F492214

General Info

Members Datasets Scaffolds Average Seq Length
1253 405 1251 254

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100036398|Ga0070683_1000363982
Length 278
Sequence VVPSEEQIVTRKGVALLEINDLHANIGEKEILKGITLSVKAGEVHAVMGPNGSGKSTLAQVLAGHPSYEVTKGTVAYDGENLLEMDAEVRAQNGIFLAFQYPVEIPGVSNAYFLRSAYNEIRKSKGMEEVDPLEFLDLMEEKLKLVDMDSAMLQRSVNSGFSGGEKKRNEILQMAVLAPRLAILDETDSGLDIDALRIVAEGVNKLRSPENATILVTHYQRLLNYIVPDQVHVLAGGRIVRSGGKELALELEEKGYDWIQSESGNGVTGRSRVQAGAK

Samples

Sample ID Description Type Environment
1 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
2 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
203 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
208 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
209 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
212 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
241 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
242 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
267 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
327 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
328 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
365 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
366 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
367 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
368 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
369 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
370 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
371 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
372 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
373 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
374 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
375 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
376 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
377 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
378 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
379 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
385 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
386 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
387 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
405 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.88
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005498 3300003203 Bacteria 5871
2 Ga0058861_12069260 3300004800 Bacteria 2101
3 Ga0058862_10049606 3300004803 Bacteria 3008
4 Ga0065704_10006494 3300005289 Bacteria 2861
5 Ga0065704_10094572 3300005289 Bacteria 2536
6 Ga0065715_10151452 3300005293 Bacteria 1722
7 Ga0065707_10002538 3300005295 Bacteria 4699
8 Ga0065707_10043917 3300005295 Bacteria 1105
9 Ga0065707_10115807 3300005295 Bacteria 2256
10 Ga0070658_10035350 3300005327 Bacteria 4024
11 Ga0070658_10054442 3300005327 Bacteria 3249
12 Ga0070676_10004169 3300005328 Bacteria 7591
13 Ga0070676_10110410 3300005328 Bacteria 1712
14 Ga0070676_10201227 3300005328 Bacteria 1305
15 Ga0070683_100000167 3300005329 Bacteria 43044
16 Ga0070683_100002754 3300005329 Bacteria 14047
17 Ga0070683_100003542 3300005329 Bacteria 12706
18 Ga0070683_100022256 3300005329 Bacteria 5663
19 Ga0070683_100036398 3300005329 Bacteria 4503
20 Ga0070683_100040754 3300005329 Bacteria 4270
21 Ga0070683_100062308 3300005329 Bacteria 3468
22 Ga0070683_100064429 3300005329 Bacteria 3412
23 Ga0070683_100067226 3300005329 Bacteria 3338
24 Ga0070683_100096920 3300005329 Bacteria 2774
25 Ga0070683_100099343 3300005329 Bacteria 2739
26 Ga0070683_100183067 3300005329 Bacteria 1989
27 Ga0070683_100239943 3300005329 Bacteria 1724
28 Ga0070683_100257895 3300005329 Bacteria 1658
29 Ga0070690_100114752 3300005330 Bacteria 1801
30 Ga0070670_100055309 3300005331 Bacteria 3406
31 Ga0070670_100343809 3300005331 Bacteria 1310
32 Ga0068869_100004425 3300005334 Bacteria 8732
33 Ga0070666_10006434 3300005335 Bacteria 7220
34 Ga0070666_10198684 3300005335 Bacteria 1411
35 Ga0070680_100004005 3300005336 Bacteria 11023
36 Ga0070680_100006270 3300005336 Bacteria 9024
37 Ga0070680_100008958 3300005336 Bacteria 7671
38 Ga0070680_100026034 3300005336 Bacteria 4678
39 Ga0070680_100027460 3300005336 Bacteria 4557
40 Ga0070680_100030681 3300005336 Bacteria 4320
41 Ga0070680_100064404 3300005336 Bacteria 3005
42 Ga0070680_100073783 3300005336 Bacteria 2807
43 Ga0070680_100172497 3300005336 Bacteria 1820
44 Ga0070680_100228288 3300005336 Bacteria 1572
45 Ga0070680_100279694 3300005336 Bacteria 1414
46 Ga0070682_100000734 3300005337 Bacteria 19649
47 Ga0070682_100000969 3300005337 Bacteria 16679
48 Ga0070682_100005193 3300005337 Bacteria 7243
49 Ga0070682_100130206 3300005337 Bacteria 1702
50 Ga0068868_100001690 3300005338 Bacteria 15098
51 Ga0068868_100033101 3300005338 Bacteria 3982
52 Ga0070660_100058628 3300005339 Bacteria 2984
53 Ga0070660_100174291 3300005339 Bacteria 1739
54 Ga0070689_100090750 3300005340 Bacteria 2408
55 Ga0070689_100092574 3300005340 Bacteria 2384
56 Ga0070689_100439768 3300005340 Bacteria 1108
57 Ga0070689_100451767 3300005340 Bacteria 1093
58 Ga0070691_10029397 3300005341 Bacteria 2570
59 Ga0070691_10094372 3300005341 Bacteria 1479
60 Ga0070691_10129826 3300005341 Bacteria 1276
61 Ga0070687_100089947 3300005343 Bacteria 1696
62 Ga0070661_100010786 3300005344 Bacteria 6362
63 Ga0070661_100011176 3300005344 Bacteria 6254
64 Ga0070661_100029581 3300005344 Bacteria 3955
65 Ga0070661_100111778 3300005344 Bacteria 2041
66 Ga0070661_100152697 3300005344 Bacteria 1746
67 Ga0070692_10283019 3300005345 Bacteria 1006
68 Ga0070668_100093855 3300005347 Bacteria 2368
69 Ga0070668_100202352 3300005347 Bacteria 1630
70 Ga0070668_100572496 3300005347 Bacteria 985
71 Ga0070669_100008716 3300005353 Bacteria 7236
72 Ga0070669_100030646 3300005353 Bacteria 3882
73 Ga0070669_100087621 3300005353 Bacteria 2328
74 Ga0070675_100136223 3300005354 Bacteria 2096
75 Ga0070671_100006816 3300005355 Bacteria 9143
76 Ga0070671_100023258 3300005355 Bacteria 5070
77 Ga0070671_100219010 3300005355 Bacteria 1615
78 Ga0070674_100000031 3300005356 Bacteria 67745
79 Ga0070674_100056773 3300005356 Bacteria 2715
80 Ga0070673_100008731 3300005364 Bacteria 6764
81 Ga0070673_100014635 3300005364 Bacteria 5475
82 Ga0070659_100009038 3300005366 Bacteria 7311
83 Ga0070659_100013907 3300005366 Bacteria 6005
84 Ga0070659_100027964 3300005366 Bacteria 4350
85 Ga0070659_100030146 3300005366 Bacteria 4196
86 Ga0070659_100034971 3300005366 Bacteria 3910
87 Ga0070659_100042432 3300005366 Bacteria 3555
88 Ga0070659_100212643 3300005366 Bacteria 1594
89 Ga0070667_100132179 3300005367 Bacteria 2179
90 Ga0070703_10014251 3300005406 Bacteria 2263
91 Ga0070703_10066636 3300005406 Bacteria 1191
92 Ga0070709_10001476 3300005434 Bacteria 12692
93 Ga0070709_10008761 3300005434 Bacteria 5565
94 Ga0070709_10023862 3300005434 Bacteria 3597
95 Ga0070709_10049249 3300005434 Bacteria 2633
96 Ga0070709_10162982 3300005434 Bacteria 1552
97 Ga0070709_10211216 3300005434 Bacteria 1380
98 Ga0070709_10596653 3300005434 Bacteria 850
99 Ga0070714_100013494 3300005435 Bacteria 6549
100 Ga0070714_100034277 3300005435 Bacteria 4251
101 Ga0070714_100046215 3300005435 Bacteria 3692
102 Ga0070714_100187059 3300005435 Bacteria 1887
103 Ga0070713_100000083 3300005436 Bacteria 59579
104 Ga0070713_100001130 3300005436 Bacteria 17054
105 Ga0070713_100203717 3300005436 Bacteria 1788
106 Ga0070710_10016685 3300005437 Bacteria 3741
107 Ga0070710_10018647 3300005437 Bacteria 3573
108 Ga0070711_100000009 3300005439 Bacteria 172420
109 Ga0070711_100000946 3300005439 Bacteria 15359
110 Ga0070711_100041611 3300005439 Bacteria 3104
111 Ga0070711_100113196 3300005439 Bacteria 1995
112 Ga0070705_100010188 3300005440 Bacteria 4697
113 Ga0070705_100164056 3300005440 Bacteria 1488
114 Ga0070705_100279069 3300005440 Bacteria 1187
115 Ga0070705_100327896 3300005440 Bacteria 1108
116 Ga0070705_100357133 3300005440 Bacteria 1067
117 Ga0070700_100035256 3300005441 Bacteria 3027
118 Ga0070700_100036045 3300005441 Bacteria 2998
119 Ga0070694_100002417 3300005444 Bacteria 11024
120 Ga0070694_100004958 3300005444 Bacteria 8027
121 Ga0070694_100019920 3300005444 Bacteria 4271
122 Ga0070708_100000075 3300005445 Bacteria 63574
123 Ga0070708_100004873 3300005445 Bacteria 10600
124 Ga0070708_100075545 3300005445 Bacteria 3042
125 Ga0070708_100076744 3300005445 Bacteria 3018
126 Ga0070708_100143567 3300005445 Bacteria 2215
127 Ga0070663_100015483 3300005455 Bacteria 4925
128 Ga0070678_100067503 3300005456 Bacteria 2662
129 Ga0070662_100000206 3300005457 Bacteria 34279
130 Ga0070662_100060350 3300005457 Bacteria 2765
131 Ga0070662_100175049 3300005457 Bacteria 1688
132 Ga0070662_100381231 3300005457 Bacteria 1161
133 Ga0070681_10001292 3300005458 Bacteria 21855
134 Ga0070681_10007697 3300005458 Bacteria 10534
135 Ga0070681_10012170 3300005458 Bacteria 8533
136 Ga0070681_10020791 3300005458 Bacteria 6575
137 Ga0070681_10051531 3300005458 Bacteria 4105
138 Ga0070681_10105072 3300005458 Bacteria 2766
139 Ga0070681_10243420 3300005458 Bacteria 1712
140 Ga0070681_10275201 3300005458 Bacteria 1595
141 Ga0070681_10285019 3300005458 Bacteria 1562
142 Ga0068867_100000341 3300005459 Bacteria 30850
143 Ga0068867_100027999 3300005459 Bacteria 4054
144 Ga0068867_100041713 3300005459 Bacteria 3354
145 Ga0068867_100220746 3300005459 Bacteria 1527
146 Ga0070706_100009626 3300005467 Bacteria 8986
147 Ga0070706_100021390 3300005467 Bacteria 5958
148 Ga0070706_100109203 3300005467 Bacteria 2574
149 Ga0070706_100268626 3300005467 Bacteria 1592
150 Ga0070707_100006739 3300005468 Bacteria 10645
151 Ga0070707_100131992 3300005468 Bacteria 2429
152 Ga0070707_100222611 3300005468 Bacteria 1837
153 Ga0070707_100294352 3300005468 Bacteria 1577
154 Ga0070707_100321207 3300005468 Bacteria 1504
155 Ga0070707_100469507 3300005468 Bacteria 1219
156 Ga0070698_100001439 3300005471 Bacteria 26401
157 Ga0070698_100001472 3300005471 Bacteria 26148
158 Ga0070698_100011487 3300005471 Bacteria 9396
159 Ga0070698_100027831 3300005471 Bacteria 5874
160 Ga0070698_100035975 3300005471 Bacteria 5119
161 Ga0070698_100284546 3300005471 Bacteria 1585
162 Ga0070698_100350440 3300005471 Bacteria 1408
163 Ga0070699_100000063 3300005518 Bacteria 100440
164 Ga0070699_100007997 3300005518 Bacteria 9179
165 Ga0070699_100009667 3300005518 Bacteria 8350
166 Ga0070699_100022150 3300005518 Bacteria 5475
167 Ga0070699_100029350 3300005518 Bacteria 4742
168 Ga0070699_100036215 3300005518 Bacteria 4268
169 Ga0070699_100037937 3300005518 Bacteria 4171
170 Ga0070699_100041992 3300005518 Bacteria 3957
171 Ga0070699_100102349 3300005518 Bacteria 2511
172 Ga0070699_100102571 3300005518 Bacteria 2508
173 Ga0070699_100110896 3300005518 Bacteria 2409
174 Ga0070699_100110974 3300005518 Bacteria 2408
175 Ga0070699_100161807 3300005518 Bacteria 1981
176 Ga0070699_100184491 3300005518 Bacteria 1852
177 Ga0070699_100197440 3300005518 Bacteria 1789
178 Ga0070699_100553093 3300005518 Bacteria 1048
179 Ga0070679_100000608 3300005530 Bacteria 30458
180 Ga0070679_100007243 3300005530 Bacteria 10353
181 Ga0070679_100007573 3300005530 Bacteria 10156
182 Ga0070679_100016503 3300005530 Bacteria 7128
183 Ga0070679_100026951 3300005530 Bacteria 5651
184 Ga0070679_100047770 3300005530 Bacteria 4265
185 Ga0070679_100048845 3300005530 Bacteria 4215
186 Ga0070679_100068952 3300005530 Bacteria 3528
187 Ga0070679_100122830 3300005530 Bacteria 2580
188 Ga0070679_100195433 3300005530 Bacteria 1991
189 Ga0070679_100215457 3300005530 Bacteria 1883
190 Ga0070679_100364673 3300005530 Bacteria 1392
191 Ga0070679_100435705 3300005530 Bacteria 1256
192 Ga0070679_100597469 3300005530 Bacteria 1047
193 Ga0070684_100000212 3300005535 Bacteria 40868
194 Ga0070684_100010985 3300005535 Bacteria 7201
195 Ga0070684_100028396 3300005535 Bacteria 4733
196 Ga0070684_100036065 3300005535 Bacteria 4237
197 Ga0070684_100060352 3300005535 Bacteria 3317
198 Ga0070684_100130303 3300005535 Bacteria 2268
199 Ga0070684_100137842 3300005535 Bacteria 2205
200 Ga0070684_100188076 3300005535 Bacteria 1878
201 Ga0070684_100353416 3300005535 Bacteria 1352
202 Ga0070697_100008915 3300005536 Bacteria 7836
203 Ga0070697_100009287 3300005536 Bacteria 7687
204 Ga0070697_100140714 3300005536 Bacteria 2029
205 Ga0070697_100260267 3300005536 Bacteria 1485
206 Ga0068853_100004232 3300005539 Bacteria 11081
207 Ga0068853_100314379 3300005539 Bacteria 1451
208 Ga0068853_100408700 3300005539 Bacteria 1271
209 Ga0068853_100530904 3300005539 Bacteria 1113
210 Ga0070672_100026672 3300005543 Bacteria 4303
211 Ga0070672_100085773 3300005543 Bacteria 2531
212 Ga0070672_100179464 3300005543 Bacteria 1764
213 Ga0070686_100004210 3300005544 Bacteria 7920
214 Ga0070695_100001374 3300005545 Bacteria 13510
215 Ga0070695_100006476 3300005545 Bacteria 6920
216 Ga0070695_100007435 3300005545 Bacteria 6497
217 Ga0070695_100021263 3300005545 Bacteria 3968
218 Ga0070695_100036976 3300005545 Bacteria 3075
219 Ga0070695_100069975 3300005545 Bacteria 2294
220 Ga0070695_100146044 3300005545 Bacteria 1645
221 Ga0070696_100003906 3300005546 Bacteria 9957
222 Ga0070696_100004602 3300005546 Bacteria 9207
223 Ga0070696_100006413 3300005546 Bacteria 7877
224 Ga0070696_100008347 3300005546 Bacteria 6928
225 Ga0070696_100145231 3300005546 Bacteria 1737
226 Ga0070693_100019448 3300005547 Bacteria 3560
227 Ga0070693_100070305 3300005547 Bacteria 2059
228 Ga0070693_100208744 3300005547 Bacteria 1273
229 Ga0070665_100275791 3300005548 Bacteria 1683
230 Ga0070704_100000701 3300005549 Bacteria 16319
231 Ga0070704_100091327 3300005549 Bacteria 2270
232 Ga0070704_100228732 3300005549 Bacteria 1516
233 Ga0070704_100363790 3300005549 Bacteria 1224
234 Ga0068855_100004308 3300005563 Bacteria 17396
235 Ga0068855_100019763 3300005563 Bacteria 8089
236 Ga0068855_100056570 3300005563 Bacteria 4602
237 Ga0068855_100267059 3300005563 Bacteria 1904
238 Ga0068855_100437458 3300005563 Bacteria 1429
239 Ga0068855_100503572 3300005563 Bacteria 1316
240 Ga0068855_100862231 3300005563 Bacteria 959
241 Ga0070664_100021929 3300005564 Bacteria 5266
242 Ga0070664_100114073 3300005564 Bacteria 2361
243 Ga0070664_100172892 3300005564 Bacteria 1917
244 Ga0070664_100294411 3300005564 Bacteria 1465
245 Ga0070664_100395866 3300005564 Bacteria 1262
246 Ga0068857_100011109 3300005577 Bacteria 7833
247 Ga0068857_100032635 3300005577 Bacteria 4603
248 Ga0068857_100044817 3300005577 Bacteria 3924
249 Ga0068857_100243826 3300005577 Bacteria 1646
250 Ga0068854_100007149 3300005578 Bacteria 7130
251 Ga0068854_100022840 3300005578 Bacteria 4267
252 Ga0068854_100034250 3300005578 Bacteria 3546
253 Ga0068856_100055886 3300005614 Bacteria 3895
254 Ga0068856_100160048 3300005614 Bacteria 2262
255 Ga0070702_100011576 3300005615 Bacteria 4391
256 Ga0070702_100173395 3300005615 Bacteria 1405
257 Ga0068852_100009676 3300005616 Bacteria 7163
258 Ga0068852_100017011 3300005616 Bacteria 5693
259 Ga0068852_100055286 3300005616 Bacteria 3425
260 Ga0068852_100596017 3300005616 Bacteria 1109
261 Ga0068852_100751719 3300005616 Bacteria 987
262 Ga0068852_100761968 3300005616 Bacteria 980
263 Ga0068859_100004322 3300005617 Bacteria 14490
264 Ga0068859_100250507 3300005617 Bacteria 1862
265 Ga0068859_100319717 3300005617 Bacteria 1646
266 Ga0068864_100017774 3300005618 Bacteria 5932
267 Ga0068864_100247571 3300005618 Bacteria 1653
268 Ga0068866_10000048 3300005718 Bacteria 46904
269 Ga0068866_10077480 3300005718 Bacteria 1776
270 Ga0068861_100007877 3300005719 Bacteria 7331
271 Ga0068861_100009043 3300005719 Bacteria 6867
272 Ga0068861_100019081 3300005719 Bacteria 4896
273 Ga0068870_10033736 3300005840 Bacteria 2614
274 Ga0068863_100015626 3300005841 Bacteria 7292
275 Ga0068863_100931988 3300005841 Bacteria 870
276 Ga0068858_100021966 3300005842 Bacteria 5960
277 Ga0068858_100030024 3300005842 Bacteria 5047
278 Ga0068858_100194229 3300005842 Bacteria 1918
279 Ga0068858_100196931 3300005842 Bacteria 1904
280 Ga0068860_100020074 3300005843 Bacteria 6473
281 Ga0068860_100151385 3300005843 Bacteria 2234
282 Ga0068862_100010499 3300005844 Bacteria 7649
283 Ga0068862_100012176 3300005844 Bacteria 7111
284 Ga0068862_100132445 3300005844 Bacteria 2206
285 Ga0068862_100142275 3300005844 Bacteria 2130
286 Ga0081455_10066458 3300005937 Bacteria 3011
287 Ga0081538_10050721 3300005981 Bacteria 2501
288 Ga0081539_10000117 3300005985 Bacteria 185868
289 Ga0070717_10001061 3300006028 Bacteria 18453
290 Ga0070717_10396173 3300006028 Bacteria 1240
291 Ga0075432_10130116 3300006058 Bacteria 953
292 Ga0070716_100000911 3300006173 Bacteria 12772
293 Ga0070716_100084807 3300006173 Bacteria 1901
294 Ga0070712_100043380 3300006175 Bacteria 3096
295 Ga0070712_100103070 3300006175 Bacteria 2115
296 Ga0070712_100407614 3300006175 Bacteria 1124
297 Ga0068871_100220782 3300006358 Bacteria 1642
298 Ga0075428_100002193 3300006844 Bacteria 21123
299 Ga0075428_100042612 3300006844 Bacteria 4991
300 Ga0075428_100051192 3300006844 Bacteria 4528
301 Ga0075428_100057685 3300006844 Bacteria 4250
302 Ga0075428_100071962 3300006844 Bacteria 3778
303 Ga0075430_100000158 3300006846 Bacteria 44327
304 Ga0075430_100013207 3300006846 Bacteria 7036
305 Ga0075430_100044776 3300006846 Bacteria 3740
306 Ga0075430_100048026 3300006846 Bacteria 3604
307 Ga0075430_100054096 3300006846 Bacteria 3378
308 Ga0075430_100164489 3300006846 Bacteria 1846
309 Ga0075430_100427800 3300006846 Bacteria 1093
310 Ga0075431_100006275 3300006847 Bacteria 11812
311 Ga0075431_100060004 3300006847 Bacteria 3925
312 Ga0075431_100089007 3300006847 Bacteria 3187
313 Ga0075431_100136207 3300006847 Bacteria 2532
314 Ga0075431_100204048 3300006847 Bacteria 2022
315 Ga0075431_100529777 3300006847 Bacteria 1167
316 Ga0075431_100726340 3300006847 Bacteria 970
317 Ga0075433_10015768 3300006852 Bacteria 6209
318 Ga0075433_10023858 3300006852 Bacteria 5154
319 Ga0075433_10029664 3300006852 Bacteria 4663
320 Ga0075433_10035491 3300006852 Bacteria 4288
321 Ga0075433_10044601 3300006852 Bacteria 3853
322 Ga0075433_10087845 3300006852 Bacteria 2746
323 Ga0075433_10104854 3300006852 Bacteria 2505
324 Ga0075433_10380246 3300006852 Bacteria 1247
325 Ga0075434_100001890 3300006871 Bacteria 18124
326 Ga0075434_100012547 3300006871 Bacteria 8036
327 Ga0075434_100019973 3300006871 Bacteria 6489
328 Ga0075434_100093491 3300006871 Bacteria 3010
329 Ga0075434_100127769 3300006871 Bacteria 2559
330 Ga0075434_100162518 3300006871 Bacteria 2253
331 Ga0075434_100179294 3300006871 Bacteria 2138
332 Ga0075429_100000263 3300006880 Bacteria 36639
333 Ga0075429_100014752 3300006880 Bacteria 6772
334 Ga0075429_100029580 3300006880 Bacteria 4757
335 Ga0075429_100041536 3300006880 Bacteria 4006
336 Ga0075429_100096822 3300006880 Bacteria 2574
337 Ga0068865_100001170 3300006881 Bacteria 15241
338 Ga0068865_100007259 3300006881 Bacteria 6811
339 Ga0075436_100001297 3300006914 Bacteria 17001
340 Ga0075436_100008948 3300006914 Bacteria 6853
341 Ga0075436_100011722 3300006914 Bacteria 6017
342 Ga0075436_100012281 3300006914 Bacteria 5869
343 Ga0075436_100035435 3300006914 Bacteria 3443
344 Ga0075436_100049244 3300006914 Bacteria 2907
345 Ga0075436_100060385 3300006914 Bacteria 2618
346 Ga0075436_100062488 3300006914 Bacteria 2573
347 Ga0075436_100065574 3300006914 Bacteria 2510
348 Ga0075436_100070933 3300006914 Bacteria 2409
349 Ga0075436_100147524 3300006914 Bacteria 1654
350 Ga0075436_100161322 3300006914 Bacteria 1581
351 Ga0075436_100488417 3300006914 Bacteria 900
352 Ga0097620_100004322 3300006931 Bacteria 14490
353 Ga0097620_100168039 3300006931 Bacteria 2273
354 Ga0097620_100250507 3300006931 Bacteria 1862
355 Ga0097620_100319733 3300006931 Bacteria 1646
356 Ga0075435_100018950 3300007076 Bacteria 5245
357 Ga0075435_100022387 3300007076 Bacteria 4876
358 Ga0075435_100071326 3300007076 Bacteria 2836
359 Ga0075435_100115161 3300007076 Bacteria 2238
360 Ga0075435_100302269 3300007076 Bacteria 1368
361 Ga0075435_100314638 3300007076 Bacteria 1340
362 Ga0075435_100470554 3300007076 Bacteria 1085
363 Ga0099795_10024610 3300007788 Bacteria 2010
364 Ga0105240_10004744 3300009093 Bacteria 20528
365 Ga0105240_10030521 3300009093 Bacteria 7005
366 Ga0105240_10075669 3300009093 Bacteria 4152
367 Ga0105240_10136507 3300009093 Bacteria 2937
368 Ga0105240_10190189 3300009093 Bacteria 2414
369 Ga0105240_10294332 3300009093 Bacteria 1859
370 Ga0105240_10837557 3300009093 Bacteria 994
371 Ga0111539_10349587 3300009094 Bacteria 1721
372 Ga0105245_10010423 3300009098 Bacteria 8094
373 Ga0105245_10011101 3300009098 Bacteria 7843
374 Ga0105245_10034539 3300009098 Bacteria 4485
375 Ga0105245_10036786 3300009098 Bacteria 4350
376 Ga0105245_10124898 3300009098 Bacteria 2407
377 Ga0114129_10004057 3300009147 Bacteria 20669
378 Ga0114129_10071105 3300009147 Bacteria 4852
379 Ga0114129_10097509 3300009147 Bacteria 4070
380 Ga0114129_10199495 3300009147 Bacteria 2711
381 Ga0114129_10273053 3300009147 Bacteria 2261
382 Ga0114129_10693858 3300009147 Bacteria 1309
383 Ga0105243_10003585 3300009148 Bacteria 12527
384 Ga0105243_10128101 3300009148 Bacteria 2150
385 Ga0105243_10334871 3300009148 Bacteria 1384
386 Ga0105241_10000019 3300009174 Bacteria 147955
387 Ga0105241_10000716 3300009174 Bacteria 25098
388 Ga0105241_10124929 3300009174 Bacteria 2077
389 Ga0105241_10158319 3300009174 Bacteria 1859
390 Ga0105241_10208895 3300009174 Bacteria 1635
391 Ga0105241_10283202 3300009174 Bacteria 1416
392 Ga0105242_10000251 3300009176 Bacteria 42425
393 Ga0105242_10000787 3300009176 Bacteria 24587
394 Ga0105248_10001792 3300009177 Bacteria 23876
395 Ga0105248_10019128 3300009177 Bacteria 7576
396 Ga0105248_10020594 3300009177 Bacteria 7310
397 Ga0105248_10086695 3300009177 Bacteria 3523
398 Ga0105248_10154882 3300009177 Bacteria 2586
399 Ga0105248_10171291 3300009177 Bacteria 2447
400 Ga0105248_10296390 3300009177 Bacteria 1821
401 Ga0105248_10303970 3300009177 Bacteria 1796
402 Ga0105237_10036092 3300009545 Bacteria 5001
403 Ga0105237_10146238 3300009545 Bacteria 2358
404 Ga0105237_10372259 3300009545 Bacteria 1433
405 Ga0105237_10397393 3300009545 Bacteria 1383
406 Ga0105237_10664197 3300009545 Bacteria 1049
407 Ga0105238_10013049 3300009551 Bacteria 8385
408 Ga0105238_10027590 3300009551 Bacteria 5787
409 Ga0105238_10108332 3300009551 Bacteria 2759
410 Ga0105238_10646960 3300009551 Bacteria 1067
411 Ga0105238_10711097 3300009551 Bacteria 1017
412 Ga0105249_10022608 3300009553 Bacteria 5634
413 Ga0105249_10023634 3300009553 Bacteria 5517
414 Ga0105249_10137800 3300009553 Bacteria 2338
415 Ga0105249_10164727 3300009553 Bacteria 2145
416 Ga0105249_10249384 3300009553 Bacteria 1759
417 Ga0105249_10332136 3300009553 Bacteria 1534
418 Ga0105239_10013449 3300010375 Bacteria 9093
419 Ga0105246_10296660 3300011119 Bacteria 1303
420 Ga0105246_10545717 3300011119 Bacteria 992
421 Ga0157373_10014172 3300013100 Bacteria 5847
422 Ga0157373_10047874 3300013100 Bacteria 3049
423 Ga0157373_10053152 3300013100 Bacteria 2880
424 Ga0157373_10182621 3300013100 Bacteria 1477
425 Ga0157373_10199721 3300013100 Bacteria 1409
426 Ga0157373_10221174 3300013100 Bacteria 1336
427 Ga0157371_10074288 3300013102 Bacteria 2408
428 Ga0157371_10161379 3300013102 Bacteria 1601
429 Ga0157371_10205901 3300013102 Bacteria 1411
430 Ga0157370_10000311 3300013104 Bacteria 60937
431 Ga0157370_10010642 3300013104 Bacteria 9682
432 Ga0157370_10049871 3300013104 Bacteria 4003
433 Ga0157370_10050227 3300013104 Bacteria 3987
434 Ga0157370_10096803 3300013104 Bacteria 2769
435 Ga0157370_10111131 3300013104 Bacteria 2562
436 Ga0157370_10112049 3300013104 Bacteria 2550
437 Ga0157370_10153672 3300013104 Bacteria 2141
438 Ga0157370_10169733 3300013104 Bacteria 2028
439 Ga0157370_10516081 3300013104 Bacteria 1097
440 Ga0157369_10002977 3300013105 Bacteria 20267
441 Ga0157369_10029240 3300013105 Bacteria 6091
442 Ga0157369_10108231 3300013105 Bacteria 2956
443 Ga0157369_10255814 3300013105 Bacteria 1827
444 Ga0157369_10262924 3300013105 Bacteria 1799
445 Ga0157369_10326382 3300013105 Bacteria 1595
446 Ga0157369_10627721 3300013105 Bacteria 1108
447 Ga0157374_10000354 3300013296 Bacteria 42454
448 Ga0157374_10032848 3300013296 Bacteria 4730
449 Ga0157374_10118697 3300013296 Bacteria 2551
450 Ga0157378_10001585 3300013297 Bacteria 20557
451 Ga0157378_10034310 3300013297 Bacteria 4487
452 Ga0157378_10056354 3300013297 Bacteria 3502
453 Ga0157378_10126749 3300013297 Bacteria 2359
454 Ga0157378_10205775 3300013297 Bacteria 1864
455 Ga0163162_10001791 3300013306 Bacteria 20158
456 Ga0163162_10043019 3300013306 Bacteria 4522
457 Ga0157372_10008172 3300013307 Bacteria 11124
458 Ga0157372_10022604 3300013307 Bacteria 6806
459 Ga0157372_10028719 3300013307 Bacteria 6072
460 Ga0157372_10042712 3300013307 Bacteria 5016
461 Ga0157372_10046586 3300013307 Bacteria 4814
462 Ga0157372_10072521 3300013307 Bacteria 3881
463 Ga0157372_10094586 3300013307 Bacteria 3403
464 Ga0157372_10101356 3300013307 Bacteria 3287
465 Ga0157372_10125276 3300013307 Bacteria 2953
466 Ga0157372_10143253 3300013307 Bacteria 2756
467 Ga0157372_10146411 3300013307 Bacteria 2724
468 Ga0157372_10243070 3300013307 Bacteria 2089
469 Ga0157372_10299974 3300013307 Bacteria 1869
470 Ga0157372_10316634 3300013307 Bacteria 1816
471 Ga0157372_10389340 3300013307 Bacteria 1624
472 Ga0157372_10560591 3300013307 Bacteria 1332
473 Ga0157372_10695174 3300013307 Bacteria 1183
474 Ga0157372_10931767 3300013307 Bacteria 1007
475 Ga0157375_10021674 3300013308 Bacteria 5898
476 Ga0157375_10088177 3300013308 Bacteria 3157
477 Ga0157375_10605034 3300013308 Bacteria 1255
478 Ga0157375_10694135 3300013308 Bacteria 1172
479 Ga0157375_11273999 3300013308 Bacteria 864
480 Ga0163163_10002166 3300014325 Bacteria 16597
481 Ga0163163_10050109 3300014325 Bacteria 4112
482 Ga0163163_10118424 3300014325 Bacteria 2681
483 Ga0163163_10287927 3300014325 Bacteria 1695
484 Ga0157380_10020140 3300014326 Bacteria 4983
485 Ga0157379_10015995 3300014968 Bacteria 6595
486 Ga0157379_10084462 3300014968 Bacteria 2845
487 Ga0157379_10197600 3300014968 Bacteria 1818
488 Ga0157379_10249520 3300014968 Bacteria 1611
489 Ga0157376_10008108 3300014969 Bacteria 7549
490 Ga0157376_10534413 3300014969 Bacteria 1158
491 Ga0163161_10464326 3300017792 Bacteria 1025
492 Ga0206356_10024056 3300020070 Bacteria 1211
493 Ga0206356_10142434 3300020070 Bacteria 1304
494 Ga0206356_10634794 3300020070 Bacteria 1146
495 Ga0206356_10968049 3300020070 Bacteria 1270
496 Ga0206356_11526478 3300020070 Bacteria 1694
497 Ga0206351_10878209 3300020077 Bacteria 2589
498 Ga0206352_10462765 3300020078 Bacteria 1533
499 Ga0206350_10138413 3300020080 Bacteria 1009
500 Ga0224712_10060979 3300022467 Bacteria 1503
501 Ga0207697_10006392 3300025315 Bacteria 5336
502 Ga0207653_10000906 3300025885 Bacteria 9853
503 Ga0207653_10016500 3300025885 Bacteria 2320
504 Ga0207653_10067324 3300025885 Bacteria 1218
505 Ga0207682_10013260 3300025893 Bacteria 3213
506 Ga0207682_10024834 3300025893 Bacteria 2375
507 Ga0207692_10011979 3300025898 Bacteria 3712
508 Ga0207692_10174924 3300025898 Bacteria 1247
509 Ga0207692_10288434 3300025898 Bacteria 995
510 Ga0207642_10000833 3300025899 Bacteria 9612
511 Ga0207642_10095217 3300025899 Bacteria 1481
512 Ga0207642_10132429 3300025899 Bacteria 1303
513 Ga0207680_10035155 3300025903 Bacteria 2874
514 Ga0207680_10064790 3300025903 Bacteria 2242
515 Ga0207699_10000990 3300025906 Bacteria 13504
516 Ga0207699_10014488 3300025906 Bacteria 4066
517 Ga0207699_10019691 3300025906 Bacteria 3604
518 Ga0207699_10060529 3300025906 Bacteria 2274
519 Ga0207645_10001078 3300025907 Bacteria 22569
520 Ga0207645_10013509 3300025907 Bacteria 5500
521 Ga0207643_10011540 3300025908 Bacteria 4772
522 Ga0207643_10060545 3300025908 Bacteria 2161
523 Ga0207705_10029338 3300025909 Bacteria 3921
524 Ga0207705_10243867 3300025909 Bacteria 1369
525 Ga0207684_10005196 3300025910 Bacteria 12109
526 Ga0207684_10007226 3300025910 Bacteria 10038
527 Ga0207684_10040882 3300025910 Bacteria 3931
528 Ga0207684_10044459 3300025910 Bacteria 3766
529 Ga0207684_10065162 3300025910 Bacteria 3094
530 Ga0207654_10000962 3300025911 Bacteria 15802
531 Ga0207654_10127999 3300025911 Bacteria 1604
532 Ga0207654_10157982 3300025911 Bacteria 1462
533 Ga0207654_10179755 3300025911 Bacteria 1379
534 Ga0207707_10001431 3300025912 Bacteria 22069
535 Ga0207707_10002091 3300025912 Bacteria 18058
536 Ga0207707_10007219 3300025912 Bacteria 9670
537 Ga0207707_10011141 3300025912 Bacteria 7821
538 Ga0207707_10015965 3300025912 Bacteria 6549
539 Ga0207707_10020488 3300025912 Bacteria 5774
540 Ga0207707_10022038 3300025912 Bacteria 5568
541 Ga0207707_10033649 3300025912 Bacteria 4485
542 Ga0207707_10218880 3300025912 Bacteria 1657
543 Ga0207707_10447202 3300025912 Bacteria 1106
544 Ga0207695_10005716 3300025913 Bacteria 16392
545 Ga0207695_10015949 3300025913 Bacteria 8822
546 Ga0207695_10028639 3300025913 Bacteria 6169
547 Ga0207695_10170463 3300025913 Bacteria 2102
548 Ga0207695_10188662 3300025913 Bacteria 1980
549 Ga0207695_10192180 3300025913 Bacteria 1959
550 Ga0207695_10261986 3300025913 Bacteria 1626
551 Ga0207695_10317467 3300025913 Bacteria 1448
552 Ga0207695_10564740 3300025913 Bacteria 1019
553 Ga0207693_10031705 3300025915 Bacteria 4176
554 Ga0207663_10000013 3300025916 Bacteria 167304
555 Ga0207663_10012478 3300025916 Bacteria 4595
556 Ga0207663_10067351 3300025916 Bacteria 2296
557 Ga0207663_10097790 3300025916 Bacteria 1964
558 Ga0207663_10116407 3300025916 Bacteria 1822
559 Ga0207660_10003331 3300025917 Bacteria 10488
560 Ga0207660_10007979 3300025917 Bacteria 6842
561 Ga0207660_10013079 3300025917 Bacteria 5434
562 Ga0207660_10013174 3300025917 Bacteria 5416
563 Ga0207660_10035605 3300025917 Bacteria 3457
564 Ga0207660_10045477 3300025917 Bacteria 3093
565 Ga0207660_10050281 3300025917 Bacteria 2959
566 Ga0207660_10140615 3300025917 Bacteria 1845
567 Ga0207660_10140630 3300025917 Bacteria 1845
568 Ga0207662_10186218 3300025918 Bacteria 1338
569 Ga0207657_10007417 3300025919 Bacteria 11247
570 Ga0207657_10017181 3300025919 Bacteria 6950
571 Ga0207657_10026711 3300025919 Bacteria 5299
572 Ga0207657_10176416 3300025919 Bacteria 1729
573 Ga0207657_10355490 3300025919 Bacteria 1155
574 Ga0207649_10007938 3300025920 Bacteria 5776
575 Ga0207649_10038609 3300025920 Bacteria 2892
576 Ga0207649_10045358 3300025920 Bacteria 2695
577 Ga0207649_10057496 3300025920 Bacteria 2432
578 Ga0207649_10223509 3300025920 Bacteria 1343
579 Ga0207652_10001513 3300025921 Bacteria 20520
580 Ga0207652_10004478 3300025921 Bacteria 11374
581 Ga0207652_10004726 3300025921 Bacteria 11041
582 Ga0207652_10005744 3300025921 Bacteria 10070
583 Ga0207652_10016515 3300025921 Bacteria 6028
584 Ga0207652_10020371 3300025921 Bacteria 5460
585 Ga0207652_10053599 3300025921 Bacteria 3464
586 Ga0207652_10057994 3300025921 Bacteria 3336
587 Ga0207652_10061824 3300025921 Bacteria 3235
588 Ga0207652_10099393 3300025921 Bacteria 2567
589 Ga0207652_10103249 3300025921 Bacteria 2520
590 Ga0207652_10108342 3300025921 Bacteria 2461
591 Ga0207652_10285114 3300025921 Bacteria 1490
592 Ga0207652_10450690 3300025921 Bacteria 1160
593 Ga0207646_10002828 3300025922 Bacteria 20191
594 Ga0207646_10002838 3300025922 Bacteria 20147
595 Ga0207646_10009959 3300025922 Bacteria 9341
596 Ga0207646_10038019 3300025922 Bacteria 4338
597 Ga0207646_10083049 3300025922 Bacteria 2865
598 Ga0207646_10163452 3300025922 Bacteria 2009
599 Ga0207646_10181255 3300025922 Bacteria 1902
600 Ga0207646_10198958 3300025922 Bacteria 1810
601 Ga0207681_10020095 3300025923 Bacteria 4228
602 Ga0207681_10021437 3300025923 Bacteria 4107
603 Ga0207681_10037604 3300025923 Bacteria 3200
604 Ga0207681_10134732 3300025923 Bacteria 1831
605 Ga0207694_10019182 3300025924 Bacteria 5169
606 Ga0207694_10033445 3300025924 Bacteria 3939
607 Ga0207694_10070725 3300025924 Bacteria 2727
608 Ga0207650_10016927 3300025925 Bacteria 5099
609 Ga0207650_10030026 3300025925 Bacteria 3912
610 Ga0207650_10391217 3300025925 Bacteria 1149
611 Ga0207659_10004878 3300025926 Bacteria 8131
612 Ga0207659_10594550 3300025926 Bacteria 943
613 Ga0207687_10019366 3300025927 Bacteria 4509
614 Ga0207687_10021988 3300025927 Bacteria 4241
615 Ga0207687_10053510 3300025927 Bacteria 2820
616 Ga0207687_10221565 3300025927 Bacteria 1490
617 Ga0207700_10000243 3300025928 Bacteria 32630
618 Ga0207700_10127337 3300025928 Bacteria 2074
619 Ga0207700_10460212 3300025928 Bacteria 1122
620 Ga0207664_10007050 3300025929 Bacteria 7786
621 Ga0207664_10014315 3300025929 Bacteria 5725
622 Ga0207664_10027416 3300025929 Bacteria 4318
623 Ga0207664_10053021 3300025929 Bacteria 3209
624 Ga0207664_10096305 3300025929 Bacteria 2436
625 Ga0207664_10102772 3300025929 Bacteria 2363
626 Ga0207664_10408112 3300025929 Bacteria 1209
627 Ga0207644_10126524 3300025931 Bacteria 1951
628 Ga0207644_10447831 3300025931 Bacteria 1060
629 Ga0207690_10012137 3300025932 Bacteria 5154
630 Ga0207690_10039738 3300025932 Bacteria 3071
631 Ga0207690_10054671 3300025932 Bacteria 2685
632 Ga0207690_10129885 3300025932 Bacteria 1842
633 Ga0207690_10208006 3300025932 Bacteria 1490
634 Ga0207706_10000096 3300025933 Bacteria 92125
635 Ga0207706_10003039 3300025933 Bacteria 16174
636 Ga0207706_10184546 3300025933 Bacteria 1832
637 Ga0207706_10542116 3300025933 Bacteria 1002
638 Ga0207686_10000112 3300025934 Bacteria 65154
639 Ga0207709_10001243 3300025935 Bacteria 18298
640 Ga0207709_10104043 3300025935 Bacteria 1883
641 Ga0207669_10001730 3300025937 Bacteria 9271
642 Ga0207704_10001104 3300025938 Bacteria 12007
643 Ga0207665_10000385 3300025939 Bacteria 30257
644 Ga0207691_10012186 3300025940 Bacteria 8243
645 Ga0207691_10016019 3300025940 Bacteria 7120
646 Ga0207691_10092668 3300025940 Bacteria 2705
647 Ga0207691_10144880 3300025940 Bacteria 2091
648 Ga0207711_10003244 3300025941 Bacteria 14176
649 Ga0207711_10018493 3300025941 Bacteria 5794
650 Ga0207711_10049151 3300025941 Bacteria 3610
651 Ga0207689_10000755 3300025942 Bacteria 31026
652 Ga0207689_10000911 3300025942 Bacteria 28348
653 Ga0207689_10516330 3300025942 Bacteria 1002
654 Ga0207661_10000266 3300025944 Bacteria 33818
655 Ga0207661_10020439 3300025944 Bacteria 4949
656 Ga0207661_10020824 3300025944 Bacteria 4908
657 Ga0207661_10040614 3300025944 Bacteria 3658
658 Ga0207661_10046960 3300025944 Bacteria 3426
659 Ga0207661_10088576 3300025944 Bacteria 2573
660 Ga0207661_10101931 3300025944 Bacteria 2412
661 Ga0207661_10102863 3300025944 Bacteria 2403
662 Ga0207661_10130283 3300025944 Bacteria 2153
663 Ga0207661_10199567 3300025944 Bacteria 1758
664 Ga0207661_10221052 3300025944 Bacteria 1674
665 Ga0207679_10001989 3300025945 Bacteria 12678
666 Ga0207679_10022240 3300025945 Bacteria 4314
667 Ga0207679_10051565 3300025945 Bacteria 3012
668 Ga0207679_10054235 3300025945 Bacteria 2950
669 Ga0207679_10058167 3300025945 Bacteria 2863
670 Ga0207679_10109728 3300025945 Bacteria 2175
671 Ga0207679_10115300 3300025945 Bacteria 2128
672 Ga0207679_10124706 3300025945 Bacteria 2056
673 Ga0207667_10002929 3300025949 Bacteria 21195
674 Ga0207667_10027244 3300025949 Bacteria 6225
675 Ga0207667_10044977 3300025949 Bacteria 4676
676 Ga0207667_10234571 3300025949 Bacteria 1878
677 Ga0207651_10376597 3300025960 Bacteria 1202
678 Ga0207651_10589569 3300025960 Bacteria 971
679 Ga0207712_10003463 3300025961 Bacteria 9965
680 Ga0207712_10007741 3300025961 Bacteria 6792
681 Ga0207712_10055730 3300025961 Bacteria 2782
682 Ga0207712_10157785 3300025961 Bacteria 1759
683 Ga0207668_10037344 3300025972 Bacteria 3250
684 Ga0207668_10091785 3300025972 Bacteria 2233
685 Ga0207668_10166705 3300025972 Bacteria 1723
686 Ga0207668_10200757 3300025972 Bacteria 1588
687 Ga0207668_10239707 3300025972 Bacteria 1467
688 Ga0207668_10581859 3300025972 Bacteria 973
689 Ga0207640_10002465 3300025981 Bacteria 9907
690 Ga0207640_10017844 3300025981 Bacteria 4158
691 Ga0207640_10026016 3300025981 Bacteria 3549
692 Ga0207640_10049558 3300025981 Bacteria 2720
693 Ga0207640_10089997 3300025981 Bacteria 2122
694 Ga0207640_10301738 3300025981 Bacteria 1267
695 Ga0207658_10022058 3300025986 Bacteria 4429
696 Ga0207658_10232896 3300025986 Bacteria 1556
697 Ga0207658_10241365 3300025986 Bacteria 1531
698 Ga0207677_10015707 3300026023 Bacteria 4463
699 Ga0207677_10182995 3300026023 Bacteria 1650
700 Ga0207677_10300527 3300026023 Bacteria 1326
701 Ga0207703_10066907 3300026035 Bacteria 2956
702 Ga0207639_10215551 3300026041 Bacteria 1655
703 Ga0207639_10705538 3300026041 Bacteria 936
704 Ga0207678_10001786 3300026067 Bacteria 19698
705 Ga0207678_10061517 3300026067 Bacteria 3229
706 Ga0207678_10204722 3300026067 Bacteria 1688
707 Ga0207678_10274790 3300026067 Bacteria 1445
708 Ga0207678_10684829 3300026067 Bacteria 902
709 Ga0207708_10038135 3300026075 Bacteria 3661
710 Ga0207708_10056957 3300026075 Bacteria 2982
711 Ga0207708_10057843 3300026075 Bacteria 2958
712 Ga0207641_10433006 3300026088 Bacteria 1268
713 Ga0207641_10509032 3300026088 Bacteria 1170
714 Ga0207641_10875515 3300026088 Bacteria 891
715 Ga0207641_10916326 3300026088 Bacteria 871
716 Ga0207648_10000043 3300026089 Bacteria 113682
717 Ga0207648_10070659 3300026089 Bacteria 3043
718 Ga0207648_10081301 3300026089 Bacteria 2826
719 Ga0207648_10140928 3300026089 Bacteria 2124
720 Ga0207648_10214133 3300026089 Bacteria 1711
721 Ga0207676_10066334 3300026095 Bacteria 2878
722 Ga0207674_10001092 3300026116 Bacteria 35309
723 Ga0207674_10004557 3300026116 Bacteria 16643
724 Ga0207674_10010897 3300026116 Bacteria 10240
725 Ga0207674_10035181 3300026116 Bacteria 5228
726 Ga0207674_10045964 3300026116 Bacteria 4487
727 Ga0207674_10059883 3300026116 Bacteria 3852
728 Ga0207675_100000197 3300026118 Bacteria 55600
729 Ga0207675_100009301 3300026118 Bacteria 9216
730 Ga0207675_100066119 3300026118 Bacteria 3379
731 Ga0207675_100283204 3300026118 Bacteria 1611
732 Ga0207683_10003314 3300026121 Bacteria 14037
733 Ga0207683_10024609 3300026121 Bacteria 5186
734 Ga0207698_10007725 3300026142 Bacteria 6748
735 Ga0207698_10015011 3300026142 Bacteria 5172
736 Ga0207698_10058998 3300026142 Bacteria 2977
737 Ga0207698_10121777 3300026142 Bacteria 2210
738 Ga0207698_10154207 3300026142 Bacteria 1998
739 Ga0207698_10448241 3300026142 Bacteria 1245
740 Ga0209967_1001446 3300027364 Bacteria 3040
741 Ga0209995_1001594 3300027471 Bacteria 3513
742 Ga0209968_1002268 3300027526 Bacteria 2907
743 Ga0209999_1001017 3300027543 Bacteria 4761
744 Ga0209999_1001140 3300027543 Bacteria 4536
745 Ga0209588_1022798 3300027671 Bacteria 1970
746 Ga0209971_1004772 3300027682 Bacteria 3219
747 Ga0209966_1003128 3300027695 Bacteria 2777
748 Ga0209966_1005831 3300027695 Bacteria 2123
749 Ga0209998_10000194 3300027717 Bacteria 21684
750 Ga0207428_10171965 3300027907 Bacteria 1640
751 Ga0268266_10395652 3300028379 Bacteria 1306
752 Ga0268265_10083741 3300028380 Bacteria 2526
753 Ga0268265_10096003 3300028380 Bacteria 2381
754 Ga0268265_10102978 3300028380 Bacteria 2310
755 Ga0268265_10344506 3300028380 Bacteria 1358
756 Ga0268264_10007645 3300028381 Bacteria 9009
757 Ga0268264_10168495 3300028381 Bacteria 1979
758 Ga0268264_10183070 3300028381 Bacteria 1904
759 Ga0265337_1001252 3300028556 Bacteria 12795
760 Ga0265326_10001074 3300028558 Bacteria 9741
761 Ga0265326_10003863 3300028558 Bacteria 4869
762 Ga0265319_1000100 3300028563 Bacteria 66728
763 Ga0265319_1000169 3300028563 Bacteria 49406
764 Ga0265334_10001411 3300028573 Bacteria 11555
765 Ga0265318_10001487 3300028577 Bacteria 13701
766 Ga0265323_10000218 3300028653 Bacteria 33811
767 Ga0265322_10000549 3300028654 Bacteria 14431
768 Ga0265322_10002031 3300028654 Bacteria 6379
769 Ga0265336_10000115 3300028666 Bacteria 59960
770 Ga0307515_10127185 3300028794 Bacteria 2836
771 Ga0265338_10001654 3300028800 Bacteria 35526
772 Ga0265338_10005397 3300028800 Bacteria 16701
773 Ga0265338_10005519 3300028800 Bacteria 16487
774 Ga0265338_10005708 3300028800 Bacteria 16097
775 Ga0265324_10001167 3300029957 Bacteria 15643
776 Ga0265324_10005143 3300029957 Bacteria 5711
777 Ga0265324_10005863 3300029957 Bacteria 5224
778 Ga0265330_10000319 3300031235 Bacteria 34472
779 Ga0265332_10000382 3300031238 Bacteria 32426
780 Ga0265332_10148623 3300031238 Bacteria 980
781 Ga0265320_10002083 3300031240 Bacteria 14085
782 Ga0265320_10002134 3300031240 Bacteria 13874
783 Ga0265325_10004251 3300031241 Bacteria 9088
784 Ga0265325_10015601 3300031241 Bacteria 4268
785 Ga0265329_10000073 3300031242 Bacteria 44995
786 Ga0265340_10004960 3300031247 Bacteria 7398
787 Ga0265339_10000297 3300031249 Bacteria 40447
788 Ga0265331_10000963 3300031250 Bacteria 22892
789 Ga0265327_10033503 3300031251 Bacteria 2861
790 Ga0265316_10000247 3300031344 Bacteria 62442
791 Ga0265316_10005834 3300031344 Bacteria 11873
792 Ga0307408_100002006 3300031548 Bacteria 14703
793 Ga0307408_100051172 3300031548 Bacteria 2974
794 Ga0307408_100061987 3300031548 Bacteria 2731
795 Ga0307408_100063300 3300031548 Bacteria 2706
796 Ga0307408_100097461 3300031548 Bacteria 2234
797 Ga0307408_100156029 3300031548 Bacteria 1807
798 Ga0307408_100206896 3300031548 Bacteria 1592
799 Ga0307408_100220320 3300031548 Bacteria 1548
800 Ga0265313_10000580 3300031595 Bacteria 38083
801 Ga0265314_10000285 3300031711 Bacteria 73539
802 Ga0265314_10101911 3300031711 Bacteria 1843
803 Ga0265342_10000764 3300031712 Bacteria 32819
804 Ga0265342_10002715 3300031712 Bacteria 15069
805 Ga0265342_10002983 3300031712 Bacteria 14207
806 Ga0307405_10004222 3300031731 Bacteria 6759
807 Ga0307405_10004860 3300031731 Bacteria 6415
808 Ga0307405_10006609 3300031731 Bacteria 5719
809 Ga0307405_10012109 3300031731 Bacteria 4551
810 Ga0307405_10021653 3300031731 Bacteria 3618
811 Ga0307405_10029235 3300031731 Bacteria 3219
812 Ga0307405_10262344 3300031731 Bacteria 1291
813 Ga0307413_10003779 3300031824 Bacteria 6451
814 Ga0307413_10006790 3300031824 Bacteria 5259
815 Ga0307413_10007348 3300031824 Bacteria 5109
816 Ga0307413_10067889 3300031824 Bacteria 2231
817 Ga0307413_10199897 3300031824 Bacteria 1443
818 Ga0307413_10214025 3300031824 Bacteria 1402
819 Ga0307410_10002673 3300031852 Bacteria 8694
820 Ga0307410_10020830 3300031852 Bacteria 4021
821 Ga0307410_10021209 3300031852 Bacteria 3991
822 Ga0307410_10073357 3300031852 Bacteria 2379
823 Ga0307406_10013122 3300031901 Bacteria 4738
824 Ga0307406_10014255 3300031901 Bacteria 4570
825 Ga0307406_10016148 3300031901 Bacteria 4333
826 Ga0307406_10018816 3300031901 Bacteria 4043
827 Ga0307406_10025477 3300031901 Bacteria 3542
828 Ga0307406_10032349 3300031901 Bacteria 3193
829 Ga0307406_10046751 3300031901 Bacteria 2724
830 Ga0307407_10008351 3300031903 Bacteria 4746
831 Ga0307407_10015673 3300031903 Bacteria 3755
832 Ga0307412_10002809 3300031911 Bacteria 9665
833 Ga0307412_10026618 3300031911 Bacteria 3597
834 Ga0307412_10029152 3300031911 Bacteria 3462
835 Ga0307412_10035677 3300031911 Bacteria 3179
836 Ga0307412_10042004 3300031911 Bacteria 2967
837 Ga0307412_10057573 3300031911 Bacteria 2595
838 Ga0307412_10472828 3300031911 Bacteria 1038
839 Ga0307409_100009742 3300031995 Bacteria 5924
840 Ga0307409_100014998 3300031995 Bacteria 5066
841 Ga0307409_100017651 3300031995 Bacteria 4765
842 Ga0307409_100017868 3300031995 Bacteria 4743
843 Ga0307409_100036606 3300031995 Bacteria 3609
844 Ga0307409_100038563 3300031995 Bacteria 3535
845 Ga0307409_100043283 3300031995 Bacteria 3379
846 Ga0307409_100066157 3300031995 Bacteria 2848
847 Ga0307409_100265762 3300031995 Bacteria 1577
848 Ga0307409_100752330 3300031995 Bacteria 978
849 Ga0307416_100001346 3300032002 Bacteria 13259
850 Ga0307416_100003759 3300032002 Bacteria 9001
851 Ga0307416_100007380 3300032002 Bacteria 6984
852 Ga0307416_100022232 3300032002 Bacteria 4573
853 Ga0307416_100025517 3300032002 Bacteria 4333
854 Ga0307416_100061624 3300032002 Bacteria 3062
855 Ga0307416_100127250 3300032002 Bacteria 2284
856 Ga0307416_100361652 3300032002 Bacteria 1474
857 Ga0307416_100471283 3300032002 Bacteria 1313
858 Ga0307416_100546634 3300032002 Bacteria 1231
859 Ga0307414_10002078 3300032004 Bacteria 10406
860 Ga0307414_10015982 3300032004 Bacteria 4548
861 Ga0307414_10179999 3300032004 Bacteria 1699
862 Ga0307414_10266904 3300032004 Bacteria 1431
863 Ga0307414_10449300 3300032004 Bacteria 1130
864 Ga0307411_10000581 3300032005 Bacteria 13068
865 Ga0307411_10069501 3300032005 Bacteria 2378
866 Ga0307411_10079257 3300032005 Bacteria 2254
867 Ga0307411_10185433 3300032005 Bacteria 1583
868 Ga0307415_100009225 3300032126 Bacteria 5514
869 Ga0307415_100013459 3300032126 Bacteria 4776
870 Ga0307415_100030103 3300032126 Bacteria 3478
871 Ga0307415_100050422 3300032126 Bacteria 2820
872 Ga0307415_100079490 3300032126 Bacteria 2336
873 Ga0316583_10088994 3300032133 Bacteria 1077
874 Ga0373959_0009856 3300034820 Bacteria 1658
875 Ga0373938_0004068 3300034957 Bacteria 2421
876 Ga0373926_0008122 3300035083 Bacteria 3496
877 Ga0373934_0008664 3300035086 Bacteria 3795
878 Ga0373944_0002092 3300035089 Bacteria 5069
879 Ga0373923_0002649 3300035111 Bacteria 5561
880 Ga0373932_0035277 3300035112 Bacteria 1414
881 Ga0373936_0048820 3300035113 Bacteria 1709
882 Ga0373941_0005211 3300035115 Bacteria 3045
883 Ga0373941_0066177 3300035115 Bacteria 1188
884 Ga0373945_0003771 3300035116 Bacteria 4785
885 Ga0373956_0000268 3300035119 Bacteria 20838
886 Ga0373957_0001328 3300035120 Bacteria 6647
887 Ga0373943_0018325 3300035170 Bacteria 3214
888 Ga0373943_0139404 3300035170 Bacteria 1305
889 Ga0373946_0001250 3300035171 Bacteria 8791
890 Ga0373946_0099228 3300035171 Bacteria 1303
891 Ga0373946_0209542 3300035171 Bacteria 937
892 Ga0373955_0000375 3300035172 Bacteria 18828
893 Ga0373955_0042312 3300035172 Bacteria 2445
894 Ga0373942_0004857 3300035207 Bacteria 3118
895 Ga0373961_0162862 3300035241 Bacteria 767
896 Ga0316574_0014342 3300035398 Bacteria 4578
897 Ga0373924_0001315 3300035410 Bacteria 7984
898 Ga0373924_0151529 3300035410 Bacteria 1014
899 Ga0373931_0005639 3300035691 Bacteria 5809
900 Ga0373931_0049888 3300035691 Bacteria 2225
901 Ga0373931_0091723 3300035691 Bacteria 1694
902 Ga0373935_0046960 3300035692 Bacteria 2728
903 Ga0373935_0104024 3300035692 Bacteria 1876
904 Ga0373935_0114251 3300035692 Bacteria 1796
905 Ga0373927_0001403 3300035695 Bacteria 18157
906 Ga0373927_0016654 3300035695 Bacteria 4849
907 Ga0373933_0000048 3300035724 Bacteria 74138
908 Ga0373933_0005244 3300035724 Bacteria 7066
909 Ga0373947_0159061 3300035725 Bacteria 1460
910 Ga0373937_0000329 3300036401 Bacteria 45063
911 Ga0373937_0001127 3300036401 Bacteria 22481
912 Ga0373937_0447607 3300036401 Bacteria 1226
913 Ga0373925_0000764 3300037068 Bacteria 29537
914 Ga0395899_0020501 3300037312 Bacteria 5011
915 Ga0395900_0020640 3300037418 Bacteria 6731
916 Ga0395898_0042905 3300037466 Bacteria 4460
917 Ga0395905_0038021 3300037471 Bacteria 4515
918 Ga0395905_0468040 3300037471 Bacteria 1159
919 Ga0395905_0656178 3300037471 Bacteria 951
920 Ga0436364_1235499 3300037853 Bacteria 1029
921 Ga0395901_0012864 3300038443 Bacteria 8487
922 Ga0436365_1243926 3300039437 Bacteria 4969
923 Ga0439448_0079057 3300042005 Bacteria 1103
924 Ga0439446_0042563 3300042156 Bacteria 1340
925 Ga0439434_0069709 3300042435 Bacteria 1106
926 Ga0439464_0014277 3300042439 Bacteria 2134
927 Ga0451577_0000109 3300042876 Bacteria 183296
928 Ga0451577_0002556 3300042876 Bacteria 21471
929 Ga0451577_0016505 3300042876 Bacteria 6837
930 Ga0451577_0019993 3300042876 Bacteria 6150
931 Ga0451577_0030104 3300042876 Bacteria 4905
932 Ga0451577_0036278 3300042876 Bacteria 4438
933 Ga0451577_0046106 3300042876 Bacteria 3900
934 Ga0451577_0442633 3300042876 Bacteria 1180
935 Ga0451577_0543424 3300042876 Bacteria 1055
936 Ga0451577_0903633 3300042876 Bacteria 795
937 Ga0453683_0004121 3300044673 Bacteria 10442
938 Ga0453683_0004688 3300044673 Bacteria 9646
939 Ga0453683_0018303 3300044673 Bacteria 4498
940 Ga0453683_0033313 3300044673 Bacteria 3249
941 Ga0466966_0031866 3300044684 Bacteria 3419
942 Ga0466966_0063642 3300044684 Bacteria 2324
943 Ga0466961_0017713 3300044693 Bacteria 4577
944 Ga0466961_0091207 3300044693 Bacteria 1924
945 Ga0466963_0194703 3300044694 Bacteria 1417
946 Ga0466963_0224894 3300044694 Bacteria 1315
947 Ga0453684_0000004 3300044712 Bacteria 1469893
948 Ga0453684_0000332 3300044712 Bacteria 197651
949 Ga0453684_0028563 3300044712 Bacteria 7954
950 Ga0453684_0089547 3300044712 Bacteria 3805
951 Ga0453684_0251225 3300044712 Bacteria 2030
952 Ga0453684_0375474 3300044712 Bacteria 1597
953 Ga0466959_0016555 3300045049 Bacteria 5390
954 Ga0466959_0129847 3300045049 Bacteria 1786
955 Ga0451576_0185451 3300045051 Bacteria 2173
956 Ga0451576_0241660 3300045051 Bacteria 1886
957 Ga0466967_0063446 3300045976 Bacteria 3283
958 Ga0466967_0266377 3300045976 Bacteria 1640
959 Ga0495592_0004119 3300046454 Bacteria 10583
960 Ga0495603_0000562 3300046455 Bacteria 20800
961 Ga0495590_0059664 3300046457 Bacteria 1335
962 Ga0495629_0035680 3300046459 Bacteria 3514
963 Ga0495629_0043348 3300046459 Bacteria 3159
964 Ga0495629_0057124 3300046459 Bacteria 2729
965 Ga0495629_0072958 3300046459 Bacteria 2397
966 Ga0495651_0000222 3300046462 Bacteria 43370
967 Ga0495651_0090723 3300046462 Bacteria 2292
968 Ga0495651_0095693 3300046462 Bacteria 2220
969 Ga0495653_0000050 3300046463 Bacteria 106233
970 Ga0495653_0048621 3300046463 Bacteria 3273
971 Ga0495653_0066752 3300046463 Bacteria 2705
972 Ga0495580_0024389 3300046472 Bacteria 4428
973 Ga0495580_0043293 3300046472 Bacteria 3204
974 Ga0495580_0045913 3300046472 Bacteria 3101
975 Ga0495580_0162776 3300046472 Bacteria 1544
976 Ga0495582_0015133 3300046473 Bacteria 4244
977 Ga0495582_0045460 3300046473 Bacteria 2418
978 Ga0495582_0145889 3300046473 Bacteria 1342
979 Ga0495639_0007465 3300046475 Bacteria 4693
980 Ga0495639_0012626 3300046475 Bacteria 3644
981 Ga0495639_0026325 3300046475 Bacteria 2570
982 Ga0495639_0063738 3300046475 Bacteria 1693
983 Ga0495662_0258621 3300046476 Bacteria 857
984 Ga0495664_0019327 3300046477 Bacteria 3916
985 Ga0495584_0092214 3300046491 Bacteria 1528
986 Ga0495594_0013448 3300046499 Bacteria 4275
987 Ga0495594_0026158 3300046499 Bacteria 3138
988 Ga0495594_0039069 3300046499 Bacteria 2593
989 Ga0495608_0000073 3300046511 Bacteria 76724
990 Ga0495618_0007472 3300046514 Bacteria 6611
991 Ga0495618_0034019 3300046514 Bacteria 3195
992 Ga0495618_0092929 3300046514 Bacteria 1929
993 Ga0495628_0000157 3300046516 Bacteria 59167
994 Ga0495628_0009614 3300046516 Bacteria 8250
995 Ga0495628_0081157 3300046516 Bacteria 2519
996 Ga0495628_0149156 3300046516 Bacteria 1782
997 Ga0495630_0001130 3300046517 Bacteria 18408
998 Ga0495630_0007186 3300046517 Bacteria 7937
999 Ga0495630_0010823 3300046517 Bacteria 6588
1000 Ga0495630_0056237 3300046517 Bacteria 2948
1001 Ga0495630_0372006 3300046517 Bacteria 1094
1002 Ga0495666_0030573 3300046526 Bacteria 2642
1003 Ga0495652_0001178 3300046529 Bacteria 29436
1004 Ga0495652_0063127 3300046529 Bacteria 3120
1005 Ga0495652_0074609 3300046529 Bacteria 2820
1006 Ga0495665_0000137 3300046531 Bacteria 35494
1007 Ga0495640_0025343 3300046533 Bacteria 4304
1008 Ga0495640_0096528 3300046533 Bacteria 1945
1009 Ga0495640_0142602 3300046533 Bacteria 1544
1010 Ga0495586_0008259 3300046535 Bacteria 5542
1011 Ga0495586_0022426 3300046535 Bacteria 3369
1012 Ga0495586_0355736 3300046535 Bacteria 841
1013 Ga0495587_0006400 3300046536 Bacteria 7682
1014 Ga0495587_0009570 3300046536 Bacteria 6203
1015 Ga0495587_0051602 3300046536 Bacteria 2431
1016 Ga0495645_0000299 3300046543 Bacteria 36039
1017 Ga0495645_0056876 3300046543 Bacteria 2840
1018 Ga0495622_0032590 3300046557 Bacteria 2433
1019 Ga0495667_0000191 3300046559 Bacteria 41960
1020 Ga0495667_0000474 3300046559 Bacteria 25533
1021 Ga0495667_0024916 3300046559 Bacteria 4031
1022 Ga0495667_0105862 3300046559 Bacteria 1818
1023 Ga0495634_0003518 3300046642 Bacteria 12547
1024 Ga0495634_0069995 3300046642 Bacteria 2313
1025 Ga0495634_0079444 3300046642 Bacteria 2148
1026 Ga0495635_0000066 3300046663 Bacteria 64707
1027 Ga0495659_0026699 3300046664 Bacteria 1987
1028 Ga0495588_0000380 3300046674 Bacteria 25738
1029 Ga0495588_0179956 3300046674 Bacteria 1117
1030 Ga0495657_0000053 3300046675 Bacteria 100979
1031 Ga0495657_0023972 3300046675 Bacteria 4353
1032 Ga0495657_0110165 3300046675 Bacteria 1745
1033 Ga0495599_0001415 3300046678 Bacteria 13735
1034 Ga0495599_0067049 3300046678 Bacteria 2242
1035 Ga0495623_0008532 3300046679 Bacteria 6654
1036 Ga0495623_0030521 3300046679 Bacteria 3467
1037 Ga0495623_0106385 3300046679 Bacteria 1704
1038 Ga0495646_0061751 3300046680 Bacteria 2230
1039 Ga0495658_0000248 3300046683 Bacteria 30893
1040 Ga0495658_0037138 3300046683 Bacteria 2691
1041 Ga0495658_0420752 3300046683 Bacteria 852
1042 Ga0495669_0207308 3300046684 Bacteria 938
1043 Ga0495613_0005336 3300046689 Bacteria 9655
1044 Ga0495613_0252590 3300046689 Bacteria 1230
1045 Ga0495613_0428717 3300046689 Bacteria 899
1046 Ga0495600_0000032 3300046809 Bacteria 85490
1047 Ga0495600_0128800 3300046809 Bacteria 1645
1048 Ga0495581_0109486 3300047315 Bacteria 1606
1049 Ga0495581_0231317 3300047315 Bacteria 1081
1050 Ga0495604_0000051 3300047317 Bacteria 103371
1051 Ga0495604_0150251 3300047317 Bacteria 1656
1052 Ga0495604_0247428 3300047317 Bacteria 1217
1053 Ga0495674_0001207 3300047319 Bacteria 25026
1054 Ga0495674_0052030 3300047319 Bacteria 3607
1055 Ga0495674_0343802 3300047319 Bacteria 1212
1056 Ga0495674_0442411 3300047319 Bacteria 1045
1057 Ga0495672_0008073 3300047320 Bacteria 7820
1058 Ga0495676_0070292 3300047321 Bacteria 2697
1059 Ga0495680_0009004 3300047322 Bacteria 9018
1060 Ga0495680_0042807 3300047322 Bacteria 3590
1061 Ga0495675_0000665 3300047444 Bacteria 21641
1062 Ga0495675_0192954 3300047444 Bacteria 1242
1063 Ga0495675_0248445 3300047444 Bacteria 1069
1064 Ga0495684_0000062 3300047471 Bacteria 73594
1065 Ga0495684_0045674 3300047471 Bacteria 3352
1066 Ga0495684_0074382 3300047471 Bacteria 2581
1067 Ga0495684_0118463 3300047471 Bacteria 1995
1068 Ga0495593_0000178 3300047673 Bacteria 32900
1069 Ga0495593_0027113 3300047673 Bacteria 3156
1070 Ga0495602_0000245 3300048088 Bacteria 50884
1071 Ga0495602_0092586 3300048088 Bacteria 2503
1072 Ga0495602_0149486 3300048088 Bacteria 1838
1073 Ga0495614_0081774 3300048089 Bacteria 1400
1074 Ga0496101_0013792 3300048904 Bacteria 5423
1075 Ga0496101_0287845 3300048904 Bacteria 1285
1076 Ga0496102_0603960 3300048905 Bacteria 1020
1077 Ga0496103_0205936 3300048906 Bacteria 1265
1078 Ga0496104_0359636 3300048907 Bacteria 1368
1079 Ga0496106_0058641 3300048909 Bacteria 2915
1080 Ga0496106_0060003 3300048909 Bacteria 2883
1081 Ga0496109_0011584 3300048912 Bacteria 7588
1082 Ga0496110_0028643 3300048913 Bacteria 4786
1083 Ga0496111_0058359 3300048914 Bacteria 2794
1084 Ga0496112_0000381 3300048915 Bacteria 29095
1085 Ga0496112_0000949 3300048915 Bacteria 21056
1086 Ga0496112_0002076 3300048915 Bacteria 15887
1087 Ga0496112_0070381 3300048915 Bacteria 3457
1088 Ga0496112_0457270 3300048915 Bacteria 1214
1089 Ga0496113_0016907 3300048916 Bacteria 5050
1090 Ga0496114_0068395 3300048917 Bacteria 2982
1091 Ga0501031_0031047 3300049568 Bacteria 3487
1092 Ga0501031_0235300 3300049568 Bacteria 1191
1093 Ga0501034_0043443 3300049571 Bacteria 4548
1094 Ga0501034_0217737 3300049571 Bacteria 1863
1095 Ga0501034_0326280 3300049571 Bacteria 1467
1096 Ga0501036_0227478 3300049572 Bacteria 1566
1097 Ga0501037_0355057 3300049573 Bacteria 1011
1098 Ga0501038_0344403 3300049574 Bacteria 1162
1099 Ga0501039_0038893 3300049575 Bacteria 3674
1100 Ga0501039_0612719 3300049575 Bacteria 853
1101 Ga0501040_0006397 3300049576 Bacteria 7649
1102 Ga0501040_0110094 3300049576 Bacteria 1926
1103 Ga0501040_0141672 3300049576 Bacteria 1694
1104 Ga0501040_0253895 3300049576 Bacteria 1254
1105 Ga0501041_0180991 3300049577 Bacteria 1319
1106 Ga0501041_0333902 3300049577 Bacteria 957
1107 Ga0501046_0199679 3300049580 Bacteria 1488
1108 Ga0501046_0310223 3300049580 Bacteria 1151
1109 Ga0501048_0110052 3300049582 Bacteria 1945
1110 Ga0501048_0200132 3300049582 Bacteria 1416
1111 Ga0501068_0123917 3300049584 Bacteria 1613
1112 Ga0501069_0038928 3300049585 Bacteria 2625
1113 Ga0501069_0324404 3300049585 Bacteria 905
1114 Ga0501070_0642972 3300049586 Bacteria 843
1115 Ga0501071_0370429 3300049587 Bacteria 1091
1116 Ga0501072_0012568 3300049588 Bacteria 6471
1117 Ga0501072_0132326 3300049588 Bacteria 1988
1118 Ga0501072_0442603 3300049588 Bacteria 1029
1119 Ga0501072_0481520 3300049588 Bacteria 982
1120 Ga0501074_0162757 3300049590 Bacteria 1593
1121 Ga0501075_0004754 3300049591 Bacteria 9232
1122 Ga0501075_0134637 3300049591 Bacteria 1882
1123 Ga0501075_0239470 3300049591 Bacteria 1383
1124 Ga0501076_0083749 3300049592 Bacteria 2561
1125 Ga0501076_0105901 3300049592 Bacteria 2270
1126 Ga0501076_0199529 3300049592 Bacteria 1633
1127 Ga0501076_0332238 3300049592 Bacteria 1247
1128 Ga0501077_0025512 3300049593 Bacteria 3753
1129 Ga0501077_0086085 3300049593 Bacteria 1992
1130 Ga0501202_007952 3300049652 Bacteria 1926
1131 Ga0501207_004020 3300049654 Bacteria 1986
1132 Ga0501209_000108 3300049656 Bacteria 8554
1133 Ga0501217_011639 3300049661 Bacteria 1950
1134 Ga0501217_021028 3300049661 Bacteria 1538
1135 Ga0501222_008998 3300049662 Bacteria 1322
1136 Ga0501224_001565 3300049664 Bacteria 3054
1137 Ga0501235_000604 3300049669 Bacteria 7242
1138 Ga0501235_002665 3300049669 Bacteria 3842
1139 Ga0501239_010467 3300049672 Bacteria 1023
1140 Ga0501247_000137 3300049677 Bacteria 4349
1141 Ga0501247_004167 3300049677 Bacteria 1572
1142 Ga0501249_038625 3300049679 Bacteria 1078
1143 Ga0501251_001500 3300049681 Bacteria 2188
1144 Ga0501253_001444 3300049683 Bacteria 2426
1145 Ga0501257_012144 3300049686 Bacteria 1969
1146 Ga0501221_000448 3300049704 Bacteria 6413
1147 Ga0501225_0000914 3300049705 Bacteria 9208
1148 Ga0501234_001489 3300049707 Bacteria 3682
1149 Ga0501079_0088003 3300049741 Bacteria 2405
1150 Ga0501079_0128417 3300049741 Bacteria 1972
1151 Ga0501079_0142060 3300049741 Bacteria 1870
1152 Ga0501079_0149253 3300049741 Bacteria 1822
1153 Ga0501079_0219181 3300049741 Bacteria 1486
1154 Ga0501080_0133787 3300049742 Bacteria 2295
1155 Ga0501080_0224474 3300049742 Bacteria 1718
1156 Ga0501080_0311000 3300049742 Bacteria 1428
1157 Ga0501080_0356272 3300049742 Bacteria 1320
1158 Ga0501081_0080724 3300049743 Bacteria 2277
1159 Ga0501081_0153786 3300049743 Bacteria 1654
1160 Ga0501081_0154574 3300049743 Bacteria 1650
1161 Ga0501081_0355385 3300049743 Bacteria 1080
1162 Ga0501081_0393903 3300049743 Bacteria 1025
1163 Ga0501081_0429260 3300049743 Bacteria 980
1164 Ga0501083_0026838 3300049744 Bacteria 3979
1165 Ga0501083_0150612 3300049744 Bacteria 1523
1166 Ga0501263_001639 3300049760 Bacteria 2152
1167 Ga0501268_000040 3300049765 Bacteria 10532
1168 Ga0501268_004967 3300049765 Bacteria 1893
1169 Ga0501268_006723 3300049765 Bacteria 1697
1170 Ga0501271_002072 3300049768 Bacteria 1763
1171 Ga0501283_005510 3300049779 Bacteria 1743
1172 Ga0501035_0038522 3300049822 Bacteria 4328
1173 Ga0501045_0023179 3300049824 Bacteria 4448
1174 Ga0501045_0043259 3300049824 Bacteria 3279
1175 Ga0501045_0149673 3300049824 Bacteria 1736
1176 Ga0501045_0191513 3300049824 Bacteria 1524
1177 Ga0501045_0355430 3300049824 Bacteria 1090
1178 nmdc:mga05p37_155774_c1 3300050507 Bacteria 2792
1179 nmdc:mga05p37_19421_c1 3300050507 Bacteria 8222
1180 nmdc:mga05p37_197905_c1 3300050507 Bacteria 2436
1181 nmdc:mga05p37_3197_c1 3300050507 Bacteria 19063
1182 nmdc:mga05p37_745005_c1 3300050507 Bacteria 1081
1183 nmdc:mga09592_1886_c1 3300050508 Bacteria 16873
1184 nmdc:mga09592_289427_c1 3300050508 Bacteria 1420
1185 nmdc:mga09592_35193_c1 3300050508 Bacteria 4191
1186 nmdc:mga09592_3549_c1 3300050508 Bacteria 12593
1187 nmdc:mga0qj67_176711_c1 3300050509 Bacteria 1734
1188 nmdc:mga0qj67_2646_c1 3300050509 Bacteria 12830
1189 nmdc:mga0qj67_311979_c1 3300050509 Bacteria 1273
1190 nmdc:mga0qj67_477509_c1 3300050509 Bacteria 1003
1191 nmdc:mga0qj67_5249_c1 3300050509 Bacteria 9447
1192 nmdc:mga0qj67_77733_c1 3300050509 Bacteria 2655
1193 nmdc:mga06r32_390614_c1 3300050510 Bacteria 1374
1194 nmdc:mga06r32_449882_c1 3300050510 Bacteria 1267
1195 nmdc:mga06r32_5005_c1 3300050510 Bacteria 11930
1196 nmdc:mga06r32_52114_c1 3300050510 Bacteria 3918
1197 nmdc:mga06r32_53042_c1 3300050510 Bacteria 3884
1198 nmdc:mga06r32_80042_c1 3300050510 Bacteria 3179
1199 nmdc:mga06r32_973687_c1 3300050510 Bacteria 802
1200 nmdc:mga08y16_1009160_c1 3300050511 Bacteria 812
1201 nmdc:mga08y16_41046_c1 3300050511 Bacteria 4847
1202 nmdc:mga08y16_507848_c1 3300050511 Bacteria 1224
1203 nmdc:mga08y16_56258_c1 3300050511 Bacteria 4112
1204 nmdc:mga0n895_106819_c1 3300050512 Bacteria 2813
1205 nmdc:mga0n895_14834_c1 3300050512 Bacteria 7091
1206 nmdc:mga0n895_21058_c1 3300050512 Bacteria 6093
1207 nmdc:mga0n895_295342_c1 3300050512 Bacteria 1643
1208 nmdc:mga0n895_330294_c1 3300050512 Bacteria 1545
1209 nmdc:mga0n895_468062_c1 3300050512 Bacteria 1272
1210 nmdc:mga0n895_61534_c1 3300050512 Bacteria 3707
1211 nmdc:mga0n895_63991_c1 3300050512 Bacteria 3638
1212 nmdc:mga0n895_854_c1 3300050512 Bacteria 21915
1213 nmdc:mga0rr50_13705_c1 3300050513 Bacteria 5290
1214 nmdc:mga0rr50_187707_c1 3300050513 Bacteria 1693
1215 nmdc:mga0rr50_209070_c1 3300050513 Bacteria 1607
1216 nmdc:mga0rr50_315618_c1 3300050513 Bacteria 1310
1217 nmdc:mga0rr50_48114_c1 3300050513 Bacteria 3151
1218 nmdc:mga0rr50_562803_c1 3300050513 Bacteria 971
1219 nmdc:mga0rr50_578522_c1 3300050513 Bacteria 957
1220 nmdc:mga08x19_100260_c1 3300050514 Bacteria 1921
1221 nmdc:mga08x19_10886_c1 3300050514 Bacteria 5470
1222 nmdc:mga08x19_1110_c1 3300050514 Bacteria 16781
1223 nmdc:mga08x19_14485_c1 3300050514 Bacteria 4782
1224 nmdc:mga08x19_3198_c1 3300050514 Bacteria 9822
1225 nmdc:mga08x19_33583_c1 3300050514 Bacteria 3238
1226 nmdc:mga08x19_5006_c1 3300050514 Bacteria 7834
1227 nmdc:mga08x19_52021_c1 3300050514 Bacteria 2633
1228 nmdc:mga08x19_5823_c1 3300050514 Bacteria 7290
1229 nmdc:mga08x19_85603_c1 3300050514 Bacteria 2074
1230 nmdc:mga0a205_110082_c1 3300050515 Bacteria 2653
1231 nmdc:mga0a205_14260_c1 3300050515 Bacteria 7410
1232 nmdc:mga0a205_23409_c1 3300050515 Bacteria 5859
1233 nmdc:mga0a205_23798_c1 3300050515 Bacteria 5813
1234 nmdc:mga0a205_26058_c1 3300050515 Bacteria 5571
1235 nmdc:mga0a205_5039_c1 3300050515 Bacteria 11897
1236 Ga0495601_0002779 3300053077 Bacteria 9940
1237 Ga0495601_0108896 3300053077 Bacteria 1793
1238 Ga0495612_0000406 3300053078 Bacteria 17258
1239 Ga0495619_0002199 3300053085 Bacteria 12920
1240 Ga0495619_0104008 3300053085 Bacteria 1935
1241 Ga0500583_0099532 3300053092 Bacteria 1423
1242 Ga0501084_0132798 3300054114 Bacteria 2096
1243 Ga0501084_0208731 3300054114 Bacteria 1648
1244 Ga0501084_0238060 3300054114 Bacteria 1536
1245 Ga0501084_0444570 3300054114 Bacteria 1096
1246 Ga0501082_0061213 3300060353 Bacteria 3241
1247 Ga0501082_0497858 3300060353 Bacteria 1065
1248 Ga0501082_0500934 3300060353 Bacteria 1061
1249 Ga0530510_0000078 3300061734 Bacteria 50426
1250 Ga0530510_0109000 3300061734 Bacteria 2027
1251 Ga0530510_0521225 3300061734 Bacteria 902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005615 Ga0070702_100173395 Ga0070702_1001733952 220
2 3300009098 Ga0105245_10124898 Ga0105245_101248983 220
3 3300005458 Ga0070681_10001292 Ga0070681_1000129222 221
4 3300005530 Ga0070679_100000608 Ga0070679_10000060828 221
5 3300009147 Ga0114129_10199495 Ga0114129_101994952 221
6 3300013307 Ga0157372_10299974 Ga0157372_102999743 221
7 3300025912 Ga0207707_10011141 Ga0207707_100111416 221
8 3300025917 Ga0207660_10003331 Ga0207660_100033319 221
9 3300025932 Ga0207690_10012137 Ga0207690_100121373 221
10 3300025933 Ga0207706_10542116 Ga0207706_105421161 221
11 3300034957 Ga0373938_0004068 Ga0373938_0004068_1135_1809 221
12 3300035115 Ga0373941_0005211 Ga0373941_0005211_1606_2280 221
13 3300035241 Ga0373961_0162862 Ga0373961_0162862_40_714 221
14 3300035691 Ga0373931_0049888 Ga0373931_0049888_1069_1743 221
15 3300050512 nmdc:mga0n895_106819_c1 nmdc:mga0n895_106819_c1_2097_2771 221
16 3300050515 nmdc:mga0a205_5039_c1 nmdc:mga0a205_5039_c1_4782_5456 221
17 3300047319 Ga0495674_0442411 Ga0495674_0442411_11_685 223
18 3300045976 Ga0466967_0266377 Ga0466967_0266377_941_1615 224
19 3300046689 Ga0495613_0428717 Ga0495613_0428717_186_860 224
20 3300049574 Ga0501038_0344403 Ga0501038_0344403_35_712 224
21 3300050510 nmdc:mga06r32_973687_c1 nmdc:mga06r32_973687_c1_41_739 224
22 3300050511 nmdc:mga08y16_1009160_c1 nmdc:mga08y16_1009160_c1_93_767 224
23 3300013100 Ga0157373_10053152 Ga0157373_100531522 225
24 3300054114 Ga0501084_0132798 Ga0501084_0132798_1406_2083 225
25 3300048906 Ga0496103_0205936 Ga0496103_0205936_207_1010 231
26 3300048909 Ga0496106_0058641 Ga0496106_0058641_1345_2148 231
27 3300046514 Ga0495618_0092929 Ga0495618_0092929_42_791 232
28 3300032002 Ga0307416_100546634 Ga0307416_1005466342 233
29 3300049576 Ga0501040_0110094 Ga0501040_0110094_20_724 234
30 3300046476 Ga0495662_0258621 Ga0495662_0258621_132_845 237
31 3300005347 Ga0070668_100093855 Ga0070668_1000938552 238
32 3300005364 Ga0070673_100008731 Ga0070673_1000087317 238
33 3300005543 Ga0070672_100085773 Ga0070672_1000857732 238
34 3300013308 Ga0157375_10605034 Ga0157375_106050342 238
35 3300025940 Ga0207691_10092668 Ga0207691_100926682 238
36 3300025960 Ga0207651_10376597 Ga0207651_103765972 238
37 3300005327 Ga0070658_10054442 Ga0070658_100544422 239
38 3300005329 Ga0070683_100239943 Ga0070683_1002399432 239
39 3300005366 Ga0070659_100027964 Ga0070659_1000279644 239
40 3300025909 Ga0207705_10243867 Ga0207705_102438672 239
41 3300025932 Ga0207690_10208006 Ga0207690_102080062 239
42 3300025944 Ga0207661_10199567 Ga0207661_101995672 239
43 3300031995 Ga0307409_100066157 Ga0307409_1000661572 239
44 3300032004 Ga0307414_10266904 Ga0307414_102669042 239
45 3300049656 Ga0501209_000108 Ga0501209_000108_3685_4455 239
46 3300049669 Ga0501235_002665 Ga0501235_002665_2174_2944 239
47 3300049677 Ga0501247_000137 Ga0501247_000137_69_839 239
48 3300049679 Ga0501249_038625 Ga0501249_038625_12_782 239
49 3300049683 Ga0501253_001444 Ga0501253_001444_12_782 239
50 3300049765 Ga0501268_006723 Ga0501268_006723_903_1673 239
51 3300049768 Ga0501271_002072 Ga0501271_002072_57_827 239
52 3300044673 Ga0453683_0033313 Ga0453683_0033313_252_1007 240
53 3300049586 Ga0501070_0642972 Ga0501070_0642972_31_768 242
54 3300005336 Ga0070680_100006270 Ga0070680_1000062702 243
55 3300005366 Ga0070659_100030146 Ga0070659_1000301461 243
56 3300005435 Ga0070714_100013494 Ga0070714_1000134942 243
57 3300005530 Ga0070679_100016503 Ga0070679_1000165031 243
58 3300005578 Ga0068854_100034250 Ga0068854_1000342502 243
59 3300005616 Ga0068852_100055286 Ga0068852_1000552862 243
60 3300009551 Ga0105238_10027590 Ga0105238_100275903 243
61 3300013104 Ga0157370_10050227 Ga0157370_100502273 243
62 3300025913 Ga0207695_10261986 Ga0207695_102619861 243
63 3300025917 Ga0207660_10140630 Ga0207660_101406302 243
64 3300025924 Ga0207694_10019182 Ga0207694_100191825 243
65 3300025929 Ga0207664_10007050 Ga0207664_100070502 243
66 3300025981 Ga0207640_10026016 Ga0207640_100260163 243
67 3300026067 Ga0207678_10204722 Ga0207678_102047222 243
68 3300026142 Ga0207698_10015011 Ga0207698_100150112 243
69 3300061734 Ga0530510_0000078 Ga0530510_0000078_19053_19787 243
70 3300005981 Ga0081538_10050721 Ga0081538_100507212 244
71 3300049577 Ga0501041_0333902 Ga0501041_0333902_90_851 244
72 3300049588 Ga0501072_0481520 Ga0501072_0481520_116_877 244
73 3300049741 Ga0501079_0219181 Ga0501079_0219181_685_1446 244
74 3300049743 Ga0501081_0154574 Ga0501081_0154574_602_1363 244
75 3300049743 Ga0501081_0355385 Ga0501081_0355385_243_1004 244
76 3300054114 Ga0501084_0208731 Ga0501084_0208731_561_1322 244
77 3300060353 Ga0501082_0061213 Ga0501082_0061213_1736_2497 244
78 3300061734 Ga0530510_0109000 Ga0530510_0109000_327_1088 244
79 3300005329 Ga0070683_100183067 Ga0070683_1001830672 245
80 3300025944 Ga0207661_10102863 Ga0207661_101028633 245
81 3300005548 Ga0070665_100275791 Ga0070665_1002757912 246
82 3300006846 Ga0075430_100000158 Ga0075430_10000015826 246
83 3300014325 Ga0163163_10287927 Ga0163163_102879272 246
84 3300046473 Ga0495582_0045460 Ga0495582_0045460_1366_2106 246
85 3300046683 Ga0495658_0420752 Ga0495658_0420752_44_784 246
86 3300050509 nmdc:mga0qj67_2646_c1 nmdc:mga0qj67_2646_c1_10148_10894 246
87 3300005353 Ga0070669_100008716 Ga0070669_1000087165 247
88 3300005354 Ga0070675_100136223 Ga0070675_1001362232 247
89 3300005457 Ga0070662_100175049 Ga0070662_1001750492 247
90 3300005459 Ga0068867_100041713 Ga0068867_1000417132 247
91 3300005468 Ga0070707_100469507 Ga0070707_1004695071 247
92 3300005518 Ga0070699_100037937 Ga0070699_1000379373 247
93 3300005518 Ga0070699_100197440 Ga0070699_1001974401 247
94 3300005564 Ga0070664_100294411 Ga0070664_1002944111 247
95 3300005577 Ga0068857_100032635 Ga0068857_1000326353 247
96 3300005719 Ga0068861_100007877 Ga0068861_1000078772 247
97 3300005844 Ga0068862_100012176 Ga0068862_1000121765 247
98 3300006846 Ga0075430_100048026 Ga0075430_1000480262 247
99 3300006846 Ga0075430_100164489 Ga0075430_1001644893 247
100 3300006880 Ga0075429_100041536 Ga0075429_1000415363 247
101 3300009147 Ga0114129_10693858 Ga0114129_106938581 247
102 3300009148 Ga0105243_10334871 Ga0105243_103348711 247
103 3300009553 Ga0105249_10022608 Ga0105249_100226083 247
104 3300013308 Ga0157375_10088177 Ga0157375_100881773 247
105 3300025922 Ga0207646_10181255 Ga0207646_101812552 247
106 3300025940 Ga0207691_10016019 Ga0207691_100160193 247
107 3300025945 Ga0207679_10115300 Ga0207679_101153002 247
108 3300025960 Ga0207651_10589569 Ga0207651_105895692 247
109 3300044673 Ga0453683_0004688 Ga0453683_0004688_6198_6977 247
110 3300050507 nmdc:mga05p37_745005_c1 nmdc:mga05p37_745005_c1_311_1057 247
111 3300050508 nmdc:mga09592_289427_c1 nmdc:mga09592_289427_c1_170_916 247
112 3300050509 nmdc:mga0qj67_5249_c1 nmdc:mga0qj67_5249_c1_4966_5718 247
113 3300005327 Ga0070658_10035350 Ga0070658_100353502 248
114 3300005329 Ga0070683_100040754 Ga0070683_1000407544 248
115 3300005336 Ga0070680_100027460 Ga0070680_1000274603 248
116 3300005339 Ga0070660_100058628 Ga0070660_1000586282 248
117 3300005339 Ga0070660_100174291 Ga0070660_1001742912 248
118 3300005341 Ga0070691_10029397 Ga0070691_100293972 248
119 3300005344 Ga0070661_100029581 Ga0070661_1000295813 248
120 3300005344 Ga0070661_100111778 Ga0070661_1001117781 248
121 3300005366 Ga0070659_100042432 Ga0070659_1000424322 248
122 3300005435 Ga0070714_100034277 Ga0070714_1000342772 248
123 3300005530 Ga0070679_100047770 Ga0070679_1000477702 248
124 3300005546 Ga0070696_100145231 Ga0070696_1001452312 248
125 3300005614 Ga0068856_100055886 Ga0068856_1000558863 248
126 3300005616 Ga0068852_100009676 Ga0068852_1000096763 248
127 3300006871 Ga0075434_100127769 Ga0075434_1001277692 248
128 3300009093 Ga0105240_10190189 Ga0105240_101901892 248
129 3300009174 Ga0105241_10000019 Ga0105241_1000001947 248
130 3300009545 Ga0105237_10036092 Ga0105237_100360924 248
131 3300009551 Ga0105238_10013049 Ga0105238_100130499 248
132 3300009551 Ga0105238_10711097 Ga0105238_107110972 248
133 3300013102 Ga0157371_10074288 Ga0157371_100742882 248
134 3300013104 Ga0157370_10112049 Ga0157370_101120492 248
135 3300013105 Ga0157369_10108231 Ga0157369_101082312 248
136 3300013307 Ga0157372_10046586 Ga0157372_100465865 248
137 3300013307 Ga0157372_10695174 Ga0157372_106951742 248
138 3300025908 Ga0207643_10060545 Ga0207643_100605452 248
139 3300025909 Ga0207705_10029338 Ga0207705_100293383 248
140 3300025911 Ga0207654_10000962 Ga0207654_100009626 248
141 3300025913 Ga0207695_10564740 Ga0207695_105647401 248
142 3300025919 Ga0207657_10007417 Ga0207657_1000741712 248
143 3300025919 Ga0207657_10017181 Ga0207657_100171816 248
144 3300025919 Ga0207657_10355490 Ga0207657_103554902 248
145 3300025920 Ga0207649_10038609 Ga0207649_100386094 248
146 3300025921 Ga0207652_10020371 Ga0207652_100203714 248
147 3300025923 Ga0207681_10020095 Ga0207681_100200952 248
148 3300025924 Ga0207694_10070725 Ga0207694_100707252 248
149 3300025929 Ga0207664_10053021 Ga0207664_100530212 248
150 3300025931 Ga0207644_10126524 Ga0207644_101265242 248
151 3300025932 Ga0207690_10129885 Ga0207690_101298852 248
152 3300025935 Ga0207709_10104043 Ga0207709_101040432 248
153 3300025944 Ga0207661_10221052 Ga0207661_102210522 248
154 3300025949 Ga0207667_10044977 Ga0207667_100449772 248
155 3300025961 Ga0207712_10003463 Ga0207712_100034638 248
156 3300025981 Ga0207640_10089997 Ga0207640_100899972 248
157 3300025986 Ga0207658_10241365 Ga0207658_102413652 248
158 3300026067 Ga0207678_10001786 Ga0207678_1000178611 248
159 3300026075 Ga0207708_10038135 Ga0207708_100381353 248
160 3300026089 Ga0207648_10140928 Ga0207648_101409282 248
161 3300026116 Ga0207674_10035181 Ga0207674_100351813 248
162 3300026118 Ga0207675_100066119 Ga0207675_1000661192 248
163 3300026142 Ga0207698_10058998 Ga0207698_100589982 248
164 3300026142 Ga0207698_10121777 Ga0207698_101217772 248
165 3300028380 Ga0268265_10096003 Ga0268265_100960032 248
166 3300031251 Ga0265327_10033503 Ga0265327_100335032 248
167 3300031711 Ga0265314_10101911 Ga0265314_101019112 248
168 3300037853 Ga0436364_1235499 Ga0436364_1235499_26_772 248
169 3300042876 Ga0451577_0903633 Ga0451577_0903633_29_778 248
170 3300044684 Ga0466966_0063642 Ga0466966_0063642_1500_2246 248
171 3300044693 Ga0466961_0017713 Ga0466961_0017713_3417_4163 248
172 3300044693 Ga0466961_0091207 Ga0466961_0091207_135_881 248
173 3300045049 Ga0466959_0016555 Ga0466959_0016555_3122_3868 248
174 3300046559 Ga0495667_0024916 Ga0495667_0024916_2791_3537 248
175 3300050511 nmdc:mga08y16_41046_c1 nmdc:mga08y16_41046_c1_2937_3704 248
176 3300053092 Ga0500583_0099532 Ga0500583_0099532_157_903 248
177 iso_pu_bacteria 2895511927 2895517961 248
178 3300005328 Ga0070676_10110410 Ga0070676_101104102 249
179 3300005366 Ga0070659_100212643 Ga0070659_1002126432 249
180 3300005468 Ga0070707_100131992 Ga0070707_1001319922 249
181 3300005518 Ga0070699_100041992 Ga0070699_1000419924 249
182 3300005518 Ga0070699_100110896 Ga0070699_1001108962 249
183 3300005563 Ga0068855_100862231 Ga0068855_1008622311 249
184 3300006846 Ga0075430_100044776 Ga0075430_1000447765 249
185 3300006880 Ga0075429_100029580 Ga0075429_1000295803 249
186 3300009093 Ga0105240_10136507 Ga0105240_101365073 249
187 3300013308 Ga0157375_10694135 Ga0157375_106941352 249
188 3300025913 Ga0207695_10170463 Ga0207695_101704632 249
189 3300025920 Ga0207649_10223509 Ga0207649_102235092 249
190 3300025922 Ga0207646_10038019 Ga0207646_100380193 249
191 3300025922 Ga0207646_10198958 Ga0207646_101989582 249
192 3300027471 Ga0209995_1001594 Ga0209995_10015942 249
193 3300027526 Ga0209968_1002268 Ga0209968_10022682 249
194 3300027543 Ga0209999_1001140 Ga0209999_10011402 249
195 3300027695 Ga0209966_1003128 Ga0209966_10031282 249
196 3300027717 Ga0209998_10000194 Ga0209998_100001941 249
197 3300031731 Ga0307405_10029235 Ga0307405_100292352 249
198 3300031824 Ga0307413_10214025 Ga0307413_102140252 249
199 3300031901 Ga0307406_10032349 Ga0307406_100323495 249
200 3300031911 Ga0307412_10029152 Ga0307412_100291524 249
201 3300031911 Ga0307412_10472828 Ga0307412_104728282 249
202 3300031995 Ga0307409_100038563 Ga0307409_1000385632 249
203 3300032002 Ga0307416_100025517 Ga0307416_1000255175 249
204 3300046463 Ga0495653_0048621 Ga0495653_0048621_1008_1757 249
205 3300046675 Ga0495657_0110165 Ga0495657_0110165_979_1728 249
206 3300047317 Ga0495604_0247428 Ga0495604_0247428_275_1024 249
207 3300049652 Ga0501202_007952 Ga0501202_007952_1016_1765 249
208 3300049654 Ga0501207_004020 Ga0501207_004020_272_1021 249
209 3300049661 Ga0501217_011639 Ga0501217_011639_200_949 249
210 3300049662 Ga0501222_008998 Ga0501222_008998_273_1022 249
211 3300049664 Ga0501224_001565 Ga0501224_001565_995_1744 249
212 3300049669 Ga0501235_000604 Ga0501235_000604_2392_3141 249
213 3300049672 Ga0501239_010467 Ga0501239_010467_93_842 249
214 3300049677 Ga0501247_004167 Ga0501247_004167_805_1554 249
215 3300049681 Ga0501251_001500 Ga0501251_001500_1123_1872 249
216 3300049686 Ga0501257_012144 Ga0501257_012144_16_765 249
217 3300049704 Ga0501221_000448 Ga0501221_000448_2735_3484 249
218 3300049705 Ga0501225_0000914 Ga0501225_0000914_4623_5372 249
219 3300049707 Ga0501234_001489 Ga0501234_001489_1681_2430 249
220 3300049760 Ga0501263_001639 Ga0501263_001639_1391_2140 249
221 3300049765 Ga0501268_000040 Ga0501268_000040_4057_4806 249
222 3300005329 Ga0070683_100022256 Ga0070683_1000222564 250
223 3300005458 Ga0070681_10275201 Ga0070681_102752012 250
224 3300005518 Ga0070699_100553093 Ga0070699_1005530932 250
225 3300005530 Ga0070679_100195433 Ga0070679_1001954332 250
226 3300014968 Ga0157379_10197600 Ga0157379_101976002 250
227 3300025944 Ga0207661_10020824 Ga0207661_100208243 250
228 3300025945 Ga0207679_10124706 Ga0207679_101247062 250
229 3300031548 Ga0307408_100061987 Ga0307408_1000619872 250
230 3300031731 Ga0307405_10004860 Ga0307405_100048604 250
231 3300031824 Ga0307413_10067889 Ga0307413_100678892 250
232 3300031852 Ga0307410_10021209 Ga0307410_100212094 250
233 3300031901 Ga0307406_10016148 Ga0307406_100161484 250
234 3300031911 Ga0307412_10035677 Ga0307412_100356774 250
235 3300031995 Ga0307409_100014998 Ga0307409_1000149985 250
236 3300032002 Ga0307416_100022232 Ga0307416_1000222323 250
237 3300032002 Ga0307416_100361652 Ga0307416_1003616522 250
238 3300032005 Ga0307411_10185433 Ga0307411_101854332 250
239 3300032126 Ga0307415_100009225 Ga0307415_1000092252 250
240 3300032126 Ga0307415_100079490 Ga0307415_1000794902 250
241 3300048904 Ga0496101_0287845 Ga0496101_0287845_251_1003 250
242 3300048905 Ga0496102_0603960 Ga0496102_0603960_141_893 250
243 3300048915 Ga0496112_0070381 Ga0496112_0070381_2199_2960 250
244 3300049568 Ga0501031_0235300 Ga0501031_0235300_223_975 250
245 3300049576 Ga0501040_0141672 Ga0501040_0141672_867_1619 250
246 3300049582 Ga0501048_0110052 Ga0501048_0110052_315_1067 250
247 3300049587 Ga0501071_0370429 Ga0501071_0370429_11_763 250
248 3300049591 Ga0501075_0134637 Ga0501075_0134637_111_863 250
249 3300049591 Ga0501075_0239470 Ga0501075_0239470_66_818 250
250 3300049592 Ga0501076_0083749 Ga0501076_0083749_985_1737 250
251 3300049592 Ga0501076_0105901 Ga0501076_0105901_818_1570 250
252 3300049741 Ga0501079_0128417 Ga0501079_0128417_1146_1898 250
253 3300049742 Ga0501080_0133787 Ga0501080_0133787_207_959 250
254 3300049742 Ga0501080_0224474 Ga0501080_0224474_30_782 250
255 3300049743 Ga0501081_0393903 Ga0501081_0393903_225_977 250
256 3300049744 Ga0501083_0150612 Ga0501083_0150612_122_874 250
257 3300049824 Ga0501045_0043259 Ga0501045_0043259_963_1715 250
258 3300049824 Ga0501045_0149673 Ga0501045_0149673_915_1667 250
259 3300061734 Ga0530510_0521225 Ga0530510_0521225_28_780 250
260 3300005293 Ga0065715_10151452 Ga0065715_101514522 251
261 3300005329 Ga0070683_100064429 Ga0070683_1000644294 251
262 3300005329 Ga0070683_100257895 Ga0070683_1002578952 251
263 3300005335 Ga0070666_10006434 Ga0070666_100064348 251
264 3300005336 Ga0070680_100008958 Ga0070680_1000089587 251
265 3300005337 Ga0070682_100000969 Ga0070682_1000009697 251
266 3300005353 Ga0070669_100087621 Ga0070669_1000876212 251
267 3300005356 Ga0070674_100000031 Ga0070674_10000003153 251
268 3300005406 Ga0070703_10014251 Ga0070703_100142512 251
269 3300005406 Ga0070703_10066636 Ga0070703_100666362 251
270 3300005434 Ga0070709_10001476 Ga0070709_100014769 251
271 3300005439 Ga0070711_100000009 Ga0070711_10000000958 251
272 3300005440 Ga0070705_100010188 Ga0070705_1000101882 251
273 3300005440 Ga0070705_100164056 Ga0070705_1001640562 251
274 3300005440 Ga0070705_100279069 Ga0070705_1002790691 251
275 3300005440 Ga0070705_100357133 Ga0070705_1003571331 251
276 3300005441 Ga0070700_100035256 Ga0070700_1000352563 251
277 3300005444 Ga0070694_100002417 Ga0070694_10000241711 251
278 3300005444 Ga0070694_100004958 Ga0070694_1000049584 251
279 3300005444 Ga0070694_100019920 Ga0070694_1000199202 251
280 3300005445 Ga0070708_100075545 Ga0070708_1000755452 251
281 3300005445 Ga0070708_100076744 Ga0070708_1000767442 251
282 3300005457 Ga0070662_100000206 Ga0070662_10000020616 251
283 3300005458 Ga0070681_10020791 Ga0070681_100207913 251
284 3300005459 Ga0068867_100000341 Ga0068867_10000034111 251
285 3300005467 Ga0070706_100109203 Ga0070706_1001092032 251
286 3300005468 Ga0070707_100222611 Ga0070707_1002226112 251
287 3300005468 Ga0070707_100321207 Ga0070707_1003212071 251
288 3300005471 Ga0070698_100001472 Ga0070698_1000014725 251
289 3300005471 Ga0070698_100350440 Ga0070698_1003504402 251
290 3300005518 Ga0070699_100022150 Ga0070699_1000221503 251
291 3300005518 Ga0070699_100029350 Ga0070699_1000293502 251
292 3300005518 Ga0070699_100102349 Ga0070699_1001023492 251
293 3300005518 Ga0070699_100102571 Ga0070699_1001025712 251
294 3300005530 Ga0070679_100007573 Ga0070679_10000757310 251
295 3300005536 Ga0070697_100140714 Ga0070697_1001407142 251
296 3300005536 Ga0070697_100260267 Ga0070697_1002602672 251
297 3300005539 Ga0068853_100004232 Ga0068853_1000042323 251
298 3300005539 Ga0068853_100530904 Ga0068853_1005309041 251
299 3300005543 Ga0070672_100179464 Ga0070672_1001794642 251
300 3300005544 Ga0070686_100004210 Ga0070686_1000042108 251
301 3300005545 Ga0070695_100006476 Ga0070695_1000064767 251
302 3300005545 Ga0070695_100007435 Ga0070695_1000074356 251
303 3300005545 Ga0070695_100036976 Ga0070695_1000369762 251
304 3300005545 Ga0070695_100069975 Ga0070695_1000699752 251
305 3300005546 Ga0070696_100003906 Ga0070696_1000039062 251
306 3300005546 Ga0070696_100006413 Ga0070696_1000064137 251
307 3300005546 Ga0070696_100008347 Ga0070696_1000083472 251
308 3300005547 Ga0070693_100019448 Ga0070693_1000194483 251
309 3300005547 Ga0070693_100208744 Ga0070693_1002087442 251
310 3300005549 Ga0070704_100000701 Ga0070704_1000007015 251
311 3300005549 Ga0070704_100091327 Ga0070704_1000913272 251
312 3300005549 Ga0070704_100363790 Ga0070704_1003637901 251
313 3300005563 Ga0068855_100056570 Ga0068855_1000565703 251
314 3300005578 Ga0068854_100007149 Ga0068854_1000071492 251
315 3300005616 Ga0068852_100596017 Ga0068852_1005960172 251
316 3300005617 Ga0068859_100319717 Ga0068859_1003197172 251
317 3300005718 Ga0068866_10000048 Ga0068866_1000004830 251
318 3300005719 Ga0068861_100009043 Ga0068861_1000090436 251
319 3300005842 Ga0068858_100021966 Ga0068858_1000219667 251
320 3300005843 Ga0068860_100151385 Ga0068860_1001513852 251
321 3300005844 Ga0068862_100010499 Ga0068862_1000104993 251
322 3300006173 Ga0070716_100084807 Ga0070716_1000848072 251
323 3300006175 Ga0070712_100043380 Ga0070712_1000433802 251
324 3300006358 Ga0068871_100220782 Ga0068871_1002207822 251
325 3300006844 Ga0075428_100002193 Ga0075428_1000021938 251
326 3300006846 Ga0075430_100013207 Ga0075430_1000132074 251
327 3300006846 Ga0075430_100427800 Ga0075430_1004278002 251
328 3300006847 Ga0075431_100060004 Ga0075431_1000600042 251
329 3300006847 Ga0075431_100089007 Ga0075431_1000890072 251
330 3300006847 Ga0075431_100726340 Ga0075431_1007263402 251
331 3300006852 Ga0075433_10087845 Ga0075433_100878452 251
332 3300006852 Ga0075433_10380246 Ga0075433_103802462 251
333 3300006871 Ga0075434_100001890 Ga0075434_1000018902 251
334 3300006881 Ga0068865_100001170 Ga0068865_1000011709 251
335 3300006914 Ga0075436_100011722 Ga0075436_1000117222 251
336 3300006914 Ga0075436_100035435 Ga0075436_1000354353 251
337 3300006914 Ga0075436_100049244 Ga0075436_1000492443 251
338 3300006914 Ga0075436_100062488 Ga0075436_1000624883 251
339 3300006914 Ga0075436_100070933 Ga0075436_1000709332 251
340 3300006914 Ga0075436_100147524 Ga0075436_1001475242 251
341 3300006914 Ga0075436_100488417 Ga0075436_1004884171 251
342 3300006931 Ga0097620_100319733 Ga0097620_1003197332 251
343 3300007076 Ga0075435_100022387 Ga0075435_1000223872 251
344 3300007076 Ga0075435_100302269 Ga0075435_1003022692 251
345 3300009093 Ga0105240_10075669 Ga0105240_100756692 251
346 3300009098 Ga0105245_10034539 Ga0105245_100345393 251
347 3300009147 Ga0114129_10004057 Ga0114129_100040578 251
348 3300009148 Ga0105243_10003585 Ga0105243_1000358510 251
349 3300009174 Ga0105241_10000716 Ga0105241_1000071611 251
350 3300009174 Ga0105241_10158319 Ga0105241_101583192 251
351 3300009176 Ga0105242_10000251 Ga0105242_1000025123 251
352 3300009177 Ga0105248_10001792 Ga0105248_1000179211 251
353 3300009553 Ga0105249_10023634 Ga0105249_100236342 251
354 3300009553 Ga0105249_10137800 Ga0105249_101378002 251
355 3300009553 Ga0105249_10164727 Ga0105249_101647272 251
356 3300010375 Ga0105239_10013449 Ga0105239_100134498 251
357 3300011119 Ga0105246_10296660 Ga0105246_102966602 251
358 3300013296 Ga0157374_10000354 Ga0157374_1000035432 251
359 3300013296 Ga0157374_10118697 Ga0157374_101186972 251
360 3300013297 Ga0157378_10001585 Ga0157378_1000158513 251
361 3300013306 Ga0163162_10001791 Ga0163162_100017919 251
362 3300013306 Ga0163162_10043019 Ga0163162_100430192 251
363 3300013307 Ga0157372_10101356 Ga0157372_101013562 251
364 3300013307 Ga0157372_10146411 Ga0157372_101464112 251
365 3300013307 Ga0157372_10389340 Ga0157372_103893401 251
366 3300013307 Ga0157372_10560591 Ga0157372_105605911 251
367 3300013308 Ga0157375_10021674 Ga0157375_100216745 251
368 3300014326 Ga0157380_10020140 Ga0157380_100201406 251
369 3300014968 Ga0157379_10084462 Ga0157379_100844622 251
370 3300025885 Ga0207653_10000906 Ga0207653_100009069 251
371 3300025885 Ga0207653_10016500 Ga0207653_100165002 251
372 3300025885 Ga0207653_10067324 Ga0207653_100673242 251
373 3300025898 Ga0207692_10288434 Ga0207692_102884342 251
374 3300025899 Ga0207642_10000833 Ga0207642_100008333 251
375 3300025903 Ga0207680_10035155 Ga0207680_100351552 251
376 3300025907 Ga0207645_10001078 Ga0207645_1000107814 251
377 3300025910 Ga0207684_10007226 Ga0207684_100072266 251
378 3300025910 Ga0207684_10065162 Ga0207684_100651623 251
379 3300025911 Ga0207654_10157982 Ga0207654_101579822 251
380 3300025912 Ga0207707_10001431 Ga0207707_1000143111 251
381 3300025916 Ga0207663_10000013 Ga0207663_1000001398 251
382 3300025917 Ga0207660_10007979 Ga0207660_100079793 251
383 3300025921 Ga0207652_10004478 Ga0207652_100044787 251
384 3300025921 Ga0207652_10450690 Ga0207652_104506901 251
385 3300025922 Ga0207646_10002838 Ga0207646_100028385 251
386 3300025922 Ga0207646_10009959 Ga0207646_100099595 251
387 3300025922 Ga0207646_10083049 Ga0207646_100830492 251
388 3300025922 Ga0207646_10163452 Ga0207646_101634522 251
389 3300025923 Ga0207681_10021437 Ga0207681_100214372 251
390 3300025923 Ga0207681_10037604 Ga0207681_100376043 251
391 3300025927 Ga0207687_10053510 Ga0207687_100535102 251
392 3300025929 Ga0207664_10027416 Ga0207664_100274162 251
393 3300025933 Ga0207706_10000096 Ga0207706_1000009675 251
394 3300025934 Ga0207686_10000112 Ga0207686_1000011218 251
395 3300025935 Ga0207709_10001243 Ga0207709_100012436 251
396 3300025937 Ga0207669_10001730 Ga0207669_100017304 251
397 3300025938 Ga0207704_10001104 Ga0207704_100011049 251
398 3300025940 Ga0207691_10144880 Ga0207691_101448802 251
399 3300025941 Ga0207711_10003244 Ga0207711_1000324415 251
400 3300025942 Ga0207689_10000911 Ga0207689_1000091121 251
401 3300025942 Ga0207689_10516330 Ga0207689_105163302 251
402 3300025944 Ga0207661_10040614 Ga0207661_100406143 251
403 3300025944 Ga0207661_10046960 Ga0207661_100469602 251
404 3300025949 Ga0207667_10027244 Ga0207667_100272442 251
405 3300025961 Ga0207712_10007741 Ga0207712_100077413 251
406 3300025961 Ga0207712_10055730 Ga0207712_100557302 251
407 3300025972 Ga0207668_10037344 Ga0207668_100373443 251
408 3300025972 Ga0207668_10166705 Ga0207668_101667052 251
409 3300025981 Ga0207640_10017844 Ga0207640_100178443 251
410 3300025986 Ga0207658_10022058 Ga0207658_100220584 251
411 3300026067 Ga0207678_10684829 Ga0207678_106848291 251
412 3300026075 Ga0207708_10057843 Ga0207708_100578432 251
413 3300026089 Ga0207648_10000043 Ga0207648_1000004353 251
414 3300026118 Ga0207675_100009301 Ga0207675_1000093016 251
415 3300026118 Ga0207675_100283204 Ga0207675_1002832041 251
416 3300026121 Ga0207683_10003314 Ga0207683_100033149 251
417 3300026142 Ga0207698_10448241 Ga0207698_104482411 251
418 3300027671 Ga0209588_1022798 Ga0209588_10227982 251
419 3300028380 Ga0268265_10083741 Ga0268265_100837412 251
420 3300028381 Ga0268264_10007645 Ga0268264_100076453 251
421 3300028381 Ga0268264_10168495 Ga0268264_101684952 251
422 3300028800 Ga0265338_10001654 Ga0265338_1000165437 251
423 3300031241 Ga0265325_10015601 Ga0265325_100156015 251
424 3300031548 Ga0307408_100002006 Ga0307408_1000020066 251
425 3300031548 Ga0307408_100156029 Ga0307408_1001560292 251
426 3300031731 Ga0307405_10004222 Ga0307405_100042228 251
427 3300031731 Ga0307405_10262344 Ga0307405_102623442 251
428 3300031901 Ga0307406_10013122 Ga0307406_100131222 251
429 3300031901 Ga0307406_10046751 Ga0307406_100467512 251
430 3300031911 Ga0307412_10042004 Ga0307412_100420043 251
431 3300031995 Ga0307409_100043283 Ga0307409_1000432833 251
432 3300032002 Ga0307416_100061624 Ga0307416_1000616242 251
433 3300032126 Ga0307415_100030103 Ga0307415_1000301032 251
434 3300035398 Ga0316574_0014342 Ga0316574_0014342_3782_4543 251
435 3300037471 Ga0395905_0468040 Ga0395905_0468040_102_872 251
436 3300042876 Ga0451577_0000109 Ga0451577_0000109_149420_150178 251
437 3300044673 Ga0453683_0004121 Ga0453683_0004121_5366_6124 251
438 3300044673 Ga0453683_0018303 Ga0453683_0018303_3270_4025 251
439 3300044684 Ga0466966_0031866 Ga0466966_0031866_1773_2543 251
440 3300044694 Ga0466963_0224894 Ga0466963_0224894_510_1280 251
441 3300044712 Ga0453684_0000004 Ga0453684_0000004_1081777_1082535 251
442 3300045049 Ga0466959_0129847 Ga0466959_0129847_276_1040 251
443 3300046557 Ga0495622_0032590 Ga0495622_0032590_1572_2327 251
444 3300046684 Ga0495669_0207308 Ga0495669_0207308_66_824 251
445 3300048904 Ga0496101_0013792 Ga0496101_0013792_1306_2061 251
446 3300048909 Ga0496106_0060003 Ga0496106_0060003_1249_2004 251
447 3300048917 Ga0496114_0068395 Ga0496114_0068395_740_1495 251
448 3300049575 Ga0501039_0612719 Ga0501039_0612719_14_799 251
449 3300049592 Ga0501076_0332238 Ga0501076_0332238_324_1094 251
450 3300049661 Ga0501217_021028 Ga0501217_021028_421_1191 251
451 3300049741 Ga0501079_0088003 Ga0501079_0088003_366_1136 251
452 3300049741 Ga0501079_0142060 Ga0501079_0142060_486_1241 251
453 3300049743 Ga0501081_0153786 Ga0501081_0153786_522_1292 251
454 3300050507 nmdc:mga05p37_3197_c1 nmdc:mga05p37_3197_c1_12994_13764 251
455 3300050509 nmdc:mga0qj67_311979_c1 nmdc:mga0qj67_311979_c1_48_803 251
456 3300050510 nmdc:mga06r32_390614_c1 nmdc:mga06r32_390614_c1_296_1051 251
457 3300050510 nmdc:mga06r32_449882_c1 nmdc:mga06r32_449882_c1_301_1071 251
458 3300050510 nmdc:mga06r32_80042_c1 nmdc:mga06r32_80042_c1_329_1084 251
459 3300050512 nmdc:mga0n895_21058_c1 nmdc:mga0n895_21058_c1_4825_5595 251
460 3300050512 nmdc:mga0n895_854_c1 nmdc:mga0n895_854_c1_15506_16276 251
461 3300050513 nmdc:mga0rr50_187707_c1 nmdc:mga0rr50_187707_c1_514_1284 251
462 3300050513 nmdc:mga0rr50_209070_c1 nmdc:mga0rr50_209070_c1_253_1023 251
463 3300050514 nmdc:mga08x19_100260_c1 nmdc:mga08x19_100260_c1_601_1356 251
464 3300050514 nmdc:mga08x19_1110_c1 nmdc:mga08x19_1110_c1_12435_13226 251
465 3300050514 nmdc:mga08x19_14485_c1 nmdc:mga08x19_14485_c1_1986_2756 251
466 3300050514 nmdc:mga08x19_3198_c1 nmdc:mga08x19_3198_c1_1716_2480 251
467 3300050514 nmdc:mga08x19_33583_c1 nmdc:mga08x19_33583_c1_2318_3076 251
468 3300050514 nmdc:mga08x19_5823_c1 nmdc:mga08x19_5823_c1_2450_3223 251
469 3300050515 nmdc:mga0a205_23409_c1 nmdc:mga0a205_23409_c1_3228_3998 251
470 3300054114 Ga0501084_0444570 Ga0501084_0444570_95_865 251
471 3300060353 Ga0501082_0497858 Ga0501082_0497858_165_920 251
472 iso_pu_bacteria 2887375801 2887378722 251
473 3300004800 Ga0058861_12069260 Ga0058861_120692602 252
474 3300004803 Ga0058862_10049606 Ga0058862_100496062 252
475 3300005289 Ga0065704_10006494 Ga0065704_100064941 252
476 3300005295 Ga0065707_10043917 Ga0065707_100439171 252
477 3300005295 Ga0065707_10115807 Ga0065707_101158071 252
478 3300005329 Ga0070683_100002754 Ga0070683_10000275411 252
479 3300005329 Ga0070683_100062308 Ga0070683_1000623084 252
480 3300005330 Ga0070690_100114752 Ga0070690_1001147522 252
481 3300005331 Ga0070670_100343809 Ga0070670_1003438092 252
482 3300005334 Ga0068869_100004425 Ga0068869_1000044257 252
483 3300005336 Ga0070680_100030681 Ga0070680_1000306814 252
484 3300005336 Ga0070680_100172497 Ga0070680_1001724972 252
485 3300005336 Ga0070680_100228288 Ga0070680_1002282882 252
486 3300005337 Ga0070682_100130206 Ga0070682_1001302062 252
487 3300005340 Ga0070689_100090750 Ga0070689_1000907502 252
488 3300005340 Ga0070689_100451767 Ga0070689_1004517671 252
489 3300005341 Ga0070691_10129826 Ga0070691_101298261 252
490 3300005344 Ga0070661_100010786 Ga0070661_1000107866 252
491 3300005344 Ga0070661_100011176 Ga0070661_1000111765 252
492 3300005355 Ga0070671_100006816 Ga0070671_10000681611 252
493 3300005366 Ga0070659_100013907 Ga0070659_1000139074 252
494 3300005434 Ga0070709_10023862 Ga0070709_100238622 252
495 3300005434 Ga0070709_10162982 Ga0070709_101629821 252
496 3300005434 Ga0070709_10211216 Ga0070709_102112162 252
497 3300005435 Ga0070714_100046215 Ga0070714_1000462152 252
498 3300005435 Ga0070714_100187059 Ga0070714_1001870592 252
499 3300005436 Ga0070713_100000083 Ga0070713_1000000838 252
500 3300005436 Ga0070713_100203717 Ga0070713_1002037172 252
501 3300005437 Ga0070710_10018647 Ga0070710_100186474 252
502 3300005439 Ga0070711_100000946 Ga0070711_10000094611 252
503 3300005458 Ga0070681_10007697 Ga0070681_100076974 252
504 3300005458 Ga0070681_10012170 Ga0070681_100121706 252
505 3300005471 Ga0070698_100001439 Ga0070698_1000014394 252
506 3300005471 Ga0070698_100284546 Ga0070698_1002845462 252
507 3300005518 Ga0070699_100161807 Ga0070699_1001618072 252
508 3300005518 Ga0070699_100184491 Ga0070699_1001844911 252
509 3300005530 Ga0070679_100007243 Ga0070679_10000724311 252
510 3300005530 Ga0070679_100026951 Ga0070679_1000269514 252
511 3300005530 Ga0070679_100122830 Ga0070679_1001228302 252
512 3300005530 Ga0070679_100364673 Ga0070679_1003646732 252
513 3300005535 Ga0070684_100028396 Ga0070684_1000283962 252
514 3300005535 Ga0070684_100060352 Ga0070684_1000603521 252
515 3300005539 Ga0068853_100314379 Ga0068853_1003143792 252
516 3300005539 Ga0068853_100408700 Ga0068853_1004087002 252
517 3300005545 Ga0070695_100021263 Ga0070695_1000212634 252
518 3300005545 Ga0070695_100146044 Ga0070695_1001460442 252
519 3300005546 Ga0070696_100004602 Ga0070696_1000046027 252
520 3300005563 Ga0068855_100019763 Ga0068855_1000197635 252
521 3300005564 Ga0070664_100172892 Ga0070664_1001728922 252
522 3300005564 Ga0070664_100395866 Ga0070664_1003958662 252
523 3300005577 Ga0068857_100044817 Ga0068857_1000448174 252
524 3300005578 Ga0068854_100022840 Ga0068854_1000228405 252
525 3300005615 Ga0070702_100011576 Ga0070702_1000115762 252
526 3300005616 Ga0068852_100017011 Ga0068852_1000170112 252
527 3300005616 Ga0068852_100761968 Ga0068852_1007619682 252
528 3300005617 Ga0068859_100004322 Ga0068859_10000432212 252
529 3300005617 Ga0068859_100250507 Ga0068859_1002505072 252
530 3300005618 Ga0068864_100017774 Ga0068864_1000177742 252
531 3300005840 Ga0068870_10033736 Ga0068870_100337362 252
532 3300005841 Ga0068863_100015626 Ga0068863_1000156266 252
533 3300005841 Ga0068863_100931988 Ga0068863_1009319881 252
534 3300005842 Ga0068858_100030024 Ga0068858_1000300245 252
535 3300005843 Ga0068860_100020074 Ga0068860_1000200744 252
536 3300006028 Ga0070717_10001061 Ga0070717_100010613 252
537 3300006028 Ga0070717_10396173 Ga0070717_103961732 252
538 3300006175 Ga0070712_100103070 Ga0070712_1001030702 252
539 3300006846 Ga0075430_100054096 Ga0075430_1000540964 252
540 3300006847 Ga0075431_100204048 Ga0075431_1002040482 252
541 3300006880 Ga0075429_100096822 Ga0075429_1000968222 252
542 3300006914 Ga0075436_100001297 Ga0075436_10000129715 252
543 3300006914 Ga0075436_100060385 Ga0075436_1000603852 252
544 3300006914 Ga0075436_100065574 Ga0075436_1000655742 252
545 3300006931 Ga0097620_100004322 Ga0097620_10000432212 252
546 3300006931 Ga0097620_100168039 Ga0097620_1001680392 252
547 3300006931 Ga0097620_100250507 Ga0097620_1002505072 252
548 3300007076 Ga0075435_100071326 Ga0075435_1000713263 252
549 3300009093 Ga0105240_10004744 Ga0105240_1000474424 252
550 3300009093 Ga0105240_10030521 Ga0105240_100305216 252
551 3300009093 Ga0105240_10837557 Ga0105240_108375572 252
552 3300009094 Ga0111539_10349587 Ga0111539_103495872 252
553 3300009098 Ga0105245_10011101 Ga0105245_100111012 252
554 3300009147 Ga0114129_10273053 Ga0114129_102730532 252
555 3300009174 Ga0105241_10208895 Ga0105241_102088952 252
556 3300009174 Ga0105241_10283202 Ga0105241_102832022 252
557 3300009176 Ga0105242_10000787 Ga0105242_1000078723 252
558 3300009177 Ga0105248_10020594 Ga0105248_100205944 252
559 3300009177 Ga0105248_10303970 Ga0105248_103039701 252
560 3300009545 Ga0105237_10397393 Ga0105237_103973932 252
561 3300009545 Ga0105237_10664197 Ga0105237_106641972 252
562 3300009551 Ga0105238_10108332 Ga0105238_101083322 252
563 3300009551 Ga0105238_10646960 Ga0105238_106469602 252
564 3300013100 Ga0157373_10014172 Ga0157373_100141723 252
565 3300013100 Ga0157373_10047874 Ga0157373_100478742 252
566 3300013100 Ga0157373_10199721 Ga0157373_101997212 252
567 3300013100 Ga0157373_10221174 Ga0157373_102211742 252
568 3300013102 Ga0157371_10161379 Ga0157371_101613792 252
569 3300013104 Ga0157370_10010642 Ga0157370_100106423 252
570 3300013104 Ga0157370_10096803 Ga0157370_100968032 252
571 3300013104 Ga0157370_10111131 Ga0157370_101111312 252
572 3300013104 Ga0157370_10153672 Ga0157370_101536722 252
573 3300013104 Ga0157370_10169733 Ga0157370_101697332 252
574 3300013104 Ga0157370_10516081 Ga0157370_105160812 252
575 3300013105 Ga0157369_10002977 Ga0157369_1000297710 252
576 3300013105 Ga0157369_10029240 Ga0157369_100292403 252
577 3300013105 Ga0157369_10326382 Ga0157369_103263822 252
578 3300013105 Ga0157369_10627721 Ga0157369_106277212 252
579 3300013296 Ga0157374_10032848 Ga0157374_100328484 252
580 3300013297 Ga0157378_10205775 Ga0157378_102057752 252
581 3300013307 Ga0157372_10028719 Ga0157372_100287194 252
582 3300013307 Ga0157372_10042712 Ga0157372_100427126 252
583 3300013307 Ga0157372_10072521 Ga0157372_100725214 252
584 3300013307 Ga0157372_10094586 Ga0157372_100945862 252
585 3300013307 Ga0157372_10125276 Ga0157372_101252762 252
586 3300013307 Ga0157372_10143253 Ga0157372_101432532 252
587 3300013307 Ga0157372_10316634 Ga0157372_103166342 252
588 3300013307 Ga0157372_10931767 Ga0157372_109317672 252
589 3300014325 Ga0163163_10002166 Ga0163163_100021662 252
590 3300014325 Ga0163163_10118424 Ga0163163_101184242 252
591 3300014968 Ga0157379_10249520 Ga0157379_102495202 252
592 3300014969 Ga0157376_10008108 Ga0157376_100081084 252
593 3300017792 Ga0163161_10464326 Ga0163161_104643262 252
594 3300020070 Ga0206356_10024056 Ga0206356_100240562 252
595 3300020070 Ga0206356_10142434 Ga0206356_101424342 252
596 3300020070 Ga0206356_10968049 Ga0206356_109680492 252
597 3300020070 Ga0206356_11526478 Ga0206356_115264782 252
598 3300020078 Ga0206352_10462765 Ga0206352_104627652 252
599 3300020080 Ga0206350_10138413 Ga0206350_101384132 252
600 3300022467 Ga0224712_10060979 Ga0224712_100609792 252
601 3300025893 Ga0207682_10013260 Ga0207682_100132602 252
602 3300025898 Ga0207692_10011979 Ga0207692_100119792 252
603 3300025898 Ga0207692_10174924 Ga0207692_101749242 252
604 3300025903 Ga0207680_10064790 Ga0207680_100647902 252
605 3300025906 Ga0207699_10014488 Ga0207699_100144882 252
606 3300025906 Ga0207699_10019691 Ga0207699_100196912 252
607 3300025908 Ga0207643_10011540 Ga0207643_100115403 252
608 3300025911 Ga0207654_10127999 Ga0207654_101279991 252
609 3300025912 Ga0207707_10002091 Ga0207707_1000209110 252
610 3300025912 Ga0207707_10007219 Ga0207707_100072197 252
611 3300025912 Ga0207707_10022038 Ga0207707_100220382 252
612 3300025912 Ga0207707_10447202 Ga0207707_104472022 252
613 3300025913 Ga0207695_10005716 Ga0207695_100057166 252
614 3300025913 Ga0207695_10015949 Ga0207695_100159495 252
615 3300025913 Ga0207695_10192180 Ga0207695_101921802 252
616 3300025913 Ga0207695_10317467 Ga0207695_103174672 252
617 3300025916 Ga0207663_10012478 Ga0207663_100124783 252
618 3300025916 Ga0207663_10116407 Ga0207663_101164072 252
619 3300025917 Ga0207660_10013079 Ga0207660_100130795 252
620 3300025917 Ga0207660_10013174 Ga0207660_100131744 252
621 3300025917 Ga0207660_10050281 Ga0207660_100502813 252
622 3300025917 Ga0207660_10140615 Ga0207660_101406152 252
623 3300025919 Ga0207657_10026711 Ga0207657_100267115 252
624 3300025919 Ga0207657_10176416 Ga0207657_101764161 252
625 3300025920 Ga0207649_10007938 Ga0207649_100079384 252
626 3300025921 Ga0207652_10005744 Ga0207652_100057446 252
627 3300025921 Ga0207652_10053599 Ga0207652_100535992 252
628 3300025921 Ga0207652_10057994 Ga0207652_100579941 252
629 3300025921 Ga0207652_10061824 Ga0207652_100618242 252
630 3300025921 Ga0207652_10103249 Ga0207652_101032492 252
631 3300025921 Ga0207652_10108342 Ga0207652_101083422 252
632 3300025925 Ga0207650_10016927 Ga0207650_100169272 252
633 3300025925 Ga0207650_10391217 Ga0207650_103912172 252
634 3300025926 Ga0207659_10004878 Ga0207659_100048787 252
635 3300025927 Ga0207687_10019366 Ga0207687_100193661 252
636 3300025928 Ga0207700_10000243 Ga0207700_100002435 252
637 3300025928 Ga0207700_10127337 Ga0207700_101273372 252
638 3300025928 Ga0207700_10460212 Ga0207700_104602122 252
639 3300025929 Ga0207664_10014315 Ga0207664_100143152 252
640 3300025929 Ga0207664_10096305 Ga0207664_100963052 252
641 3300025929 Ga0207664_10102772 Ga0207664_101027722 252
642 3300025929 Ga0207664_10408112 Ga0207664_104081121 252
643 3300025932 Ga0207690_10039738 Ga0207690_100397384 252
644 3300025942 Ga0207689_10000755 Ga0207689_1000075510 252
645 3300025944 Ga0207661_10020439 Ga0207661_100204395 252
646 3300025945 Ga0207679_10001989 Ga0207679_100019895 252
647 3300025945 Ga0207679_10058167 Ga0207679_100581674 252
648 3300025945 Ga0207679_10109728 Ga0207679_101097282 252
649 3300025949 Ga0207667_10234571 Ga0207667_102345712 252
650 3300025972 Ga0207668_10239707 Ga0207668_102397072 252
651 3300025981 Ga0207640_10002465 Ga0207640_100024656 252
652 3300025981 Ga0207640_10049558 Ga0207640_100495582 252
653 3300025986 Ga0207658_10232896 Ga0207658_102328961 252
654 3300026035 Ga0207703_10066907 Ga0207703_100669072 252
655 3300026041 Ga0207639_10215551 Ga0207639_102155512 252
656 3300026088 Ga0207641_10875515 Ga0207641_108755152 252
657 3300026088 Ga0207641_10916326 Ga0207641_109163261 252
658 3300026116 Ga0207674_10001092 Ga0207674_100010922 252
659 3300026142 Ga0207698_10007725 Ga0207698_100077255 252
660 3300027364 Ga0209967_1001446 Ga0209967_10014462 252
661 3300027543 Ga0209999_1001017 Ga0209999_10010174 252
662 3300027682 Ga0209971_1004772 Ga0209971_10047722 252
663 3300027695 Ga0209966_1005831 Ga0209966_10058312 252
664 3300027907 Ga0207428_10171965 Ga0207428_101719652 252
665 3300028381 Ga0268264_10183070 Ga0268264_101830702 252
666 3300028556 Ga0265337_1001252 Ga0265337_10012525 252
667 3300028558 Ga0265326_10001074 Ga0265326_100010747 252
668 3300028558 Ga0265326_10003863 Ga0265326_100038632 252
669 3300028563 Ga0265319_1000100 Ga0265319_100010030 252
670 3300028563 Ga0265319_1000169 Ga0265319_100016933 252
671 3300028573 Ga0265334_10001411 Ga0265334_100014115 252
672 3300028577 Ga0265318_10001487 Ga0265318_100014873 252
673 3300028653 Ga0265323_10000218 Ga0265323_1000021822 252
674 3300028654 Ga0265322_10000549 Ga0265322_100005496 252
675 3300028654 Ga0265322_10002031 Ga0265322_100020315 252
676 3300028666 Ga0265336_10000115 Ga0265336_1000011537 252
677 3300028794 Ga0307515_10127185 Ga0307515_101271855 252
678 3300028800 Ga0265338_10005397 Ga0265338_1000539712 252
679 3300028800 Ga0265338_10005519 Ga0265338_100055199 252
680 3300028800 Ga0265338_10005708 Ga0265338_100057088 252
681 3300029957 Ga0265324_10001167 Ga0265324_100011677 252
682 3300029957 Ga0265324_10005143 Ga0265324_100051437 252
683 3300029957 Ga0265324_10005863 Ga0265324_100058632 252
684 3300031235 Ga0265330_10000319 Ga0265330_1000031921 252
685 3300031238 Ga0265332_10000382 Ga0265332_1000038210 252
686 3300031238 Ga0265332_10148623 Ga0265332_101486231 252
687 3300031240 Ga0265320_10002083 Ga0265320_1000208320 252
688 3300031240 Ga0265320_10002134 Ga0265320_100021348 252
689 3300031241 Ga0265325_10004251 Ga0265325_100042516 252
690 3300031242 Ga0265329_10000073 Ga0265329_100000737 252
691 3300031247 Ga0265340_10004960 Ga0265340_100049603 252
692 3300031249 Ga0265339_10000297 Ga0265339_100002976 252
693 3300031250 Ga0265331_10000963 Ga0265331_1000096325 252
694 3300031344 Ga0265316_10000247 Ga0265316_1000024721 252
695 3300031344 Ga0265316_10005834 Ga0265316_1000583413 252
696 3300031595 Ga0265313_10000580 Ga0265313_1000058039 252
697 3300031711 Ga0265314_10000285 Ga0265314_1000028543 252
698 3300031712 Ga0265342_10000764 Ga0265342_1000076420 252
699 3300031712 Ga0265342_10002715 Ga0265342_1000271516 252
700 3300031995 Ga0307409_100017651 Ga0307409_1000176512 252
701 3300032002 Ga0307416_100127250 Ga0307416_1001272502 252
702 3300032133 Ga0316583_10088994 Ga0316583_100889942 252
703 3300035083 Ga0373926_0008122 Ga0373926_0008122_2266_3039 252
704 3300035089 Ga0373944_0002092 Ga0373944_0002092_4166_4939 252
705 3300035111 Ga0373923_0002649 Ga0373923_0002649_1180_1953 252
706 3300035113 Ga0373936_0048820 Ga0373936_0048820_900_1673 252
707 3300035116 Ga0373945_0003771 Ga0373945_0003771_3824_4597 252
708 3300035119 Ga0373956_0000268 Ga0373956_0000268_15851_16624 252
709 3300035120 Ga0373957_0001328 Ga0373957_0001328_937_1710 252
710 3300035170 Ga0373943_0018325 Ga0373943_0018325_2115_2888 252
711 3300035171 Ga0373946_0001250 Ga0373946_0001250_5538_6311 252
712 3300035171 Ga0373946_0209542 Ga0373946_0209542_73_846 252
713 3300035172 Ga0373955_0000375 Ga0373955_0000375_13686_14459 252
714 3300035410 Ga0373924_0001315 Ga0373924_0001315_348_1121 252
715 3300035691 Ga0373931_0005639 Ga0373931_0005639_4278_5042 252
716 3300035691 Ga0373931_0091723 Ga0373931_0091723_538_1302 252
717 3300035692 Ga0373935_0046960 Ga0373935_0046960_216_989 252
718 3300035695 Ga0373927_0001403 Ga0373927_0001403_15236_16009 252
719 3300035724 Ga0373933_0000048 Ga0373933_0000048_12457_13230 252
720 3300035725 Ga0373947_0159061 Ga0373947_0159061_460_1233 252
721 3300036401 Ga0373937_0001127 Ga0373937_0001127_16267_17040 252
722 3300036401 Ga0373937_0447607 Ga0373937_0447607_174_938 252
723 3300037068 Ga0373925_0000764 Ga0373925_0000764_4369_5142 252
724 3300042439 Ga0439464_0014277 Ga0439464_0014277_897_1655 252
725 3300042876 Ga0451577_0002556 Ga0451577_0002556_17950_18708 252
726 3300042876 Ga0451577_0019993 Ga0451577_0019993_4530_5288 252
727 3300042876 Ga0451577_0036278 Ga0451577_0036278_880_1638 252
728 3300042876 Ga0451577_0442633 Ga0451577_0442633_221_979 252
729 3300042876 Ga0451577_0543424 Ga0451577_0543424_96_869 252
730 3300044712 Ga0453684_0000332 Ga0453684_0000332_193344_194102 252
731 3300044712 Ga0453684_0251225 Ga0453684_0251225_525_1283 252
732 3300044712 Ga0453684_0375474 Ga0453684_0375474_103_861 252
733 3300045051 Ga0451576_0185451 Ga0451576_0185451_1000_1767 252
734 3300045976 Ga0466967_0063446 Ga0466967_0063446_1657_2430 252
735 3300046454 Ga0495592_0004119 Ga0495592_0004119_4834_5607 252
736 3300046455 Ga0495603_0000562 Ga0495603_0000562_14384_15157 252
737 3300046457 Ga0495590_0059664 Ga0495590_0059664_83_850 252
738 3300046459 Ga0495629_0043348 Ga0495629_0043348_239_1012 252
739 3300046459 Ga0495629_0057124 Ga0495629_0057124_1606_2370 252
740 3300046459 Ga0495629_0072958 Ga0495629_0072958_1439_2197 252
741 3300046462 Ga0495651_0000222 Ga0495651_0000222_16035_16808 252
742 3300046463 Ga0495653_0000050 Ga0495653_0000050_48908_49681 252
743 3300046472 Ga0495580_0043293 Ga0495580_0043293_158_931 252
744 3300046473 Ga0495582_0015133 Ga0495582_0015133_1070_1828 252
745 3300046473 Ga0495582_0145889 Ga0495582_0145889_362_1135 252
746 3300046475 Ga0495639_0012626 Ga0495639_0012626_2672_3445 252
747 3300046475 Ga0495639_0026325 Ga0495639_0026325_922_1680 252
748 3300046477 Ga0495664_0019327 Ga0495664_0019327_718_1476 252
749 3300046499 Ga0495594_0039069 Ga0495594_0039069_702_1460 252
750 3300046511 Ga0495608_0000073 Ga0495608_0000073_73245_74018 252
751 3300046514 Ga0495618_0007472 Ga0495618_0007472_5301_6059 252
752 3300046514 Ga0495618_0034019 Ga0495618_0034019_566_1339 252
753 3300046516 Ga0495628_0000157 Ga0495628_0000157_50074_50847 252
754 3300046516 Ga0495628_0149156 Ga0495628_0149156_418_1176 252
755 3300046517 Ga0495630_0001130 Ga0495630_0001130_66_839 252
756 3300046517 Ga0495630_0007186 Ga0495630_0007186_4743_5516 252
757 3300046517 Ga0495630_0056237 Ga0495630_0056237_1173_1931 252
758 3300046529 Ga0495652_0001178 Ga0495652_0001178_12163_12936 252
759 3300046531 Ga0495665_0000137 Ga0495665_0000137_11707_12480 252
760 3300046533 Ga0495640_0025343 Ga0495640_0025343_127_885 252
761 3300046533 Ga0495640_0096528 Ga0495640_0096528_817_1590 252
762 3300046535 Ga0495586_0008259 Ga0495586_0008259_2167_2925 252
763 3300046535 Ga0495586_0355736 Ga0495586_0355736_39_797 252
764 3300046536 Ga0495587_0009570 Ga0495587_0009570_467_1240 252
765 3300046543 Ga0495645_0000299 Ga0495645_0000299_16036_16809 252
766 3300046543 Ga0495645_0056876 Ga0495645_0056876_1258_2022 252
767 3300046559 Ga0495667_0000191 Ga0495667_0000191_11636_12409 252
768 3300046642 Ga0495634_0003518 Ga0495634_0003518_5862_6620 252
769 3300046642 Ga0495634_0079444 Ga0495634_0079444_691_1464 252
770 3300046663 Ga0495635_0000066 Ga0495635_0000066_26563_27336 252
771 3300046674 Ga0495588_0000380 Ga0495588_0000380_24488_25261 252
772 3300046675 Ga0495657_0000053 Ga0495657_0000053_27951_28724 252
773 3300046678 Ga0495599_0001415 Ga0495599_0001415_4475_5248 252
774 3300046678 Ga0495599_0067049 Ga0495599_0067049_34_792 252
775 3300046679 Ga0495623_0008532 Ga0495623_0008532_1779_2552 252
776 3300046683 Ga0495658_0000248 Ga0495658_0000248_28743_29516 252
777 3300046683 Ga0495658_0037138 Ga0495658_0037138_586_1344 252
778 3300046689 Ga0495613_0005336 Ga0495613_0005336_1184_1957 252
779 3300046689 Ga0495613_0252590 Ga0495613_0252590_162_935 252
780 3300046809 Ga0495600_0000032 Ga0495600_0000032_27006_27779 252
781 3300047315 Ga0495581_0109486 Ga0495581_0109486_701_1474 252
782 3300047317 Ga0495604_0000051 Ga0495604_0000051_50057_50830 252
783 3300047319 Ga0495674_0001207 Ga0495674_0001207_4181_4954 252
784 3300047321 Ga0495676_0070292 Ga0495676_0070292_880_1638 252
785 3300047322 Ga0495680_0009004 Ga0495680_0009004_4698_5456 252
786 3300047322 Ga0495680_0042807 Ga0495680_0042807_844_1617 252
787 3300047444 Ga0495675_0000665 Ga0495675_0000665_11141_11914 252
788 3300047471 Ga0495684_0000062 Ga0495684_0000062_16267_17040 252
789 3300047471 Ga0495684_0045674 Ga0495684_0045674_201_959 252
790 3300047673 Ga0495593_0000178 Ga0495593_0000178_31971_32744 252
791 3300047673 Ga0495593_0027113 Ga0495593_0027113_189_962 252
792 3300048088 Ga0495602_0000245 Ga0495602_0000245_22285_23058 252
793 3300048089 Ga0495614_0081774 Ga0495614_0081774_530_1288 252
794 3300048907 Ga0496104_0359636 Ga0496104_0359636_282_1046 252
795 3300048912 Ga0496109_0011584 Ga0496109_0011584_5413_6249 252
796 3300048913 Ga0496110_0028643 Ga0496110_0028643_1071_1907 252
797 3300048914 Ga0496111_0058359 Ga0496111_0058359_203_1039 252
798 3300048915 Ga0496112_0000381 Ga0496112_0000381_19900_20664 252
799 3300048915 Ga0496112_0002076 Ga0496112_0002076_11099_11935 252
800 3300048916 Ga0496113_0016907 Ga0496113_0016907_3935_4699 252
801 3300049571 Ga0501034_0217737 Ga0501034_0217737_344_1108 252
802 3300049576 Ga0501040_0006397 Ga0501040_0006397_6405_7169 252
803 3300049743 Ga0501081_0429260 Ga0501081_0429260_37_801 252
804 3300049779 Ga0501283_005510 Ga0501283_005510_792_1562 252
805 3300050508 nmdc:mga09592_35193_c1 nmdc:mga09592_35193_c1_912_1676 252
806 3300050509 nmdc:mga0qj67_176711_c1 nmdc:mga0qj67_176711_c1_138_902 252
807 3300050509 nmdc:mga0qj67_477509_c1 nmdc:mga0qj67_477509_c1_166_930 252
808 3300050509 nmdc:mga0qj67_77733_c1 nmdc:mga0qj67_77733_c1_181_945 252
809 3300050510 nmdc:mga06r32_52114_c1 nmdc:mga06r32_52114_c1_535_1299 252
810 3300050511 nmdc:mga08y16_507848_c1 nmdc:mga08y16_507848_c1_137_925 252
811 3300050511 nmdc:mga08y16_56258_c1 nmdc:mga08y16_56258_c1_2618_3376 252
812 3300050513 nmdc:mga0rr50_578522_c1 nmdc:mga0rr50_578522_c1_110_877 252
813 3300050514 nmdc:mga08x19_10886_c1 nmdc:mga08x19_10886_c1_1799_2560 252
814 3300050514 nmdc:mga08x19_52021_c1 nmdc:mga08x19_52021_c1_525_1292 252
815 3300053077 Ga0495601_0002779 Ga0495601_0002779_8222_8995 252
816 3300053078 Ga0495612_0000406 Ga0495612_0000406_4161_4934 252
817 3300053085 Ga0495619_0002199 Ga0495619_0002199_10117_10890 252
818 3300005328 Ga0070676_10004169 Ga0070676_100041697 253
819 3300005329 Ga0070683_100099343 Ga0070683_1000993432 253
820 3300005336 Ga0070680_100026034 Ga0070680_1000260343 253
821 3300005336 Ga0070680_100073783 Ga0070680_1000737831 253
822 3300005337 Ga0070682_100000734 Ga0070682_10000073411 253
823 3300005337 Ga0070682_100005193 Ga0070682_1000051933 253
824 3300005338 Ga0068868_100001690 Ga0068868_10000169012 253
825 3300005341 Ga0070691_10094372 Ga0070691_100943722 253
826 3300005345 Ga0070692_10283019 Ga0070692_102830191 253
827 3300005347 Ga0070668_100572496 Ga0070668_1005724961 253
828 3300005353 Ga0070669_100030646 Ga0070669_1000306462 253
829 3300005355 Ga0070671_100023258 Ga0070671_1000232581 253
830 3300005355 Ga0070671_100219010 Ga0070671_1002190102 253
831 3300005356 Ga0070674_100056773 Ga0070674_1000567731 253
832 3300005364 Ga0070673_100014635 Ga0070673_1000146357 253
833 3300005366 Ga0070659_100034971 Ga0070659_1000349712 253
834 3300005434 Ga0070709_10008761 Ga0070709_100087613 253
835 3300005434 Ga0070709_10596653 Ga0070709_105966531 253
836 3300005437 Ga0070710_10016685 Ga0070710_100166852 253
837 3300005439 Ga0070711_100041611 Ga0070711_1000416112 253
838 3300005439 Ga0070711_100113196 Ga0070711_1001131963 253
839 3300005441 Ga0070700_100036045 Ga0070700_1000360453 253
840 3300005456 Ga0070678_100067503 Ga0070678_1000675032 253
841 3300005457 Ga0070662_100381231 Ga0070662_1003812312 253
842 3300005458 Ga0070681_10105072 Ga0070681_101050722 253
843 3300005459 Ga0068867_100027999 Ga0068867_1000279992 253
844 3300005459 Ga0068867_100220746 Ga0068867_1002207462 253
845 3300005518 Ga0070699_100000063 Ga0070699_10000006344 253
846 3300005530 Ga0070679_100068952 Ga0070679_1000689522 253
847 3300005530 Ga0070679_100215457 Ga0070679_1002154572 253
848 3300005535 Ga0070684_100000212 Ga0070684_10000021237 253
849 3300005545 Ga0070695_100001374 Ga0070695_10000137410 253
850 3300005547 Ga0070693_100070305 Ga0070693_1000703052 253
851 3300005549 Ga0070704_100228732 Ga0070704_1002287322 253
852 3300005563 Ga0068855_100004308 Ga0068855_10000430812 253
853 3300005563 Ga0068855_100267059 Ga0068855_1002670592 253
854 3300005563 Ga0068855_100437458 Ga0068855_1004374582 253
855 3300005564 Ga0070664_100021929 Ga0070664_1000219294 253
856 3300005616 Ga0068852_100751719 Ga0068852_1007517191 253
857 3300005718 Ga0068866_10077480 Ga0068866_100774802 253
858 3300005844 Ga0068862_100142275 Ga0068862_1001422752 253
859 3300005937 Ga0081455_10066458 Ga0081455_100664583 253
860 3300006173 Ga0070716_100000911 Ga0070716_1000009112 253
861 3300006175 Ga0070712_100407614 Ga0070712_1004076141 253
862 3300006844 Ga0075428_100042612 Ga0075428_1000426126 253
863 3300006847 Ga0075431_100136207 Ga0075431_1001362072 253
864 3300006852 Ga0075433_10015768 Ga0075433_100157687 253
865 3300006852 Ga0075433_10044601 Ga0075433_100446012 253
866 3300006871 Ga0075434_100012547 Ga0075434_1000125478 253
867 3300006871 Ga0075434_100162518 Ga0075434_1001625182 253
868 3300006871 Ga0075434_100179294 Ga0075434_1001792942 253
869 3300006880 Ga0075429_100000263 Ga0075429_10000026330 253
870 3300006881 Ga0068865_100007259 Ga0068865_1000072598 253
871 3300006914 Ga0075436_100012281 Ga0075436_1000122813 253
872 3300006914 Ga0075436_100161322 Ga0075436_1001613222 253
873 3300007076 Ga0075435_100314638 Ga0075435_1003146382 253
874 3300007788 Ga0099795_10024610 Ga0099795_100246102 253
875 3300009093 Ga0105240_10294332 Ga0105240_102943322 253
876 3300009098 Ga0105245_10010423 Ga0105245_100104239 253
877 3300009098 Ga0105245_10036786 Ga0105245_100367864 253
878 3300009147 Ga0114129_10071105 Ga0114129_100711052 253
879 3300009148 Ga0105243_10128101 Ga0105243_101281012 253
880 3300009177 Ga0105248_10086695 Ga0105248_100866952 253
881 3300009177 Ga0105248_10296390 Ga0105248_102963902 253
882 3300009545 Ga0105237_10146238 Ga0105237_101462382 253
883 3300009545 Ga0105237_10372259 Ga0105237_103722591 253
884 3300013105 Ga0157369_10262924 Ga0157369_102629241 253
885 3300013297 Ga0157378_10034310 Ga0157378_100343102 253
886 3300013297 Ga0157378_10056354 Ga0157378_100563544 253
887 3300013297 Ga0157378_10126749 Ga0157378_101267491 253
888 3300013307 Ga0157372_10008172 Ga0157372_1000817213 253
889 3300013307 Ga0157372_10022604 Ga0157372_100226043 253
890 3300020077 Ga0206351_10878209 Ga0206351_108782092 253
891 3300025893 Ga0207682_10024834 Ga0207682_100248342 253
892 3300025899 Ga0207642_10132429 Ga0207642_101324291 253
893 3300025906 Ga0207699_10060529 Ga0207699_100605292 253
894 3300025907 Ga0207645_10013509 Ga0207645_100135092 253
895 3300025912 Ga0207707_10015965 Ga0207707_100159656 253
896 3300025913 Ga0207695_10188662 Ga0207695_101886622 253
897 3300025916 Ga0207663_10097790 Ga0207663_100977902 253
898 3300025917 Ga0207660_10045477 Ga0207660_100454772 253
899 3300025921 Ga0207652_10001513 Ga0207652_1000151322 253
900 3300025921 Ga0207652_10099393 Ga0207652_100993932 253
901 3300025923 Ga0207681_10134732 Ga0207681_101347322 253
902 3300025924 Ga0207694_10033445 Ga0207694_100334454 253
903 3300025927 Ga0207687_10021988 Ga0207687_100219884 253
904 3300025927 Ga0207687_10221565 Ga0207687_102215652 253
905 3300025931 Ga0207644_10447831 Ga0207644_104478312 253
906 3300025933 Ga0207706_10003039 Ga0207706_100030392 253
907 3300025939 Ga0207665_10000385 Ga0207665_1000038521 253
908 3300025944 Ga0207661_10000266 Ga0207661_1000026627 253
909 3300025945 Ga0207679_10054235 Ga0207679_100542352 253
910 3300025949 Ga0207667_10002929 Ga0207667_1000292920 253
911 3300025972 Ga0207668_10581859 Ga0207668_105818591 253
912 3300025981 Ga0207640_10301738 Ga0207640_103017381 253
913 3300026023 Ga0207677_10015707 Ga0207677_100157072 253
914 3300026023 Ga0207677_10300527 Ga0207677_103005272 253
915 3300026067 Ga0207678_10274790 Ga0207678_102747902 253
916 3300026075 Ga0207708_10056957 Ga0207708_100569571 253
917 3300026089 Ga0207648_10070659 Ga0207648_100706592 253
918 3300026089 Ga0207648_10081301 Ga0207648_100813012 253
919 3300026089 Ga0207648_10214133 Ga0207648_102141331 253
920 3300026116 Ga0207674_10004557 Ga0207674_1000455719 253
921 3300026121 Ga0207683_10024609 Ga0207683_100246092 253
922 3300028380 Ga0268265_10344506 Ga0268265_103445062 253
923 3300031548 Ga0307408_100063300 Ga0307408_1000633002 253
924 3300031731 Ga0307405_10021653 Ga0307405_100216534 253
925 3300031901 Ga0307406_10018816 Ga0307406_100188164 253
926 3300032002 Ga0307416_100471283 Ga0307416_1004712832 253
927 3300032004 Ga0307414_10179999 Ga0307414_101799992 253
928 3300032004 Ga0307414_10449300 Ga0307414_104493001 253
929 3300034820 Ga0373959_0009856 Ga0373959_0009856_585_1355 253
930 3300035112 Ga0373932_0035277 Ga0373932_0035277_422_1192 253
931 3300035115 Ga0373941_0066177 Ga0373941_0066177_57_827 253
932 3300035170 Ga0373943_0139404 Ga0373943_0139404_336_1100 253
933 3300035171 Ga0373946_0099228 Ga0373946_0099228_350_1114 253
934 3300035207 Ga0373942_0004857 Ga0373942_0004857_329_1099 253
935 3300035692 Ga0373935_0104024 Ga0373935_0104024_101_865 253
936 3300042876 Ga0451577_0016505 Ga0451577_0016505_5037_5804 253
937 3300046459 Ga0495629_0035680 Ga0495629_0035680_1623_2390 253
938 3300046472 Ga0495580_0045913 Ga0495580_0045913_681_1448 253
939 3300046475 Ga0495639_0007465 Ga0495639_0007465_1065_1832 253
940 3300046491 Ga0495584_0092214 Ga0495584_0092214_476_1240 253
941 3300046517 Ga0495630_0010823 Ga0495630_0010823_5256_6023 253
942 3300046526 Ga0495666_0030573 Ga0495666_0030573_242_1009 253
943 3300046559 Ga0495667_0000474 Ga0495667_0000474_13624_14391 253
944 3300046675 Ga0495657_0023972 Ga0495657_0023972_229_996 253
945 3300046679 Ga0495623_0106385 Ga0495623_0106385_627_1394 253
946 3300046680 Ga0495646_0061751 Ga0495646_0061751_1306_2073 253
947 3300047315 Ga0495581_0231317 Ga0495581_0231317_159_926 253
948 3300047319 Ga0495674_0052030 Ga0495674_0052030_1854_2621 253
949 3300047471 Ga0495684_0074382 Ga0495684_0074382_561_1328 253
950 3300048088 Ga0495602_0092586 Ga0495602_0092586_171_938 253
951 3300048915 Ga0496112_0000949 Ga0496112_0000949_4286_5056 253
952 3300049824 Ga0501045_0355430 Ga0501045_0355430_260_1021 253
953 3300050507 nmdc:mga05p37_155774_c1 nmdc:mga05p37_155774_c1_1432_2193 253
954 3300050507 nmdc:mga05p37_197905_c1 nmdc:mga05p37_197905_c1_375_1145 253
955 3300050508 nmdc:mga09592_1886_c1 nmdc:mga09592_1886_c1_14618_15379 253
956 3300050510 nmdc:mga06r32_53042_c1 nmdc:mga06r32_53042_c1_2812_3573 253
957 3300050512 nmdc:mga0n895_330294_c1 nmdc:mga0n895_330294_c1_318_1079 253
958 3300050514 nmdc:mga08x19_5006_c1 nmdc:mga08x19_5006_c1_3972_4742 253
959 3300050514 nmdc:mga08x19_85603_c1 nmdc:mga08x19_85603_c1_805_1575 253
960 3300005329 Ga0070683_100036398 Ga0070683_1000363982 254
961 3300005331 Ga0070670_100055309 Ga0070670_1000553091 254
962 3300005336 Ga0070680_100279694 Ga0070680_1002796941 254
963 3300005340 Ga0070689_100439768 Ga0070689_1004397681 254
964 3300005842 Ga0068858_100194229 Ga0068858_1001942292 254
965 3300006871 Ga0075434_100019973 Ga0075434_1000199736 254
966 3300007076 Ga0075435_100018950 Ga0075435_1000189503 254
967 3300009177 Ga0105248_10019128 Ga0105248_1001912810 254
968 3300009177 Ga0105248_10171291 Ga0105248_101712912 254
969 3300013308 Ga0157375_11273999 Ga0157375_112739991 254
970 3300014325 Ga0163163_10050109 Ga0163163_100501094 254
971 3300014968 Ga0157379_10015995 Ga0157379_100159953 254
972 3300014969 Ga0157376_10534413 Ga0157376_105344131 254
973 3300025899 Ga0207642_10095217 Ga0207642_100952172 254
974 3300025925 Ga0207650_10030026 Ga0207650_100300262 254
975 3300025926 Ga0207659_10594550 Ga0207659_105945501 254
976 3300025941 Ga0207711_10018493 Ga0207711_100184933 254
977 3300025972 Ga0207668_10200757 Ga0207668_102007572 254
978 3300026088 Ga0207641_10509032 Ga0207641_105090321 254
979 3300026095 Ga0207676_10066334 Ga0207676_100663342 254
980 3300031824 Ga0307413_10199897 Ga0307413_101998972 254
981 3300031995 Ga0307409_100752330 Ga0307409_1007523301 254
982 3300042876 Ga0451577_0046106 Ga0451577_0046106_609_1376 254
983 3300044712 Ga0453684_0089547 Ga0453684_0089547_897_1664 254
984 3300045051 Ga0451576_0241660 Ga0451576_0241660_335_1102 254
985 3300047320 Ga0495672_0008073 Ga0495672_0008073_4008_4778 254
986 3300049571 Ga0501034_0326280 Ga0501034_0326280_573_1337 254
987 3300049573 Ga0501037_0355057 Ga0501037_0355057_180_944 254
988 3300049822 Ga0501035_0038522 Ga0501035_0038522_3392_4156 254
989 3300049824 Ga0501045_0191513 Ga0501045_0191513_550_1317 254
990 3300050512 nmdc:mga0n895_295342_c1 nmdc:mga0n895_295342_c1_713_1492 254
991 3300050513 nmdc:mga0rr50_13705_c1 nmdc:mga0rr50_13705_c1_2469_3248 254
992 3300005329 Ga0070683_100003542 Ga0070683_10000354212 255
993 3300005336 Ga0070680_100004005 Ga0070680_1000040053 255
994 3300005436 Ga0070713_100001130 Ga0070713_10000113010 255
995 3300005458 Ga0070681_10243420 Ga0070681_102434202 255
996 3300005458 Ga0070681_10285019 Ga0070681_102850192 255
997 3300005530 Ga0070679_100048845 Ga0070679_1000488452 255
998 3300005535 Ga0070684_100010985 Ga0070684_1000109852 255
999 3300005535 Ga0070684_100130303 Ga0070684_1001303032 255
1000 3300005577 Ga0068857_100243826 Ga0068857_1002438262 255
1001 3300009174 Ga0105241_10124929 Ga0105241_101249292 255
1002 3300013100 Ga0157373_10182621 Ga0157373_101826212 255
1003 3300013104 Ga0157370_10000311 Ga0157370_1000031155 255
1004 3300013104 Ga0157370_10049871 Ga0157370_100498714 255
1005 3300013307 Ga0157372_10243070 Ga0157372_102430702 255
1006 3300020070 Ga0206356_10634794 Ga0206356_106347942 255
1007 3300025911 Ga0207654_10179755 Ga0207654_101797551 255
1008 3300025912 Ga0207707_10020488 Ga0207707_100204883 255
1009 3300025912 Ga0207707_10218880 Ga0207707_102188801 255
1010 3300025913 Ga0207695_10028639 Ga0207695_100286392 255
1011 3300025917 Ga0207660_10035605 Ga0207660_100356052 255
1012 3300025921 Ga0207652_10016515 Ga0207652_100165154 255
1013 3300025944 Ga0207661_10101931 Ga0207661_101019312 255
1014 3300025944 Ga0207661_10130283 Ga0207661_101302832 255
1015 3300026116 Ga0207674_10045964 Ga0207674_100459645 255
1016 3300031548 Ga0307408_100051172 Ga0307408_1000511722 255
1017 3300031712 Ga0265342_10002983 Ga0265342_100029839 255
1018 3300031731 Ga0307405_10006609 Ga0307405_100066094 255
1019 3300031824 Ga0307413_10006790 Ga0307413_100067903 255
1020 3300031852 Ga0307410_10020830 Ga0307410_100208302 255
1021 3300031903 Ga0307407_10015673 Ga0307407_100156733 255
1022 3300031911 Ga0307412_10002809 Ga0307412_100028098 255
1023 3300031995 Ga0307409_100009742 Ga0307409_1000097425 255
1024 3300032002 Ga0307416_100003759 Ga0307416_1000037592 255
1025 3300032004 Ga0307414_10015982 Ga0307414_100159825 255
1026 3300032005 Ga0307411_10079257 Ga0307411_100792572 255
1027 3300032126 Ga0307415_100013459 Ga0307415_1000134593 255
1028 3300035086 Ga0373934_0008664 Ga0373934_0008664_271_1047 255
1029 3300035172 Ga0373955_0042312 Ga0373955_0042312_158_934 255
1030 3300035410 Ga0373924_0151529 Ga0373924_0151529_52_828 255
1031 3300035724 Ga0373933_0005244 Ga0373933_0005244_3287_4063 255
1032 3300036401 Ga0373937_0000329 Ga0373937_0000329_21200_21976 255
1033 3300037312 Ga0395899_0020501 Ga0395899_0020501_2217_2990 255
1034 3300037418 Ga0395900_0020640 Ga0395900_0020640_4660_5433 255
1035 3300037466 Ga0395898_0042905 Ga0395898_0042905_2492_3265 255
1036 3300038443 Ga0395901_0012864 Ga0395901_0012864_7623_8396 255
1037 3300046462 Ga0495651_0095693 Ga0495651_0095693_196_972 255
1038 3300046463 Ga0495653_0066752 Ga0495653_0066752_296_1072 255
1039 3300046475 Ga0495639_0063738 Ga0495639_0063738_518_1294 255
1040 3300046516 Ga0495628_0009614 Ga0495628_0009614_5764_6540 255
1041 3300046529 Ga0495652_0063127 Ga0495652_0063127_1584_2360 255
1042 3300046536 Ga0495587_0006400 Ga0495587_0006400_6681_7457 255
1043 3300046679 Ga0495623_0030521 Ga0495623_0030521_1520_2296 255
1044 3300046809 Ga0495600_0128800 Ga0495600_0128800_506_1282 255
1045 3300047317 Ga0495604_0150251 Ga0495604_0150251_609_1385 255
1046 3300047319 Ga0495674_0343802 Ga0495674_0343802_391_1167 255
1047 3300047444 Ga0495675_0248445 Ga0495675_0248445_104_880 255
1048 3300049584 Ga0501068_0123917 Ga0501068_0123917_689_1456 255
1049 3300049593 Ga0501077_0086085 Ga0501077_0086085_94_861 255
1050 3300053077 Ga0495601_0108896 Ga0495601_0108896_285_1061 255
1051 3300053085 Ga0495619_0104008 Ga0495619_0104008_396_1172 255
1052 3300005289 Ga0065704_10094572 Ga0065704_100945722 256
1053 3300005295 Ga0065707_10002538 Ga0065707_100025382 256
1054 3300005328 Ga0070676_10201227 Ga0070676_102012272 256
1055 3300005329 Ga0070683_100000167 Ga0070683_10000016739 256
1056 3300005329 Ga0070683_100067226 Ga0070683_1000672262 256
1057 3300005329 Ga0070683_100096920 Ga0070683_1000969202 256
1058 3300005335 Ga0070666_10198684 Ga0070666_101986842 256
1059 3300005336 Ga0070680_100064404 Ga0070680_1000644042 256
1060 3300005338 Ga0068868_100033101 Ga0068868_1000331014 256
1061 3300005340 Ga0070689_100092574 Ga0070689_1000925742 256
1062 3300005343 Ga0070687_100089947 Ga0070687_1000899471 256
1063 3300005344 Ga0070661_100152697 Ga0070661_1001526971 256
1064 3300005347 Ga0070668_100202352 Ga0070668_1002023521 256
1065 3300005366 Ga0070659_100009038 Ga0070659_1000090386 256
1066 3300005367 Ga0070667_100132179 Ga0070667_1001321791 256
1067 3300005434 Ga0070709_10049249 Ga0070709_100492493 256
1068 3300005440 Ga0070705_100327896 Ga0070705_1003278961 256
1069 3300005445 Ga0070708_100000075 Ga0070708_10000007554 256
1070 3300005445 Ga0070708_100004873 Ga0070708_10000487313 256
1071 3300005445 Ga0070708_100143567 Ga0070708_1001435672 256
1072 3300005455 Ga0070663_100015483 Ga0070663_1000154833 256
1073 3300005457 Ga0070662_100060350 Ga0070662_1000603503 256
1074 3300005458 Ga0070681_10051531 Ga0070681_100515312 256
1075 3300005467 Ga0070706_100009626 Ga0070706_1000096266 256
1076 3300005467 Ga0070706_100021390 Ga0070706_1000213904 256
1077 3300005468 Ga0070707_100006739 Ga0070707_1000067394 256
1078 3300005468 Ga0070707_100294352 Ga0070707_1002943522 256
1079 3300005471 Ga0070698_100011487 Ga0070698_1000114874 256
1080 3300005471 Ga0070698_100027831 Ga0070698_1000278313 256
1081 3300005518 Ga0070699_100007997 Ga0070699_10000799714 256
1082 3300005518 Ga0070699_100009667 Ga0070699_1000096677 256
1083 3300005518 Ga0070699_100036215 Ga0070699_1000362154 256
1084 3300005518 Ga0070699_100110974 Ga0070699_1001109743 256
1085 3300005530 Ga0070679_100435705 Ga0070679_1004357051 256
1086 3300005530 Ga0070679_100597469 Ga0070679_1005974691 256
1087 3300005535 Ga0070684_100036065 Ga0070684_1000360653 256
1088 3300005535 Ga0070684_100137842 Ga0070684_1001378422 256
1089 3300005535 Ga0070684_100188076 Ga0070684_1001880762 256
1090 3300005536 Ga0070697_100008915 Ga0070697_1000089157 256
1091 3300005536 Ga0070697_100009287 Ga0070697_1000092873 256
1092 3300005543 Ga0070672_100026672 Ga0070672_1000266723 256
1093 3300005563 Ga0068855_100503572 Ga0068855_1005035722 256
1094 3300005564 Ga0070664_100114073 Ga0070664_1001140731 256
1095 3300005577 Ga0068857_100011109 Ga0068857_1000111096 256
1096 3300005614 Ga0068856_100160048 Ga0068856_1001600482 256
1097 3300005618 Ga0068864_100247571 Ga0068864_1002475712 256
1098 3300005719 Ga0068861_100019081 Ga0068861_1000190812 256
1099 3300005842 Ga0068858_100196931 Ga0068858_1001969312 256
1100 3300005844 Ga0068862_100132445 Ga0068862_1001324452 256
1101 3300006058 Ga0075432_10130116 Ga0075432_101301161 256
1102 3300006844 Ga0075428_100051192 Ga0075428_1000511923 256
1103 3300006844 Ga0075428_100057685 Ga0075428_1000576852 256
1104 3300006844 Ga0075428_100071962 Ga0075428_1000719623 256
1105 3300006847 Ga0075431_100006275 Ga0075431_10000627510 256
1106 3300006847 Ga0075431_100529777 Ga0075431_1005297772 256
1107 3300006852 Ga0075433_10023858 Ga0075433_100238583 256
1108 3300006852 Ga0075433_10029664 Ga0075433_100296642 256
1109 3300006852 Ga0075433_10035491 Ga0075433_100354912 256
1110 3300006852 Ga0075433_10104854 Ga0075433_101048542 256
1111 3300006871 Ga0075434_100093491 Ga0075434_1000934913 256
1112 3300006880 Ga0075429_100014752 Ga0075429_1000147525 256
1113 3300006914 Ga0075436_100008948 Ga0075436_1000089485 256
1114 3300007076 Ga0075435_100115161 Ga0075435_1001151612 256
1115 3300007076 Ga0075435_100470554 Ga0075435_1004705541 256
1116 3300009147 Ga0114129_10097509 Ga0114129_100975092 256
1117 3300009177 Ga0105248_10154882 Ga0105248_101548823 256
1118 3300009553 Ga0105249_10332136 Ga0105249_103321362 256
1119 3300011119 Ga0105246_10545717 Ga0105246_105457172 256
1120 3300013102 Ga0157371_10205901 Ga0157371_102059011 256
1121 3300013105 Ga0157369_10255814 Ga0157369_102558142 256
1122 3300025315 Ga0207697_10006392 Ga0207697_100063925 256
1123 3300025906 Ga0207699_10000990 Ga0207699_1000099010 256
1124 3300025910 Ga0207684_10005196 Ga0207684_1000519611 256
1125 3300025910 Ga0207684_10044459 Ga0207684_100444591 256
1126 3300025912 Ga0207707_10033649 Ga0207707_100336494 256
1127 3300025915 Ga0207693_10031705 Ga0207693_100317053 256
1128 3300025916 Ga0207663_10067351 Ga0207663_100673512 256
1129 3300025918 Ga0207662_10186218 Ga0207662_101862182 256
1130 3300025920 Ga0207649_10045358 Ga0207649_100453582 256
1131 3300025920 Ga0207649_10057496 Ga0207649_100574963 256
1132 3300025921 Ga0207652_10285114 Ga0207652_102851142 256
1133 3300025922 Ga0207646_10002828 Ga0207646_1000282823 256
1134 3300025932 Ga0207690_10054671 Ga0207690_100546711 256
1135 3300025933 Ga0207706_10184546 Ga0207706_101845462 256
1136 3300025940 Ga0207691_10012186 Ga0207691_100121864 256
1137 3300025941 Ga0207711_10049151 Ga0207711_100491513 256
1138 3300025944 Ga0207661_10088576 Ga0207661_100885761 256
1139 3300025945 Ga0207679_10022240 Ga0207679_100222405 256
1140 3300025945 Ga0207679_10051565 Ga0207679_100515652 256
1141 3300025972 Ga0207668_10091785 Ga0207668_100917852 256
1142 3300026023 Ga0207677_10182995 Ga0207677_101829952 256
1143 3300026041 Ga0207639_10705538 Ga0207639_107055381 256
1144 3300026067 Ga0207678_10061517 Ga0207678_100615172 256
1145 3300026088 Ga0207641_10433006 Ga0207641_104330061 256
1146 3300026116 Ga0207674_10010897 Ga0207674_100108973 256
1147 3300026116 Ga0207674_10059883 Ga0207674_100598833 256
1148 3300026118 Ga0207675_100000197 Ga0207675_10000019747 256
1149 3300026142 Ga0207698_10154207 Ga0207698_101542072 256
1150 3300028379 Ga0268266_10395652 Ga0268266_103956522 256
1151 3300028380 Ga0268265_10102978 Ga0268265_101029782 256
1152 3300031548 Ga0307408_100097461 Ga0307408_1000974612 256
1153 3300031548 Ga0307408_100206896 Ga0307408_1002068962 256
1154 3300031731 Ga0307405_10012109 Ga0307405_100121092 256
1155 3300031824 Ga0307413_10003779 Ga0307413_100037799 256
1156 3300031824 Ga0307413_10007348 Ga0307413_100073484 256
1157 3300031852 Ga0307410_10002673 Ga0307410_100026735 256
1158 3300031852 Ga0307410_10073357 Ga0307410_100733572 256
1159 3300031901 Ga0307406_10014255 Ga0307406_100142553 256
1160 3300031901 Ga0307406_10025477 Ga0307406_100254771 256
1161 3300031903 Ga0307407_10008351 Ga0307407_100083514 256
1162 3300031911 Ga0307412_10026618 Ga0307412_100266182 256
1163 3300031911 Ga0307412_10057573 Ga0307412_100575731 256
1164 3300031995 Ga0307409_100017868 Ga0307409_1000178684 256
1165 3300031995 Ga0307409_100036606 Ga0307409_1000366062 256
1166 3300032002 Ga0307416_100001346 Ga0307416_10000134611 256
1167 3300032002 Ga0307416_100007380 Ga0307416_1000073804 256
1168 3300032004 Ga0307414_10002078 Ga0307414_100020787 256
1169 3300032005 Ga0307411_10000581 Ga0307411_1000058111 256
1170 3300032005 Ga0307411_10069501 Ga0307411_100695012 256
1171 3300032126 Ga0307415_100050422 Ga0307415_1000504222 256
1172 3300035692 Ga0373935_0114251 Ga0373935_0114251_982_1761 256
1173 3300035695 Ga0373927_0016654 Ga0373927_0016654_3239_4018 256
1174 3300037471 Ga0395905_0038021 Ga0395905_0038021_1285_2070 256
1175 3300037471 Ga0395905_0656178 Ga0395905_0656178_73_858 256
1176 3300039437 Ga0436365_1243926 Ga0436365_1243926_2736_3512 256
1177 3300042005 Ga0439448_0079057 Ga0439448_0079057_22_798 256
1178 3300042876 Ga0451577_0030104 Ga0451577_0030104_591_1379 256
1179 3300044694 Ga0466963_0194703 Ga0466963_0194703_39_815 256
1180 3300044712 Ga0453684_0028563 Ga0453684_0028563_6318_7106 256
1181 3300046472 Ga0495580_0024389 Ga0495580_0024389_3634_4413 256
1182 3300046499 Ga0495594_0013448 Ga0495594_0013448_3277_4056 256
1183 3300046517 Ga0495630_0372006 Ga0495630_0372006_40_819 256
1184 3300046535 Ga0495586_0022426 Ga0495586_0022426_255_1034 256
1185 3300046674 Ga0495588_0179956 Ga0495588_0179956_141_920 256
1186 3300048915 Ga0496112_0457270 Ga0496112_0457270_359_1138 256
1187 3300049568 Ga0501031_0031047 Ga0501031_0031047_1315_2100 256
1188 3300049575 Ga0501039_0038893 Ga0501039_0038893_767_1552 256
1189 3300049576 Ga0501040_0253895 Ga0501040_0253895_146_931 256
1190 3300049577 Ga0501041_0180991 Ga0501041_0180991_64_837 256
1191 3300049580 Ga0501046_0199679 Ga0501046_0199679_334_1119 256
1192 3300049580 Ga0501046_0310223 Ga0501046_0310223_259_1032 256
1193 3300049585 Ga0501069_0324404 Ga0501069_0324404_89_871 256
1194 3300049588 Ga0501072_0132326 Ga0501072_0132326_595_1368 256
1195 3300049591 Ga0501075_0004754 Ga0501075_0004754_4468_5253 256
1196 3300049592 Ga0501076_0199529 Ga0501076_0199529_395_1180 256
1197 3300049593 Ga0501077_0025512 Ga0501077_0025512_2710_3495 256
1198 3300049741 Ga0501079_0149253 Ga0501079_0149253_272_1057 256
1199 3300049744 Ga0501083_0026838 Ga0501083_0026838_2983_3768 256
1200 3300049765 Ga0501268_004967 Ga0501268_004967_1095_1880 256
1201 3300049824 Ga0501045_0023179 Ga0501045_0023179_1501_2286 256
1202 3300050507 nmdc:mga05p37_19421_c1 nmdc:mga05p37_19421_c1_578_1363 256
1203 3300050508 nmdc:mga09592_3549_c1 nmdc:mga09592_3549_c1_1509_2294 256
1204 3300050510 nmdc:mga06r32_5005_c1 nmdc:mga06r32_5005_c1_5497_6282 256
1205 3300050512 nmdc:mga0n895_14834_c1 nmdc:mga0n895_14834_c1_3884_4678 256
1206 3300050512 nmdc:mga0n895_468062_c1 nmdc:mga0n895_468062_c1_11_796 256
1207 3300050512 nmdc:mga0n895_61534_c1 nmdc:mga0n895_61534_c1_1822_2598 256
1208 3300050512 nmdc:mga0n895_63991_c1 nmdc:mga0n895_63991_c1_287_1072 256
1209 3300050513 nmdc:mga0rr50_315618_c1 nmdc:mga0rr50_315618_c1_460_1245 256
1210 3300050513 nmdc:mga0rr50_48114_c1 nmdc:mga0rr50_48114_c1_11_796 256
1211 3300050513 nmdc:mga0rr50_562803_c1 nmdc:mga0rr50_562803_c1_153_929 256
1212 3300050515 nmdc:mga0a205_110082_c1 nmdc:mga0a205_110082_c1_319_1113 256
1213 3300050515 nmdc:mga0a205_14260_c1 nmdc:mga0a205_14260_c1_6113_6889 256
1214 3300050515 nmdc:mga0a205_23798_c1 nmdc:mga0a205_23798_c1_11_796 256
1215 3300050515 nmdc:mga0a205_26058_c1 nmdc:mga0a205_26058_c1_3568_4353 256
1216 3300054114 Ga0501084_0238060 Ga0501084_0238060_420_1205 256
1217 3300005535 Ga0070684_100353416 Ga0070684_1003534162 257
1218 3300009553 Ga0105249_10249384 Ga0105249_102493842 257
1219 3300025961 Ga0207712_10157785 Ga0207712_101577852 257
1220 3300031548 Ga0307408_100220320 Ga0307408_1002203202 257
1221 3300046462 Ga0495651_0090723 Ga0495651_0090723_1448_2221 257
1222 3300046472 Ga0495580_0162776 Ga0495580_0162776_73_870 257
1223 3300046499 Ga0495594_0026158 Ga0495594_0026158_213_986 257
1224 3300046516 Ga0495628_0081157 Ga0495628_0081157_1656_2429 257
1225 3300046529 Ga0495652_0074609 Ga0495652_0074609_2012_2785 257
1226 3300046533 Ga0495640_0142602 Ga0495640_0142602_107_880 257
1227 3300046536 Ga0495587_0051602 Ga0495587_0051602_1580_2353 257
1228 3300046559 Ga0495667_0105862 Ga0495667_0105862_83_856 257
1229 3300046642 Ga0495634_0069995 Ga0495634_0069995_46_819 257
1230 3300047444 Ga0495675_0192954 Ga0495675_0192954_395_1168 257
1231 3300047471 Ga0495684_0118463 Ga0495684_0118463_1148_1921 257
1232 3300048088 Ga0495602_0149486 Ga0495602_0149486_68_841 257
1233 3300049571 Ga0501034_0043443 Ga0501034_0043443_2537_3310 257
1234 3300049572 Ga0501036_0227478 Ga0501036_0227478_505_1278 257
1235 3300049585 Ga0501069_0038928 Ga0501069_0038928_1556_2329 257
1236 3300049588 Ga0501072_0012568 Ga0501072_0012568_2282_3055 257
1237 3300049588 Ga0501072_0442603 Ga0501072_0442603_29_802 257
1238 3300049590 Ga0501074_0162757 Ga0501074_0162757_336_1109 257
1239 3300049742 Ga0501080_0311000 Ga0501080_0311000_314_1087 257
1240 3300049742 Ga0501080_0356272 Ga0501080_0356272_357_1130 257
1241 3300049743 Ga0501081_0080724 Ga0501081_0080724_672_1445 257
1242 3300060353 Ga0501082_0500934 Ga0501082_0500934_98_871 257
1243 3300005467 Ga0070706_100268626 Ga0070706_1002686262 259
1244 3300005471 Ga0070698_100035975 Ga0070698_1000359752 259
1245 3300025910 Ga0207684_10040882 Ga0207684_100408823 259
1246 3300025921 Ga0207652_10004726 Ga0207652_100047269 259
1247 3300031995 Ga0307409_100265762 Ga0307409_1002657622 259
1248 3300049582 Ga0501048_0200132 Ga0501048_0200132_502_1293 259
1249 3300003203 JGI25406J46586_10005498 JGI25406J46586_100054985 260
1250 3300005985 Ga0081539_10000117 Ga0081539_10000117117 260
1251 3300042156 Ga0439446_0042563 Ga0439446_0042563_23_853 260
1252 3300042435 Ga0439434_0069709 Ga0439434_0069709_247_1077 260
1253 3300046664 Ga0495659_0026699 Ga0495659_0026699_907_1695 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

32

189

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9576 1 230
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9514 1 243
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9339 1 230
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9327 1 243
2d3w-assembly1.cif.gz_C crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery 0.9201 1 243
ID Description Score Start End Superfamily
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.963 2 247 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9589 1 244 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9401 1 244 3.40.50.300
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9331 2 247 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9082 1 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382HLW2-F1-model_v4 ABC transporter domain-containing protein 0.9827 8 236 GO:0005524
GO:0016887
AF-A0A537HGZ3-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9784 2 249 GO:0005524
GO:0016887
AF-A0A200QTB1-F1-model_v4 ABC transporter-like 0.9773 1 245 GO:0005524
GO:0016887
AF-A0A7X6GVV0-F1-model_v4 deleted 0.9754 1 247
AF-A0A382HLW2-F1-model_v4 ABC transporter domain-containing protein 0.9743 8 236 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.13 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map