F492228

General Info

Members Datasets Scaffolds Average Seq Length
1254 399 2508 92

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_11220825|Ga0070681_112208252
Length 90
Sequence MATTCTHLGEIKVSQTQTRVCNECVQLGDTWVHLGHVGCCDSSKNKHATRHFHRTRHPLIRSIEPGERWVWCYVDEMAPGELPSEGIVAR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
144 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
220 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
237 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
264 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
265 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
266 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
267 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
275 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
276 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
319 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
320 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
321 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
336 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
355 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
356 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
357 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.19
Metatranscriptomes 7.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 1.28
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 15.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_11220825 3300005458 Bacteria 674
2 JGI24747J21853_1012948 3300001978 Unclassified 856
3 JGI24743J22301_10006256 3300001991 Bacteria 2021
4 JGI24745J21846_1039197 3300002073 Unclassified 584
5 JGI24033J26618_1047475 3300002155 Unclassified 610
6 JGI24034J26672_10006364 3300002239 Bacteria 1703
7 rootH1_10074194 3300003316 Bacteria 1578
8 rootH1_10118688 3300003323 Bacteria 2762
9 Ga0058863_10169016 3300004799 Bacteria 1115
10 Ga0058863_11328245 3300004799 Bacteria 1361
11 Ga0058863_11972463 3300004799 Bacteria 875
12 Ga0058861_10035870 3300004800 Bacteria 668
13 Ga0058862_12838737 3300004803 Bacteria 945
14 Ga0065165_1001397 3300005262 Bacteria 26353
15 Ga0065712_10127583 3300005290 Bacteria 1589
16 Ga0065712_10533850 3300005290 Unclassified 628
17 Ga0065715_10447627 3300005293 Unclassified 827
18 Ga0065707_10161803 3300005295 Bacteria 1541
19 Ga0065707_10612311 3300005295 Bacteria 669
20 Ga0070658_10067908 3300005327 Bacteria 2914
21 Ga0070658_10169186 3300005327 Bacteria 1836
22 Ga0070658_10208422 3300005327 Bacteria 1651
23 Ga0070658_10348612 3300005327 Unclassified 1267
24 Ga0070676_10028309 3300005328 Bacteria 3182
25 Ga0070683_100038660 3300005329 Bacteria 4375
26 Ga0070683_100043720 3300005329 Unclassified 4129
27 Ga0070683_100052914 3300005329 Bacteria 3762
28 Ga0070683_100068057 3300005329 Bacteria 3317
29 Ga0070683_100307367 3300005329 Bacteria 1508
30 Ga0070690_100055358 3300005330 Bacteria 2541
31 Ga0070690_101283815 3300005330 Bacteria 586
32 Ga0070670_100003945 3300005331 Bacteria 12379
33 Ga0070670_100038379 3300005331 Bacteria 4119
34 Ga0070677_10008635 3300005333 Bacteria 3435
35 Ga0070677_10666361 3300005333 Bacteria 583
36 Ga0068869_100001726 3300005334 Bacteria 13057
37 Ga0068869_100043396 3300005334 Bacteria 3229
38 Ga0068869_101269207 3300005334 Bacteria 649
39 Ga0068869_101385045 3300005334 Bacteria 622
40 Ga0070666_10018142 3300005335 Bacteria 4520
41 Ga0070666_10054209 3300005335 Bacteria 2705
42 Ga0070666_10076867 3300005335 Bacteria 2278
43 Ga0070666_10113694 3300005335 Bacteria 1873
44 Ga0070666_10947841 3300005335 Bacteria 637
45 Ga0070680_100075561 3300005336 Bacteria 2773
46 Ga0070680_100107381 3300005336 Bacteria 2322
47 Ga0070680_100152520 3300005336 Bacteria 1940
48 Ga0070680_100153174 3300005336 Unclassified 1936
49 Ga0070680_100286226 3300005336 Bacteria 1397
50 Ga0070680_100560506 3300005336 Bacteria 979
51 Ga0070680_100612333 3300005336 Bacteria 935
52 Ga0070680_100994740 3300005336 Bacteria 724
53 Ga0070680_101115834 3300005336 Bacteria 682
54 Ga0070680_101321102 3300005336 Bacteria 624
55 Ga0070682_100008051 3300005337 Bacteria 5936
56 Ga0070682_100126134 3300005337 Bacteria 1725
57 Ga0070682_100158085 3300005337 Bacteria 1562
58 Ga0070682_100289385 3300005337 Bacteria 1197
59 Ga0070682_100774831 3300005337 Bacteria 777
60 Ga0068868_100002997 3300005338 Bacteria 11735
61 Ga0068868_100020426 3300005338 Bacteria 4976
62 Ga0068868_100290804 3300005338 Bacteria 1385
63 Ga0068868_101152182 3300005338 Bacteria 715
64 Ga0070660_100014330 3300005339 Bacteria 5709
65 Ga0070660_100084372 3300005339 Bacteria 2496
66 Ga0070660_100087160 3300005339 Unclassified 2457
67 Ga0070660_100100200 3300005339 Bacteria 2294
68 Ga0070660_100165686 3300005339 Bacteria 1783
69 Ga0070660_100178381 3300005339 Bacteria 1718
70 Ga0070660_100618630 3300005339 Bacteria 906
71 Ga0070660_100836793 3300005339 Bacteria 775
72 Ga0070660_101126500 3300005339 Bacteria 664
73 Ga0070689_100067085 3300005340 Bacteria 2796
74 Ga0070689_100110645 3300005340 Bacteria 2184
75 Ga0070689_100327815 3300005340 Unclassified 1280
76 Ga0070689_100399077 3300005340 Bacteria 1162
77 Ga0070689_100842324 3300005340 Bacteria 809
78 Ga0070691_10522192 3300005341 Unclassified 689
79 Ga0070687_100001840 3300005343 Bacteria 7678
80 Ga0070687_100140135 3300005343 Unclassified 1407
81 Ga0070687_100464332 3300005343 Bacteria 845
82 Ga0070661_100073479 3300005344 Bacteria 2517
83 Ga0070661_100168682 3300005344 Bacteria 1661
84 Ga0070661_100190755 3300005344 Unclassified 1563
85 Ga0070661_100957281 3300005344 Unclassified 709
86 Ga0070661_101680762 3300005344 Unclassified 538
87 Ga0070692_10172236 3300005345 Bacteria 1248
88 Ga0070692_10291007 3300005345 Bacteria 994
89 Ga0070668_100003692 3300005347 Bacteria 11309
90 Ga0070668_100081837 3300005347 Bacteria 2532
91 Ga0070669_100003850 3300005353 Bacteria 10843
92 Ga0070669_100005119 3300005353 Bacteria 9479
93 Ga0070669_100015754 3300005353 Bacteria 5390
94 Ga0070675_100009409 3300005354 Bacteria 7603
95 Ga0070675_100271021 3300005354 Bacteria 1490
96 Ga0070675_100314509 3300005354 Unclassified 1382
97 Ga0070675_100333965 3300005354 Bacteria 1341
98 Ga0070675_100632150 3300005354 Bacteria 972
99 Ga0070675_101087962 3300005354 Bacteria 735
100 Ga0070675_101983338 3300005354 Bacteria 537
101 Ga0070671_100171947 3300005355 Bacteria 1833
102 Ga0070671_100227365 3300005355 Bacteria 1583
103 Ga0070671_100365827 3300005355 Unclassified 1231
104 Ga0070674_100189458 3300005356 Bacteria 1581
105 Ga0070674_100211449 3300005356 Unclassified 1503
106 Ga0070674_100421931 3300005356 Bacteria 1095
107 Ga0070674_100517064 3300005356 Bacteria 997
108 Ga0070674_100733963 3300005356 Bacteria 847
109 Ga0070673_100029628 3300005364 Unclassified 4084
110 Ga0070673_100588816 3300005364 Bacteria 1014
111 Ga0070673_101218483 3300005364 Bacteria 705
112 Ga0070688_100091372 3300005365 Bacteria 1989
113 Ga0070688_100317300 3300005365 Unclassified 1131
114 Ga0070688_100820135 3300005365 Bacteria 729
115 Ga0070688_101812804 3300005365 Bacteria 501
116 Ga0070659_100002666 3300005366 Bacteria 12691
117 Ga0070659_100005672 3300005366 Bacteria 8976
118 Ga0070659_100020948 3300005366 Bacteria 4972
119 Ga0070659_100146655 3300005366 Bacteria 1923
120 Ga0070659_100344500 3300005366 Bacteria 1249
121 Ga0070659_100590702 3300005366 Bacteria 953
122 Ga0070667_100012858 3300005367 Bacteria 6916
123 Ga0070667_100039392 3300005367 Bacteria 3961
124 Ga0070667_100138543 3300005367 Bacteria 2129
125 Ga0070667_100299692 3300005367 Bacteria 1447
126 Ga0070667_100335736 3300005367 Unclassified 1366
127 Ga0070709_10013822 3300005434 Bacteria 4550
128 Ga0070709_10022458 3300005434 Bacteria 3691
129 Ga0070709_10028444 3300005434 Bacteria 3333
130 Ga0070709_10101067 3300005434 Bacteria 1921
131 Ga0070709_10157872 3300005434 Bacteria 1574
132 Ga0070709_10173118 3300005434 Bacteria 1510
133 Ga0070709_10198254 3300005434 Bacteria 1420
134 Ga0070709_10218868 3300005434 Bacteria 1357
135 Ga0070709_10827624 3300005434 Unclassified 728
136 Ga0070714_100008559 3300005435 Bacteria 8000
137 Ga0070714_100079767 3300005435 Bacteria 2846
138 Ga0070714_100169170 3300005435 Bacteria 1982
139 Ga0070714_100173109 3300005435 Bacteria 1960
140 Ga0070714_100200496 3300005435 Bacteria 1825
141 Ga0070714_100273817 3300005435 Bacteria 1566
142 Ga0070714_100571329 3300005435 Unclassified 1084
143 Ga0070714_100832148 3300005435 Unclassified 895
144 Ga0070714_101467519 3300005435 Bacteria 666
145 Ga0070714_101860292 3300005435 Unclassified 588
146 Ga0070713_100031891 3300005436 Bacteria 4202
147 Ga0070713_100054101 3300005436 Bacteria 3329
148 Ga0070713_100253781 3300005436 Bacteria 1605
149 Ga0070713_100596834 3300005436 Bacteria 1049
150 Ga0070713_101262329 3300005436 Unclassified 715
151 Ga0070713_101485823 3300005436 Unclassified 657
152 Ga0070713_101651276 3300005436 Bacteria 622
153 Ga0070710_10032552 3300005437 Bacteria 2825
154 Ga0070710_10049421 3300005437 Bacteria 2352
155 Ga0070710_10297599 3300005437 Unclassified 1052
156 Ga0070710_10650914 3300005437 Unclassified 739
157 Ga0070711_100002998 3300005439 Bacteria 9750
158 Ga0070711_100003181 3300005439 Bacteria 9527
159 Ga0070711_100009164 3300005439 Bacteria 6083
160 Ga0070711_100245733 3300005439 Bacteria 1401
161 Ga0070711_100600650 3300005439 Bacteria 918
162 Ga0070711_101149337 3300005439 Bacteria 670
163 Ga0070711_101741672 3300005439 Bacteria 546
164 Ga0070700_100220340 3300005441 Bacteria 1344
165 Ga0070700_100353091 3300005441 Bacteria 1091
166 Ga0070694_100036045 3300005444 Bacteria 3274
167 Ga0070708_100101920 3300005445 Unclassified 2630
168 Ga0070708_100112405 3300005445 Bacteria 2505
169 Ga0070708_100173433 3300005445 Bacteria 2014
170 Ga0070708_100430714 3300005445 Bacteria 1244
171 Ga0070708_100704655 3300005445 Bacteria 950
172 Ga0070663_100018203 3300005455 Unclassified 4599
173 Ga0070663_100020969 3300005455 Bacteria 4336
174 Ga0070663_100140869 3300005455 Bacteria 1841
175 Ga0070663_100222803 3300005455 Bacteria 1481
176 Ga0070663_100870956 3300005455 Unclassified 776
177 Ga0070663_100942412 3300005455 Unclassified 748
178 Ga0070678_100506091 3300005456 Bacteria 1066
179 Ga0070678_100978581 3300005456 Bacteria 777
180 Ga0070678_101463464 3300005456 Bacteria 639
181 Ga0070662_100002683 3300005457 Bacteria 10979
182 Ga0070662_100019519 3300005457 Unclassified 4602
183 Ga0070662_100319859 3300005457 Unclassified 1265
184 Ga0070662_100348908 3300005457 Bacteria 1212
185 Ga0070681_10000034 3300005458 Bacteria 98600
186 Ga0070681_10000866 3300005458 Bacteria 25486
187 Ga0070681_10004801 3300005458 Bacteria 12958
188 Ga0070681_10015551 3300005458 Bacteria 7579
189 Ga0070681_10053214 3300005458 Bacteria 4034
190 Ga0070681_10066651 3300005458 Bacteria 3569
191 Ga0070681_10110791 3300005458 Bacteria 2684
192 Ga0070681_10124433 3300005458 Bacteria 2511
193 Ga0070681_10257813 3300005458 Bacteria 1656
194 Ga0070681_10331415 3300005458 Bacteria 1432
195 Ga0070681_10480312 3300005458 Bacteria 1155
196 Ga0070681_10587272 3300005458 Bacteria 1028
197 Ga0070681_10849360 3300005458 Bacteria 831
198 Ga0070681_11092996 3300005458 Unclassified 718
199 Ga0068867_100002188 3300005459 Bacteria 13721
200 Ga0068867_100003854 3300005459 Bacteria 10546
201 Ga0068867_100013806 3300005459 Bacteria 5719
202 Ga0068867_100038423 3300005459 Bacteria 3485
203 Ga0068867_100046167 3300005459 Bacteria 3198
204 Ga0068867_100312526 3300005459 Bacteria 1299
205 Ga0068867_100929926 3300005459 Bacteria 784
206 Ga0068867_101267561 3300005459 Bacteria 679
207 Ga0068867_101273963 3300005459 Bacteria 678
208 Ga0070685_10020596 3300005466 Bacteria 3569
209 Ga0070685_10203978 3300005466 Bacteria 1287
210 Ga0070685_10516900 3300005466 Unclassified 847
211 Ga0070706_100004512 3300005467 Bacteria 13405
212 Ga0070706_100031340 3300005467 Bacteria 4903
213 Ga0070706_100233730 3300005467 Unclassified 1716
214 Ga0070706_101018619 3300005467 Unclassified 763
215 Ga0070706_102027529 3300005467 Bacteria 521
216 Ga0070707_100019321 3300005468 Bacteria 6417
217 Ga0070707_100062647 3300005468 Bacteria 3568
218 Ga0070707_100070745 3300005468 Bacteria 3360
219 Ga0070707_100386866 3300005468 Bacteria 1358
220 Ga0070707_100644972 3300005468 Bacteria 1021
221 Ga0070707_100702543 3300005468 Bacteria 974
222 Ga0070707_101267169 3300005468 Bacteria 703
223 Ga0070698_100003066 3300005471 Bacteria 18422
224 Ga0070698_100048069 3300005471 Unclassified 4360
225 Ga0070698_100082784 3300005471 Bacteria 3200
226 Ga0070698_100251452 3300005471 Bacteria 1700
227 Ga0070698_100422048 3300005471 Bacteria 1268
228 Ga0070699_100010361 3300005518 Bacteria 8062
229 Ga0070699_100095096 3300005518 Bacteria 2608
230 Ga0070699_100273406 3300005518 Bacteria 1513
231 Ga0070699_100562450 3300005518 Bacteria 1038
232 Ga0070699_100781710 3300005518 Bacteria 873
233 Ga0070699_101204775 3300005518 Bacteria 695
234 Ga0070699_102115654 3300005518 Bacteria 514
235 Ga0070679_100004353 3300005530 Bacteria 13079
236 Ga0070679_100131869 3300005530 Bacteria 2480
237 Ga0070679_100278304 3300005530 Bacteria 1626
238 Ga0070679_100311181 3300005530 Bacteria 1525
239 Ga0070679_100509907 3300005530 Bacteria 1147
240 Ga0070679_100565309 3300005530 Bacteria 1081
241 Ga0070679_100687620 3300005530 Bacteria 966
242 Ga0070679_100749370 3300005530 Unclassified 919
243 Ga0070679_101154407 3300005530 Bacteria 719
244 Ga0070679_101238367 3300005530 Unclassified 692
245 Ga0070684_100009298 3300005535 Bacteria 7736
246 Ga0070684_100032072 3300005535 Bacteria 4476
247 Ga0070684_100032814 3300005535 Bacteria 4430
248 Ga0070684_100090844 3300005535 Bacteria 2716
249 Ga0070684_100102391 3300005535 Bacteria 2560
250 Ga0070684_100139502 3300005535 Bacteria 2192
251 Ga0070684_100141434 3300005535 Bacteria 2176
252 Ga0070684_100149776 3300005535 Bacteria 2113
253 Ga0070684_100366017 3300005535 Bacteria 1327
254 Ga0070684_100426222 3300005535 Bacteria 1225
255 Ga0070684_100637644 3300005535 Bacteria 991
256 Ga0070684_101002781 3300005535 Unclassified 784
257 Ga0070684_102140132 3300005535 Bacteria 528
258 Ga0070697_100038980 3300005536 Bacteria 3840
259 Ga0070697_100083399 3300005536 Bacteria 2636
260 Ga0070697_100159347 3300005536 Bacteria 1906
261 Ga0070697_100254727 3300005536 Bacteria 1501
262 Ga0070697_100929069 3300005536 Bacteria 772
263 Ga0070697_101541598 3300005536 Bacteria 594
264 Ga0068853_100006343 3300005539 Bacteria 9387
265 Ga0068853_100023709 3300005539 Bacteria 5141
266 Ga0068853_100023953 3300005539 Bacteria 5116
267 Ga0068853_100054558 3300005539 Bacteria 3444
268 Ga0068853_100136453 3300005539 Unclassified 2200
269 Ga0068853_100208592 3300005539 Unclassified 1780
270 Ga0068853_100474674 3300005539 Bacteria 1179
271 Ga0068853_100560559 3300005539 Bacteria 1083
272 Ga0068853_100788036 3300005539 Bacteria 910
273 Ga0070672_100131384 3300005543 Bacteria 2058
274 Ga0070672_101200556 3300005543 Bacteria 676
275 Ga0070672_101270673 3300005543 Bacteria 657
276 Ga0070686_100001440 3300005544 Bacteria 13445
277 Ga0070686_100007852 3300005544 Bacteria 5965
278 Ga0070686_100049173 3300005544 Bacteria 2674
279 Ga0070695_100032054 3300005545 Unclassified 3284
280 Ga0070695_100208066 3300005545 Bacteria 1402
281 Ga0070695_100972452 3300005545 Bacteria 689
282 Ga0070693_100010082 3300005547 Bacteria 4718
283 Ga0070693_100036873 3300005547 Bacteria 2721
284 Ga0070693_100198595 3300005547 Bacteria 1301
285 Ga0070665_100008136 3300005548 Bacteria 10615
286 Ga0070665_100066861 3300005548 Bacteria 3605
287 Ga0070704_100142682 3300005549 Unclassified 1872
288 Ga0070704_100214449 3300005549 Unclassified 1562
289 Ga0068855_100001570 3300005563 Bacteria 28673
290 Ga0068855_100002685 3300005563 Bacteria 21936
291 Ga0068855_100004336 3300005563 Bacteria 17344
292 Ga0068855_100008443 3300005563 Bacteria 12454
293 Ga0068855_100008940 3300005563 Bacteria 12109
294 Ga0068855_100064834 3300005563 Bacteria 4260
295 Ga0068855_100184044 3300005563 Bacteria 2361
296 Ga0068855_100304257 3300005563 Bacteria 1765
297 Ga0068855_100308434 3300005563 Bacteria 1751
298 Ga0068855_100452362 3300005563 Bacteria 1401
299 Ga0068855_100456708 3300005563 Unclassified 1393
300 Ga0068855_100488219 3300005563 Bacteria 1340
301 Ga0068855_100514410 3300005563 Bacteria 1299
302 Ga0068855_100553639 3300005563 Bacteria 1245
303 Ga0068855_100922035 3300005563 Bacteria 922
304 Ga0068855_100929057 3300005563 Bacteria 917
305 Ga0068855_101753069 3300005563 Bacteria 632
306 Ga0068855_102033078 3300005563 Unclassified 580
307 Ga0070664_100003262 3300005564 Bacteria 13103
308 Ga0070664_100012731 3300005564 Bacteria 6846
309 Ga0070664_100081223 3300005564 Bacteria 2793
310 Ga0070664_100166698 3300005564 Bacteria 1952
311 Ga0070664_100199625 3300005564 Bacteria 1784
312 Ga0070664_100212178 3300005564 Bacteria 1730
313 Ga0070664_100215277 3300005564 Bacteria 1717
314 Ga0070664_100994725 3300005564 Unclassified 788
315 Ga0070664_101188301 3300005564 Bacteria 719
316 Ga0070664_102389646 3300005564 Unclassified 501
317 Ga0068857_100001766 3300005577 Bacteria 17387
318 Ga0068857_100008687 3300005577 Bacteria 8790
319 Ga0068857_100136799 3300005577 Bacteria 2212
320 Ga0068857_100193153 3300005577 Bacteria 1854
321 Ga0068857_100262556 3300005577 Bacteria 1585
322 Ga0068857_100634991 3300005577 Bacteria 1011
323 Ga0068854_100010285 3300005578 Bacteria 6064
324 Ga0068854_100014154 3300005578 Bacteria 5252
325 Ga0068854_100014415 3300005578 Bacteria 5212
326 Ga0068854_100267898 3300005578 Bacteria 1370
327 Ga0068854_100409927 3300005578 Bacteria 1123
328 Ga0068854_100433188 3300005578 Bacteria 1094
329 Ga0068854_100492617 3300005578 Unclassified 1031
330 Ga0068854_100579220 3300005578 Unclassified 955
331 Ga0068854_101500153 3300005578 Bacteria 612
332 Ga0068856_100000494 3300005614 Bacteria 43641
333 Ga0068856_100000571 3300005614 Bacteria 40367
334 Ga0068856_100012826 3300005614 Bacteria 8110
335 Ga0068856_100020988 3300005614 Bacteria 6347
336 Ga0068856_100025816 3300005614 Bacteria 5729
337 Ga0068856_100067395 3300005614 Bacteria 3537
338 Ga0068856_100244501 3300005614 Unclassified 1809
339 Ga0068856_100503913 3300005614 Bacteria 1232
340 Ga0068856_100757148 3300005614 Bacteria 991
341 Ga0068856_100956440 3300005614 Bacteria 875
342 Ga0070702_100010550 3300005615 Bacteria 4557
343 Ga0070702_100151567 3300005615 Bacteria 1489
344 Ga0070702_100585260 3300005615 Unclassified 834
345 Ga0068852_100019955 3300005616 Bacteria 5320
346 Ga0068852_100027091 3300005616 Bacteria 4666
347 Ga0068852_100054256 3300005616 Bacteria 3454
348 Ga0068852_100069129 3300005616 Bacteria 3094
349 Ga0068852_100079200 3300005616 Bacteria 2910
350 Ga0068852_100098365 3300005616 Bacteria 2634
351 Ga0068852_100251898 3300005616 Bacteria 1692
352 Ga0068852_100375349 3300005616 Bacteria 1394
353 Ga0068852_100801204 3300005616 Bacteria 956
354 Ga0068852_100899419 3300005616 Bacteria 902
355 Ga0068852_100917667 3300005616 Bacteria 893
356 Ga0068852_102272074 3300005616 Bacteria 564
357 Ga0068852_102805074 3300005616 Bacteria 506
358 Ga0068859_100000492 3300005617 Bacteria 38877
359 Ga0068859_100074505 3300005617 Bacteria 3433
360 Ga0068864_100000824 3300005618 Bacteria 26117
361 Ga0068864_100013098 3300005618 Bacteria 6869
362 Ga0068864_100065215 3300005618 Bacteria 3159
363 Ga0068864_100167207 3300005618 Unclassified 2003
364 Ga0068864_100195582 3300005618 Bacteria 1855
365 Ga0068864_100230741 3300005618 Bacteria 1712
366 Ga0068864_101128535 3300005618 Unclassified 781
367 Ga0068864_101387445 3300005618 Bacteria 704
368 Ga0068864_101890436 3300005618 Bacteria 603
369 Ga0068866_10012445 3300005718 Bacteria 3706
370 Ga0068866_10019171 3300005718 Bacteria 3108
371 Ga0068866_10124922 3300005718 Bacteria 1455
372 Ga0068866_10279063 3300005718 Unclassified 1034
373 Ga0068866_10315632 3300005718 Bacteria 981
374 Ga0068866_10407211 3300005718 Bacteria 879
375 Ga0068866_10649388 3300005718 Bacteria 718
376 Ga0068861_100011158 3300005719 Bacteria 6239
377 Ga0068861_100063942 3300005719 Bacteria 2830
378 Ga0068851_10005651 3300005834 Bacteria 5681
379 Ga0068851_10014132 3300005834 Bacteria 3786
380 Ga0068851_10045214 3300005834 Bacteria 2225
381 Ga0068851_10064097 3300005834 Bacteria 1888
382 Ga0068851_10076787 3300005834 Bacteria 1738
383 Ga0068870_10013857 3300005840 Bacteria 3798
384 Ga0068870_10047272 3300005840 Bacteria 2262
385 Ga0068863_100002384 3300005841 Bacteria 18685
386 Ga0068863_100088618 3300005841 Bacteria 2933
387 Ga0068863_100131057 3300005841 Bacteria 2394
388 Ga0068863_100340322 3300005841 Bacteria 1459
389 Ga0068863_101859382 3300005841 Bacteria 612
390 Ga0068858_100001288 3300005842 Bacteria 25901
391 Ga0068858_100001544 3300005842 Bacteria 23649
392 Ga0068858_100021746 3300005842 Bacteria 5992
393 Ga0068858_100041995 3300005842 Bacteria 4240
394 Ga0068858_100254555 3300005842 Bacteria 1668
395 Ga0068858_101029876 3300005842 Bacteria 807
396 Ga0068858_101848427 3300005842 Bacteria 597
397 Ga0068858_102118706 3300005842 Unclassified 556
398 Ga0068860_100005288 3300005843 Bacteria 13101
399 Ga0068860_100048364 3300005843 Bacteria 4053
400 Ga0068860_100079065 3300005843 Bacteria 3127
401 Ga0068860_100389342 3300005843 Bacteria 1377
402 Ga0068862_100009136 3300005844 Bacteria 8205
403 Ga0068862_100028003 3300005844 Unclassified 4746
404 Ga0068862_100234747 3300005844 Bacteria 1665
405 Ga0070717_10022337 3300006028 Bacteria 4997
406 Ga0070717_10024241 3300006028 Bacteria 4816
407 Ga0070717_10067404 3300006028 Bacteria 2978
408 Ga0070717_10067722 3300006028 Bacteria 2971
409 Ga0070717_10071819 3300006028 Bacteria 2888
410 Ga0070717_10082774 3300006028 Bacteria 2697
411 Ga0070717_10118244 3300006028 Bacteria 2268
412 Ga0070717_10132130 3300006028 Bacteria 2147
413 Ga0070717_10180915 3300006028 Bacteria 1838
414 Ga0070717_10233836 3300006028 Bacteria 1619
415 Ga0070717_10339978 3300006028 Bacteria 1340
416 Ga0070717_10484587 3300006028 Bacteria 1117
417 Ga0070717_10538846 3300006028 Bacteria 1057
418 Ga0070717_10551574 3300006028 Bacteria 1044
419 Ga0070717_10725068 3300006028 Bacteria 903
420 Ga0070717_10762431 3300006028 Bacteria 880
421 Ga0070717_10974339 3300006028 Unclassified 772
422 Ga0070717_11902935 3300006028 Bacteria 537
423 Ga0070715_10072093 3300006163 Unclassified 1546
424 Ga0070715_10287454 3300006163 Bacteria 874
425 Ga0070715_10472278 3300006163 Bacteria 712
426 Ga0070716_100015742 3300006173 Bacteria 3891
427 Ga0070716_100018398 3300006173 Bacteria 3639
428 Ga0070716_100074910 3300006173 Bacteria 2001
429 Ga0070716_100126690 3300006173 Bacteria 1607
430 Ga0070716_100161478 3300006173 Bacteria 1452
431 Ga0070716_100336149 3300006173 Bacteria 1064
432 Ga0070716_100599832 3300006173 Bacteria 828
433 Ga0070716_100762141 3300006173 Bacteria 746
434 Ga0070716_101284460 3300006173 Bacteria 591
435 Ga0070712_100006231 3300006175 Bacteria 7385
436 Ga0070712_100082778 3300006175 Unclassified 2328
437 Ga0070712_100150532 3300006175 Bacteria 1786
438 Ga0070712_100530535 3300006175 Unclassified 990
439 Ga0070712_100558024 3300006175 Bacteria 966
440 Ga0070712_100579700 3300006175 Bacteria 948
441 Ga0070712_101044626 3300006175 Bacteria 708
442 Ga0070712_101485410 3300006175 Bacteria 592
443 Ga0070712_101727666 3300006175 Bacteria 548
444 Ga0070712_101860946 3300006175 Bacteria 527
445 Ga0070712_101931714 3300006175 Bacteria 517
446 Ga0075367_11088914 3300006178 Bacteria 511
447 Ga0075369_10588796 3300006186 Bacteria 532
448 Ga0075366_10596748 3300006195 Bacteria 684
449 Ga0097621_100000229 3300006237 Bacteria 37450
450 Ga0097621_100000693 3300006237 Bacteria 23626
451 Ga0097621_100137848 3300006237 Bacteria 2083
452 Ga0097621_100141888 3300006237 Bacteria 2053
453 Ga0097621_100148402 3300006237 Bacteria 2010
454 Ga0097621_100200184 3300006237 Bacteria 1733
455 Ga0097621_100386003 3300006237 Unclassified 1252
456 Ga0075370_10553726 3300006353 Bacteria 695
457 Ga0075370_10863884 3300006353 Bacteria 552
458 Ga0068871_100000071 3300006358 Bacteria 57255
459 Ga0068871_100000385 3300006358 Bacteria 31027
460 Ga0068871_100058479 3300006358 Bacteria 3139
461 Ga0068871_100078544 3300006358 Bacteria 2729
462 Ga0068871_100489008 3300006358 Bacteria 1108
463 Ga0068871_100680070 3300006358 Bacteria 941
464 Ga0068871_100796269 3300006358 Unclassified 871
465 Ga0068871_100969087 3300006358 Bacteria 791
466 Ga0075428_100091508 3300006844 Bacteria 3317
467 Ga0075431_100112124 3300006847 Bacteria 2815
468 Ga0075431_100149163 3300006847 Bacteria 2408
469 Ga0075431_101463496 3300006847 Unclassified 642
470 Ga0075433_10074837 3300006852 Bacteria 2980
471 Ga0075433_10083094 3300006852 Bacteria 2826
472 Ga0075433_10250864 3300006852 Bacteria 1570
473 Ga0075433_10603100 3300006852 Unclassified 964
474 Ga0075433_10893613 3300006852 Unclassified 775
475 Ga0075434_100092177 3300006871 Bacteria 3032
476 Ga0075434_100235761 3300006871 Bacteria 1850
477 Ga0075434_100339306 3300006871 Archaea 1523
478 Ga0075434_100501817 3300006871 Bacteria 1234
479 Ga0075434_100651057 3300006871 Bacteria 1072
480 Ga0075434_101123744 3300006871 Bacteria 799
481 Ga0075429_101554111 3300006880 Bacteria 575
482 Ga0068865_100007241 3300006881 Bacteria 6816
483 Ga0068865_100008484 3300006881 Bacteria 6353
484 Ga0068865_100055079 3300006881 Bacteria 2766
485 Ga0068865_100341961 3300006881 Bacteria 1209
486 Ga0068865_101606070 3300006881 Bacteria 584
487 Ga0075436_100000697 3300006914 Bacteria 22196
488 Ga0075436_100003624 3300006914 Bacteria 10593
489 Ga0075436_100147844 3300006914 Bacteria 1652
490 Ga0075436_100763269 3300006914 Bacteria 719
491 Ga0075436_100832783 3300006914 Bacteria 688
492 Ga0075436_101050582 3300006914 Bacteria 612
493 Ga0075436_101327608 3300006914 Bacteria 544
494 Ga0097620_100000492 3300006931 Bacteria 38877
495 Ga0097620_100074504 3300006931 Bacteria 3433
496 Ga0075435_100040851 3300007076 Bacteria 3705
497 Ga0075435_100057986 3300007076 Bacteria 3134
498 Ga0075435_100659858 3300007076 Bacteria 908
499 Ga0075435_100711358 3300007076 Unclassified 873
500 Ga0075435_100879516 3300007076 Bacteria 781
501 Ga0099794_10045534 3300007265 Bacteria 2100
502 Ga0099794_10057241 3300007265 Unclassified 1888
503 Ga0099795_10002569 3300007788 Bacteria 4303
504 Ga0099795_10083995 3300007788 Bacteria 1223
505 Ga0099795_10332724 3300007788 Bacteria 675
506 Ga0099795_10441934 3300007788 Unclassified 597
507 Ga0105240_10049521 3300009093 Bacteria 5302
508 Ga0105240_10099336 3300009093 Bacteria 3543
509 Ga0105240_10167885 3300009093 Bacteria 2601
510 Ga0105240_10171524 3300009093 Bacteria 2569
511 Ga0105240_10190823 3300009093 Bacteria 2410
512 Ga0105240_10216638 3300009093 Bacteria 2233
513 Ga0105240_10293649 3300009093 Bacteria 1862
514 Ga0105240_10331838 3300009093 Bacteria 1730
515 Ga0105240_10721310 3300009093 Bacteria 1086
516 Ga0105240_10941884 3300009093 Bacteria 927
517 Ga0105240_12560500 3300009093 Unclassified 527
518 Ga0111539_10461367 3300009094 Bacteria 1479
519 Ga0111539_10840582 3300009094 Unclassified 1068
520 Ga0105245_10045147 3300009098 Bacteria 3934
521 Ga0105245_10090667 3300009098 Bacteria 2812
522 Ga0105245_11629084 3300009098 Bacteria 697
523 Ga0105245_13039597 3300009098 Bacteria 520
524 Ga0105247_10009761 3300009101 Bacteria 5821
525 Ga0105247_10033696 3300009101 Bacteria 3117
526 Ga0105247_10534996 3300009101 Bacteria 859
527 Ga0105247_11488170 3300009101 Bacteria 551
528 Ga0114129_10017580 3300009147 Bacteria 10179
529 Ga0114129_10613916 3300009147 Unclassified 1407
530 Ga0114129_10676335 3300009147 Bacteria 1329
531 Ga0105243_10024167 3300009148 Bacteria 4634
532 Ga0105243_10262795 3300009148 Bacteria 1546
533 Ga0105243_10555437 3300009148 Bacteria 1098
534 Ga0105243_10752150 3300009148 Unclassified 956
535 Ga0105241_10012600 3300009174 Bacteria 6203
536 Ga0105241_10035957 3300009174 Bacteria 3726
537 Ga0105241_10060437 3300009174 Bacteria 2915
538 Ga0105241_10089093 3300009174 Unclassified 2431
539 Ga0105241_10176533 3300009174 Bacteria 1769
540 Ga0105241_12696890 3300009174 Unclassified 500
541 Ga0105242_10003389 3300009176 Bacteria 12406
542 Ga0105242_10083140 3300009176 Bacteria 2680
543 Ga0105242_10161211 3300009176 Bacteria 1963
544 Ga0105242_10190421 3300009176 Bacteria 1816
545 Ga0105242_11216657 3300009176 Unclassified 773
546 Ga0105242_12984224 3300009176 Bacteria 524
547 Ga0105248_10006560 3300009177 Bacteria 12762
548 Ga0105248_10014540 3300009177 Bacteria 8663
549 Ga0105248_10027109 3300009177 Bacteria 6374
550 Ga0105248_10042946 3300009177 Bacteria 5069
551 Ga0105248_10158876 3300009177 Bacteria 2550
552 Ga0105248_10260273 3300009177 Bacteria 1953
553 Ga0105248_11941565 3300009177 Bacteria 668
554 Ga0105248_12632921 3300009177 Bacteria 573
555 Ga0105248_13136286 3300009177 Bacteria 526
556 Ga0105237_10000998 3300009545 Bacteria 38080
557 Ga0105237_10076207 3300009545 Unclassified 3344
558 Ga0105237_10120418 3300009545 Bacteria 2619
559 Ga0105237_10146511 3300009545 Bacteria 2356
560 Ga0105237_10163256 3300009545 Bacteria 2226
561 Ga0105237_10373749 3300009545 Bacteria 1430
562 Ga0105237_10475712 3300009545 Bacteria 1255
563 Ga0105237_10537681 3300009545 Bacteria 1175
564 Ga0105237_10761076 3300009545 Bacteria 975
565 Ga0105237_11360921 3300009545 Bacteria 716
566 Ga0105237_12458177 3300009545 Unclassified 531
567 Ga0105238_10028767 3300009551 Bacteria 5660
568 Ga0105238_10131860 3300009551 Bacteria 2477
569 Ga0105238_10820039 3300009551 Bacteria 946
570 Ga0105238_12119577 3300009551 Unclassified 597
571 Ga0105238_12797190 3300009551 Unclassified 524
572 Ga0105238_13024992 3300009551 Unclassified 505
573 Ga0105249_10025015 3300009553 Bacteria 5372
574 Ga0105249_10039963 3300009553 Bacteria 4260
575 Ga0105249_10149807 3300009553 Bacteria 2245
576 Ga0105249_10168008 3300009553 Bacteria 2125
577 Ga0105249_11158952 3300009553 Bacteria 844
578 Ga0105249_12589822 3300009553 Bacteria 579
579 Ga0099796_10073709 3300010159 Bacteria 1238
580 Ga0099796_10255621 3300010159 Bacteria 729
581 Ga0105239_10028158 3300010375 Bacteria 6182
582 Ga0105239_10039915 3300010375 Bacteria 5142
583 Ga0105239_10101256 3300010375 Bacteria 3187
584 Ga0105239_10231297 3300010375 Bacteria 2074
585 Ga0105239_10256097 3300010375 Bacteria 1966
586 Ga0105239_10380145 3300010375 Bacteria 1596
587 Ga0105239_10603711 3300010375 Bacteria 1252
588 Ga0105239_10889992 3300010375 Unclassified 1022
589 Ga0105246_10015894 3300011119 Bacteria 4760
590 Ga0105246_10050958 3300011119 Bacteria 2841
591 Ga0105246_10055236 3300011119 Bacteria 2740
592 Ga0105246_10238306 3300011119 Bacteria 1437
593 Ga0157314_1056418 3300012500 Unclassified 516
594 Ga0157373_10002380 3300013100 Bacteria 14283
595 Ga0157373_10003194 3300013100 Bacteria 12392
596 Ga0157373_10041300 3300013100 Bacteria 3299
597 Ga0157373_10077482 3300013100 Bacteria 2345
598 Ga0157373_10144300 3300013100 Bacteria 1674
599 Ga0157373_10459769 3300013100 Unclassified 917
600 Ga0157373_11499334 3300013100 Bacteria 515
601 Ga0157371_10002907 3300013102 Bacteria 16015
602 Ga0157371_10022249 3300013102 Bacteria 4649
603 Ga0157371_10045463 3300013102 Bacteria 3124
604 Ga0157371_10160659 3300013102 Bacteria 1605
605 Ga0157371_10505176 3300013102 Unclassified 893
606 Ga0157370_10008943 3300013104 Bacteria 10760
607 Ga0157370_10016839 3300013104 Bacteria 7388
608 Ga0157370_10045791 3300013104 Bacteria 4197
609 Ga0157370_10046476 3300013104 Bacteria 4162
610 Ga0157370_10183386 3300013104 Bacteria 1944
611 Ga0157370_10243312 3300013104 Bacteria 1664
612 Ga0157370_10491969 3300013104 Bacteria 1127
613 Ga0157370_10602076 3300013104 Bacteria 1006
614 Ga0157370_11242881 3300013104 Unclassified 672
615 Ga0157369_10010175 3300013105 Bacteria 10734
616 Ga0157369_10018225 3300013105 Bacteria 7874
617 Ga0157369_10021280 3300013105 Bacteria 7253
618 Ga0157369_10060664 3300013105 Bacteria 4078
619 Ga0157369_10104452 3300013105 Bacteria 3017
620 Ga0157369_10118771 3300013105 Bacteria 2806
621 Ga0157369_10184412 3300013105 Bacteria 2195
622 Ga0157369_10212090 3300013105 Bacteria 2029
623 Ga0157369_10274083 3300013105 Bacteria 1758
624 Ga0157369_10327375 3300013105 Bacteria 1592
625 Ga0157369_11041982 3300013105 Bacteria 837
626 Ga0157369_11132291 3300013105 Bacteria 800
627 Ga0157369_11209324 3300013105 Bacteria 771
628 Ga0157369_11607726 3300013105 Unclassified 661
629 Ga0157369_11798127 3300013105 Bacteria 622
630 Ga0157374_10001377 3300013296 Bacteria 20643
631 Ga0157374_10001647 3300013296 Bacteria 18695
632 Ga0157374_10026911 3300013296 Bacteria 5180
633 Ga0157374_10069083 3300013296 Bacteria 3326
634 Ga0157374_10140347 3300013296 Bacteria 2345
635 Ga0157374_10178983 3300013296 Bacteria 2070
636 Ga0157374_10239311 3300013296 Bacteria 1785
637 Ga0157374_10525369 3300013296 Unclassified 1190
638 Ga0157374_11405916 3300013296 Bacteria 720
639 Ga0157378_10000733 3300013297 Bacteria 30679
640 Ga0157378_10005107 3300013297 Bacteria 11523
641 Ga0157378_10062863 3300013297 Bacteria 3316
642 Ga0157378_10078132 3300013297 Bacteria 2985
643 Ga0157378_10119801 3300013297 Unclassified 2424
644 Ga0157378_10125230 3300013297 Bacteria 2373
645 Ga0157378_10526648 3300013297 Bacteria 1184
646 Ga0157378_10671165 3300013297 Bacteria 1054
647 Ga0157378_11381374 3300013297 Bacteria 747
648 Ga0157378_12046943 3300013297 Bacteria 623
649 Ga0163162_10034415 3300013306 Bacteria 5042
650 Ga0163162_10339319 3300013306 Unclassified 1635
651 Ga0163162_10764455 3300013306 Bacteria 1085
652 Ga0163162_11266017 3300013306 Bacteria 838
653 Ga0157372_10000287 3300013307 Bacteria 56080
654 Ga0157372_10004400 3300013307 Bacteria 15026
655 Ga0157372_10009796 3300013307 Bacteria 10191
656 Ga0157372_10019261 3300013307 Bacteria 7349
657 Ga0157372_10026210 3300013307 Bacteria 6344
658 Ga0157372_10083897 3300013307 Bacteria 3609
659 Ga0157372_10167878 3300013307 Bacteria 2538
660 Ga0157372_10212888 3300013307 Bacteria 2240
661 Ga0157372_10292855 3300013307 Bacteria 1893
662 Ga0157372_10584194 3300013307 Bacteria 1302
663 Ga0157372_10782370 3300013307 Bacteria 1109
664 Ga0157372_10950816 3300013307 Bacteria 996
665 Ga0157372_11367990 3300013307 Unclassified 816
666 Ga0157375_10055998 3300013308 Bacteria 3890
667 Ga0157375_10333283 3300013308 Bacteria 1682
668 Ga0157375_12774179 3300013308 Bacteria 586
669 Ga0163163_10008073 3300014325 Bacteria 9326
670 Ga0163163_10099375 3300014325 Bacteria 2931
671 Ga0163163_10143975 3300014325 Bacteria 2427
672 Ga0163163_10276857 3300014325 Bacteria 1729
673 Ga0163163_10278786 3300014325 Bacteria 1723
674 Ga0163163_10333072 3300014325 Bacteria 1573
675 Ga0163163_11497311 3300014325 Unclassified 736
676 Ga0182008_10050339 3300014497 Bacteria 2067
677 Ga0157377_10001555 3300014745 Bacteria 9979
678 Ga0157379_10000323 3300014968 Bacteria 38184
679 Ga0157379_10001375 3300014968 Bacteria 19911
680 Ga0157379_10020278 3300014968 Bacteria 5877
681 Ga0157379_10075613 3300014968 Bacteria 3016
682 Ga0157379_10111753 3300014968 Bacteria 2454
683 Ga0157379_10741048 3300014968 Bacteria 924
684 Ga0157379_11130808 3300014968 Bacteria 751
685 Ga0157379_11957107 3300014968 Bacteria 578
686 Ga0157376_10019818 3300014969 Bacteria 5192
687 Ga0157376_10182461 3300014969 Bacteria 1920
688 Ga0157376_10959739 3300014969 Bacteria 876
689 Ga0157376_11264933 3300014969 Bacteria 767
690 Ga0157376_11494338 3300014969 Bacteria 708
691 Ga0157376_12695778 3300014969 Bacteria 537
692 Ga0182006_1020623 3300015261 Bacteria 2759
693 Ga0182007_10009845 3300015262 Bacteria 3815
694 Ga0182005_1067548 3300015265 Bacteria 980
695 Ga0182005_1126475 3300015265 Unclassified 731
696 Ga0197907_10098072 3300020069 Bacteria 649
697 Ga0197907_10740934 3300020069 Unclassified 543
698 Ga0197907_10815525 3300020069 Unclassified 807
699 Ga0197907_11155002 3300020069 Bacteria 787
700 Ga0206356_10401914 3300020070 Bacteria 849
701 Ga0206356_11007705 3300020070 Unclassified 701
702 Ga0206356_11052062 3300020070 Bacteria 2162
703 Ga0206356_11552040 3300020070 Unclassified 892
704 Ga0206349_1668343 3300020075 Unclassified 640
705 Ga0206355_1081738 3300020076 Unclassified 1285
706 Ga0206355_1429875 3300020076 Bacteria 2161
707 Ga0206351_10191672 3300020077 Unclassified 817
708 Ga0206351_10927832 3300020077 Bacteria 704
709 Ga0206352_10940195 3300020078 Bacteria 850
710 Ga0206352_11149266 3300020078 Bacteria 860
711 Ga0206350_10070795 3300020080 Bacteria 537
712 Ga0206350_10157797 3300020080 Unclassified 1507
713 Ga0206350_10458796 3300020080 Bacteria 704
714 Ga0206350_11419293 3300020080 Unclassified 744
715 Ga0206354_10336299 3300020081 Bacteria 1679
716 Ga0206354_10951279 3300020081 Bacteria 1514
717 Ga0206353_11427356 3300020082 Bacteria 1375
718 Ga0206353_11575536 3300020082 Bacteria 1541
719 Ga0154015_1524408 3300020610 Bacteria 1762
720 Ga0213872_10013951 3300021361 Bacteria 3757
721 Ga0213876_10667011 3300021384 Bacteria 553
722 Ga0213871_10313805 3300021441 Unclassified 508
723 Ga0224712_10096438 3300022467 Bacteria 1247
724 Ga0224712_10102869 3300022467 Unclassified 1214
725 Ga0224712_10364793 3300022467 Unclassified 684
726 Ga0224712_10580099 3300022467 Unclassified 546
727 Ga0207697_10289069 3300025315 Unclassified 727
728 Ga0207656_10267201 3300025321 Bacteria 841
729 Ga0207692_10043918 3300025898 Bacteria 2227
730 Ga0207692_10647388 3300025898 Unclassified 683
731 Ga0207642_10502341 3300025899 Unclassified 743
732 Ga0207642_11081006 3300025899 Bacteria 518
733 Ga0207710_10022104 3300025900 Bacteria 2729
734 Ga0207680_10071713 3300025903 Bacteria 2148
735 Ga0207680_11086145 3300025903 Bacteria 572
736 Ga0207647_10011120 3300025904 Bacteria 6323
737 Ga0207685_10051104 3300025905 Bacteria 1595
738 Ga0207699_10086730 3300025906 Bacteria 1956
739 Ga0207699_10230218 3300025906 Bacteria 1269
740 Ga0207699_10368901 3300025906 Bacteria 1017
741 Ga0207645_10312428 3300025907 Bacteria 1047
742 Ga0207643_10010452 3300025908 Bacteria 4999
743 Ga0207643_10862646 3300025908 Bacteria 587
744 Ga0207705_10031642 3300025909 Bacteria 3778
745 Ga0207705_10057261 3300025909 Bacteria 2811
746 Ga0207705_10289106 3300025909 Bacteria 1256
747 Ga0207705_10557667 3300025909 Bacteria 891
748 Ga0207684_10003813 3300025910 Bacteria 14538
749 Ga0207684_10208962 3300025910 Bacteria 1684
750 Ga0207684_10286064 3300025910 Unclassified 1422
751 Ga0207654_10623793 3300025911 Bacteria 771
752 Ga0207707_10001110 3300025912 Bacteria 25554
753 Ga0207707_10005825 3300025912 Bacteria 10768
754 Ga0207707_10106254 3300025912 Bacteria 2454
755 Ga0207707_10153740 3300025912 Bacteria 2012
756 Ga0207707_10324631 3300025912 Unclassified 1328
757 Ga0207707_10464548 3300025912 Bacteria 1082
758 Ga0207707_10816657 3300025912 Unclassified 776
759 Ga0207695_10018355 3300025913 Bacteria 8093
760 Ga0207695_10061347 3300025913 Bacteria 3886
761 Ga0207695_10101990 3300025913 Bacteria 2863
762 Ga0207695_10135331 3300025913 Bacteria 2418
763 Ga0207695_10147529 3300025913 Bacteria 2295
764 Ga0207695_10275618 3300025913 Bacteria 1577
765 Ga0207695_10506211 3300025913 Bacteria 1089
766 Ga0207695_10711638 3300025913 Unclassified 885
767 Ga0207695_11685343 3300025913 Bacteria 515
768 Ga0207671_11112623 3300025914 Unclassified 620
769 Ga0207671_11420451 3300025914 Unclassified 537
770 Ga0207693_10010671 3300025915 Bacteria 7457
771 Ga0207693_10067804 3300025915 Unclassified 2794
772 Ga0207693_10254859 3300025915 Unclassified 1377
773 Ga0207693_10468117 3300025915 Bacteria 984
774 Ga0207693_10539606 3300025915 Bacteria 910
775 Ga0207693_11148830 3300025915 Unclassified 588
776 Ga0207693_11303364 3300025915 Unclassified 543
777 Ga0207663_10000026 3300025916 Bacteria 109142
778 Ga0207663_10018814 3300025916 Bacteria 3880
779 Ga0207663_10042253 3300025916 Bacteria 2784
780 Ga0207663_10047717 3300025916 Bacteria 2646
781 Ga0207663_10192029 3300025916 Unclassified 1467
782 Ga0207663_10587281 3300025916 Bacteria 874
783 Ga0207663_10762125 3300025916 Bacteria 769
784 Ga0207663_11500308 3300025916 Bacteria 543
785 Ga0207660_10001738 3300025917 Bacteria 14598
786 Ga0207660_10125857 3300025917 Bacteria 1946
787 Ga0207660_10172558 3300025917 Bacteria 1675
788 Ga0207660_10557420 3300025917 Bacteria 932
789 Ga0207660_10616931 3300025917 Bacteria 884
790 Ga0207660_11324309 3300025917 Bacteria 585
791 Ga0207662_10367738 3300025918 Unclassified 969
792 Ga0207657_10000545 3300025919 Bacteria 40246
793 Ga0207657_10105535 3300025919 Bacteria 2332
794 Ga0207657_10219733 3300025919 Bacteria 1523
795 Ga0207657_10370903 3300025919 Bacteria 1128
796 Ga0207657_10543810 3300025919 Bacteria 908
797 Ga0207657_11047085 3300025919 Unclassified 625
798 Ga0207649_10112862 3300025920 Bacteria 1819
799 Ga0207649_10309756 3300025920 Bacteria 1157
800 Ga0207649_10315114 3300025920 Bacteria 1148
801 Ga0207652_10001268 3300025921 Bacteria 22477
802 Ga0207652_10011513 3300025921 Bacteria 7131
803 Ga0207652_10074351 3300025921 Bacteria 2959
804 Ga0207652_10101182 3300025921 Bacteria 2545
805 Ga0207652_10309847 3300025921 Bacteria 1425
806 Ga0207652_10410144 3300025921 Bacteria 1222
807 Ga0207652_10510945 3300025921 Bacteria 1081
808 Ga0207652_10555182 3300025921 Bacteria 1032
809 Ga0207652_11661199 3300025921 Bacteria 543
810 Ga0207646_10013472 3300025922 Bacteria 7818
811 Ga0207646_10245554 3300025922 Bacteria 1617
812 Ga0207646_10311501 3300025922 Bacteria 1422
813 Ga0207681_10010109 3300025923 Bacteria 5774
814 Ga0207694_10027358 3300025924 Bacteria 4343
815 Ga0207694_10034291 3300025924 Bacteria 3891
816 Ga0207694_10102366 3300025924 Bacteria 2271
817 Ga0207694_10173028 3300025924 Bacteria 1749
818 Ga0207694_10182772 3300025924 Bacteria 1701
819 Ga0207694_11862834 3300025924 Unclassified 505
820 Ga0207650_10007755 3300025925 Bacteria 7318
821 Ga0207650_10273319 3300025925 Bacteria 1374
822 Ga0207650_11453312 3300025925 Bacteria 583
823 Ga0207659_10582890 3300025926 Unclassified 953
824 Ga0207659_10620811 3300025926 Bacteria 922
825 Ga0207687_10457059 3300025927 Bacteria 1060
826 Ga0207700_10006948 3300025928 Bacteria 6885
827 Ga0207700_10038228 3300025928 Bacteria 3482
828 Ga0207700_10064900 3300025928 Bacteria 2783
829 Ga0207700_10208916 3300025928 Bacteria 1649
830 Ga0207700_10242099 3300025928 Bacteria 1538
831 Ga0207700_10399652 3300025928 Bacteria 1204
832 Ga0207700_11499294 3300025928 Unclassified 598
833 Ga0207664_10048243 3300025929 Bacteria 3348
834 Ga0207664_10147020 3300025929 Bacteria 1999
835 Ga0207664_10154715 3300025929 Bacteria 1951
836 Ga0207664_10230956 3300025929 Bacteria 1608
837 Ga0207664_10290571 3300025929 Bacteria 1436
838 Ga0207664_10377818 3300025929 Bacteria 1257
839 Ga0207664_10417338 3300025929 Bacteria 1195
840 Ga0207664_10507416 3300025929 Unclassified 1080
841 Ga0207664_10530397 3300025929 Bacteria 1055
842 Ga0207664_10554744 3300025929 Unclassified 1031
843 Ga0207644_11487869 3300025931 Bacteria 568
844 Ga0207690_10056564 3300025932 Bacteria 2647
845 Ga0207690_10508769 3300025932 Bacteria 975
846 Ga0207706_10174174 3300025933 Bacteria 1890
847 Ga0207706_10236421 3300025933 Unclassified 1597
848 Ga0207706_10330260 3300025933 Unclassified 1327
849 Ga0207686_10102370 3300025934 Bacteria 1915
850 Ga0207686_10107654 3300025934 Bacteria 1874
851 Ga0207686_10138016 3300025934 Bacteria 1681
852 Ga0207686_10455411 3300025934 Bacteria 985
853 Ga0207686_10723764 3300025934 Bacteria 793
854 Ga0207670_10098641 3300025936 Bacteria 2082
855 Ga0207670_10425609 3300025936 Bacteria 1066
856 Ga0207670_10650922 3300025936 Bacteria 869
857 Ga0207670_11138048 3300025936 Bacteria 660
858 Ga0207669_10179794 3300025937 Bacteria 1515
859 Ga0207704_10004100 3300025938 Bacteria 6638
860 Ga0207704_10004645 3300025938 Bacteria 6295
861 Ga0207704_10416017 3300025938 Bacteria 1065
862 Ga0207704_11050762 3300025938 Unclassified 690
863 Ga0207665_10252236 3300025939 Bacteria 1304
864 Ga0207665_10450556 3300025939 Bacteria 988
865 Ga0207665_11065747 3300025939 Unclassified 644
866 Ga0207711_10003977 3300025941 Bacteria 12713
867 Ga0207711_10021908 3300025941 Bacteria 5339
868 Ga0207711_10028562 3300025941 Bacteria 4695
869 Ga0207711_10186065 3300025941 Bacteria 1891
870 Ga0207689_10000845 3300025942 Bacteria 29447
871 Ga0207689_10199150 3300025942 Bacteria 1653
872 Ga0207689_10493926 3300025942 Bacteria 1025
873 Ga0207689_10601737 3300025942 Bacteria 925
874 Ga0207661_10026846 3300025944 Bacteria 4393
875 Ga0207661_10144685 3300025944 Bacteria 2049
876 Ga0207661_10359906 3300025944 Bacteria 1314
877 Ga0207661_11258991 3300025944 Bacteria 680
878 Ga0207661_11497760 3300025944 Unclassified 618
879 Ga0207661_11503685 3300025944 Unclassified 617
880 Ga0207679_10006295 3300025945 Bacteria 7492
881 Ga0207679_10029218 3300025945 Bacteria 3836
882 Ga0207679_10166980 3300025945 Bacteria 1808
883 Ga0207679_10612648 3300025945 Bacteria 982
884 Ga0207679_10668441 3300025945 Bacteria 941
885 Ga0207679_11051564 3300025945 Bacteria 747
886 Ga0207679_11326560 3300025945 Unclassified 660
887 Ga0207667_10000163 3300025949 Bacteria 98321
888 Ga0207667_10000827 3300025949 Bacteria 39994
889 Ga0207667_10006364 3300025949 Bacteria 14314
890 Ga0207667_10018660 3300025949 Bacteria 7772
891 Ga0207667_10033680 3300025949 Bacteria 5506
892 Ga0207667_10356801 3300025949 Bacteria 1491
893 Ga0207667_10366831 3300025949 Bacteria 1468
894 Ga0207667_10474362 3300025949 Bacteria 1270
895 Ga0207667_10686535 3300025949 Unclassified 1027
896 Ga0207667_10750598 3300025949 Bacteria 975
897 Ga0207667_10946711 3300025949 Bacteria 851
898 Ga0207667_11430794 3300025949 Bacteria 664
899 Ga0207667_11903306 3300025949 Unclassified 557
900 Ga0207651_10015414 3300025960 Unclassified 4441
901 Ga0207651_11135050 3300025960 Bacteria 701
902 Ga0207668_10039783 3300025972 Bacteria 3168
903 Ga0207640_10282438 3300025981 Bacteria 1305
904 Ga0207640_10358399 3300025981 Bacteria 1174
905 Ga0207640_10740021 3300025981 Bacteria 847
906 Ga0207658_10148531 3300025986 Bacteria 1906
907 Ga0207658_10534512 3300025986 Bacteria 1048
908 Ga0207677_10338871 3300026023 Bacteria 1256
909 Ga0207677_11893277 3300026023 Bacteria 554
910 Ga0207703_10003111 3300026035 Bacteria 14014
911 Ga0207703_10011078 3300026035 Bacteria 7025
912 Ga0207703_10013425 3300026035 Bacteria 6380
913 Ga0207703_10683730 3300026035 Bacteria 975
914 Ga0207703_12187563 3300026035 Bacteria 529
915 Ga0207639_10369803 3300026041 Unclassified 1285
916 Ga0207639_10371511 3300026041 Bacteria 1282
917 Ga0207639_10788223 3300026041 Unclassified 885
918 Ga0207678_10006945 3300026067 Bacteria 10048
919 Ga0207678_10896576 3300026067 Unclassified 784
920 Ga0207702_10000612 3300026078 Bacteria 39396
921 Ga0207702_10002903 3300026078 Bacteria 16043
922 Ga0207702_10004408 3300026078 Bacteria 12538
923 Ga0207702_10113079 3300026078 Bacteria 2417
924 Ga0207702_10234084 3300026078 Bacteria 1718
925 Ga0207702_12096128 3300026078 Bacteria 555
926 Ga0207641_10018946 3300026088 Bacteria 5645
927 Ga0207641_10392967 3300026088 Unclassified 1330
928 Ga0207641_11879955 3300026088 Bacteria 600
929 Ga0207648_10009935 3300026089 Bacteria 9067
930 Ga0207648_10025289 3300026089 Bacteria 5290
931 Ga0207676_10004570 3300026095 Bacteria 9803
932 Ga0207676_10011892 3300026095 Bacteria 6227
933 Ga0207676_10026867 3300026095 Bacteria 4282
934 Ga0207676_11181031 3300026095 Bacteria 758
935 Ga0207674_10000599 3300026116 Bacteria 47369
936 Ga0207674_10001299 3300026116 Bacteria 32627
937 Ga0207674_10014078 3300026116 Bacteria 8836
938 Ga0207674_10135017 3300026116 Bacteria 2429
939 Ga0207675_100001110 3300026118 Bacteria 26637
940 Ga0207675_100188294 3300026118 Bacteria 1978
941 Ga0207675_100882794 3300026118 Bacteria 910
942 Ga0207683_10389759 3300026121 Bacteria 1281
943 Ga0207683_11342412 3300026121 Bacteria 662
944 Ga0207698_10137098 3300026142 Bacteria 2101
945 Ga0207698_10488790 3300026142 Bacteria 1195
946 Ga0207698_10630157 3300026142 Bacteria 1060
947 Ga0207698_10896398 3300026142 Bacteria 894
948 Ga0265357_1028107 3300028023 Bacteria 636
949 Ga0268266_10024459 3300028379 Bacteria 5135
950 Ga0268265_10025195 3300028380 Unclassified 4219
951 Ga0268265_10366251 3300028380 Bacteria 1321
952 Ga0268264_10000872 3300028381 Bacteria 31948
953 Ga0268264_10375857 3300028381 Bacteria 1359
954 Ga0265319_1117839 3300028563 Bacteria 828
955 Ga0265762_1015812 3300030760 Bacteria 1367
956 Ga0265767_118987 3300030836 Bacteria 512
957 Ga0265773_1005643 3300031018 Bacteria 917
958 Ga0265760_10038412 3300031090 Bacteria 1423
959 Ga0265330_10241210 3300031235 Bacteria 762
960 Ga0265332_10245446 3300031238 Bacteria 741
961 Ga0265320_10564358 3300031240 Bacteria 503
962 Ga0265329_10023016 3300031242 Bacteria 2079
963 Ga0265340_10035244 3300031247 Bacteria 2486
964 Ga0265331_10066094 3300031250 Bacteria 1699
965 Ga0265316_10008727 3300031344 Bacteria 9378
966 Ga0265316_10024535 3300031344 Bacteria 5048
967 Ga0265316_10329073 3300031344 Bacteria 1109
968 Ga0265316_10494313 3300031344 Bacteria 874
969 Ga0265316_11013928 3300031344 Bacteria 577
970 Ga0307408_100221861 3300031548 Bacteria 1543
971 Ga0265314_10105678 3300031711 Bacteria 1800
972 Ga0265314_10121462 3300031711 Bacteria 1644
973 Ga0265314_10476405 3300031711 Bacteria 661
974 Ga0265342_10285740 3300031712 Bacteria 872
975 Ga0307409_101049463 3300031995 Unclassified 835
976 Ga0307415_100824076 3300032126 Bacteria 849
977 Ga0307415_100994197 3300032126 Bacteria 779
978 Ga0316583_10222812 3300032133 Unclassified 654
979 Ga0316212_1005758 3300033547 Bacteria 1797
980 Ga0373926_0020319 3300035083 Bacteria 2294
981 Ga0373929_0159156 3300035085 Bacteria 611
982 Ga0373934_0082392 3300035086 Bacteria 1293
983 Ga0373936_0438465 3300035113 Bacteria 603
984 Ga0373953_0067996 3300035117 Unclassified 1466
985 Ga0373953_0170848 3300035117 Bacteria 936
986 Ga0373954_0095587 3300035118 Bacteria 1430
987 Ga0373954_0235239 3300035118 Bacteria 902
988 Ga0373956_0236865 3300035119 Bacteria 867
989 Ga0373943_0036145 3300035170 Bacteria 2365
990 Ga0373943_0045362 3300035170 Bacteria 2142
991 Ga0373955_0094599 3300035172 Bacteria 1708
992 Ga0373955_0845396 3300035172 Unclassified 563
993 Ga0373931_0486445 3300035691 Bacteria 794
994 Ga0373935_0016406 3300035692 Bacteria 4481
995 Ga0373935_0179068 3300035692 Bacteria 1455
996 Ga0373927_0006677 3300035695 Bacteria 7852
997 Ga0373927_0041162 3300035695 Bacteria 2997
998 Ga0373927_0404182 3300035695 Bacteria 901
999 Ga0373927_0729493 3300035695 Bacteria 655
1000 Ga0373933_0112529 3300035724 Bacteria 1699
1001 Ga0373933_0688328 3300035724 Unclassified 672
1002 Ga0373947_0058297 3300035725 Bacteria 2340
1003 Ga0373947_0470957 3300035725 Unclassified 852
1004 Ga0373937_0104317 3300036401 Unclassified 2634
1005 Ga0373937_0140386 3300036401 Bacteria 2260
1006 Ga0373937_0251807 3300036401 Bacteria 1665
1007 Ga0373937_0267129 3300036401 Bacteria 1614
1008 Ga0373937_0501704 3300036401 Unclassified 1153
1009 Ga0373937_0635291 3300036401 Bacteria 1013
1010 Ga0373925_0351968 3300037068 Bacteria 1196
1011 Ga0395899_0206275 3300037312 Bacteria 1368
1012 Ga0395899_0652675 3300037312 Bacteria 665
1013 Ga0395900_0060652 3300037418 Bacteria 3892
1014 Ga0395900_0291088 3300037418 Bacteria 1622
1015 Ga0395898_0082684 3300037466 Bacteria 3095
1016 Ga0436364_0181287 3300037853 Bacteria 641
1017 Ga0436364_0654329 3300037853 Bacteria 10688
1018 Ga0436364_1338884 3300037853 Unclassified 982
1019 Ga0395901_0160056 3300038443 Bacteria 2365
1020 Ga0395901_0271118 3300038443 Bacteria 1765
1021 Ga0395901_0392554 3300038443 Bacteria 1427
1022 Ga0436365_0316424 3300039437 Unclassified 4062
1023 Ga0436365_1658177 3300039437 Bacteria 1154
1024 Ga0436360_0344554 3300039438 Unclassified 750
1025 Ga0436360_0762903 3300039438 Bacteria 506
1026 Ga0436361_0461868 3300039447 Bacteria 17644
1027 Ga0436363_1042151 3300039450 Unclassified 1039
1028 Ga0436362_0444124 3300039453 Bacteria 799
1029 Ga0451787_005017 3300041441 Bacteria 974
1030 Ga0451839_0591775 3300041496 Unclassified 528
1031 Ga0451843_1744014 3300041509 Bacteria 591
1032 Ga0450894_039415 3300042131 Bacteria 676
1033 Ga0451577_0603934 3300042876 Bacteria 996
1034 Ga0466969_0065024 3300044656 Bacteria 1764
1035 Ga0466969_0160387 3300044656 Bacteria 1033
1036 Ga0453683_0074846 3300044673 Bacteria 2120
1037 Ga0466966_0000513 3300044684 Bacteria 24684
1038 Ga0466966_0193617 3300044684 Bacteria 1231
1039 Ga0466966_0265662 3300044684 Bacteria 1033
1040 Ga0466961_0316846 3300044693 Unclassified 951
1041 Ga0466963_0000041 3300044694 Bacteria 41829
1042 Ga0466963_0567510 3300044694 Bacteria 801
1043 Ga0466971_0310626 3300044719 Unclassified 758
1044 Ga0466968_0449880 3300044735 Bacteria 637
1045 Ga0466970_0337929 3300044765 Bacteria 853
1046 Ga0466957_0235335 3300044842 Bacteria 1214
1047 Ga0466957_1310403 3300044842 Bacteria 526
1048 Ga0466959_0020950 3300045049 Bacteria 4819
1049 Ga0466959_0158154 3300045049 Bacteria 1594
1050 Ga0466959_0688553 3300045049 Bacteria 685
1051 Ga0466959_1145905 3300045049 Unclassified 517
1052 Ga0451576_1838328 3300045051 Bacteria 626
1053 Ga0466958_0021289 3300045836 Unclassified 3787
1054 Ga0466958_0555158 3300045836 Bacteria 746
1055 Ga0466958_0850781 3300045836 Bacteria 595
1056 Ga0466967_0000566 3300045976 Bacteria 18166
1057 Ga0466967_0004442 3300045976 Bacteria 9458
1058 Ga0466967_0019630 3300045976 Bacteria 5441
1059 Ga0466967_0194001 3300045976 Unclassified 1921
1060 Ga0495592_0254430 3300046454 Bacteria 1159
1061 Ga0495592_0306740 3300046454 Bacteria 1030
1062 Ga0495651_0001752 3300046462 Bacteria 16745
1063 Ga0495651_0422165 3300046462 Bacteria 867
1064 Ga0495580_0004971 3300046472 Bacteria 11106
1065 Ga0495580_0006128 3300046472 Bacteria 9836
1066 Ga0495582_0172079 3300046473 Bacteria 1233
1067 Ga0495662_0211314 3300046476 Bacteria 956
1068 Ga0495662_0528541 3300046476 Bacteria 578
1069 Ga0495664_0733219 3300046477 Bacteria 583
1070 Ga0495594_0031366 3300046499 Bacteria 2880
1071 Ga0495594_0049706 3300046499 Bacteria 2305
1072 Ga0495628_0217375 3300046516 Bacteria 1436
1073 Ga0495630_0196560 3300046517 Bacteria 1539
1074 Ga0495630_0342578 3300046517 Bacteria 1144
1075 Ga0495666_0058454 3300046526 Bacteria 1845
1076 Ga0495652_0064163 3300046529 Bacteria 3090
1077 Ga0495652_0237388 3300046529 Bacteria 1359
1078 Ga0495665_0010453 3300046531 Bacteria 5022
1079 Ga0495665_0123090 3300046531 Bacteria 1358
1080 Ga0495640_0180550 3300046533 Bacteria 1345
1081 Ga0495640_0201602 3300046533 Bacteria 1261
1082 Ga0495586_0209238 3300046535 Bacteria 1107
1083 Ga0495587_0137991 3300046536 Bacteria 1393
1084 Ga0495587_0220222 3300046536 Bacteria 1070
1085 Ga0495645_0153148 3300046543 Bacteria 1600
1086 Ga0495667_0029553 3300046559 Unclassified 3689
1087 Ga0495634_0479232 3300046642 Bacteria 731
1088 Ga0495635_0131966 3300046663 Bacteria 1703
1089 Ga0495635_0163015 3300046663 Bacteria 1517
1090 Ga0495657_0537599 3300046675 Bacteria 679
1091 Ga0495599_0088341 3300046678 Bacteria 1935
1092 Ga0495599_0152181 3300046678 Bacteria 1432
1093 Ga0495599_0222345 3300046678 Bacteria 1155
1094 Ga0495623_0028412 3300046679 Unclassified 3598
1095 Ga0495646_0327537 3300046680 Bacteria 806
1096 Ga0495658_0601236 3300046683 Bacteria 705
1097 Ga0495613_0081924 3300046689 Unclassified 2344
1098 Ga0495613_0393711 3300046689 Bacteria 946
1099 Ga0495624_0147243 3300046690 Bacteria 1441
1100 Ga0495670_0695266 3300046691 Unclassified 555
1101 Ga0495600_0177708 3300046809 Bacteria 1372
1102 Ga0495600_0520434 3300046809 Bacteria 729
1103 Ga0495581_0199797 3300047315 Bacteria 1170
1104 Ga0495581_0448366 3300047315 Bacteria 751
1105 Ga0495604_0079173 3300047317 Unclassified 2465
1106 Ga0495636_0514344 3300047318 Bacteria 580
1107 Ga0495674_0022255 3300047319 Bacteria 5845
1108 Ga0495674_0087370 3300047319 Bacteria 2668
1109 Ga0495674_0097651 3300047319 Bacteria 2502
1110 Ga0495674_0226016 3300047319 Bacteria 1546
1111 Ga0495674_1215705 3300047319 Unclassified 569
1112 Ga0495674_1235901 3300047319 Bacteria 563
1113 Ga0495675_0011403 3300047444 Bacteria 5578
1114 Ga0495675_0210443 3300047444 Bacteria 1181
1115 Ga0495684_0006742 3300047471 Bacteria 8915
1116 Ga0495684_0020161 3300047471 Bacteria 5135
1117 Ga0495684_0576974 3300047471 Bacteria 762
1118 Ga0495593_0491600 3300047673 Bacteria 615
1119 Ga0495602_0015970 3300048088 Bacteria 7559
1120 Ga0495602_0382435 3300048088 Unclassified 1008
1121 Ga0495602_0813310 3300048088 Bacteria 627
1122 Ga0495614_0314817 3300048089 Bacteria 725
1123 Ga0496101_0722926 3300048904 Bacteria 786
1124 Ga0496102_0107781 3300048905 Bacteria 2594
1125 Ga0496103_0020250 3300048906 Bacteria 3996
1126 Ga0496103_0275569 3300048906 Unclassified 1082
1127 Ga0496108_0000127 3300048911 Bacteria 75144
1128 Ga0496108_0034478 3300048911 Bacteria 4206
1129 Ga0496109_0018774 3300048912 Bacteria 6082
1130 Ga0496110_0118328 3300048913 Bacteria 2386
1131 Ga0496110_0334144 3300048913 Bacteria 1380
1132 Ga0496110_1825365 3300048913 Unclassified 518
1133 Ga0496112_0136162 3300048915 Bacteria 2426
1134 Ga0496112_0163457 3300048915 Bacteria 2192
1135 Ga0496112_0230136 3300048915 Bacteria 1808
1136 Ga0496113_0416049 3300048916 Bacteria 1080
1137 Ga0496115_0995080 3300048918 Unclassified 641
1138 Ga0496125_0438267 3300048928 Bacteria 752
1139 Ga0496126_0020359 3300048929 Bacteria 6509
1140 Ga0496126_0279324 3300048929 Bacteria 1384
1141 Ga0501031_0811210 3300049568 Bacteria 600
1142 Ga0501037_0000739 3300049573 Bacteria 24789
1143 Ga0501046_0009333 3300049580 Bacteria 8486
1144 Ga0501047_0386756 3300049581 Bacteria 1233
1145 Ga0501067_0008685 3300049583 Bacteria 5629
1146 Ga0501067_0281690 3300049583 Unclassified 926
1147 Ga0501072_1099388 3300049588 Bacteria 619
1148 Ga0501073_0099581 3300049589 Unclassified 2018
1149 Ga0501076_0154614 3300049592 Bacteria 1867
1150 Ga0501076_0315349 3300049592 Bacteria 1283
1151 Ga0501077_0101339 3300049593 Bacteria 1825
1152 Ga0501077_0108270 3300049593 Bacteria 1761
1153 Ga0501257_262518 3300049686 Bacteria 515
1154 Ga0501080_0348589 3300049742 Bacteria 1337
1155 Ga0501083_0002624 3300049744 Bacteria 12390
1156 Ga0501035_0297130 3300049822 Bacteria 1361
1157 Ga0501035_0466648 3300049822 Bacteria 1043
1158 Ga0501045_0297940 3300049824 Bacteria 1200
1159 nmdc:mga05p37_111824_c1 3300050507 Bacteria 3359
1160 nmdc:mga09592_1328130_c1 3300050508 Bacteria 590
1161 nmdc:mga0qj67_187857_c1 3300050509 Bacteria 1679
1162 nmdc:mga06r32_121954_c1 3300050510 Bacteria 2572
1163 nmdc:mga06r32_1801598_c1 3300050510 Bacteria 548
1164 nmdc:mga06r32_18146_c1 3300050510 Bacteria 6437
1165 nmdc:mga08y16_366151_c1 3300050511 Bacteria 1479
1166 nmdc:mga0n895_1312370_c1 3300050512 Bacteria 694
1167 nmdc:mga0n895_251439_c1 3300050512 Bacteria 1794
1168 nmdc:mga0n895_347934_c1 3300050512 Bacteria 1501
1169 nmdc:mga0n895_352971_c1 3300050512 Bacteria 1489
1170 nmdc:mga0n895_544146_c1 3300050512 Bacteria 1167
1171 nmdc:mga0rr50_22911_c1 3300050513 Bacteria 4296
1172 nmdc:mga0rr50_44903_c1 3300050513 Bacteria 3244
1173 nmdc:mga08x19_3423_c1 3300050514 Bacteria 9464
1174 nmdc:mga08x19_42_c1 3300050514 Bacteria 150509
1175 nmdc:mga08x19_60212_c1 3300050514 Bacteria 2459
1176 nmdc:mga08x19_960767_c1 3300050514 Bacteria 607
1177 nmdc:mga0a205_10341_c1 3300050515 Bacteria 8577
1178 nmdc:mga0a205_11635_c1 3300050515 Bacteria 4917
1179 nmdc:mga0a205_675153_c1 3300050515 Bacteria 884
1180 Ga0495601_0008427 3300053077 Bacteria 6091
1181 Ga0495612_0043467 3300053078 Bacteria 1836
1182 Ga0495612_0370807 3300053078 Bacteria 648
1183 Ga0500635_0021759 3300053080 Bacteria 1980
1184 Ga0500646_0197267 3300053090 Bacteria 689
1185 Ga0500555_181302 3300053103 Bacteria 509
1186 Ga0500595_000320 3300053119 Bacteria 31611
1187 Ga0500559_0179236 3300053136 Bacteria 998
1188 Ga0500568_0029491 3300053139 Bacteria 2276
1189 Ga0500590_288028 3300053148 Bacteria 626
1190 Ga0500622_0000002 3300053156 Bacteria 646442
1191 Ga0500645_062767 3300053730 Bacteria 1073
1192 Ga0501084_0032813 3300054114 Bacteria 4345
1193 Ga0587066_011929 3300059490 Unclassified 1286
1194 Ga0587066_024070 3300059490 Unclassified 1033
1195 Ga0587066_048807 3300059490 Bacteria 825
1196 Ga0587066_094882 3300059490 Bacteria 669
1197 Ga0587070_169095 3300059491 Bacteria 561
1198 Ga0587073_0094789 3300059492 Unclassified 765
1199 Ga0587073_0099364 3300059492 Bacteria 754
1200 Ga0587077_003208 3300059493 Unclassified 2033
1201 Ga0587077_011641 3300059493 Unclassified 1389
1202 Ga0587077_051295 3300059493 Bacteria 864
1203 Ga0587080_181933 3300059503 Bacteria 504
1204 Ga0587082_058540 3300059504 Bacteria 754
1205 Ga0587082_115067 3300059504 Bacteria 602
1206 Ga0587083_0091879 3300059505 Bacteria 742
1207 Ga0587083_0118195 3300059505 Unclassified 682
1208 Ga0587085_008364 3300059506 Bacteria 1318
1209 Ga0587086_099029 3300059507 Unclassified 535
1210 Ga0587088_068321 3300059508 Bacteria 735
1211 Ga0587088_086396 3300059508 Bacteria 680
1212 Ga0587089_020292 3300059509 Bacteria 914
1213 Ga0587090_053991 3300059510 Bacteria 744
1214 Ga0587091_006440 3300059511 Bacteria 1650
1215 Ga0587091_044360 3300059511 Bacteria 890
1216 Ga0587091_114043 3300059511 Bacteria 649
1217 Ga0587094_070437 3300059513 Unclassified 629
1218 Ga0587094_112394 3300059513 Unclassified 537
1219 Ga0587095_018029 3300059514 Bacteria 659
1220 Ga0587106_020695 3300059605 Bacteria 973
1221 Ga0587099_003167 3300059622 Bacteria 1351
1222 Ga0587099_054697 3300059622 Bacteria 540
1223 Ga0587113_001431 3300059625 Bacteria 1574
1224 Ga0587113_023198 3300059625 Bacteria 666
1225 Ga0587128_027920 3300059630 Bacteria 915
1226 Ga0587130_037882 3300059631 Bacteria 574
1227 Ga0587067_102046 3300059640 Bacteria 665
1228 Ga0587068_137148 3300059641 Bacteria 543
1229 Ga0587069_079038 3300059642 Unclassified 639
1230 Ga0587069_090912 3300059642 Bacteria 610
1231 Ga0587075_035754 3300059644 Bacteria 812
1232 Ga0587075_104809 3300059644 Bacteria 569
1233 Ga0587076_057266 3300059645 Unclassified 777
1234 Ga0587076_068030 3300059645 Bacteria 733
1235 Ga0587078_003416 3300059646 Bacteria 1607
1236 Ga0587078_033149 3300059646 Bacteria 704
1237 Ga0587078_069629 3300059646 Unclassified 547
1238 Ga0587079_041102 3300059647 Bacteria 934
1239 Ga0587079_081440 3300059647 Bacteria 741
1240 Ga0587102_057556 3300059649 Bacteria 536
1241 Ga0587107_040311 3300059652 Unclassified 752
1242 Ga0587107_083373 3300059652 Bacteria 605
1243 Ga0587107_153922 3300059652 Unclassified 501
1244 Ga0587110_020899 3300059654 Bacteria 740
1245 Ga0587114_009695 3300059655 Bacteria 1160
1246 Ga0587060_019037 3300060243 Bacteria 644
1247 Ga0587060_027715 3300060243 Unclassified 566
1248 Ga0587060_028602 3300060243 Unclassified 560
1249 Ga0587071_030033 3300060344 Bacteria 1042
1250 Ga0587071_042949 3300060344 Bacteria 912
1251 Ga0587071_138982 3300060344 Unclassified 595
1252 Ga0587111_0020562 3300060346 Unclassified 1264
1253 Ga0587111_0071641 3300060346 Bacteria 810
1254 Ga0501082_0042240 3300060353 Bacteria 3931
1255 Ga0070681_11220825
1256 JGI24747J21853_1012948
1257 JGI24743J22301_10006256
1258 JGI24745J21846_1039197
1259 JGI24033J26618_1047475
1260 JGI24034J26672_10006364
1261 rootH1_10074194
1262 rootH1_10118688
1263 Ga0058863_10169016
1264 Ga0058863_11328245
1265 Ga0058863_11972463
1266 Ga0058861_10035870
1267 Ga0058862_12838737
1268 Ga0065165_1001397
1269 Ga0065712_10127583
1270 Ga0065712_10533850
1271 Ga0065715_10447627
1272 Ga0065707_10161803
1273 Ga0065707_10612311
1274 Ga0070658_10067908
1275 Ga0070658_10169186
1276 Ga0070658_10208422
1277 Ga0070658_10348612
1278 Ga0070676_10028309
1279 Ga0070683_100038660
1280 Ga0070683_100043720
1281 Ga0070683_100052914
1282 Ga0070683_100068057
1283 Ga0070683_100307367
1284 Ga0070690_100055358
1285 Ga0070690_101283815
1286 Ga0070670_100003945
1287 Ga0070670_100038379
1288 Ga0070677_10008635
1289 Ga0070677_10666361
1290 Ga0068869_100001726
1291 Ga0068869_100043396
1292 Ga0068869_101269207
1293 Ga0068869_101385045
1294 Ga0070666_10018142
1295 Ga0070666_10054209
1296 Ga0070666_10076867
1297 Ga0070666_10113694
1298 Ga0070666_10947841
1299 Ga0070680_100075561
1300 Ga0070680_100107381
1301 Ga0070680_100152520
1302 Ga0070680_100153174
1303 Ga0070680_100286226
1304 Ga0070680_100560506
1305 Ga0070680_100612333
1306 Ga0070680_100994740
1307 Ga0070680_101115834
1308 Ga0070680_101321102
1309 Ga0070682_100008051
1310 Ga0070682_100126134
1311 Ga0070682_100158085
1312 Ga0070682_100289385
1313 Ga0070682_100774831
1314 Ga0068868_100002997
1315 Ga0068868_100020426
1316 Ga0068868_100290804
1317 Ga0068868_101152182
1318 Ga0070660_100014330
1319 Ga0070660_100084372
1320 Ga0070660_100087160
1321 Ga0070660_100100200
1322 Ga0070660_100165686
1323 Ga0070660_100178381
1324 Ga0070660_100618630
1325 Ga0070660_100836793
1326 Ga0070660_101126500
1327 Ga0070689_100067085
1328 Ga0070689_100110645
1329 Ga0070689_100327815
1330 Ga0070689_100399077
1331 Ga0070689_100842324
1332 Ga0070691_10522192
1333 Ga0070687_100001840
1334 Ga0070687_100140135
1335 Ga0070687_100464332
1336 Ga0070661_100073479
1337 Ga0070661_100168682
1338 Ga0070661_100190755
1339 Ga0070661_100957281
1340 Ga0070661_101680762
1341 Ga0070692_10172236
1342 Ga0070692_10291007
1343 Ga0070668_100003692
1344 Ga0070668_100081837
1345 Ga0070669_100003850
1346 Ga0070669_100005119
1347 Ga0070669_100015754
1348 Ga0070675_100009409
1349 Ga0070675_100271021
1350 Ga0070675_100314509
1351 Ga0070675_100333965
1352 Ga0070675_100632150
1353 Ga0070675_101087962
1354 Ga0070675_101983338
1355 Ga0070671_100171947
1356 Ga0070671_100227365
1357 Ga0070671_100365827
1358 Ga0070674_100189458
1359 Ga0070674_100211449
1360 Ga0070674_100421931
1361 Ga0070674_100517064
1362 Ga0070674_100733963
1363 Ga0070673_100029628
1364 Ga0070673_100588816
1365 Ga0070673_101218483
1366 Ga0070688_100091372
1367 Ga0070688_100317300
1368 Ga0070688_100820135
1369 Ga0070688_101812804
1370 Ga0070659_100002666
1371 Ga0070659_100005672
1372 Ga0070659_100020948
1373 Ga0070659_100146655
1374 Ga0070659_100344500
1375 Ga0070659_100590702
1376 Ga0070667_100012858
1377 Ga0070667_100039392
1378 Ga0070667_100138543
1379 Ga0070667_100299692
1380 Ga0070667_100335736
1381 Ga0070709_10013822
1382 Ga0070709_10022458
1383 Ga0070709_10028444
1384 Ga0070709_10101067
1385 Ga0070709_10157872
1386 Ga0070709_10173118
1387 Ga0070709_10198254
1388 Ga0070709_10218868
1389 Ga0070709_10827624
1390 Ga0070714_100008559
1391 Ga0070714_100079767
1392 Ga0070714_100169170
1393 Ga0070714_100173109
1394 Ga0070714_100200496
1395 Ga0070714_100273817
1396 Ga0070714_100571329
1397 Ga0070714_100832148
1398 Ga0070714_101467519
1399 Ga0070714_101860292
1400 Ga0070713_100031891
1401 Ga0070713_100054101
1402 Ga0070713_100253781
1403 Ga0070713_100596834
1404 Ga0070713_101262329
1405 Ga0070713_101485823
1406 Ga0070713_101651276
1407 Ga0070710_10032552
1408 Ga0070710_10049421
1409 Ga0070710_10297599
1410 Ga0070710_10650914
1411 Ga0070711_100002998
1412 Ga0070711_100003181
1413 Ga0070711_100009164
1414 Ga0070711_100245733
1415 Ga0070711_100600650
1416 Ga0070711_101149337
1417 Ga0070711_101741672
1418 Ga0070700_100220340
1419 Ga0070700_100353091
1420 Ga0070694_100036045
1421 Ga0070708_100101920
1422 Ga0070708_100112405
1423 Ga0070708_100173433
1424 Ga0070708_100430714
1425 Ga0070708_100704655
1426 Ga0070663_100018203
1427 Ga0070663_100020969
1428 Ga0070663_100140869
1429 Ga0070663_100222803
1430 Ga0070663_100870956
1431 Ga0070663_100942412
1432 Ga0070678_100506091
1433 Ga0070678_100978581
1434 Ga0070678_101463464
1435 Ga0070662_100002683
1436 Ga0070662_100019519
1437 Ga0070662_100319859
1438 Ga0070662_100348908
1439 Ga0070681_10000034
1440 Ga0070681_10000866
1441 Ga0070681_10004801
1442 Ga0070681_10015551
1443 Ga0070681_10053214
1444 Ga0070681_10066651
1445 Ga0070681_10110791
1446 Ga0070681_10124433
1447 Ga0070681_10257813
1448 Ga0070681_10331415
1449 Ga0070681_10480312
1450 Ga0070681_10587272
1451 Ga0070681_10849360
1452 Ga0070681_11092996
1453 Ga0068867_100002188
1454 Ga0068867_100003854
1455 Ga0068867_100013806
1456 Ga0068867_100038423
1457 Ga0068867_100046167
1458 Ga0068867_100312526
1459 Ga0068867_100929926
1460 Ga0068867_101267561
1461 Ga0068867_101273963
1462 Ga0070685_10020596
1463 Ga0070685_10203978
1464 Ga0070685_10516900
1465 Ga0070706_100004512
1466 Ga0070706_100031340
1467 Ga0070706_100233730
1468 Ga0070706_101018619
1469 Ga0070706_102027529
1470 Ga0070707_100019321
1471 Ga0070707_100062647
1472 Ga0070707_100070745
1473 Ga0070707_100386866
1474 Ga0070707_100644972
1475 Ga0070707_100702543
1476 Ga0070707_101267169
1477 Ga0070698_100003066
1478 Ga0070698_100048069
1479 Ga0070698_100082784
1480 Ga0070698_100251452
1481 Ga0070698_100422048
1482 Ga0070699_100010361
1483 Ga0070699_100095096
1484 Ga0070699_100273406
1485 Ga0070699_100562450
1486 Ga0070699_100781710
1487 Ga0070699_101204775
1488 Ga0070699_102115654
1489 Ga0070679_100004353
1490 Ga0070679_100131869
1491 Ga0070679_100278304
1492 Ga0070679_100311181
1493 Ga0070679_100509907
1494 Ga0070679_100565309
1495 Ga0070679_100687620
1496 Ga0070679_100749370
1497 Ga0070679_101154407
1498 Ga0070679_101238367
1499 Ga0070684_100009298
1500 Ga0070684_100032072
1501 Ga0070684_100032814
1502 Ga0070684_100090844
1503 Ga0070684_100102391
1504 Ga0070684_100139502
1505 Ga0070684_100141434
1506 Ga0070684_100149776
1507 Ga0070684_100366017
1508 Ga0070684_100426222
1509 Ga0070684_100637644
1510 Ga0070684_101002781
1511 Ga0070684_102140132
1512 Ga0070697_100038980
1513 Ga0070697_100083399
1514 Ga0070697_100159347
1515 Ga0070697_100254727
1516 Ga0070697_100929069
1517 Ga0070697_101541598
1518 Ga0068853_100006343
1519 Ga0068853_100023709
1520 Ga0068853_100023953
1521 Ga0068853_100054558
1522 Ga0068853_100136453
1523 Ga0068853_100208592
1524 Ga0068853_100474674
1525 Ga0068853_100560559
1526 Ga0068853_100788036
1527 Ga0070672_100131384
1528 Ga0070672_101200556
1529 Ga0070672_101270673
1530 Ga0070686_100001440
1531 Ga0070686_100007852
1532 Ga0070686_100049173
1533 Ga0070695_100032054
1534 Ga0070695_100208066
1535 Ga0070695_100972452
1536 Ga0070693_100010082
1537 Ga0070693_100036873
1538 Ga0070693_100198595
1539 Ga0070665_100008136
1540 Ga0070665_100066861
1541 Ga0070704_100142682
1542 Ga0070704_100214449
1543 Ga0068855_100001570
1544 Ga0068855_100002685
1545 Ga0068855_100004336
1546 Ga0068855_100008443
1547 Ga0068855_100008940
1548 Ga0068855_100064834
1549 Ga0068855_100184044
1550 Ga0068855_100304257
1551 Ga0068855_100308434
1552 Ga0068855_100452362
1553 Ga0068855_100456708
1554 Ga0068855_100488219
1555 Ga0068855_100514410
1556 Ga0068855_100553639
1557 Ga0068855_100922035
1558 Ga0068855_100929057
1559 Ga0068855_101753069
1560 Ga0068855_102033078
1561 Ga0070664_100003262
1562 Ga0070664_100012731
1563 Ga0070664_100081223
1564 Ga0070664_100166698
1565 Ga0070664_100199625
1566 Ga0070664_100212178
1567 Ga0070664_100215277
1568 Ga0070664_100994725
1569 Ga0070664_101188301
1570 Ga0070664_102389646
1571 Ga0068857_100001766
1572 Ga0068857_100008687
1573 Ga0068857_100136799
1574 Ga0068857_100193153
1575 Ga0068857_100262556
1576 Ga0068857_100634991
1577 Ga0068854_100010285
1578 Ga0068854_100014154
1579 Ga0068854_100014415
1580 Ga0068854_100267898
1581 Ga0068854_100409927
1582 Ga0068854_100433188
1583 Ga0068854_100492617
1584 Ga0068854_100579220
1585 Ga0068854_101500153
1586 Ga0068856_100000494
1587 Ga0068856_100000571
1588 Ga0068856_100012826
1589 Ga0068856_100020988
1590 Ga0068856_100025816
1591 Ga0068856_100067395
1592 Ga0068856_100244501
1593 Ga0068856_100503913
1594 Ga0068856_100757148
1595 Ga0068856_100956440
1596 Ga0070702_100010550
1597 Ga0070702_100151567
1598 Ga0070702_100585260
1599 Ga0068852_100019955
1600 Ga0068852_100027091
1601 Ga0068852_100054256
1602 Ga0068852_100069129
1603 Ga0068852_100079200
1604 Ga0068852_100098365
1605 Ga0068852_100251898
1606 Ga0068852_100375349
1607 Ga0068852_100801204
1608 Ga0068852_100899419
1609 Ga0068852_100917667
1610 Ga0068852_102272074
1611 Ga0068852_102805074
1612 Ga0068859_100000492
1613 Ga0068859_100074505
1614 Ga0068864_100000824
1615 Ga0068864_100013098
1616 Ga0068864_100065215
1617 Ga0068864_100167207
1618 Ga0068864_100195582
1619 Ga0068864_100230741
1620 Ga0068864_101128535
1621 Ga0068864_101387445
1622 Ga0068864_101890436
1623 Ga0068866_10012445
1624 Ga0068866_10019171
1625 Ga0068866_10124922
1626 Ga0068866_10279063
1627 Ga0068866_10315632
1628 Ga0068866_10407211
1629 Ga0068866_10649388
1630 Ga0068861_100011158
1631 Ga0068861_100063942
1632 Ga0068851_10005651
1633 Ga0068851_10014132
1634 Ga0068851_10045214
1635 Ga0068851_10064097
1636 Ga0068851_10076787
1637 Ga0068870_10013857
1638 Ga0068870_10047272
1639 Ga0068863_100002384
1640 Ga0068863_100088618
1641 Ga0068863_100131057
1642 Ga0068863_100340322
1643 Ga0068863_101859382
1644 Ga0068858_100001288
1645 Ga0068858_100001544
1646 Ga0068858_100021746
1647 Ga0068858_100041995
1648 Ga0068858_100254555
1649 Ga0068858_101029876
1650 Ga0068858_101848427
1651 Ga0068858_102118706
1652 Ga0068860_100005288
1653 Ga0068860_100048364
1654 Ga0068860_100079065
1655 Ga0068860_100389342
1656 Ga0068862_100009136
1657 Ga0068862_100028003
1658 Ga0068862_100234747
1659 Ga0070717_10022337
1660 Ga0070717_10024241
1661 Ga0070717_10067404
1662 Ga0070717_10067722
1663 Ga0070717_10071819
1664 Ga0070717_10082774
1665 Ga0070717_10118244
1666 Ga0070717_10132130
1667 Ga0070717_10180915
1668 Ga0070717_10233836
1669 Ga0070717_10339978
1670 Ga0070717_10484587
1671 Ga0070717_10538846
1672 Ga0070717_10551574
1673 Ga0070717_10725068
1674 Ga0070717_10762431
1675 Ga0070717_10974339
1676 Ga0070717_11902935
1677 Ga0070715_10072093
1678 Ga0070715_10287454
1679 Ga0070715_10472278
1680 Ga0070716_100015742
1681 Ga0070716_100018398
1682 Ga0070716_100074910
1683 Ga0070716_100126690
1684 Ga0070716_100161478
1685 Ga0070716_100336149
1686 Ga0070716_100599832
1687 Ga0070716_100762141
1688 Ga0070716_101284460
1689 Ga0070712_100006231
1690 Ga0070712_100082778
1691 Ga0070712_100150532
1692 Ga0070712_100530535
1693 Ga0070712_100558024
1694 Ga0070712_100579700
1695 Ga0070712_101044626
1696 Ga0070712_101485410
1697 Ga0070712_101727666
1698 Ga0070712_101860946
1699 Ga0070712_101931714
1700 Ga0075367_11088914
1701 Ga0075369_10588796
1702 Ga0075366_10596748
1703 Ga0097621_100000229
1704 Ga0097621_100000693
1705 Ga0097621_100137848
1706 Ga0097621_100141888
1707 Ga0097621_100148402
1708 Ga0097621_100200184
1709 Ga0097621_100386003
1710 Ga0075370_10553726
1711 Ga0075370_10863884
1712 Ga0068871_100000071
1713 Ga0068871_100000385
1714 Ga0068871_100058479
1715 Ga0068871_100078544
1716 Ga0068871_100489008
1717 Ga0068871_100680070
1718 Ga0068871_100796269
1719 Ga0068871_100969087
1720 Ga0075428_100091508
1721 Ga0075431_100112124
1722 Ga0075431_100149163
1723 Ga0075431_101463496
1724 Ga0075433_10074837
1725 Ga0075433_10083094
1726 Ga0075433_10250864
1727 Ga0075433_10603100
1728 Ga0075433_10893613
1729 Ga0075434_100092177
1730 Ga0075434_100235761
1731 Ga0075434_100339306
1732 Ga0075434_100501817
1733 Ga0075434_100651057
1734 Ga0075434_101123744
1735 Ga0075429_101554111
1736 Ga0068865_100007241
1737 Ga0068865_100008484
1738 Ga0068865_100055079
1739 Ga0068865_100341961
1740 Ga0068865_101606070
1741 Ga0075436_100000697
1742 Ga0075436_100003624
1743 Ga0075436_100147844
1744 Ga0075436_100763269
1745 Ga0075436_100832783
1746 Ga0075436_101050582
1747 Ga0075436_101327608
1748 Ga0097620_100000492
1749 Ga0097620_100074504
1750 Ga0075435_100040851
1751 Ga0075435_100057986
1752 Ga0075435_100659858
1753 Ga0075435_100711358
1754 Ga0075435_100879516
1755 Ga0099794_10045534
1756 Ga0099794_10057241
1757 Ga0099795_10002569
1758 Ga0099795_10083995
1759 Ga0099795_10332724
1760 Ga0099795_10441934
1761 Ga0105240_10049521
1762 Ga0105240_10099336
1763 Ga0105240_10167885
1764 Ga0105240_10171524
1765 Ga0105240_10190823
1766 Ga0105240_10216638
1767 Ga0105240_10293649
1768 Ga0105240_10331838
1769 Ga0105240_10721310
1770 Ga0105240_10941884
1771 Ga0105240_12560500
1772 Ga0111539_10461367
1773 Ga0111539_10840582
1774 Ga0105245_10045147
1775 Ga0105245_10090667
1776 Ga0105245_11629084
1777 Ga0105245_13039597
1778 Ga0105247_10009761
1779 Ga0105247_10033696
1780 Ga0105247_10534996
1781 Ga0105247_11488170
1782 Ga0114129_10017580
1783 Ga0114129_10613916
1784 Ga0114129_10676335
1785 Ga0105243_10024167
1786 Ga0105243_10262795
1787 Ga0105243_10555437
1788 Ga0105243_10752150
1789 Ga0105241_10012600
1790 Ga0105241_10035957
1791 Ga0105241_10060437
1792 Ga0105241_10089093
1793 Ga0105241_10176533
1794 Ga0105241_12696890
1795 Ga0105242_10003389
1796 Ga0105242_10083140
1797 Ga0105242_10161211
1798 Ga0105242_10190421
1799 Ga0105242_11216657
1800 Ga0105242_12984224
1801 Ga0105248_10006560
1802 Ga0105248_10014540
1803 Ga0105248_10027109
1804 Ga0105248_10042946
1805 Ga0105248_10158876
1806 Ga0105248_10260273
1807 Ga0105248_11941565
1808 Ga0105248_12632921
1809 Ga0105248_13136286
1810 Ga0105237_10000998
1811 Ga0105237_10076207
1812 Ga0105237_10120418
1813 Ga0105237_10146511
1814 Ga0105237_10163256
1815 Ga0105237_10373749
1816 Ga0105237_10475712
1817 Ga0105237_10537681
1818 Ga0105237_10761076
1819 Ga0105237_11360921
1820 Ga0105237_12458177
1821 Ga0105238_10028767
1822 Ga0105238_10131860
1823 Ga0105238_10820039
1824 Ga0105238_12119577
1825 Ga0105238_12797190
1826 Ga0105238_13024992
1827 Ga0105249_10025015
1828 Ga0105249_10039963
1829 Ga0105249_10149807
1830 Ga0105249_10168008
1831 Ga0105249_11158952
1832 Ga0105249_12589822
1833 Ga0099796_10073709
1834 Ga0099796_10255621
1835 Ga0105239_10028158
1836 Ga0105239_10039915
1837 Ga0105239_10101256
1838 Ga0105239_10231297
1839 Ga0105239_10256097
1840 Ga0105239_10380145
1841 Ga0105239_10603711
1842 Ga0105239_10889992
1843 Ga0105246_10015894
1844 Ga0105246_10050958
1845 Ga0105246_10055236
1846 Ga0105246_10238306
1847 Ga0157314_1056418
1848 Ga0157373_10002380
1849 Ga0157373_10003194
1850 Ga0157373_10041300
1851 Ga0157373_10077482
1852 Ga0157373_10144300
1853 Ga0157373_10459769
1854 Ga0157373_11499334
1855 Ga0157371_10002907
1856 Ga0157371_10022249
1857 Ga0157371_10045463
1858 Ga0157371_10160659
1859 Ga0157371_10505176
1860 Ga0157370_10008943
1861 Ga0157370_10016839
1862 Ga0157370_10045791
1863 Ga0157370_10046476
1864 Ga0157370_10183386
1865 Ga0157370_10243312
1866 Ga0157370_10491969
1867 Ga0157370_10602076
1868 Ga0157370_11242881
1869 Ga0157369_10010175
1870 Ga0157369_10018225
1871 Ga0157369_10021280
1872 Ga0157369_10060664
1873 Ga0157369_10104452
1874 Ga0157369_10118771
1875 Ga0157369_10184412
1876 Ga0157369_10212090
1877 Ga0157369_10274083
1878 Ga0157369_10327375
1879 Ga0157369_11041982
1880 Ga0157369_11132291
1881 Ga0157369_11209324
1882 Ga0157369_11607726
1883 Ga0157369_11798127
1884 Ga0157374_10001377
1885 Ga0157374_10001647
1886 Ga0157374_10026911
1887 Ga0157374_10069083
1888 Ga0157374_10140347
1889 Ga0157374_10178983
1890 Ga0157374_10239311
1891 Ga0157374_10525369
1892 Ga0157374_11405916
1893 Ga0157378_10000733
1894 Ga0157378_10005107
1895 Ga0157378_10062863
1896 Ga0157378_10078132
1897 Ga0157378_10119801
1898 Ga0157378_10125230
1899 Ga0157378_10526648
1900 Ga0157378_10671165
1901 Ga0157378_11381374
1902 Ga0157378_12046943
1903 Ga0163162_10034415
1904 Ga0163162_10339319
1905 Ga0163162_10764455
1906 Ga0163162_11266017
1907 Ga0157372_10000287
1908 Ga0157372_10004400
1909 Ga0157372_10009796
1910 Ga0157372_10019261
1911 Ga0157372_10026210
1912 Ga0157372_10083897
1913 Ga0157372_10167878
1914 Ga0157372_10212888
1915 Ga0157372_10292855
1916 Ga0157372_10584194
1917 Ga0157372_10782370
1918 Ga0157372_10950816
1919 Ga0157372_11367990
1920 Ga0157375_10055998
1921 Ga0157375_10333283
1922 Ga0157375_12774179
1923 Ga0163163_10008073
1924 Ga0163163_10099375
1925 Ga0163163_10143975
1926 Ga0163163_10276857
1927 Ga0163163_10278786
1928 Ga0163163_10333072
1929 Ga0163163_11497311
1930 Ga0182008_10050339
1931 Ga0157377_10001555
1932 Ga0157379_10000323
1933 Ga0157379_10001375
1934 Ga0157379_10020278
1935 Ga0157379_10075613
1936 Ga0157379_10111753
1937 Ga0157379_10741048
1938 Ga0157379_11130808
1939 Ga0157379_11957107
1940 Ga0157376_10019818
1941 Ga0157376_10182461
1942 Ga0157376_10959739
1943 Ga0157376_11264933
1944 Ga0157376_11494338
1945 Ga0157376_12695778
1946 Ga0182006_1020623
1947 Ga0182007_10009845
1948 Ga0182005_1067548
1949 Ga0182005_1126475
1950 Ga0197907_10098072
1951 Ga0197907_10740934
1952 Ga0197907_10815525
1953 Ga0197907_11155002
1954 Ga0206356_10401914
1955 Ga0206356_11007705
1956 Ga0206356_11052062
1957 Ga0206356_11552040
1958 Ga0206349_1668343
1959 Ga0206355_1081738
1960 Ga0206355_1429875
1961 Ga0206351_10191672
1962 Ga0206351_10927832
1963 Ga0206352_10940195
1964 Ga0206352_11149266
1965 Ga0206350_10070795
1966 Ga0206350_10157797
1967 Ga0206350_10458796
1968 Ga0206350_11419293
1969 Ga0206354_10336299
1970 Ga0206354_10951279
1971 Ga0206353_11427356
1972 Ga0206353_11575536
1973 Ga0154015_1524408
1974 Ga0213872_10013951
1975 Ga0213876_10667011
1976 Ga0213871_10313805
1977 Ga0224712_10096438
1978 Ga0224712_10102869
1979 Ga0224712_10364793
1980 Ga0224712_10580099
1981 Ga0207697_10289069
1982 Ga0207656_10267201
1983 Ga0207692_10043918
1984 Ga0207692_10647388
1985 Ga0207642_10502341
1986 Ga0207642_11081006
1987 Ga0207710_10022104
1988 Ga0207680_10071713
1989 Ga0207680_11086145
1990 Ga0207647_10011120
1991 Ga0207685_10051104
1992 Ga0207699_10086730
1993 Ga0207699_10230218
1994 Ga0207699_10368901
1995 Ga0207645_10312428
1996 Ga0207643_10010452
1997 Ga0207643_10862646
1998 Ga0207705_10031642
1999 Ga0207705_10057261
2000 Ga0207705_10289106
2001 Ga0207705_10557667
2002 Ga0207684_10003813
2003 Ga0207684_10208962
2004 Ga0207684_10286064
2005 Ga0207654_10623793
2006 Ga0207707_10001110
2007 Ga0207707_10005825
2008 Ga0207707_10106254
2009 Ga0207707_10153740
2010 Ga0207707_10324631
2011 Ga0207707_10464548
2012 Ga0207707_10816657
2013 Ga0207695_10018355
2014 Ga0207695_10061347
2015 Ga0207695_10101990
2016 Ga0207695_10135331
2017 Ga0207695_10147529
2018 Ga0207695_10275618
2019 Ga0207695_10506211
2020 Ga0207695_10711638
2021 Ga0207695_11685343
2022 Ga0207671_11112623
2023 Ga0207671_11420451
2024 Ga0207693_10010671
2025 Ga0207693_10067804
2026 Ga0207693_10254859
2027 Ga0207693_10468117
2028 Ga0207693_10539606
2029 Ga0207693_11148830
2030 Ga0207693_11303364
2031 Ga0207663_10000026
2032 Ga0207663_10018814
2033 Ga0207663_10042253
2034 Ga0207663_10047717
2035 Ga0207663_10192029
2036 Ga0207663_10587281
2037 Ga0207663_10762125
2038 Ga0207663_11500308
2039 Ga0207660_10001738
2040 Ga0207660_10125857
2041 Ga0207660_10172558
2042 Ga0207660_10557420
2043 Ga0207660_10616931
2044 Ga0207660_11324309
2045 Ga0207662_10367738
2046 Ga0207657_10000545
2047 Ga0207657_10105535
2048 Ga0207657_10219733
2049 Ga0207657_10370903
2050 Ga0207657_10543810
2051 Ga0207657_11047085
2052 Ga0207649_10112862
2053 Ga0207649_10309756
2054 Ga0207649_10315114
2055 Ga0207652_10001268
2056 Ga0207652_10011513
2057 Ga0207652_10074351
2058 Ga0207652_10101182
2059 Ga0207652_10309847
2060 Ga0207652_10410144
2061 Ga0207652_10510945
2062 Ga0207652_10555182
2063 Ga0207652_11661199
2064 Ga0207646_10013472
2065 Ga0207646_10245554
2066 Ga0207646_10311501
2067 Ga0207681_10010109
2068 Ga0207694_10027358
2069 Ga0207694_10034291
2070 Ga0207694_10102366
2071 Ga0207694_10173028
2072 Ga0207694_10182772
2073 Ga0207694_11862834
2074 Ga0207650_10007755
2075 Ga0207650_10273319
2076 Ga0207650_11453312
2077 Ga0207659_10582890
2078 Ga0207659_10620811
2079 Ga0207687_10457059
2080 Ga0207700_10006948
2081 Ga0207700_10038228
2082 Ga0207700_10064900
2083 Ga0207700_10208916
2084 Ga0207700_10242099
2085 Ga0207700_10399652
2086 Ga0207700_11499294
2087 Ga0207664_10048243
2088 Ga0207664_10147020
2089 Ga0207664_10154715
2090 Ga0207664_10230956
2091 Ga0207664_10290571
2092 Ga0207664_10377818
2093 Ga0207664_10417338
2094 Ga0207664_10507416
2095 Ga0207664_10530397
2096 Ga0207664_10554744
2097 Ga0207644_11487869
2098 Ga0207690_10056564
2099 Ga0207690_10508769
2100 Ga0207706_10174174
2101 Ga0207706_10236421
2102 Ga0207706_10330260
2103 Ga0207686_10102370
2104 Ga0207686_10107654
2105 Ga0207686_10138016
2106 Ga0207686_10455411
2107 Ga0207686_10723764
2108 Ga0207670_10098641
2109 Ga0207670_10425609
2110 Ga0207670_10650922
2111 Ga0207670_11138048
2112 Ga0207669_10179794
2113 Ga0207704_10004100
2114 Ga0207704_10004645
2115 Ga0207704_10416017
2116 Ga0207704_11050762
2117 Ga0207665_10252236
2118 Ga0207665_10450556
2119 Ga0207665_11065747
2120 Ga0207711_10003977
2121 Ga0207711_10021908
2122 Ga0207711_10028562
2123 Ga0207711_10186065
2124 Ga0207689_10000845
2125 Ga0207689_10199150
2126 Ga0207689_10493926
2127 Ga0207689_10601737
2128 Ga0207661_10026846
2129 Ga0207661_10144685
2130 Ga0207661_10359906
2131 Ga0207661_11258991
2132 Ga0207661_11497760
2133 Ga0207661_11503685
2134 Ga0207679_10006295
2135 Ga0207679_10029218
2136 Ga0207679_10166980
2137 Ga0207679_10612648
2138 Ga0207679_10668441
2139 Ga0207679_11051564
2140 Ga0207679_11326560
2141 Ga0207667_10000163
2142 Ga0207667_10000827
2143 Ga0207667_10006364
2144 Ga0207667_10018660
2145 Ga0207667_10033680
2146 Ga0207667_10356801
2147 Ga0207667_10366831
2148 Ga0207667_10474362
2149 Ga0207667_10686535
2150 Ga0207667_10750598
2151 Ga0207667_10946711
2152 Ga0207667_11430794
2153 Ga0207667_11903306
2154 Ga0207651_10015414
2155 Ga0207651_11135050
2156 Ga0207668_10039783
2157 Ga0207640_10282438
2158 Ga0207640_10358399
2159 Ga0207640_10740021
2160 Ga0207658_10148531
2161 Ga0207658_10534512
2162 Ga0207677_10338871
2163 Ga0207677_11893277
2164 Ga0207703_10003111
2165 Ga0207703_10011078
2166 Ga0207703_10013425
2167 Ga0207703_10683730
2168 Ga0207703_12187563
2169 Ga0207639_10369803
2170 Ga0207639_10371511
2171 Ga0207639_10788223
2172 Ga0207678_10006945
2173 Ga0207678_10896576
2174 Ga0207702_10000612
2175 Ga0207702_10002903
2176 Ga0207702_10004408
2177 Ga0207702_10113079
2178 Ga0207702_10234084
2179 Ga0207702_12096128
2180 Ga0207641_10018946
2181 Ga0207641_10392967
2182 Ga0207641_11879955
2183 Ga0207648_10009935
2184 Ga0207648_10025289
2185 Ga0207676_10004570
2186 Ga0207676_10011892
2187 Ga0207676_10026867
2188 Ga0207676_11181031
2189 Ga0207674_10000599
2190 Ga0207674_10001299
2191 Ga0207674_10014078
2192 Ga0207674_10135017
2193 Ga0207675_100001110
2194 Ga0207675_100188294
2195 Ga0207675_100882794
2196 Ga0207683_10389759
2197 Ga0207683_11342412
2198 Ga0207698_10137098
2199 Ga0207698_10488790
2200 Ga0207698_10630157
2201 Ga0207698_10896398
2202 Ga0265357_1028107
2203 Ga0268266_10024459
2204 Ga0268265_10025195
2205 Ga0268265_10366251
2206 Ga0268264_10000872
2207 Ga0268264_10375857
2208 Ga0265319_1117839
2209 Ga0265762_1015812
2210 Ga0265767_118987
2211 Ga0265773_1005643
2212 Ga0265760_10038412
2213 Ga0265330_10241210
2214 Ga0265332_10245446
2215 Ga0265320_10564358
2216 Ga0265329_10023016
2217 Ga0265340_10035244
2218 Ga0265331_10066094
2219 Ga0265316_10008727
2220 Ga0265316_10024535
2221 Ga0265316_10329073
2222 Ga0265316_10494313
2223 Ga0265316_11013928
2224 Ga0307408_100221861
2225 Ga0265314_10105678
2226 Ga0265314_10121462
2227 Ga0265314_10476405
2228 Ga0265342_10285740
2229 Ga0307409_101049463
2230 Ga0307415_100824076
2231 Ga0307415_100994197
2232 Ga0316583_10222812
2233 Ga0316212_1005758
2234 Ga0373926_0020319
2235 Ga0373929_0159156
2236 Ga0373934_0082392
2237 Ga0373936_0438465
2238 Ga0373953_0067996
2239 Ga0373953_0170848
2240 Ga0373954_0095587
2241 Ga0373954_0235239
2242 Ga0373956_0236865
2243 Ga0373943_0036145
2244 Ga0373943_0045362
2245 Ga0373955_0094599
2246 Ga0373955_0845396
2247 Ga0373931_0486445
2248 Ga0373935_0016406
2249 Ga0373935_0179068
2250 Ga0373927_0006677
2251 Ga0373927_0041162
2252 Ga0373927_0404182
2253 Ga0373927_0729493
2254 Ga0373933_0112529
2255 Ga0373933_0688328
2256 Ga0373947_0058297
2257 Ga0373947_0470957
2258 Ga0373937_0104317
2259 Ga0373937_0140386
2260 Ga0373937_0251807
2261 Ga0373937_0267129
2262 Ga0373937_0501704
2263 Ga0373937_0635291
2264 Ga0373925_0351968
2265 Ga0395899_0206275
2266 Ga0395899_0652675
2267 Ga0395900_0060652
2268 Ga0395900_0291088
2269 Ga0395898_0082684
2270 Ga0436364_0181287
2271 Ga0436364_0654329
2272 Ga0436364_1338884
2273 Ga0395901_0160056
2274 Ga0395901_0271118
2275 Ga0395901_0392554
2276 Ga0436365_0316424
2277 Ga0436365_1658177
2278 Ga0436360_0344554
2279 Ga0436360_0762903
2280 Ga0436361_0461868
2281 Ga0436363_1042151
2282 Ga0436362_0444124
2283 Ga0451787_005017
2284 Ga0451839_0591775
2285 Ga0451843_1744014
2286 Ga0450894_039415
2287 Ga0451577_0603934
2288 Ga0466969_0065024
2289 Ga0466969_0160387
2290 Ga0453683_0074846
2291 Ga0466966_0000513
2292 Ga0466966_0193617
2293 Ga0466966_0265662
2294 Ga0466961_0316846
2295 Ga0466963_0000041
2296 Ga0466963_0567510
2297 Ga0466971_0310626
2298 Ga0466968_0449880
2299 Ga0466970_0337929
2300 Ga0466957_0235335
2301 Ga0466957_1310403
2302 Ga0466959_0020950
2303 Ga0466959_0158154
2304 Ga0466959_0688553
2305 Ga0466959_1145905
2306 Ga0451576_1838328
2307 Ga0466958_0021289
2308 Ga0466958_0555158
2309 Ga0466958_0850781
2310 Ga0466967_0000566
2311 Ga0466967_0004442
2312 Ga0466967_0019630
2313 Ga0466967_0194001
2314 Ga0495592_0254430
2315 Ga0495592_0306740
2316 Ga0495651_0001752
2317 Ga0495651_0422165
2318 Ga0495580_0004971
2319 Ga0495580_0006128
2320 Ga0495582_0172079
2321 Ga0495662_0211314
2322 Ga0495662_0528541
2323 Ga0495664_0733219
2324 Ga0495594_0031366
2325 Ga0495594_0049706
2326 Ga0495628_0217375
2327 Ga0495630_0196560
2328 Ga0495630_0342578
2329 Ga0495666_0058454
2330 Ga0495652_0064163
2331 Ga0495652_0237388
2332 Ga0495665_0010453
2333 Ga0495665_0123090
2334 Ga0495640_0180550
2335 Ga0495640_0201602
2336 Ga0495586_0209238
2337 Ga0495587_0137991
2338 Ga0495587_0220222
2339 Ga0495645_0153148
2340 Ga0495667_0029553
2341 Ga0495634_0479232
2342 Ga0495635_0131966
2343 Ga0495635_0163015
2344 Ga0495657_0537599
2345 Ga0495599_0088341
2346 Ga0495599_0152181
2347 Ga0495599_0222345
2348 Ga0495623_0028412
2349 Ga0495646_0327537
2350 Ga0495658_0601236
2351 Ga0495613_0081924
2352 Ga0495613_0393711
2353 Ga0495624_0147243
2354 Ga0495670_0695266
2355 Ga0495600_0177708
2356 Ga0495600_0520434
2357 Ga0495581_0199797
2358 Ga0495581_0448366
2359 Ga0495604_0079173
2360 Ga0495636_0514344
2361 Ga0495674_0022255
2362 Ga0495674_0087370
2363 Ga0495674_0097651
2364 Ga0495674_0226016
2365 Ga0495674_1215705
2366 Ga0495674_1235901
2367 Ga0495675_0011403
2368 Ga0495675_0210443
2369 Ga0495684_0006742
2370 Ga0495684_0020161
2371 Ga0495684_0576974
2372 Ga0495593_0491600
2373 Ga0495602_0015970
2374 Ga0495602_0382435
2375 Ga0495602_0813310
2376 Ga0495614_0314817
2377 Ga0496101_0722926
2378 Ga0496102_0107781
2379 Ga0496103_0020250
2380 Ga0496103_0275569
2381 Ga0496108_0000127
2382 Ga0496108_0034478
2383 Ga0496109_0018774
2384 Ga0496110_0118328
2385 Ga0496110_0334144
2386 Ga0496110_1825365
2387 Ga0496112_0136162
2388 Ga0496112_0163457
2389 Ga0496112_0230136
2390 Ga0496113_0416049
2391 Ga0496115_0995080
2392 Ga0496125_0438267
2393 Ga0496126_0020359
2394 Ga0496126_0279324
2395 Ga0501031_0811210
2396 Ga0501037_0000739
2397 Ga0501046_0009333
2398 Ga0501047_0386756
2399 Ga0501067_0008685
2400 Ga0501067_0281690
2401 Ga0501072_1099388
2402 Ga0501073_0099581
2403 Ga0501076_0154614
2404 Ga0501076_0315349
2405 Ga0501077_0101339
2406 Ga0501077_0108270
2407 Ga0501257_262518
2408 Ga0501080_0348589
2409 Ga0501083_0002624
2410 Ga0501035_0297130
2411 Ga0501035_0466648
2412 Ga0501045_0297940
2413 nmdc:mga05p37_111824_c1
2414 nmdc:mga09592_1328130_c1
2415 nmdc:mga0qj67_187857_c1
2416 nmdc:mga06r32_121954_c1
2417 nmdc:mga06r32_1801598_c1
2418 nmdc:mga06r32_18146_c1
2419 nmdc:mga08y16_366151_c1
2420 nmdc:mga0n895_1312370_c1
2421 nmdc:mga0n895_251439_c1
2422 nmdc:mga0n895_347934_c1
2423 nmdc:mga0n895_352971_c1
2424 nmdc:mga0n895_544146_c1
2425 nmdc:mga0rr50_22911_c1
2426 nmdc:mga0rr50_44903_c1
2427 nmdc:mga08x19_3423_c1
2428 nmdc:mga08x19_42_c1
2429 nmdc:mga08x19_60212_c1
2430 nmdc:mga08x19_960767_c1
2431 nmdc:mga0a205_10341_c1
2432 nmdc:mga0a205_11635_c1
2433 nmdc:mga0a205_675153_c1
2434 Ga0495601_0008427
2435 Ga0495612_0043467
2436 Ga0495612_0370807
2437 Ga0500635_0021759
2438 Ga0500646_0197267
2439 Ga0500555_181302
2440 Ga0500595_000320
2441 Ga0500559_0179236
2442 Ga0500568_0029491
2443 Ga0500590_288028
2444 Ga0500622_0000002
2445 Ga0500645_062767
2446 Ga0501084_0032813
2447 Ga0587066_011929
2448 Ga0587066_024070
2449 Ga0587066_048807
2450 Ga0587066_094882
2451 Ga0587070_169095
2452 Ga0587073_0094789
2453 Ga0587073_0099364
2454 Ga0587077_003208
2455 Ga0587077_011641
2456 Ga0587077_051295
2457 Ga0587080_181933
2458 Ga0587082_058540
2459 Ga0587082_115067
2460 Ga0587083_0091879
2461 Ga0587083_0118195
2462 Ga0587085_008364
2463 Ga0587086_099029
2464 Ga0587088_068321
2465 Ga0587088_086396
2466 Ga0587089_020292
2467 Ga0587090_053991
2468 Ga0587091_006440
2469 Ga0587091_044360
2470 Ga0587091_114043
2471 Ga0587094_070437
2472 Ga0587094_112394
2473 Ga0587095_018029
2474 Ga0587106_020695
2475 Ga0587099_003167
2476 Ga0587099_054697
2477 Ga0587113_001431
2478 Ga0587113_023198
2479 Ga0587128_027920
2480 Ga0587130_037882
2481 Ga0587067_102046
2482 Ga0587068_137148
2483 Ga0587069_079038
2484 Ga0587069_090912
2485 Ga0587075_035754
2486 Ga0587075_104809
2487 Ga0587076_057266
2488 Ga0587076_068030
2489 Ga0587078_003416
2490 Ga0587078_033149
2491 Ga0587078_069629
2492 Ga0587079_041102
2493 Ga0587079_081440
2494 Ga0587102_057556
2495 Ga0587107_040311
2496 Ga0587107_083373
2497 Ga0587107_153922
2498 Ga0587110_020899
2499 Ga0587114_009695
2500 Ga0587060_019037
2501 Ga0587060_027715
2502 Ga0587060_028602
2503 Ga0587071_030033
2504 Ga0587071_042949
2505 Ga0587071_138982
2506 Ga0587111_0020562
2507 Ga0587111_0071641
2508 Ga0501082_0042240

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

21

79

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9206 1 86
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9106 1 86
4fjc-assembly1.cif.gz_E structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module 0.8329 19 86
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.8318 4 86
3phd-assembly1.cif.gz_D crystal structure of human hdac6 in complex with ubiquitin 0.8286 4 86
ID Description Score Start End Superfamily
af_I1ME85_192_270_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9476 33 46 3.30.40.10
af_Q10N73_174_281_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9209 33 46 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9206 1 86 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9106 1 86 3.30.40.10
af_A4IA95_233_330_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9048 20 86 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A656TSE6-F1-model_v4 deleted 1.005 21 86
AF-A0A538H4T4-F1-model_v4 UBP-type zinc finger domain-containing protein 1.004 37 85 GO:0008270
AF-A0A0F6W6X5-F1-model_v4 Putative Glutathione-regulated potassium-efflux system protein KefB 1.003 20 85 GO:0008270
AF-A0A359E811-F1-model_v4 UBP-type domain-containing protein 1.002 21 86 GO:0008270
AF-A0A1Q4ZYX5-F1-model_v4 deleted 1.002 16 84

Map