bacteria 2977523885 2977525249 440
642 iso_pu_bacteria 2977530762 2977536923 440
643 iso_pu_bacteria 2977537788 2977539336 440
644 iso_pu_bacteria 2977544691 2977546576 440
645 iso_pu_bacteria 2977551784 2977558702 440
646 iso_pu_bacteria 2977558990 2977564279 440
647 iso_pu_bacteria 2977565890 2977568651 440
648 iso_pu_bacteria 2977572785 2977575064 440
649 iso_pu_bacteria 2977579622 2977580664 440
650 iso_pu_bacteria 2977821940 2977823337 440
651 iso_pu_bacteria 2977828996 2977831310 440
652 iso_pu_bacteria 2977843712 2977845616 440
653 iso_pu_bacteria 2977858184 2977864090 440
654 iso_pu_bacteria 2977864932 2977866033 440
655 iso_pu_bacteria 2977872689 2977880162 440
656 iso_pu_bacteria 2977898635 2977899518 440
657 iso_pu_bacteria 2977922695 2977928381 440
658 iso_pu_bacteria 2977957713 2977962517 440
659 iso_pu_bacteria 2977971508 2977973239 440
660 iso_pu_bacteria 2977986579 2977987710 440
661 iso_pu_bacteria 2979089926 2979091316 440
662 iso_pu_bacteria 2979095461 2979096840 440
663 iso_pu_bacteria 2979100975 2979102560 440
664 iso_pu_bacteria 2979742915 2979747980 440
665 iso_pu_bacteria 2979779861 2979784863 440
666 iso_pu_bacteria 2979793036 2979793850 440
667 iso_pu_bacteria 2979808191 2979808987 440
668 iso_pu_bacteria 2984509177 2984509555 440
669 iso_pu_bacteria 2984518228 2984519747 440
670 iso_pu_bacteria 2984537506 2984537890 440
671 iso_pu_bacteria 2984601300 2984604635 440
672 iso_pu_bacteria 2987636660 2987637138 440
673 iso_pu_bacteria 2987636660 2987642185 440
674 iso_pu_bacteria 2987659509 2987659898 440
675 iso_pu_bacteria 2987666974 2987672960 440
676 iso_pu_bacteria 2987673487 2987678871 440
677 iso_pu_bacteria 2996341866 2996345381 440
678 iso_pu_bacteria 2996386984 2996393825 440
679 iso_pu_bacteria 2996887358 2996893022 440
680 iso_pu_bacteria 3000135777 3000140977 440
681 iso_pu_bacteria 3004188549 3004188945 440
682 iso_pu_bacteria 3004203850 3004204107 440
683 iso_pu_bacteria 3004211236 3004215612 440
684 iso_pu_bacteria 3004218560 3004222084 440
685 iso_pu_bacteria 3004239961 3004243612 440
686 iso_pu_bacteria 3005416602 3005416652 440
687 iso_pu_bacteria 3005483717 3005488727 440
688 iso_pu_bacteria 3005587118 3005592095 440
689 iso_pu_bacteria 637000159 637078901 440
690 iso_pu_bacteria 639633055 639645372 440
691 iso_pu_bacteria 643348564 643600620 440
692 iso_pu_bacteria 643692032 643822490 440
693 iso_pu_bacteria 648276728 648738626 440
694 iso_pu_bacteria 650716007 650843111 440
695 iso_pu_bacteria 8003570095 8003575458 440
696 iso_pu_bacteria 8003992118 8003997749 440
697 iso_pu_bacteria 8003999396 8004005444 440
698 iso_pu_bacteria 8004312739 8004313825 440
699 iso_pu_bacteria 8004374579 8004375698 440
700 iso_pu_bacteria 8004387939 8004389070 440
701 iso_pu_bacteria 8004445564 8004451938 440
702 iso_pu_bacteria 8004695233 8004697539 440
703 iso_pu_bacteria 8004703790 8004713250 440
704 iso_pu_bacteria 8004714634 8004716133 440
705 iso_pu_bacteria 8005275841 8005275948 440
706 iso_pu_bacteria 8005282627 8005285833 440
707 iso_pu_bacteria 8005289223 8005290849 440
708 iso_pu_bacteria 8005301065 8005301274 440
709 iso_pu_bacteria 8005307578 8005308298 440
710 iso_pu_bacteria 8005314921 8005320705 440
711 iso_pu_bacteria 8005321885 8005327549 440
712 iso_pu_bacteria 8005376324 8005380556 440
713 iso_pu_bacteria 8005382845 8005383381 440
714 iso_pu_bacteria 8005395548 8005398975 440
715 iso_pu_bacteria 8005430974 8005436582 440
716 iso_pu_bacteria 8005460587 8005467567 440
717 iso_pu_bacteria 8005484373 8005487620 440
718 iso_pu_bacteria 8005497431 8005501997 440
719 iso_pu_bacteria 8005556819 8005559482 440
720 iso_pu_bacteria 8005563573 8005566471 440
721 iso_pu_bacteria 8005570704 8005571150 440
722 iso_pu_bacteria 8005619151 8005624239 440
723 iso_pu_bacteria 8005626139 8005629505 440
724 iso_pu_bacteria 8005645114 8005651808 440
725 iso_pu_bacteria 8005668836 8005673419 440
726 iso_pu_bacteria 8005682033 8005686028 440
727 iso_pu_bacteria 8005688590 8005688911 440
728 iso_pu_bacteria 8005695170 8005695467 440
729 iso_pu_bacteria 8018127388 8018132286 440
730 iso_pu_bacteria 8018150411 8018151249 440
731 iso_pu_bacteria 8018163183 8018163745 440
732 iso_pu_bacteria 8018176218 8018180836 440
733 iso_pu_bacteria 8019619141 8019623694 440
734 iso_pu_bacteria 8019629233 8019638340 440
735 iso_pu_bacteria 8019638758 8019641298 440
736 iso_pu_bacteria 8019648815 8019656845 440
737 iso_pu_bacteria 8019659431 8019666265 440
738 iso_pu_bacteria 8019668869 8019675761 440
739 iso_pu_bacteria 8023680758 8023681567 440
740 iso_pu_bacteria 8024479707 8024481439 440
741 iso_pu_bacteria 8024486573 8024493049 440
742 iso_pu_bacteria 8046767195 8046774208 440
743 iso_pu_bacteria 8049293176 8049298101 440
744 iso_pu_bacteria 8054002106 8054005274 440
745 iso_pu_bacteria 8054558443 8054563375 440
746 iso_pu_bacteria 8055617313 8055621713 440
747 iso_pu_bacteria 8056375014 8056381771 440
748 iso_pu_bacteria 8057874678 8057881300 440
749 3300005466 Ga0070685_10001923 Ga0070685_100019234 441
750 3300009093 Ga0105240_10001044 Ga0105240_1000104439 441
751 3300009551 Ga0105238_10006969 Ga0105238_1000696912 441
752 3300025904 Ga0207647_10000500 Ga0207647_100005008 441
753 3300025913 Ga0207695_10000007 Ga0207695_10000007191 441
754 3300025924 Ga0207694_10005080 Ga0207694_100050802 441
755 iso_pu_bacteria 2521172590 2521557009 442
756 iso_pu_bacteria 2551306416 2553004808 442
757 iso_pu_bacteria 2775506901 2776265227 442
758 iso_pu_bacteria 2818991449 2819616808 442
759 iso_pu_bacteria 2904439833 2904440286 442
760 iso_pu_bacteria 2904530477 2904530801 442
761 iso_pu_bacteria 2904584206 2904585784 442
762 iso_pu_bacteria 2904589729 2904592403 442
763 iso_pu_bacteria 2904601388 2904601464 442
764 iso_pu_bacteria 2919079590 2919082886 442
765 iso_pu_bacteria 2923510766 2923515641 442
766 iso_pu_bacteria 2928130867 2928134541 442
767 3300049568 Ga0501031_0139909 Ga0501031_0139909_87_1457 443
768 3300001979 JGI24740J21852_10006396 JGI24740J21852_100063965 444
769 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003192 444
770 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004186 444
771 3300002737 JGI25162J39368_1000069 JGI25162J39368_100006986 444
772 3300002738 JGI25154J39366_1000013 JGI25154J39366_1000013269 444
773 3300002741 JGI25157J39369_1000004 JGI25157J39369_100000491 444
774 3300002773 JGI25152J39213_1000186 JGI25152J39213_100018625 444
775 3300002987 JGI25159J45721_1000019 JGI25159J45721_100001980 444
776 3300003187 JGI25151J46595_10000867 JGI25151J46595_1000086714 444
777 3300003214 JGI25165J46597_1000018 JGI25165J46597_100001863 444
778 3300003214 JGI25165J46597_1000020 JGI25165J46597_1000020169 444
779 3300003214 JGI25165J46597_1000372 JGI25165J46597_100037216 444
780 3300003214 JGI25165J46597_1005415 JGI25165J46597_10054151 444
781 3300003215 JGI25153J46596_10000200 JGI25153J46596_1000020013 444
782 3300003215 JGI25153J46596_10000829 JGI25153J46596_1000082914 444
783 3300003215 JGI25153J46596_10020305 JGI25153J46596_100203051 444
784 3300003316 rootH1_10018479 rootH1_100184792 444
785 3300003323 rootH1_10010878 rootH1_100108785 444
786 3300003323 rootH1_10084286 rootH1_100842865 444
787 3300003354 JGI25160J50197_1000054 JGI25160J50197_100005480 444
788 3300003354 JGI25160J50197_1000203 JGI25160J50197_100020315 444
789 3300003354 JGI25160J50197_1002223 JGI25160J50197_10022232 444
790 3300003374 JGI25161J50226_1000570 JGI25161J50226_10005704 444
791 3300003374 JGI25161J50226_1002643 JGI25161J50226_10026434 444
792 3300003374 JGI25161J50226_1003970 JGI25161J50226_10039702 444
793 3300003762 Ga0055542_1000068 Ga0055542_100006812 444
794 3300003771 Ga0055526_1000308 Ga0055526_100030817 444
795 3300003771 Ga0055526_1002146 Ga0055526_10021462 444
796 3300003775 Ga0055524_1002400 Ga0055524_100240010 444
797 3300003775 Ga0055524_1017598 Ga0055524_10175982 444
798 3300003781 Ga0055536_1000640 Ga0055536_10006409 444
799 3300003781 Ga0055536_1001374 Ga0055536_10013748 444
800 3300003781 Ga0055536_1004941 Ga0055536_10049413 444
801 3300003790 Ga0055528_1000054 Ga0055528_100005434 444
802 3300003790 Ga0055528_1000611 Ga0055528_100061122 444
803 3300003792 Ga0055540_1000131 Ga0055540_100013110 444
804 3300003794 Ga0055531_10000207 Ga0055531_1000020733 444
805 3300003794 Ga0055531_10003719 Ga0055531_100037195 444
806 3300003794 Ga0055531_10020782 Ga0055531_100207822 444
807 3300003856 Ga0058692_1004401 Ga0058692_10044013 444
808 3300004625 Ga0055543_1000150 Ga0055543_10001504 444
809 3300004625 Ga0055543_1000349 Ga0055543_10003493 444
810 3300004625 Ga0055543_1001165 Ga0055543_10011659 444
811 3300005262 Ga0065165_1000136 Ga0065165_100013680 444
812 3300005262 Ga0065165_1000672 Ga0065165_100067215 444
813 3300005347 Ga0070668_100046856 Ga0070668_1000468564 444
814 3300005355 Ga0070671_100017186 Ga0070671_1000171863 444
815 3300005356 Ga0070674_100034053 Ga0070674_1000340532 444
816 3300005367 Ga0070667_100009753 Ga0070667_1000097532 444
817 3300005434 Ga0070709_10004117 Ga0070709_100041176 444
818 3300005436 Ga0070713_100020550 Ga0070713_1000205503 444
819 3300005437 Ga0070710_10001455 Ga0070710_100014552 444
820 3300005455 Ga0070663_100006884 Ga0070663_1000068845 444
821 3300005548 Ga0070665_100040698 Ga0070665_1000406985 444
822 3300005548 Ga0070665_100153116 Ga0070665_1001531163 444
823 3300005563 Ga0068855_100153664 Ga0068855_1001536643 444
824 3300005577 Ga0068857_100120684 Ga0068857_1001206842 444
825 3300005578 Ga0068854_100063002 Ga0068854_1000630022 444
826 3300005614 Ga0068856_100009837 Ga0068856_1000098374 444
827 3300005614 Ga0068856_100017742 Ga0068856_1000177424 444
828 3300005616 Ga0068852_100000915 Ga0068852_10000091510 444
829 3300005616 Ga0068852_100201722 Ga0068852_1002017222 444
830 3300005618 Ga0068864_100187555 Ga0068864_1001875552 444
831 3300005841 Ga0068863_100106350 Ga0068863_1001063503 444
832 3300005844 Ga0068862_100176133 Ga0068862_1001761332 444
833 3300005983 Ga0081540_1003849 Ga0081540_10038497 444
834 3300006028 Ga0070717_10064195 Ga0070717_100641953 444
835 3300006038 Ga0075365_10000531 Ga0075365_100005313 444
836 3300006038 Ga0075365_10009053 Ga0075365_100090535 444
837 3300006038 Ga0075365_10010720 Ga0075365_100107205 444
838 3300006038 Ga0075365_10017374 Ga0075365_100173743 444
839 3300006038 Ga0075365_10019715 Ga0075365_100197154 444
840 3300006038 Ga0075365_10022527 Ga0075365_100225272 444
841 3300006038 Ga0075365_10030791 Ga0075365_100307912 444
842 3300006038 Ga0075365_10081484 Ga0075365_100814841 444
843 3300006042 Ga0075368_10034284 Ga0075368_100342842 444
844 3300006048 Ga0075363_100000058 Ga0075363_1000000584 444
845 3300006051 Ga0075364_10014932 Ga0075364_100149325 444
846 3300006175 Ga0070712_100016628 Ga0070712_1000166284 444
847 3300006177 Ga0075362_10010898 Ga0075362_100108984 444
848 3300006177 Ga0075362_10015935 Ga0075362_100159353 444
849 3300006177 Ga0075362_10040411 Ga0075362_100404112 444
850 3300006178 Ga0075367_10000241 Ga0075367_1000024112 444
851 3300006178 Ga0075367_10049377 Ga0075367_100493772 444
852 3300006178 Ga0075367_10094119 Ga0075367_100941192 444
853 3300006186 Ga0075369_10002765 Ga0075369_100027653 444
854 3300006186 Ga0075369_10004181 Ga0075369_100041811 444
855 3300006186 Ga0075369_10006567 Ga0075369_100065674 444
856 3300006186 Ga0075369_10009584 Ga0075369_100095844 444
857 3300006195 Ga0075366_10006620 Ga0075366_100066204 444
858 3300006353 Ga0075370_10008090 Ga0075370_100080904 444
859 3300006844 Ga0075428_100117841 Ga0075428_1001178412 444
860 3300006941 Ga0099825_1029359 Ga0099825_10293592 444
861 3300006942 Ga0099824_1023232 Ga0099824_10232323 444
862 3300006943 Ga0099822_1023504 Ga0099822_10235046 444
863 3300006948 Ga0099826_10000665 Ga0099826_100006655 444
864 3300009093 Ga0105240_10000217 Ga0105240_1000021733 444
865 3300009093 Ga0105240_10176549 Ga0105240_101765492 444
866 3300009148 Ga0105243_10007647 Ga0105243_100076477 444
867 3300009148 Ga0105243_10018759 Ga0105243_100187594 444
868 3300009176 Ga0105242_10210522 Ga0105242_102105221 444
869 3300009177 Ga0105248_10029402 Ga0105248_100294022 444
870 3300009545 Ga0105237_10000978 Ga0105237_100009785 444
871 3300009545 Ga0105237_10016626 Ga0105237_100166265 444
872 3300009545 Ga0105237_10045493 Ga0105237_100454934 444
873 3300009551 Ga0105238_10073563 Ga0105238_100735633 444
874 3300009551 Ga0105238_10148003 Ga0105238_101480032 444
875 3300009551 Ga0105238_10209138 Ga0105238_102091381 444
876 3300009553 Ga0105249_10085551 Ga0105249_100855513 444
877 3300009765 Ga0123341_1000093 Ga0123341_100009323 444
878 3300009766 Ga0123342_1019635 Ga0123342_10196353 444
879 3300009766 Ga0123342_1024823 Ga0123342_10248233 444
880 3300010375 Ga0105239_10027600 Ga0105239_100276005 444
881 3300010375 Ga0105239_10164192 Ga0105239_101641922 444
882 3300013100 Ga0157373_10004938 Ga0157373_100049384 444
883 3300013102 Ga0157371_10000002 Ga0157371_10000002359 444
884 3300013104 Ga0157370_10003627 Ga0157370_100036276 444
885 3300013104 Ga0157370_10005183 Ga0157370_100051833 444
886 3300013249 Ga0171463_1002 Ga0171463_1002504 444
887 3300013296 Ga0157374_10035329 Ga0157374_100353293 444
888 3300014325 Ga0163163_10013631 Ga0163163_100136316 444
889 3300015262 Ga0182007_10004509 Ga0182007_100045094 444
890 3300015265 Ga0182005_1014944 Ga0182005_10149442 444
891 3300015690 Ga0183363_1041 Ga0183363_104122 444
892 3300021320 Ga0214544_1000018 Ga0214544_1000018166 444
893 3300021320 Ga0214544_1009587 Ga0214544_10095877 444
894 3300021321 Ga0214542_1000307 Ga0214542_100030776 444
895 3300021321 Ga0214542_1001549 Ga0214542_100154928 444
896 3300021321 Ga0214542_1018955 Ga0214542_10189555 444
897 3300021324 Ga0214545_1005475 Ga0214545_100547518 444
898 3300021327 Ga0214543_1000195 Ga0214543_100019511 444
899 3300021327 Ga0214543_1007141 Ga0214543_100714113 444
900 3300021327 Ga0214543_1011326 Ga0214543_101132610 444
901 3300022739 Ga0228711_1004587 Ga0228711_100458712 444
902 3300022740 Ga0228710_1004744 Ga0228710_100474413 444
903 3300025206 Ga0209435_100006 Ga0209435_10000690 444
904 3300025208 Ga0209436_100404 Ga0209436_10040412 444
905 3300025208 Ga0209436_102987 Ga0209436_1029874 444
906 3300025228 Ga0209672_105623 Ga0209672_1056232 444
907 3300025233 Ga0209437_100022 Ga0209437_100022128 444
908 3300025245 Ga0207425_1002753 Ga0207425_10027533 444
909 3300025245 Ga0207425_1003951 Ga0207425_10039512 444
910 3300025246 Ga0209646_1000015 Ga0209646_1000015444 444
911 3300025250 Ga0209026_1000039 Ga0209026_100003990 444
912 3300025253 Ga0209677_100826 Ga0209677_10082611 444
913 3300025254 Ga0209148_1000078 Ga0209148_1000078147 444
914 3300025254 Ga0209148_1000790 Ga0209148_100079021 444
915 3300025254 Ga0209148_1006123 Ga0209148_10061232 444
916 3300025254 Ga0209148_1010791 Ga0209148_10107911 444
917 3300025256 Ga0209759_1000005 Ga0209759_100000590 444
918 3300025256 Ga0209759_1019371 Ga0209759_10193711 444
919 3300025258 Ga0209129_1000255 Ga0209129_100025516 444
920 3300025258 Ga0209129_1000669 Ga0209129_10006699 444
921 3300025261 Ga0209233_1000031 Ga0209233_1000031128 444
922 3300025261 Ga0209233_1000047 Ga0209233_1000047165 444
923 3300025261 Ga0209233_1000324 Ga0209233_100032415 444
924 3300025261 Ga0209233_1000330 Ga0209233_100033018 444
925 3300025261 Ga0209233_1011262 Ga0209233_10112622 444
926 3300025272 Ga0209455_1000193 Ga0209455_100019336 444
927 3300025272 Ga0209455_1000641 Ga0209455_100064114 444
928 3300025272 Ga0209455_1005792 Ga0209455_10057922 444
929 3300025272 Ga0209455_1009389 Ga0209455_10093891 444
930 3300025273 Ga0209673_1000067 Ga0209673_1000067199 444
931 3300025273 Ga0209673_1000291 Ga0209673_100029142 444
932 3300025273 Ga0209673_1000473 Ga0209673_100047319 444
933 3300025273 Ga0209673_1000642 Ga0209673_100064249 444
934 3300025273 Ga0209673_1013619 Ga0209673_10136193 444
935 3300025284 Ga0209130_1000120 Ga0209130_100012053 444
936 3300025284 Ga0209130_1000242 Ga0209130_100024234 444
937 3300025291 Ga0209675_1014646 Ga0209675_10146462 444
938 3300025292 Ga0209676_1000470 Ga0209676_100047051 444
939 3300025292 Ga0209676_1001059 Ga0209676_100105913 444
940 3300025292 Ga0209676_1001988 Ga0209676_100198810 444
941 3300025292 Ga0209676_1022144 Ga0209676_10221442 444
942 3300025294 Ga0209025_1000240 Ga0209025_1000240145 444
943 3300025294 Ga0209025_1000430 Ga0209025_100043038 444
944 3300025294 Ga0209025_1000708 Ga0209025_100070816 444
945 3300025294 Ga0209025_1001534 Ga0209025_10015344 444
946 3300025295 Ga0209564_1000092 Ga0209564_1000092199 444
947 3300025295 Ga0209564_1000338 Ga0209564_100033875 444
948 3300025295 Ga0209564_1000876 Ga0209564_10008765 444
949 3300025295 Ga0209564_1018490 Ga0209564_10184902 444
950 3300025297 Ga0209758_1000131 Ga0209758_100013183 444
951 3300025297 Ga0209758_1000490 Ga0209758_100049021 444
952 3300025297 Ga0209758_1000508 Ga0209758_10005082 444
953 3300025297 Ga0209758_1000610 Ga0209758_100061016 444
954 3300025297 Ga0209758_1008376 Ga0209758_10083762 444
955 3300025298 Ga0209050_1001238 Ga0209050_10012385 444
956 3300025298 Ga0209050_1006857 Ga0209050_10068575 444
957 3300025298 Ga0209050_1009556 Ga0209050_10095562 444
958 3300025298 Ga0209050_1013160 Ga0209050_10131604 444
959 3300025299 Ga0209256_1000788 Ga0209256_10007887 444
960 3300025299 Ga0209256_1001230 Ga0209256_10012309 444
961 3300025299 Ga0209256_1001843 Ga0209256_10018436 444
962 3300025299 Ga0209256_1002067 Ga0209256_100206712 444
963 3300025302 Ga0207426_1000075 Ga0207426_1000075253 444
964 3300025302 Ga0207426_1000206 Ga0207426_100020653 444
965 3300025302 Ga0207426_1000483 Ga0207426_100048346 444
966 3300025303 Ga0209051_1000038 Ga0209051_1000038241 444
967 3300025303 Ga0209051_1002802 Ga0209051_10028023 444
968 3300025303 Ga0209051_1002894 Ga0209051_10028942 444
969 3300025303 Ga0209051_1016836 Ga0209051_10168362 444
970 3300025304 Ga0209257_1000545 Ga0209257_100054524 444
971 3300025304 Ga0209257_1001781 Ga0209257_10017818 444
972 3300025304 Ga0209257_1003568 Ga0209257_100356810 444
973 3300025304 Ga0209257_1003646 Ga0209257_100364610 444
974 3300025898 Ga0207692_10012086 Ga0207692_100120863 444
975 3300025904 Ga0207647_10001555 Ga0207647_100015556 444
976 3300025904 Ga0207647_10003982 Ga0207647_100039822 444
977 3300025906 Ga0207699_10001044 Ga0207699_100010441 444
978 3300025911 Ga0207654_10058718 Ga0207654_100587181 444
979 3300025913 Ga0207695_10001205 Ga0207695_1000120533 444
980 3300025914 Ga0207671_10000793 Ga0207671_100007939 444
981 3300025914 Ga0207671_10209851 Ga0207671_102098511 444
982 3300025915 Ga0207693_10025190 Ga0207693_100251905 444
983 3300025924 Ga0207694_10009453 Ga0207694_100094535 444
984 3300025924 Ga0207694_10039024 Ga0207694_100390242 444
985 3300025931 Ga0207644_10021404 Ga0207644_100214043 444
986 3300025933 Ga0207706_10107587 Ga0207706_101075872 444
987 3300025937 Ga0207669_10066859 Ga0207669_100668591 444
988 3300025938 Ga0207704_10053054 Ga0207704_100530542 444
989 3300025939 Ga0207665_10001859 Ga0207665_1000185910 444
990 3300025940 Ga0207691_10078053 Ga0207691_100780531 444
991 3300025941 Ga0207711_10040250 Ga0207711_100402503 444
992 3300025961 Ga0207712_10024258 Ga0207712_100242583 444
993 3300025972 Ga0207668_10033246 Ga0207668_100332461 444
994 3300025972 Ga0207668_10047884 Ga0207668_100478843 444
995 3300025986 Ga0207658_10013181 Ga0207658_100131816 444
996 3300026067 Ga0207678_10033763 Ga0207678_100337634 444
997 3300026078 Ga0207702_10013019 Ga0207702_100130194 444
998 3300026078 Ga0207702_10034297 Ga0207702_100342972 444
999 3300026088 Ga0207641_10094135 Ga0207641_100941353 444
1000 3300026089 Ga0207648_10084397 Ga0207648_100843973 444
1001 3300026116 Ga0207674_10124592 Ga0207674_101245923 444
1002 3300026118 Ga0207675_100107710 Ga0207675_1001077102 444
1003 3300026121 Ga0207683_10181519 Ga0207683_101815192 444
1004 3300027111 Ga0209281_1000491 Ga0209281_100049136 444
1005 3300027111 Ga0209281_1000981 Ga0209281_100098112 444
1006 3300027296 Ga0209389_1004138 Ga0209389_100413810 444
1007 3300027312 Ga0209371_1000003 Ga0209371_1000003454 444
1008 3300027312 Ga0209371_1000324 Ga0209371_100032436 444
1009 3300027357 Ga0209589_1002342 Ga0209589_100234219 444
1010 3300027357 Ga0209589_1007145 Ga0209589_100714515 444
1011 3300027361 Ga0209489_106154 Ga0209489_1061549 444
1012 3300027361 Ga0209489_106733 Ga0209489_10673315 444
1013 3300027363 Ga0209700_100005 Ga0209700_100005507 444
1014 3300027666 Ga0209282_1000108 Ga0209282_100010822 444
1015 3300027666 Ga0209282_1000604 Ga0209282_10006045 444
1016 3300027866 Ga0209813_10001351 Ga0209813_100013513 444
1017 3300028379 Ga0268266_10029411 Ga0268266_100294115 444
1018 3300028379 Ga0268266_10033739 Ga0268266_100337393 444
1019 3300028381 Ga0268264_10127213 Ga0268264_101272132 444
1020 3300028794 Ga0307515_10001625 Ga0307515_1000162535 444
1021 3300028794 Ga0307515_10001999 Ga0307515_1000199936 444
1022 3300028794 Ga0307515_10233095 Ga0307515_102330951 444
1023 3300030500 Ga0268256_1000004 Ga0268256_1000004596 444
1024 3300030500 Ga0268256_1001615 Ga0268256_100161512 444
1025 3300031456 Ga0307513_10095186 Ga0307513_100951862 444
1026 3300031649 Ga0307514_10000850 Ga0307514_1000085035 444
1027 3300031967 Ga0315914_1000427 Ga0315914_100042733 444
1028 3300033430 Ga0315913_1001358 Ga0315913_100135819 444
1029 3300033464 Ga0315915_1000032 Ga0315915_100003275 444
1030 3300035695 Ga0373927_0000581 Ga0373927_0000581_8627_10000 444
1031 3300037068 Ga0373925_0003311 Ga0373925_0003311_3718_5091 444
1032 3300037418 Ga0395900_0170554 Ga0395900_0170554_808_2181 444
1033 3300037471 Ga0395905_0001624 Ga0395905_0001624_12638_14014 444
1034 3300037471 Ga0395905_0018526 Ga0395905_0018526_4150_5523 444
1035 3300037471 Ga0395905_0168297 Ga0395905_0168297_386_1762 444
1036 3300038443 Ga0395901_0037069 Ga0395901_0037069_324_1700 444
1037 3300038443 Ga0395901_0099665 Ga0395901_0099665_371_1747 444
1038 3300039437 Ga0436365_1690000 Ga0436365_1690000_16_1389 444
1039 3300039447 Ga0436361_0082211 Ga0436361_0082211_179_1552 444
1040 3300039447 Ga0436361_1160430 Ga0436361_1160430_5735_7108 444
1041 3300041404 Ga0439436_0032326 Ga0439436_0032326_110_1486 444
1042 3300041413 Ga0439465_0001210 Ga0439465_0001210_5976_7352 444
1043 3300041413 Ga0439465_0008515 Ga0439465_0008515_1659_3035 444
1044 3300041505 Ga0451849_0513859 Ga0451849_0513859_261_1637 444
1045 3300041507 Ga0451851_0276965 Ga0451851_0276965_87_1463 444
1046 3300041509 Ga0451843_1077282 Ga0451843_1077282_566_1942 444
1047 3300041512 Ga0451853_1283853 Ga0451853_1283853_207_1583 444
1048 3300042007 Ga0439449_0019041 Ga0439449_0019041_1143_2516 444
1049 3300042145 Ga0450906_003989 Ga0450906_003989_851_2227 444
1050 3300042146 Ga0450907_007441 Ga0450907_007441_88_1464 444
1051 3300042435 Ga0439434_0010852 Ga0439434_0010852_1187_2563 444
1052 3300042531 Ga0450918_000330 Ga0450918_000330_1175_2551 444
1053 3300044694 Ga0466963_0008944 Ga0466963_0008944_2732_4108 444
1054 3300044735 Ga0466968_0006460 Ga0466968_0006460_2683_4059 444
1055 3300044765 Ga0466970_0000136 Ga0466970_0000136_10999_12375 444
1056 3300045049 Ga0466959_0056743 Ga0466959_0056743_200_1576 444
1057 3300045051 Ga0451576_0121180 Ga0451576_0121180_399_1781 444
1058 3300045836 Ga0466958_0004964 Ga0466958_0004964_2306_3682 444
1059 3300046452 Ga0495617_006379 Ga0495617_006379_2034_3410 444
1060 3300046459 Ga0495629_0009432 Ga0495629_0009432_4941_6314 444
1061 3300046460 Ga0495638_0001519 Ga0495638_0001519_17973_19349 444
1062 3300046471 Ga0495650_0060858 Ga0495650_0060858_120_1496 444
1063 3300046474 Ga0495605_0020476 Ga0495605_0020476_1529_2905 444
1064 3300046492 Ga0495585_0033722 Ga0495585_0033722_531_1907 444
1065 3300046492 Ga0495585_0099629 Ga0495585_0099629_156_1532 444
1066 3300046507 Ga0495606_0006572 Ga0495606_0006572_2162_3535 444
1067 3300046507 Ga0495606_0021433 Ga0495606_0021433_1843_3219 444
1068 3300046507 Ga0495606_0079141 Ga0495606_0079141_147_1523 444
1069 3300046512 Ga0495610_0016880 Ga0495610_0016880_307_1680 444
1070 3300046515 Ga0495620_0001877 Ga0495620_0001877_1520_2896 444
1071 3300046520 Ga0495637_0014296 Ga0495637_0014296_576_1949 444
1072 3300046522 Ga0495643_0001015 Ga0495643_0001015_27253_28629 444
1073 3300046522 Ga0495643_0038695 Ga0495643_0038695_617_1990 444
1074 3300046524 Ga0495648_0043713 Ga0495648_0043713_327_1703 444
1075 3300046530 Ga0495654_0000920 Ga0495654_0000920_15132_16508 444
1076 3300046542 Ga0495597_0007987 Ga0495597_0007987_3840_5216 444
1077 3300046557 Ga0495622_0001480 Ga0495622_0001480_5828_7201 444
1078 3300046558 Ga0495633_0044363 Ga0495633_0044363_475_1851 444
1079 3300046558 Ga0495633_0063020 Ga0495633_0063020_343_1716 444
1080 3300046616 Ga0495668_0027729 Ga0495668_0027729_1532_2908 444
1081 3300046660 Ga0495625_0014937 Ga0495625_0014937_1780_3156 444
1082 3300046660 Ga0495625_0028129 Ga0495625_0028129_1409_2785 444
1083 3300046660 Ga0495625_0169879 Ga0495625_0169879_59_1432 444
1084 3300046663 Ga0495635_0069085 Ga0495635_0069085_552_1925 444
1085 3300046665 Ga0495661_0038541 Ga0495661_0038541_569_1945 444
1086 3300046674 Ga0495588_0000630 Ga0495588_0000630_1648_3021 444
1087 3300046809 Ga0495600_0091745 Ga0495600_0091745_140_1513 444
1088 3300047317 Ga0495604_0000886 Ga0495604_0000886_5323_6696 444
1089 3300047320 Ga0495672_0017946 Ga0495672_0017946_2253_3629 444
1090 3300047443 Ga0495687_008305 Ga0495687_008305_2197_3573 444
1091 3300047470 Ga0495681_0002578 Ga0495681_0002578_743_2116 444
1092 3300047470 Ga0495681_0009025 Ga0495681_0009025_1161_2534 444
1093 3300048904 Ga0496101_0015346 Ga0496101_0015346_1915_3291 444
1094 3300048905 Ga0496102_0003274 Ga0496102_0003274_2659_4035 444
1095 3300048906 Ga0496103_0005911 Ga0496103_0005911_3154_4530 444
1096 3300048907 Ga0496104_0012545 Ga0496104_0012545_3966_5342 444
1097 3300048908 Ga0496105_0003825 Ga0496105_0003825_1434_2810 444
1098 3300048911 Ga0496108_0026952 Ga0496108_0026952_976_2352 444
1099 3300048912 Ga0496109_0018060 Ga0496109_0018060_2856_4232 444
1100 3300048913 Ga0496110_0010594 Ga0496110_0010594_4550_5926 444
1101 3300048915 Ga0496112_0010380 Ga0496112_0010380_4874_6250 444
1102 3300048915 Ga0496112_0084625 Ga0496112_0084625_1684_3057 444
1103 3300048915 Ga0496112_0090216 Ga0496112_0090216_1576_2949 444
1104 3300048919 Ga0496116_0031320 Ga0496116_0031320_2183_3556 444
1105 3300048920 Ga0496117_0000016 Ga0496117_0000016_225903_227276 444
1106 3300048920 Ga0496117_0077648 Ga0496117_0077648_74_1450 444
1107 3300048921 Ga0496118_0000153 Ga0496118_0000153_33149_34522 444
1108 3300048921 Ga0496118_0001953 Ga0496118_0001953_26097_27473 444
1109 3300048921 Ga0496118_0060873 Ga0496118_0060873_1385_2761 444
1110 3300048922 Ga0496119_0007331 Ga0496119_0007331_6921_8297 444
1111 3300048922 Ga0496119_0021185 Ga0496119_0021185_699_2075 444
1112 3300048922 Ga0496119_0026665 Ga0496119_0026665_1269_2642 444
1113 3300048922 Ga0496119_0045015 Ga0496119_0045015_811_2184 444
1114 3300048922 Ga0496119_0053504 Ga0496119_0053504_113_1489 444
1115 3300048923 Ga0496120_0000660 Ga0496120_0000660_37389_38762 444
1116 3300048923 Ga0496120_0004196 Ga0496120_0004196_9542_10915 444
1117 3300048923 Ga0496120_0006449 Ga0496120_0006449_3086_4462 444
1118 3300048924 Ga0496121_0001476 Ga0496121_0001476_33374_34747 444
1119 3300048924 Ga0496121_0016949 Ga0496121_0016949_4436_5812 444
1120 3300048924 Ga0496121_0077608 Ga0496121_0077608_1114_2490 444
1121 3300048924 Ga0496121_0159878 Ga0496121_0159878_170_1546 444
1122 3300048925 Ga0496122_0000002 Ga0496122_0000002_226564_227937 444
1123 3300048925 Ga0496122_0002358 Ga0496122_0002358_20734_22110 444
1124 3300048925 Ga0496122_0003859 Ga0496122_0003859_9306_10679 444
1125 3300048926 Ga0496123_0000002 Ga0496123_0000002_1583746_1585119 444
1126 3300048926 Ga0496123_0000002 Ga0496123_0000002_226564_227937 444
1127 3300048926 Ga0496123_0021716 Ga0496123_0021716_3049_4422 444
1128 3300048927 Ga0496124_0008231 Ga0496124_0008231_9380_10756 444
1129 3300048927 Ga0496124_0011294 Ga0496124_0011294_3874_5247 444
1130 3300048928 Ga0496125_0000428 Ga0496125_0000428_74141_75517 444
1131 3300048928 Ga0496125_0014527 Ga0496125_0014527_307_1680 444
1132 3300048928 Ga0496125_0023312 Ga0496125_0023312_1233_2606 444
1133 3300048928 Ga0496125_0050628 Ga0496125_0050628_810_2186 444
1134 3300048928 Ga0496125_0065695 Ga0496125_0065695_808_2184 444
1135 3300049569 Ga0501032_0008522 Ga0501032_0008522_3625_5001 444
1136 3300049570 Ga0501033_0002403 Ga0501033_0002403_8655_10031 444
1137 3300049573 Ga0501037_0000028 Ga0501037_0000028_48254_49630 444
1138 3300049579 Ga0501043_0000028 Ga0501043_0000028_50764_52140 444
1139 3300049585 Ga0501069_0000014 Ga0501069_0000014_93807_95183 444
1140 3300049586 Ga0501070_0000121 Ga0501070_0000121_19771_21147 444
1141 3300049589 Ga0501073_0021852 Ga0501073_0021852_3185_4561 444
1142 3300049590 Ga0501074_0000004 Ga0501074_0000004_85773_87149 444
1143 3300049742 Ga0501080_0000027 Ga0501080_0000027_38864_40240 444
1144 3300049744 Ga0501083_0000025 Ga0501083_0000025_91060_92436 444
1145 3300049822 Ga0501035_0000129 Ga0501035_0000129_41500_42876 444
1146 3300049823 Ga0501044_0000052 Ga0501044_0000052_26822_28198 444
1147 3300050489 nmdc:mga03683_14537_c1 nmdc:mga03683_14537_c1_1524_2897 444
1148 3300050491 nmdc:mga00v17_11453_c1 nmdc:mga00v17_11453_c1_906_2279 444
1149 3300050491 nmdc:mga00v17_11939_c1 nmdc:mga00v17_11939_c1_1406_2782 444
1150 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_5777_7150 444
1151 3300050492 nmdc:mga0yw44_10540_c1 nmdc:mga0yw44_10540_c1_239_1615 444
1152 3300050492 nmdc:mga0yw44_31834_c1 nmdc:mga0yw44_31834_c1_1368_2741 444
1153 3300050492 nmdc:mga0yw44_6443_c1 nmdc:mga0yw44_6443_c1_2918_4291 444
1154 3300050493 nmdc:mga0k408_1643_c1 nmdc:mga0k408_1643_c1_10207_11583 444
1155 3300050493 nmdc:mga0k408_28205_c1 nmdc:mga0k408_28205_c1_400_1773 444
1156 3300050494 nmdc:mga06z11_19394_c1 nmdc:mga06z11_19394_c1_785_2161 444
1157 3300050494 nmdc:mga06z11_42757_c1 nmdc:mga06z11_42757_c1_716_2092 444
1158 3300050494 nmdc:mga06z11_98357_c1 nmdc:mga06z11_98357_c1_79_1455 444
1159 3300050496 nmdc:mga07m45_40126_c1 nmdc:mga07m45_40126_c1_142_1518 444
1160 3300050496 nmdc:mga07m45_7997_c1 nmdc:mga07m45_7997_c1_3272_4648 444
1161 3300050516 nmdc:mga0sz30_17402_c1 nmdc:mga0sz30_17402_c1_1052_2428 444
1162 3300050516 nmdc:mga0sz30_28733_c1 nmdc:mga0sz30_28733_c1_635_2011 444
1163 3300050516 nmdc:mga0sz30_514_c1 nmdc:mga0sz30_514_c1_7100_8473 444
1164 3300050516 nmdc:mga0sz30_5788_c1 nmdc:mga0sz30_5788_c1_2019_3395 444
1165 3300053079 Ga0500610_0019641 Ga0500610_0019641_357_1730 444
1166 3300053083 Ga0495655_0007607 Ga0495655_0007607_505_1878 444
1167 3300053107 Ga0500560_001318 Ga0500560_001318_1539_2912 444
1168 3300053109 Ga0500569_006377 Ga0500569_006377_1007_2383 444
1169 3300053125 Ga0500618_006461 Ga0500618_006461_937_2313 444
1170 3300053125 Ga0500618_012616 Ga0500618_012616_10_1386 444
1171 3300053134 Ga0500658_0001866 Ga0500658_0001866_121_1497 444
1172 3300053137 Ga0500561_0000133 Ga0500561_0000133_1366_2739 444
1173 3300053139 Ga0500568_0012171 Ga0500568_0012171_1291_2667 444
1174 3300053148 Ga0500590_002599 Ga0500590_002599_3453_4826 444
1175 3300053153 Ga0500616_0005939 Ga0500616_0005939_1353_2729 444
1176 3300053157 Ga0500624_000337 Ga0500624_000337_10084_11457 444
1177 3300053177 Ga0500636_0000001 Ga0500636_0000001_62622_63995 444
1178 3300053177 Ga0500636_0056283 Ga0500636_0056283_445_1821 444
1179 iso_pu_bacteria 2874628541 2874634384 444
1180 iso_pu_bacteria 8002869464 8002869582 444
1181 3300005548 Ga0070665_100059322 Ga0070665_1000593223 445
1182 3300005841 Ga0068863_100051283 Ga0068863_1000512834 445
1183 3300026121 Ga0207683_10091692 Ga0207683_100916922 445
1184 3300028379 Ga0268266_10096000 Ga0268266_100960001 445
1185 3300039110 Ga0400487_39107 Ga0400487_39107_1004_2386 445
1186 3300048927 Ga0496124_0000006 Ga0496124_0000006_660041_661432 445
1187 3300053153 Ga0500616_0038875 Ga0500616_0038875_147_1523 445
1188 3300053157 Ga0500624_000016 Ga0500624_000016_31869_33251 445
1189 3300053178 Ga0500637_0000007 Ga0500637_0000007_31887_33269 445
1190 iso_pu_bacteria 2919679072 2919682597 445
1191 3300009545 Ga0105237_10003836 Ga0105237_100038368 446
1192 3300025913 Ga0207695_10031196 Ga0207695_100311964 446
1193 3300048909 Ga0496106_0006011 Ga0496106_0006011_6470_7870 446
1194 3300048920 Ga0496117_0041396 Ga0496117_0041396_1346_2746 446
1195 3300048921 Ga0496118_0023476 Ga0496118_0023476_1722_3122 446
1196 3300048924 Ga0496121_0000191 Ga0496121_0000191_89387_90787 446
1197 3300048927 Ga0496124_0029218 Ga0496124_0029218_1353_2753 446
1198 3300048928 Ga0496125_0120723 Ga0496125_0120723_420_1820 446
1199 3300048929 Ga0496126_0001278 Ga0496126_0001278_9376_10776 446
1200 3300048929 Ga0496126_0109555 Ga0496126_0109555_25_1413 446
1201 3300050489 nmdc:mga03683_12598_c1 nmdc:mga03683_12598_c1_1649_3037 446
1202 3300050492 nmdc:mga0yw44_9013_c1 nmdc:mga0yw44_9013_c1_1915_3303 446
1203 3300050507 nmdc:mga05p37_114737_c1 nmdc:mga05p37_114737_c1_482_1906 446
1204 3300053087 Ga0500643_019909 Ga0500643_019909_694_2076 446
1205 3300053140 Ga0500573_0014457 Ga0500573_0014457_559_1938 446
1206 iso_pu_bacteria 2922386360 2922387161 446
1207 iso_pu_bacteria 8016583857 8016587319 446
1208 3300031548 Ga0307408_100000948 Ga0307408_1000009484 447
1209 3300031731 Ga0307405_10019055 Ga0307405_100190553 447
1210 3300031901 Ga0307406_10064691 Ga0307406_100646912 447
1211 3300031911 Ga0307412_10007012 Ga0307412_100070123 447
1212 3300032002 Ga0307416_100082647 Ga0307416_1000826472 447
1213 3300032005 Ga0307411_10099176 Ga0307411_100991761 447
1214 3300048928 Ga0496125_0014609 Ga0496125_0014609_1863_3317 447
1215 3300009093 Ga0105240_10136724 Ga0105240_101367242 448
1216 3300028794 Ga0307515_10051586 Ga0307515_100515863 448
1217 3300048924 Ga0496121_0023957 Ga0496121_0023957_1817_3226 448
1218 iso_pu_bacteria 2919046199 2919049819 448
1219 3300001904 JGI24736J21556_1000196 JGI24736J21556_10001967 449
1220 3300001915 JGI24741J21665_1000024 JGI24741J21665_100002419 449
1221 3300001979 JGI24740J21852_10001594 JGI24740J21852_100015948 449
1222 3300002075 JGI24738J21930_10003743 JGI24738J21930_100037432 449
1223 3300005339 Ga0070660_100012565 Ga0070660_1000125653 449
1224 3300005455 Ga0070663_100008174 Ga0070663_1000081744 449
1225 3300005563 Ga0068855_100186637 Ga0068855_1001866372 449
1226 3300005577 Ga0068857_100279867 Ga0068857_1002798671 449
1227 3300005614 Ga0068856_100009010 Ga0068856_1000090101 449
1228 3300009011 Ga0105251_10031549 Ga0105251_100315492 449
1229 3300009174 Ga0105241_10001102 Ga0105241_100011027 449
1230 3300009545 Ga0105237_10010892 Ga0105237_100108926 449
1231 3300013100 Ga0157373_10010185 Ga0157373_100101852 449
1232 3300013105 Ga0157369_10104600 Ga0157369_101046002 449
1233 3300013105 Ga0157369_10177423 Ga0157369_101774232 449
1234 3300013307 Ga0157372_10234891 Ga0157372_102348912 449
1235 3300017792 Ga0163161_10043176 Ga0163161_100431763 449
1236 3300025321 Ga0207656_10025224 Ga0207656_100252242 449
1237 3300025735 Ga0207713_1036400 Ga0207713_10364002 449
1238 3300025911 Ga0207654_10008998 Ga0207654_100089983 449
1239 3300025913 Ga0207695_10036514 Ga0207695_100365143 449
1240 3300025919 Ga0207657_10062390 Ga0207657_100623902 449
1241 3300025924 Ga0207694_10011666 Ga0207694_100116661 449
1242 3300025933 Ga0207706_10046067 Ga0207706_100460673 449
1243 3300025933 Ga0207706_10120797 Ga0207706_101207972 449
1244 3300025949 Ga0207667_10090804 Ga0207667_100908043 449
1245 3300025981 Ga0207640_10017441 Ga0207640_100174413 449
1246 3300026041 Ga0207639_10000560 Ga0207639_100005606 449
1247 3300026067 Ga0207678_10002324 Ga0207678_1000232418 449
1248 3300026078 Ga0207702_10004405 Ga0207702_100044053 449
1249 3300026116 Ga0207674_10141337 Ga0207674_101413372 449
1250 3300026142 Ga0207698_10140736 Ga0207698_101407362 449
1251 3300032004 Ga0307414_10128900 Ga0307414_101289002 449
1252 3300048913 Ga0496110_0031938 Ga0496110_0031938_391_1776 449
1253 3300048925 Ga0496122_0002550 Ga0496122_0002550_17479_18864 449
1254 3300048927 Ga0496124_0004712 Ga0496124_0004712_4767_6152 449
1255 3300048928 Ga0496125_0001524 Ga0496125_0001524_6235_7620 449

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

95

518

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kqw-assembly2.cif.gz_D directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9721 9 442
5kr3-assembly1.cif.gz_B directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9717 7 442
5kr5-assembly1.cif.gz_B directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9715 9 440
5kr6-assembly1.cif.gz_A directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.971 9 440
5kqu-assembly1.cif.gz_A directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9704 9 442
ID Description Score Start End Superfamily
5kquA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9765 55 329 3.40.640.10
af_A0A1D6DZK7_115_400_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.974 58 329 3.40.640.10
6fyqA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9708 55 331 3.40.640.10
6io1A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.97 55 331 3.40.640.10
5lhaB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9683 55 329 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A534ARV6-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9917 333 449 GO:0008483
GO:0030170
AF-A0A149SA99-F1-model_v4 deleted 0.9836 9 365
AF-A0A3M1GGM4-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.976 1 300 GO:0005829
GO:0008483
GO:0030170
AF-A0A534ARV6-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9752 333 449 GO:0008483
GO:0030170
AF-A0A7C3AS51-F1-model_v4 Aspartate aminotransferase family protein 0.9732 52 439 GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
92.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map