F492214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1253 | 405 | 1251 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100036398|Ga0070683_1000363982 |
| Length | 278 |
| Sequence | VVPSEEQIVTRKGVALLEINDLHANIGEKEILKGITLSVKAGEVHAVMGPNGSGKSTLAQVLAGHPSYEVTKGTVAYDGENLLEMDAEVRAQNGIFLAFQYPVEIPGVSNAYFLRSAYNEIRKSKGMEEVDPLEFLDLMEEKLKLVDMDSAMLQRSVNSGFSGGEKKRNEILQMAVLAPRLAILDETDSGLDIDALRIVAEGVNKLRSPENATILVTHYQRLLNYIVPDQVHVLAGGRIVRSGGKELALELEEKGYDWIQSESGNGVTGRSRVQAGAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 2 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 239 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 242 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 257 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 261 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 263 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 266 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 267 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 273 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 365 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 366 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 367 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 368 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 369 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 372 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 373 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 374 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 375 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 376 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 377 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 378 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 385 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 386 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 387 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 0.88 |
| Isolates | 0.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.08 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 98.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005498 | 3300003203 | Bacteria | 5871 |
| 2 | Ga0058861_12069260 | 3300004800 | Bacteria | 2101 |
| 3 | Ga0058862_10049606 | 3300004803 | Bacteria | 3008 |
| 4 | Ga0065704_10006494 | 3300005289 | Bacteria | 2861 |
| 5 | Ga0065704_10094572 | 3300005289 | Bacteria | 2536 |
| 6 | Ga0065715_10151452 | 3300005293 | Bacteria | 1722 |
| 7 | Ga0065707_10002538 | 3300005295 | Bacteria | 4699 |
| 8 | Ga0065707_10043917 | 3300005295 | Bacteria | 1105 |
| 9 | Ga0065707_10115807 | 3300005295 | Bacteria | 2256 |
| 10 | Ga0070658_10035350 | 3300005327 | Bacteria | 4024 |
| 11 | Ga0070658_10054442 | 3300005327 | Bacteria | 3249 |
| 12 | Ga0070676_10004169 | 3300005328 | Bacteria | 7591 |
| 13 | Ga0070676_10110410 | 3300005328 | Bacteria | 1712 |
| 14 | Ga0070676_10201227 | 3300005328 | Bacteria | 1305 |
| 15 | Ga0070683_100000167 | 3300005329 | Bacteria | 43044 |
| 16 | Ga0070683_100002754 | 3300005329 | Bacteria | 14047 |
| 17 | Ga0070683_100003542 | 3300005329 | Bacteria | 12706 |
| 18 | Ga0070683_100022256 | 3300005329 | Bacteria | 5663 |
| 19 | Ga0070683_100036398 | 3300005329 | Bacteria | 4503 |
| 20 | Ga0070683_100040754 | 3300005329 | Bacteria | 4270 |
| 21 | Ga0070683_100062308 | 3300005329 | Bacteria | 3468 |
| 22 | Ga0070683_100064429 | 3300005329 | Bacteria | 3412 |
| 23 | Ga0070683_100067226 | 3300005329 | Bacteria | 3338 |
| 24 | Ga0070683_100096920 | 3300005329 | Bacteria | 2774 |
| 25 | Ga0070683_100099343 | 3300005329 | Bacteria | 2739 |
| 26 | Ga0070683_100183067 | 3300005329 | Bacteria | 1989 |
| 27 | Ga0070683_100239943 | 3300005329 | Bacteria | 1724 |
| 28 | Ga0070683_100257895 | 3300005329 | Bacteria | 1658 |
| 29 | Ga0070690_100114752 | 3300005330 | Bacteria | 1801 |
| 30 | Ga0070670_100055309 | 3300005331 | Bacteria | 3406 |
| 31 | Ga0070670_100343809 | 3300005331 | Bacteria | 1310 |
| 32 | Ga0068869_100004425 | 3300005334 | Bacteria | 8732 |
| 33 | Ga0070666_10006434 | 3300005335 | Bacteria | 7220 |
| 34 | Ga0070666_10198684 | 3300005335 | Bacteria | 1411 |
| 35 | Ga0070680_100004005 | 3300005336 | Bacteria | 11023 |
| 36 | Ga0070680_100006270 | 3300005336 | Bacteria | 9024 |
| 37 | Ga0070680_100008958 | 3300005336 | Bacteria | 7671 |
| 38 | Ga0070680_100026034 | 3300005336 | Bacteria | 4678 |
| 39 | Ga0070680_100027460 | 3300005336 | Bacteria | 4557 |
| 40 | Ga0070680_100030681 | 3300005336 | Bacteria | 4320 |
| 41 | Ga0070680_100064404 | 3300005336 | Bacteria | 3005 |
| 42 | Ga0070680_100073783 | 3300005336 | Bacteria | 2807 |
| 43 | Ga0070680_100172497 | 3300005336 | Bacteria | 1820 |
| 44 | Ga0070680_100228288 | 3300005336 | Bacteria | 1572 |
| 45 | Ga0070680_100279694 | 3300005336 | Bacteria | 1414 |
| 46 | Ga0070682_100000734 | 3300005337 | Bacteria | 19649 |
| 47 | Ga0070682_100000969 | 3300005337 | Bacteria | 16679 |
| 48 | Ga0070682_100005193 | 3300005337 | Bacteria | 7243 |
| 49 | Ga0070682_100130206 | 3300005337 | Bacteria | 1702 |
| 50 | Ga0068868_100001690 | 3300005338 | Bacteria | 15098 |
| 51 | Ga0068868_100033101 | 3300005338 | Bacteria | 3982 |
| 52 | Ga0070660_100058628 | 3300005339 | Bacteria | 2984 |
| 53 | Ga0070660_100174291 | 3300005339 | Bacteria | 1739 |
| 54 | Ga0070689_100090750 | 3300005340 | Bacteria | 2408 |
| 55 | Ga0070689_100092574 | 3300005340 | Bacteria | 2384 |
| 56 | Ga0070689_100439768 | 3300005340 | Bacteria | 1108 |
| 57 | Ga0070689_100451767 | 3300005340 | Bacteria | 1093 |
| 58 | Ga0070691_10029397 | 3300005341 | Bacteria | 2570 |
| 59 | Ga0070691_10094372 | 3300005341 | Bacteria | 1479 |
| 60 | Ga0070691_10129826 | 3300005341 | Bacteria | 1276 |
| 61 | Ga0070687_100089947 | 3300005343 | Bacteria | 1696 |
| 62 | Ga0070661_100010786 | 3300005344 | Bacteria | 6362 |
| 63 | Ga0070661_100011176 | 3300005344 | Bacteria | 6254 |
| 64 | Ga0070661_100029581 | 3300005344 | Bacteria | 3955 |
| 65 | Ga0070661_100111778 | 3300005344 | Bacteria | 2041 |
| 66 | Ga0070661_100152697 | 3300005344 | Bacteria | 1746 |
| 67 | Ga0070692_10283019 | 3300005345 | Bacteria | 1006 |
| 68 | Ga0070668_100093855 | 3300005347 | Bacteria | 2368 |
| 69 | Ga0070668_100202352 | 3300005347 | Bacteria | 1630 |
| 70 | Ga0070668_100572496 | 3300005347 | Bacteria | 985 |
| 71 | Ga0070669_100008716 | 3300005353 | Bacteria | 7236 |
| 72 | Ga0070669_100030646 | 3300005353 | Bacteria | 3882 |
| 73 | Ga0070669_100087621 | 3300005353 | Bacteria | 2328 |
| 74 | Ga0070675_100136223 | 3300005354 | Bacteria | 2096 |
| 75 | Ga0070671_100006816 | 3300005355 | Bacteria | 9143 |
| 76 | Ga0070671_100023258 | 3300005355 | Bacteria | 5070 |
| 77 | Ga0070671_100219010 | 3300005355 | Bacteria | 1615 |
| 78 | Ga0070674_100000031 | 3300005356 | Bacteria | 67745 |
| 79 | Ga0070674_100056773 | 3300005356 | Bacteria | 2715 |
| 80 | Ga0070673_100008731 | 3300005364 | Bacteria | 6764 |
| 81 | Ga0070673_100014635 | 3300005364 | Bacteria | 5475 |
| 82 | Ga0070659_100009038 | 3300005366 | Bacteria | 7311 |
| 83 | Ga0070659_100013907 | 3300005366 | Bacteria | 6005 |
| 84 | Ga0070659_100027964 | 3300005366 | Bacteria | 4350 |
| 85 | Ga0070659_100030146 | 3300005366 | Bacteria | 4196 |
| 86 | Ga0070659_100034971 | 3300005366 | Bacteria | 3910 |
| 87 | Ga0070659_100042432 | 3300005366 | Bacteria | 3555 |
| 88 | Ga0070659_100212643 | 3300005366 | Bacteria | 1594 |
| 89 | Ga0070667_100132179 | 3300005367 | Bacteria | 2179 |
| 90 | Ga0070703_10014251 | 3300005406 | Bacteria | 2263 |
| 91 | Ga0070703_10066636 | 3300005406 | Bacteria | 1191 |
| 92 | Ga0070709_10001476 | 3300005434 | Bacteria | 12692 |
| 93 | Ga0070709_10008761 | 3300005434 | Bacteria | 5565 |
| 94 | Ga0070709_10023862 | 3300005434 | Bacteria | 3597 |
| 95 | Ga0070709_10049249 | 3300005434 | Bacteria | 2633 |
| 96 | Ga0070709_10162982 | 3300005434 | Bacteria | 1552 |
| 97 | Ga0070709_10211216 | 3300005434 | Bacteria | 1380 |
| 98 | Ga0070709_10596653 | 3300005434 | Bacteria | 850 |
| 99 | Ga0070714_100013494 | 3300005435 | Bacteria | 6549 |
| 100 | Ga0070714_100034277 | 3300005435 | Bacteria | 4251 |
| 101 | Ga0070714_100046215 | 3300005435 | Bacteria | 3692 |
| 102 | Ga0070714_100187059 | 3300005435 | Bacteria | 1887 |
| 103 | Ga0070713_100000083 | 3300005436 | Bacteria | 59579 |
| 104 | Ga0070713_100001130 | 3300005436 | Bacteria | 17054 |
| 105 | Ga0070713_100203717 | 3300005436 | Bacteria | 1788 |
| 106 | Ga0070710_10016685 | 3300005437 | Bacteria | 3741 |
| 107 | Ga0070710_10018647 | 3300005437 | Bacteria | 3573 |
| 108 | Ga0070711_100000009 | 3300005439 | Bacteria | 172420 |
| 109 | Ga0070711_100000946 | 3300005439 | Bacteria | 15359 |
| 110 | Ga0070711_100041611 | 3300005439 | Bacteria | 3104 |
| 111 | Ga0070711_100113196 | 3300005439 | Bacteria | 1995 |
| 112 | Ga0070705_100010188 | 3300005440 | Bacteria | 4697 |
| 113 | Ga0070705_100164056 | 3300005440 | Bacteria | 1488 |
| 114 | Ga0070705_100279069 | 3300005440 | Bacteria | 1187 |
| 115 | Ga0070705_100327896 | 3300005440 | Bacteria | 1108 |
| 116 | Ga0070705_100357133 | 3300005440 | Bacteria | 1067 |
| 117 | Ga0070700_100035256 | 3300005441 | Bacteria | 3027 |
| 118 | Ga0070700_100036045 | 3300005441 | Bacteria | 2998 |
| 119 | Ga0070694_100002417 | 3300005444 | Bacteria | 11024 |
| 120 | Ga0070694_100004958 | 3300005444 | Bacteria | 8027 |
| 121 | Ga0070694_100019920 | 3300005444 | Bacteria | 4271 |
| 122 | Ga0070708_100000075 | 3300005445 | Bacteria | 63574 |
| 123 | Ga0070708_100004873 | 3300005445 | Bacteria | 10600 |
| 124 | Ga0070708_100075545 | 3300005445 | Bacteria | 3042 |
| 125 | Ga0070708_100076744 | 3300005445 | Bacteria | 3018 |
| 126 | Ga0070708_100143567 | 3300005445 | Bacteria | 2215 |
| 127 | Ga0070663_100015483 | 3300005455 | Bacteria | 4925 |
| 128 | Ga0070678_100067503 | 3300005456 | Bacteria | 2662 |
| 129 | Ga0070662_100000206 | 3300005457 | Bacteria | 34279 |
| 130 | Ga0070662_100060350 | 3300005457 | Bacteria | 2765 |
| 131 | Ga0070662_100175049 | 3300005457 | Bacteria | 1688 |
| 132 | Ga0070662_100381231 | 3300005457 | Bacteria | 1161 |
| 133 | Ga0070681_10001292 | 3300005458 | Bacteria | 21855 |
| 134 | Ga0070681_10007697 | 3300005458 | Bacteria | 10534 |
| 135 | Ga0070681_10012170 | 3300005458 | Bacteria | 8533 |
| 136 | Ga0070681_10020791 | 3300005458 | Bacteria | 6575 |
| 137 | Ga0070681_10051531 | 3300005458 | Bacteria | 4105 |
| 138 | Ga0070681_10105072 | 3300005458 | Bacteria | 2766 |
| 139 | Ga0070681_10243420 | 3300005458 | Bacteria | 1712 |
| 140 | Ga0070681_10275201 | 3300005458 | Bacteria | 1595 |
| 141 | Ga0070681_10285019 | 3300005458 | Bacteria | 1562 |
| 142 | Ga0068867_100000341 | 3300005459 | Bacteria | 30850 |
| 143 | Ga0068867_100027999 | 3300005459 | Bacteria | 4054 |
| 144 | Ga0068867_100041713 | 3300005459 | Bacteria | 3354 |
| 145 | Ga0068867_100220746 | 3300005459 | Bacteria | 1527 |
| 146 | Ga0070706_100009626 | 3300005467 | Bacteria | 8986 |
| 147 | Ga0070706_100021390 | 3300005467 | Bacteria | 5958 |
| 148 | Ga0070706_100109203 | 3300005467 | Bacteria | 2574 |
| 149 | Ga0070706_100268626 | 3300005467 | Bacteria | 1592 |
| 150 | Ga0070707_100006739 | 3300005468 | Bacteria | 10645 |
| 151 | Ga0070707_100131992 | 3300005468 | Bacteria | 2429 |
| 152 | Ga0070707_100222611 | 3300005468 | Bacteria | 1837 |
| 153 | Ga0070707_100294352 | 3300005468 | Bacteria | 1577 |
| 154 | Ga0070707_100321207 | 3300005468 | Bacteria | 1504 |
| 155 | Ga0070707_100469507 | 3300005468 | Bacteria | 1219 |
| 156 | Ga0070698_100001439 | 3300005471 | Bacteria | 26401 |
| 157 | Ga0070698_100001472 | 3300005471 | Bacteria | 26148 |
| 158 | Ga0070698_100011487 | 3300005471 | Bacteria | 9396 |
| 159 | Ga0070698_100027831 | 3300005471 | Bacteria | 5874 |
| 160 | Ga0070698_100035975 | 3300005471 | Bacteria | 5119 |
| 161 | Ga0070698_100284546 | 3300005471 | Bacteria | 1585 |
| 162 | Ga0070698_100350440 | 3300005471 | Bacteria | 1408 |
| 163 | Ga0070699_100000063 | 3300005518 | Bacteria | 100440 |
| 164 | Ga0070699_100007997 | 3300005518 | Bacteria | 9179 |
| 165 | Ga0070699_100009667 | 3300005518 | Bacteria | 8350 |
| 166 | Ga0070699_100022150 | 3300005518 | Bacteria | 5475 |
| 167 | Ga0070699_100029350 | 3300005518 | Bacteria | 4742 |
| 168 | Ga0070699_100036215 | 3300005518 | Bacteria | 4268 |
| 169 | Ga0070699_100037937 | 3300005518 | Bacteria | 4171 |
| 170 | Ga0070699_100041992 | 3300005518 | Bacteria | 3957 |
| 171 | Ga0070699_100102349 | 3300005518 | Bacteria | 2511 |
| 172 | Ga0070699_100102571 | 3300005518 | Bacteria | 2508 |
| 173 | Ga0070699_100110896 | 3300005518 | Bacteria | 2409 |
| 174 | Ga0070699_100110974 | 3300005518 | Bacteria | 2408 |
| 175 | Ga0070699_100161807 | 3300005518 | Bacteria | 1981 |
| 176 | Ga0070699_100184491 | 3300005518 | Bacteria | 1852 |
| 177 | Ga0070699_100197440 | 3300005518 | Bacteria | 1789 |
| 178 | Ga0070699_100553093 | 3300005518 | Bacteria | 1048 |
| 179 | Ga0070679_100000608 | 3300005530 | Bacteria | 30458 |
| 180 | Ga0070679_100007243 | 3300005530 | Bacteria | 10353 |
| 181 | Ga0070679_100007573 | 3300005530 | Bacteria | 10156 |
| 182 | Ga0070679_100016503 | 3300005530 | Bacteria | 7128 |
| 183 | Ga0070679_100026951 | 3300005530 | Bacteria | 5651 |
| 184 | Ga0070679_100047770 | 3300005530 | Bacteria | 4265 |
| 185 | Ga0070679_100048845 | 3300005530 | Bacteria | 4215 |
| 186 | Ga0070679_100068952 | 3300005530 | Bacteria | 3528 |
| 187 | Ga0070679_100122830 | 3300005530 | Bacteria | 2580 |
| 188 | Ga0070679_100195433 | 3300005530 | Bacteria | 1991 |
| 189 | Ga0070679_100215457 | 3300005530 | Bacteria | 1883 |
| 190 | Ga0070679_100364673 | 3300005530 | Bacteria | 1392 |
| 191 | Ga0070679_100435705 | 3300005530 | Bacteria | 1256 |
| 192 | Ga0070679_100597469 | 3300005530 | Bacteria | 1047 |
| 193 | Ga0070684_100000212 | 3300005535 | Bacteria | 40868 |
| 194 | Ga0070684_100010985 | 3300005535 | Bacteria | 7201 |
| 195 | Ga0070684_100028396 | 3300005535 | Bacteria | 4733 |
| 196 | Ga0070684_100036065 | 3300005535 | Bacteria | 4237 |
| 197 | Ga0070684_100060352 | 3300005535 | Bacteria | 3317 |
| 198 | Ga0070684_100130303 | 3300005535 | Bacteria | 2268 |
| 199 | Ga0070684_100137842 | 3300005535 | Bacteria | 2205 |
| 200 | Ga0070684_100188076 | 3300005535 | Bacteria | 1878 |
| 201 | Ga0070684_100353416 | 3300005535 | Bacteria | 1352 |
| 202 | Ga0070697_100008915 | 3300005536 | Bacteria | 7836 |
| 203 | Ga0070697_100009287 | 3300005536 | Bacteria | 7687 |
| 204 | Ga0070697_100140714 | 3300005536 | Bacteria | 2029 |
| 205 | Ga0070697_100260267 | 3300005536 | Bacteria | 1485 |
| 206 | Ga0068853_100004232 | 3300005539 | Bacteria | 11081 |
| 207 | Ga0068853_100314379 | 3300005539 | Bacteria | 1451 |
| 208 | Ga0068853_100408700 | 3300005539 | Bacteria | 1271 |
| 209 | Ga0068853_100530904 | 3300005539 | Bacteria | 1113 |
| 210 | Ga0070672_100026672 | 3300005543 | Bacteria | 4303 |
| 211 | Ga0070672_100085773 | 3300005543 | Bacteria | 2531 |
| 212 | Ga0070672_100179464 | 3300005543 | Bacteria | 1764 |
| 213 | Ga0070686_100004210 | 3300005544 | Bacteria | 7920 |
| 214 | Ga0070695_100001374 | 3300005545 | Bacteria | 13510 |
| 215 | Ga0070695_100006476 | 3300005545 | Bacteria | 6920 |
| 216 | Ga0070695_100007435 | 3300005545 | Bacteria | 6497 |
| 217 | Ga0070695_100021263 | 3300005545 | Bacteria | 3968 |
| 218 | Ga0070695_100036976 | 3300005545 | Bacteria | 3075 |
| 219 | Ga0070695_100069975 | 3300005545 | Bacteria | 2294 |
| 220 | Ga0070695_100146044 | 3300005545 | Bacteria | 1645 |
| 221 | Ga0070696_100003906 | 3300005546 | Bacteria | 9957 |
| 222 | Ga0070696_100004602 | 3300005546 | Bacteria | 9207 |
| 223 | Ga0070696_100006413 | 3300005546 | Bacteria | 7877 |
| 224 | Ga0070696_100008347 | 3300005546 | Bacteria | 6928 |
| 225 | Ga0070696_100145231 | 3300005546 | Bacteria | 1737 |
| 226 | Ga0070693_100019448 | 3300005547 | Bacteria | 3560 |
| 227 | Ga0070693_100070305 | 3300005547 | Bacteria | 2059 |
| 228 | Ga0070693_100208744 | 3300005547 | Bacteria | 1273 |
| 229 | Ga0070665_100275791 | 3300005548 | Bacteria | 1683 |
| 230 | Ga0070704_100000701 | 3300005549 | Bacteria | 16319 |
| 231 | Ga0070704_100091327 | 3300005549 | Bacteria | 2270 |
| 232 | Ga0070704_100228732 | 3300005549 | Bacteria | 1516 |
| 233 | Ga0070704_100363790 | 3300005549 | Bacteria | 1224 |
| 234 | Ga0068855_100004308 | 3300005563 | Bacteria | 17396 |
| 235 | Ga0068855_100019763 | 3300005563 | Bacteria | 8089 |
| 236 | Ga0068855_100056570 | 3300005563 | Bacteria | 4602 |
| 237 | Ga0068855_100267059 | 3300005563 | Bacteria | 1904 |
| 238 | Ga0068855_100437458 | 3300005563 | Bacteria | 1429 |
| 239 | Ga0068855_100503572 | 3300005563 | Bacteria | 1316 |
| 240 | Ga0068855_100862231 | 3300005563 | Bacteria | 959 |
| 241 | Ga0070664_100021929 | 3300005564 | Bacteria | 5266 |
| 242 | Ga0070664_100114073 | 3300005564 | Bacteria | 2361 |
| 243 | Ga0070664_100172892 | 3300005564 | Bacteria | 1917 |
| 244 | Ga0070664_100294411 | 3300005564 | Bacteria | 1465 |
| 245 | Ga0070664_100395866 | 3300005564 | Bacteria | 1262 |
| 246 | Ga0068857_100011109 | 3300005577 | Bacteria | 7833 |
| 247 | Ga0068857_100032635 | 3300005577 | Bacteria | 4603 |
| 248 | Ga0068857_100044817 | 3300005577 | Bacteria | 3924 |
| 249 | Ga0068857_100243826 | 3300005577 | Bacteria | 1646 |
| 250 | Ga0068854_100007149 | 3300005578 | Bacteria | 7130 |
| 251 | Ga0068854_100022840 | 3300005578 | Bacteria | 4267 |
| 252 | Ga0068854_100034250 | 3300005578 | Bacteria | 3546 |
| 253 | Ga0068856_100055886 | 3300005614 | Bacteria | 3895 |
| 254 | Ga0068856_100160048 | 3300005614 | Bacteria | 2262 |
| 255 | Ga0070702_100011576 | 3300005615 | Bacteria | 4391 |
| 256 | Ga0070702_100173395 | 3300005615 | Bacteria | 1405 |
| 257 | Ga0068852_100009676 | 3300005616 | Bacteria | 7163 |
| 258 | Ga0068852_100017011 | 3300005616 | Bacteria | 5693 |
| 259 | Ga0068852_100055286 | 3300005616 | Bacteria | 3425 |
| 260 | Ga0068852_100596017 | 3300005616 | Bacteria | 1109 |
| 261 | Ga0068852_100751719 | 3300005616 | Bacteria | 987 |
| 262 | Ga0068852_100761968 | 3300005616 | Bacteria | 980 |
| 263 | Ga0068859_100004322 | 3300005617 | Bacteria | 14490 |
| 264 | Ga0068859_100250507 | 3300005617 | Bacteria | 1862 |
| 265 | Ga0068859_100319717 | 3300005617 | Bacteria | 1646 |
| 266 | Ga0068864_100017774 | 3300005618 | Bacteria | 5932 |
| 267 | Ga0068864_100247571 | 3300005618 | Bacteria | 1653 |
| 268 | Ga0068866_10000048 | 3300005718 | Bacteria | 46904 |
| 269 | Ga0068866_10077480 | 3300005718 | Bacteria | 1776 |
| 270 | Ga0068861_100007877 | 3300005719 | Bacteria | 7331 |
| 271 | Ga0068861_100009043 | 3300005719 | Bacteria | 6867 |
| 272 | Ga0068861_100019081 | 3300005719 | Bacteria | 4896 |
| 273 | Ga0068870_10033736 | 3300005840 | Bacteria | 2614 |
| 274 | Ga0068863_100015626 | 3300005841 | Bacteria | 7292 |
| 275 | Ga0068863_100931988 | 3300005841 | Bacteria | 870 |
| 276 | Ga0068858_100021966 | 3300005842 | Bacteria | 5960 |
| 277 | Ga0068858_100030024 | 3300005842 | Bacteria | 5047 |
| 278 | Ga0068858_100194229 | 3300005842 | Bacteria | 1918 |
| 279 | Ga0068858_100196931 | 3300005842 | Bacteria | 1904 |
| 280 | Ga0068860_100020074 | 3300005843 | Bacteria | 6473 |
| 281 | Ga0068860_100151385 | 3300005843 | Bacteria | 2234 |
| 282 | Ga0068862_100010499 | 3300005844 | Bacteria | 7649 |
| 283 | Ga0068862_100012176 | 3300005844 | Bacteria | 7111 |
| 284 | Ga0068862_100132445 | 3300005844 | Bacteria | 2206 |
| 285 | Ga0068862_100142275 | 3300005844 | Bacteria | 2130 |
| 286 | Ga0081455_10066458 | 3300005937 | Bacteria | 3011 |
| 287 | Ga0081538_10050721 | 3300005981 | Bacteria | 2501 |
| 288 | Ga0081539_10000117 | 3300005985 | Bacteria | 185868 |
| 289 | Ga0070717_10001061 | 3300006028 | Bacteria | 18453 |
| 290 | Ga0070717_10396173 | 3300006028 | Bacteria | 1240 |
| 291 | Ga0075432_10130116 | 3300006058 | Bacteria | 953 |
| 292 | Ga0070716_100000911 | 3300006173 | Bacteria | 12772 |
| 293 | Ga0070716_100084807 | 3300006173 | Bacteria | 1901 |
| 294 | Ga0070712_100043380 | 3300006175 | Bacteria | 3096 |
| 295 | Ga0070712_100103070 | 3300006175 | Bacteria | 2115 |
| 296 | Ga0070712_100407614 | 3300006175 | Bacteria | 1124 |
| 297 | Ga0068871_100220782 | 3300006358 | Bacteria | 1642 |
| 298 | Ga0075428_100002193 | 3300006844 | Bacteria | 21123 |
| 299 | Ga0075428_100042612 | 3300006844 | Bacteria | 4991 |
| 300 | Ga0075428_100051192 | 3300006844 | Bacteria | 4528 |
| 301 | Ga0075428_100057685 | 3300006844 | Bacteria | 4250 |
| 302 | Ga0075428_100071962 | 3300006844 | Bacteria | 3778 |
| 303 | Ga0075430_100000158 | 3300006846 | Bacteria | 44327 |
| 304 | Ga0075430_100013207 | 3300006846 | Bacteria | 7036 |
| 305 | Ga0075430_100044776 | 3300006846 | Bacteria | 3740 |
| 306 | Ga0075430_100048026 | 3300006846 | Bacteria | 3604 |
| 307 | Ga0075430_100054096 | 3300006846 | Bacteria | 3378 |
| 308 | Ga0075430_100164489 | 3300006846 | Bacteria | 1846 |
| 309 | Ga0075430_100427800 | 3300006846 | Bacteria | 1093 |
| 310 | Ga0075431_100006275 | 3300006847 | Bacteria | 11812 |
| 311 | Ga0075431_100060004 | 3300006847 | Bacteria | 3925 |
| 312 | Ga0075431_100089007 | 3300006847 | Bacteria | 3187 |
| 313 | Ga0075431_100136207 | 3300006847 | Bacteria | 2532 |
| 314 | Ga0075431_100204048 | 3300006847 | Bacteria | 2022 |
| 315 | Ga0075431_100529777 | 3300006847 | Bacteria | 1167 |
| 316 | Ga0075431_100726340 | 3300006847 | Bacteria | 970 |
| 317 | Ga0075433_10015768 | 3300006852 | Bacteria | 6209 |
| 318 | Ga0075433_10023858 | 3300006852 | Bacteria | 5154 |
| 319 | Ga0075433_10029664 | 3300006852 | Bacteria | 4663 |
| 320 | Ga0075433_10035491 | 3300006852 | Bacteria | 4288 |
| 321 | Ga0075433_10044601 | 3300006852 | Bacteria | 3853 |
| 322 | Ga0075433_10087845 | 3300006852 | Bacteria | 2746 |
| 323 | Ga0075433_10104854 | 3300006852 | Bacteria | 2505 |
| 324 | Ga0075433_10380246 | 3300006852 | Bacteria | 1247 |
| 325 | Ga0075434_100001890 | 3300006871 | Bacteria | 18124 |
| 326 | Ga0075434_100012547 | 3300006871 | Bacteria | 8036 |
| 327 | Ga0075434_100019973 | 3300006871 | Bacteria | 6489 |
| 328 | Ga0075434_100093491 | 3300006871 | Bacteria | 3010 |
| 329 | Ga0075434_100127769 | 3300006871 | Bacteria | 2559 |
| 330 | Ga0075434_100162518 | 3300006871 | Bacteria | 2253 |
| 331 | Ga0075434_100179294 | 3300006871 | Bacteria | 2138 |
| 332 | Ga0075429_100000263 | 3300006880 | Bacteria | 36639 |
| 333 | Ga0075429_100014752 | 3300006880 | Bacteria | 6772 |
| 334 | Ga0075429_100029580 | 3300006880 | Bacteria | 4757 |
| 335 | Ga0075429_100041536 | 3300006880 | Bacteria | 4006 |
| 336 | Ga0075429_100096822 | 3300006880 | Bacteria | 2574 |
| 337 | Ga0068865_100001170 | 3300006881 | Bacteria | 15241 |
| 338 | Ga0068865_100007259 | 3300006881 | Bacteria | 6811 |
| 339 | Ga0075436_100001297 | 3300006914 | Bacteria | 17001 |
| 340 | Ga0075436_100008948 | 3300006914 | Bacteria | 6853 |
| 341 | Ga0075436_100011722 | 3300006914 | Bacteria | 6017 |
| 342 | Ga0075436_100012281 | 3300006914 | Bacteria | 5869 |
| 343 | Ga0075436_100035435 | 3300006914 | Bacteria | 3443 |
| 344 | Ga0075436_100049244 | 3300006914 | Bacteria | 2907 |
| 345 | Ga0075436_100060385 | 3300006914 | Bacteria | 2618 |
| 346 | Ga0075436_100062488 | 3300006914 | Bacteria | 2573 |
| 347 | Ga0075436_100065574 | 3300006914 | Bacteria | 2510 |
| 348 | Ga0075436_100070933 | 3300006914 | Bacteria | 2409 |
| 349 | Ga0075436_100147524 | 3300006914 | Bacteria | 1654 |
| 350 | Ga0075436_100161322 | 3300006914 | Bacteria | 1581 |
| 351 | Ga0075436_100488417 | 3300006914 | Bacteria | 900 |
| 352 | Ga0097620_100004322 | 3300006931 | Bacteria | 14490 |
| 353 | Ga0097620_100168039 | 3300006931 | Bacteria | 2273 |
| 354 | Ga0097620_100250507 | 3300006931 | Bacteria | 1862 |
| 355 | Ga0097620_100319733 | 3300006931 | Bacteria | 1646 |
| 356 | Ga0075435_100018950 | 3300007076 | Bacteria | 5245 |
| 357 | Ga0075435_100022387 | 3300007076 | Bacteria | 4876 |
| 358 | Ga0075435_100071326 | 3300007076 | Bacteria | 2836 |
| 359 | Ga0075435_100115161 | 3300007076 | Bacteria | 2238 |
| 360 | Ga0075435_100302269 | 3300007076 | Bacteria | 1368 |
| 361 | Ga0075435_100314638 | 3300007076 | Bacteria | 1340 |
| 362 | Ga0075435_100470554 | 3300007076 | Bacteria | 1085 |
| 363 | Ga0099795_10024610 | 3300007788 | Bacteria | 2010 |
| 364 | Ga0105240_10004744 | 3300009093 | Bacteria | 20528 |
| 365 | Ga0105240_10030521 | 3300009093 | Bacteria | 7005 |
| 366 | Ga0105240_10075669 | 3300009093 | Bacteria | 4152 |
| 367 | Ga0105240_10136507 | 3300009093 | Bacteria | 2937 |
| 368 | Ga0105240_10190189 | 3300009093 | Bacteria | 2414 |
| 369 | Ga0105240_10294332 | 3300009093 | Bacteria | 1859 |
| 370 | Ga0105240_10837557 | 3300009093 | Bacteria | 994 |
| 371 | Ga0111539_10349587 | 3300009094 | Bacteria | 1721 |
| 372 | Ga0105245_10010423 | 3300009098 | Bacteria | 8094 |
| 373 | Ga0105245_10011101 | 3300009098 | Bacteria | 7843 |
| 374 | Ga0105245_10034539 | 3300009098 | Bacteria | 4485 |
| 375 | Ga0105245_10036786 | 3300009098 | Bacteria | 4350 |
| 376 | Ga0105245_10124898 | 3300009098 | Bacteria | 2407 |
| 377 | Ga0114129_10004057 | 3300009147 | Bacteria | 20669 |
| 378 | Ga0114129_10071105 | 3300009147 | Bacteria | 4852 |
| 379 | Ga0114129_10097509 | 3300009147 | Bacteria | 4070 |
| 380 | Ga0114129_10199495 | 3300009147 | Bacteria | 2711 |
| 381 | Ga0114129_10273053 | 3300009147 | Bacteria | 2261 |
| 382 | Ga0114129_10693858 | 3300009147 | Bacteria | 1309 |
| 383 | Ga0105243_10003585 | 3300009148 | Bacteria | 12527 |
| 384 | Ga0105243_10128101 | 3300009148 | Bacteria | 2150 |
| 385 | Ga0105243_10334871 | 3300009148 | Bacteria | 1384 |
| 386 | Ga0105241_10000019 | 3300009174 | Bacteria | 147955 |
| 387 | Ga0105241_10000716 | 3300009174 | Bacteria | 25098 |
| 388 | Ga0105241_10124929 | 3300009174 | Bacteria | 2077 |
| 389 | Ga0105241_10158319 | 3300009174 | Bacteria | 1859 |
| 390 | Ga0105241_10208895 | 3300009174 | Bacteria | 1635 |
| 391 | Ga0105241_10283202 | 3300009174 | Bacteria | 1416 |
| 392 | Ga0105242_10000251 | 3300009176 | Bacteria | 42425 |
| 393 | Ga0105242_10000787 | 3300009176 | Bacteria | 24587 |
| 394 | Ga0105248_10001792 | 3300009177 | Bacteria | 23876 |
| 395 | Ga0105248_10019128 | 3300009177 | Bacteria | 7576 |
| 396 | Ga0105248_10020594 | 3300009177 | Bacteria | 7310 |
| 397 | Ga0105248_10086695 | 3300009177 | Bacteria | 3523 |
| 398 | Ga0105248_10154882 | 3300009177 | Bacteria | 2586 |
| 399 | Ga0105248_10171291 | 3300009177 | Bacteria | 2447 |
| 400 | Ga0105248_10296390 | 3300009177 | Bacteria | 1821 |
| 401 | Ga0105248_10303970 | 3300009177 | Bacteria | 1796 |
| 402 | Ga0105237_10036092 | 3300009545 | Bacteria | 5001 |
| 403 | Ga0105237_10146238 | 3300009545 | Bacteria | 2358 |
| 404 | Ga0105237_10372259 | 3300009545 | Bacteria | 1433 |
| 405 | Ga0105237_10397393 | 3300009545 | Bacteria | 1383 |
| 406 | Ga0105237_10664197 | 3300009545 | Bacteria | 1049 |
| 407 | Ga0105238_10013049 | 3300009551 | Bacteria | 8385 |
| 408 | Ga0105238_10027590 | 3300009551 | Bacteria | 5787 |
| 409 | Ga0105238_10108332 | 3300009551 | Bacteria | 2759 |
| 410 | Ga0105238_10646960 | 3300009551 | Bacteria | 1067 |
| 411 | Ga0105238_10711097 | 3300009551 | Bacteria | 1017 |
| 412 | Ga0105249_10022608 | 3300009553 | Bacteria | 5634 |
| 413 | Ga0105249_10023634 | 3300009553 | Bacteria | 5517 |
| 414 | Ga0105249_10137800 | 3300009553 | Bacteria | 2338 |
| 415 | Ga0105249_10164727 | 3300009553 | Bacteria | 2145 |
| 416 | Ga0105249_10249384 | 3300009553 | Bacteria | 1759 |
| 417 | Ga0105249_10332136 | 3300009553 | Bacteria | 1534 |
| 418 | Ga0105239_10013449 | 3300010375 | Bacteria | 9093 |
| 419 | Ga0105246_10296660 | 3300011119 | Bacteria | 1303 |
| 420 | Ga0105246_10545717 | 3300011119 | Bacteria | 992 |
| 421 | Ga0157373_10014172 | 3300013100 | Bacteria | 5847 |
| 422 | Ga0157373_10047874 | 3300013100 | Bacteria | 3049 |
| 423 | Ga0157373_10053152 | 3300013100 | Bacteria | 2880 |
| 424 | Ga0157373_10182621 | 3300013100 | Bacteria | 1477 |
| 425 | Ga0157373_10199721 | 3300013100 | Bacteria | 1409 |
| 426 | Ga0157373_10221174 | 3300013100 | Bacteria | 1336 |
| 427 | Ga0157371_10074288 | 3300013102 | Bacteria | 2408 |
| 428 | Ga0157371_10161379 | 3300013102 | Bacteria | 1601 |
| 429 | Ga0157371_10205901 | 3300013102 | Bacteria | 1411 |
| 430 | Ga0157370_10000311 | 3300013104 | Bacteria | 60937 |
| 431 | Ga0157370_10010642 | 3300013104 | Bacteria | 9682 |
| 432 | Ga0157370_10049871 | 3300013104 | Bacteria | 4003 |
| 433 | Ga0157370_10050227 | 3300013104 | Bacteria | 3987 |
| 434 | Ga0157370_10096803 | 3300013104 | Bacteria | 2769 |
| 435 | Ga0157370_10111131 | 3300013104 | Bacteria | 2562 |
| 436 | Ga0157370_10112049 | 3300013104 | Bacteria | 2550 |
| 437 | Ga0157370_10153672 | 3300013104 | Bacteria | 2141 |
| 438 | Ga0157370_10169733 | 3300013104 | Bacteria | 2028 |
| 439 | Ga0157370_10516081 | 3300013104 | Bacteria | 1097 |
| 440 | Ga0157369_10002977 | 3300013105 | Bacteria | 20267 |
| 441 | Ga0157369_10029240 | 3300013105 | Bacteria | 6091 |
| 442 | Ga0157369_10108231 | 3300013105 | Bacteria | 2956 |
| 443 | Ga0157369_10255814 | 3300013105 | Bacteria | 1827 |
| 444 | Ga0157369_10262924 | 3300013105 | Bacteria | 1799 |
| 445 | Ga0157369_10326382 | 3300013105 | Bacteria | 1595 |
| 446 | Ga0157369_10627721 | 3300013105 | Bacteria | 1108 |
| 447 | Ga0157374_10000354 | 3300013296 | Bacteria | 42454 |
| 448 | Ga0157374_10032848 | 3300013296 | Bacteria | 4730 |
| 449 | Ga0157374_10118697 | 3300013296 | Bacteria | 2551 |
| 450 | Ga0157378_10001585 | 3300013297 | Bacteria | 20557 |
| 451 | Ga0157378_10034310 | 3300013297 | Bacteria | 4487 |
| 452 | Ga0157378_10056354 | 3300013297 | Bacteria | 3502 |
| 453 | Ga0157378_10126749 | 3300013297 | Bacteria | 2359 |
| 454 | Ga0157378_10205775 | 3300013297 | Bacteria | 1864 |
| 455 | Ga0163162_10001791 | 3300013306 | Bacteria | 20158 |
| 456 | Ga0163162_10043019 | 3300013306 | Bacteria | 4522 |
| 457 | Ga0157372_10008172 | 3300013307 | Bacteria | 11124 |
| 458 | Ga0157372_10022604 | 3300013307 | Bacteria | 6806 |
| 459 | Ga0157372_10028719 | 3300013307 | Bacteria | 6072 |
| 460 | Ga0157372_10042712 | 3300013307 | Bacteria | 5016 |
| 461 | Ga0157372_10046586 | 3300013307 | Bacteria | 4814 |
| 462 | Ga0157372_10072521 | 3300013307 | Bacteria | 3881 |
| 463 | Ga0157372_10094586 | 3300013307 | Bacteria | 3403 |
| 464 | Ga0157372_10101356 | 3300013307 | Bacteria | 3287 |
| 465 | Ga0157372_10125276 | 3300013307 | Bacteria | 2953 |
| 466 | Ga0157372_10143253 | 3300013307 | Bacteria | 2756 |
| 467 | Ga0157372_10146411 | 3300013307 | Bacteria | 2724 |
| 468 | Ga0157372_10243070 | 3300013307 | Bacteria | 2089 |
| 469 | Ga0157372_10299974 | 3300013307 | Bacteria | 1869 |
| 470 | Ga0157372_10316634 | 3300013307 | Bacteria | 1816 |
| 471 | Ga0157372_10389340 | 3300013307 | Bacteria | 1624 |
| 472 | Ga0157372_10560591 | 3300013307 | Bacteria | 1332 |
| 473 | Ga0157372_10695174 | 3300013307 | Bacteria | 1183 |
| 474 | Ga0157372_10931767 | 3300013307 | Bacteria | 1007 |
| 475 | Ga0157375_10021674 | 3300013308 | Bacteria | 5898 |
| 476 | Ga0157375_10088177 | 3300013308 | Bacteria | 3157 |
| 477 | Ga0157375_10605034 | 3300013308 | Bacteria | 1255 |
| 478 | Ga0157375_10694135 | 3300013308 | Bacteria | 1172 |
| 479 | Ga0157375_11273999 | 3300013308 | Bacteria | 864 |
| 480 | Ga0163163_10002166 | 3300014325 | Bacteria | 16597 |
| 481 | Ga0163163_10050109 | 3300014325 | Bacteria | 4112 |
| 482 | Ga0163163_10118424 | 3300014325 | Bacteria | 2681 |
| 483 | Ga0163163_10287927 | 3300014325 | Bacteria | 1695 |
| 484 | Ga0157380_10020140 | 3300014326 | Bacteria | 4983 |
| 485 | Ga0157379_10015995 | 3300014968 | Bacteria | 6595 |
| 486 | Ga0157379_10084462 | 3300014968 | Bacteria | 2845 |
| 487 | Ga0157379_10197600 | 3300014968 | Bacteria | 1818 |
| 488 | Ga0157379_10249520 | 3300014968 | Bacteria | 1611 |
| 489 | Ga0157376_10008108 | 3300014969 | Bacteria | 7549 |
| 490 | Ga0157376_10534413 | 3300014969 | Bacteria | 1158 |
| 491 | Ga0163161_10464326 | 3300017792 | Bacteria | 1025 |
| 492 | Ga0206356_10024056 | 3300020070 | Bacteria | 1211 |
| 493 | Ga0206356_10142434 | 3300020070 | Bacteria | 1304 |
| 494 | Ga0206356_10634794 | 3300020070 | Bacteria | 1146 |
| 495 | Ga0206356_10968049 | 3300020070 | Bacteria | 1270 |
| 496 | Ga0206356_11526478 | 3300020070 | Bacteria | 1694 |
| 497 | Ga0206351_10878209 | 3300020077 | Bacteria | 2589 |
| 498 | Ga0206352_10462765 | 3300020078 | Bacteria | 1533 |
| 499 | Ga0206350_10138413 | 3300020080 | Bacteria | 1009 |
| 500 | Ga0224712_10060979 | 3300022467 | Bacteria | 1503 |
| 501 | Ga0207697_10006392 | 3300025315 | Bacteria | 5336 |
| 502 | Ga0207653_10000906 | 3300025885 | Bacteria | 9853 |
| 503 | Ga0207653_10016500 | 3300025885 | Bacteria | 2320 |
| 504 | Ga0207653_10067324 | 3300025885 | Bacteria | 1218 |
| 505 | Ga0207682_10013260 | 3300025893 | Bacteria | 3213 |
| 506 | Ga0207682_10024834 | 3300025893 | Bacteria | 2375 |
| 507 | Ga0207692_10011979 | 3300025898 | Bacteria | 3712 |
| 508 | Ga0207692_10174924 | 3300025898 | Bacteria | 1247 |
| 509 | Ga0207692_10288434 | 3300025898 | Bacteria | 995 |
| 510 | Ga0207642_10000833 | 3300025899 | Bacteria | 9612 |
| 511 | Ga0207642_10095217 | 3300025899 | Bacteria | 1481 |
| 512 | Ga0207642_10132429 | 3300025899 | Bacteria | 1303 |
| 513 | Ga0207680_10035155 | 3300025903 | Bacteria | 2874 |
| 514 | Ga0207680_10064790 | 3300025903 | Bacteria | 2242 |
| 515 | Ga0207699_10000990 | 3300025906 | Bacteria | 13504 |
| 516 | Ga0207699_10014488 | 3300025906 | Bacteria | 4066 |
| 517 | Ga0207699_10019691 | 3300025906 | Bacteria | 3604 |
| 518 | Ga0207699_10060529 | 3300025906 | Bacteria | 2274 |
| 519 | Ga0207645_10001078 | 3300025907 | Bacteria | 22569 |
| 520 | Ga0207645_10013509 | 3300025907 | Bacteria | 5500 |
| 521 | Ga0207643_10011540 | 3300025908 | Bacteria | 4772 |
| 522 | Ga0207643_10060545 | 3300025908 | Bacteria | 2161 |
| 523 | Ga0207705_10029338 | 3300025909 | Bacteria | 3921 |
| 524 | Ga0207705_10243867 | 3300025909 | Bacteria | 1369 |
| 525 | Ga0207684_10005196 | 3300025910 | Bacteria | 12109 |
| 526 | Ga0207684_10007226 | 3300025910 | Bacteria | 10038 |
| 527 | Ga0207684_10040882 | 3300025910 | Bacteria | 3931 |
| 528 | Ga0207684_10044459 | 3300025910 | Bacteria | 3766 |
| 529 | Ga0207684_10065162 | 3300025910 | Bacteria | 3094 |
| 530 | Ga0207654_10000962 | 3300025911 | Bacteria | 15802 |
| 531 | Ga0207654_10127999 | 3300025911 | Bacteria | 1604 |
| 532 | Ga0207654_10157982 | 3300025911 | Bacteria | 1462 |
| 533 | Ga0207654_10179755 | 3300025911 | Bacteria | 1379 |
| 534 | Ga0207707_10001431 | 3300025912 | Bacteria | 22069 |
| 535 | Ga0207707_10002091 | 3300025912 | Bacteria | 18058 |
| 536 | Ga0207707_10007219 | 3300025912 | Bacteria | 9670 |
| 537 | Ga0207707_10011141 | 3300025912 | Bacteria | 7821 |
| 538 | Ga0207707_10015965 | 3300025912 | Bacteria | 6549 |
| 539 | Ga0207707_10020488 | 3300025912 | Bacteria | 5774 |
| 540 | Ga0207707_10022038 | 3300025912 | Bacteria | 5568 |
| 541 | Ga0207707_10033649 | 3300025912 | Bacteria | 4485 |
| 542 | Ga0207707_10218880 | 3300025912 | Bacteria | 1657 |
| 543 | Ga0207707_10447202 | 3300025912 | Bacteria | 1106 |
| 544 | Ga0207695_10005716 | 3300025913 | Bacteria | 16392 |
| 545 | Ga0207695_10015949 | 3300025913 | Bacteria | 8822 |
| 546 | Ga0207695_10028639 | 3300025913 | Bacteria | 6169 |
| 547 | Ga0207695_10170463 | 3300025913 | Bacteria | 2102 |
| 548 | Ga0207695_10188662 | 3300025913 | Bacteria | 1980 |
| 549 | Ga0207695_10192180 | 3300025913 | Bacteria | 1959 |
| 550 | Ga0207695_10261986 | 3300025913 | Bacteria | 1626 |
| 551 | Ga0207695_10317467 | 3300025913 | Bacteria | 1448 |
| 552 | Ga0207695_10564740 | 3300025913 | Bacteria | 1019 |
| 553 | Ga0207693_10031705 | 3300025915 | Bacteria | 4176 |
| 554 | Ga0207663_10000013 | 3300025916 | Bacteria | 167304 |
| 555 | Ga0207663_10012478 | 3300025916 | Bacteria | 4595 |
| 556 | Ga0207663_10067351 | 3300025916 | Bacteria | 2296 |
| 557 | Ga0207663_10097790 | 3300025916 | Bacteria | 1964 |
| 558 | Ga0207663_10116407 | 3300025916 | Bacteria | 1822 |
| 559 | Ga0207660_10003331 | 3300025917 | Bacteria | 10488 |
| 560 | Ga0207660_10007979 | 3300025917 | Bacteria | 6842 |
| 561 | Ga0207660_10013079 | 3300025917 | Bacteria | 5434 |
| 562 | Ga0207660_10013174 | 3300025917 | Bacteria | 5416 |
| 563 | Ga0207660_10035605 | 3300025917 | Bacteria | 3457 |
| 564 | Ga0207660_10045477 | 3300025917 | Bacteria | 3093 |
| 565 | Ga0207660_10050281 | 3300025917 | Bacteria | 2959 |
| 566 | Ga0207660_10140615 | 3300025917 | Bacteria | 1845 |
| 567 | Ga0207660_10140630 | 3300025917 | Bacteria | 1845 |
| 568 | Ga0207662_10186218 | 3300025918 | Bacteria | 1338 |
| 569 | Ga0207657_10007417 | 3300025919 | Bacteria | 11247 |
| 570 | Ga0207657_10017181 | 3300025919 | Bacteria | 6950 |
| 571 | Ga0207657_10026711 | 3300025919 | Bacteria | 5299 |
| 572 | Ga0207657_10176416 | 3300025919 | Bacteria | 1729 |
| 573 | Ga0207657_10355490 | 3300025919 | Bacteria | 1155 |
| 574 | Ga0207649_10007938 | 3300025920 | Bacteria | 5776 |
| 575 | Ga0207649_10038609 | 3300025920 | Bacteria | 2892 |
| 576 | Ga0207649_10045358 | 3300025920 | Bacteria | 2695 |
| 577 | Ga0207649_10057496 | 3300025920 | Bacteria | 2432 |
| 578 | Ga0207649_10223509 | 3300025920 | Bacteria | 1343 |
| 579 | Ga0207652_10001513 | 3300025921 | Bacteria | 20520 |
| 580 | Ga0207652_10004478 | 3300025921 | Bacteria | 11374 |
| 581 | Ga0207652_10004726 | 3300025921 | Bacteria | 11041 |
| 582 | Ga0207652_10005744 | 3300025921 | Bacteria | 10070 |
| 583 | Ga0207652_10016515 | 3300025921 | Bacteria | 6028 |
| 584 | Ga0207652_10020371 | 3300025921 | Bacteria | 5460 |
| 585 | Ga0207652_10053599 | 3300025921 | Bacteria | 3464 |
| 586 | Ga0207652_10057994 | 3300025921 | Bacteria | 3336 |
| 587 | Ga0207652_10061824 | 3300025921 | Bacteria | 3235 |
| 588 | Ga0207652_10099393 | 3300025921 | Bacteria | 2567 |
| 589 | Ga0207652_10103249 | 3300025921 | Bacteria | 2520 |
| 590 | Ga0207652_10108342 | 3300025921 | Bacteria | 2461 |
| 591 | Ga0207652_10285114 | 3300025921 | Bacteria | 1490 |
| 592 | Ga0207652_10450690 | 3300025921 | Bacteria | 1160 |
| 593 | Ga0207646_10002828 | 3300025922 | Bacteria | 20191 |
| 594 | Ga0207646_10002838 | 3300025922 | Bacteria | 20147 |
| 595 | Ga0207646_10009959 | 3300025922 | Bacteria | 9341 |
| 596 | Ga0207646_10038019 | 3300025922 | Bacteria | 4338 |
| 597 | Ga0207646_10083049 | 3300025922 | Bacteria | 2865 |
| 598 | Ga0207646_10163452 | 3300025922 | Bacteria | 2009 |
| 599 | Ga0207646_10181255 | 3300025922 | Bacteria | 1902 |
| 600 | Ga0207646_10198958 | 3300025922 | Bacteria | 1810 |
| 601 | Ga0207681_10020095 | 3300025923 | Bacteria | 4228 |
| 602 | Ga0207681_10021437 | 3300025923 | Bacteria | 4107 |
| 603 | Ga0207681_10037604 | 3300025923 | Bacteria | 3200 |
| 604 | Ga0207681_10134732 | 3300025923 | Bacteria | 1831 |
| 605 | Ga0207694_10019182 | 3300025924 | Bacteria | 5169 |
| 606 | Ga0207694_10033445 | 3300025924 | Bacteria | 3939 |
| 607 | Ga0207694_10070725 | 3300025924 | Bacteria | 2727 |
| 608 | Ga0207650_10016927 | 3300025925 | Bacteria | 5099 |
| 609 | Ga0207650_10030026 | 3300025925 | Bacteria | 3912 |
| 610 | Ga0207650_10391217 | 3300025925 | Bacteria | 1149 |
| 611 | Ga0207659_10004878 | 3300025926 | Bacteria | 8131 |
| 612 | Ga0207659_10594550 | 3300025926 | Bacteria | 943 |
| 613 | Ga0207687_10019366 | 3300025927 | Bacteria | 4509 |
| 614 | Ga0207687_10021988 | 3300025927 | Bacteria | 4241 |
| 615 | Ga0207687_10053510 | 3300025927 | Bacteria | 2820 |
| 616 | Ga0207687_10221565 | 3300025927 | Bacteria | 1490 |
| 617 | Ga0207700_10000243 | 3300025928 | Bacteria | 32630 |
| 618 | Ga0207700_10127337 | 3300025928 | Bacteria | 2074 |
| 619 | Ga0207700_10460212 | 3300025928 | Bacteria | 1122 |
| 620 | Ga0207664_10007050 | 3300025929 | Bacteria | 7786 |
| 621 | Ga0207664_10014315 | 3300025929 | Bacteria | 5725 |
| 622 | Ga0207664_10027416 | 3300025929 | Bacteria | 4318 |
| 623 | Ga0207664_10053021 | 3300025929 | Bacteria | 3209 |
| 624 | Ga0207664_10096305 | 3300025929 | Bacteria | 2436 |
| 625 | Ga0207664_10102772 | 3300025929 | Bacteria | 2363 |
| 626 | Ga0207664_10408112 | 3300025929 | Bacteria | 1209 |
| 627 | Ga0207644_10126524 | 3300025931 | Bacteria | 1951 |
| 628 | Ga0207644_10447831 | 3300025931 | Bacteria | 1060 |
| 629 | Ga0207690_10012137 | 3300025932 | Bacteria | 5154 |
| 630 | Ga0207690_10039738 | 3300025932 | Bacteria | 3071 |
| 631 | Ga0207690_10054671 | 3300025932 | Bacteria | 2685 |
| 632 | Ga0207690_10129885 | 3300025932 | Bacteria | 1842 |
| 633 | Ga0207690_10208006 | 3300025932 | Bacteria | 1490 |
| 634 | Ga0207706_10000096 | 3300025933 | Bacteria | 92125 |
| 635 | Ga0207706_10003039 | 3300025933 | Bacteria | 16174 |
| 636 | Ga0207706_10184546 | 3300025933 | Bacteria | 1832 |
| 637 | Ga0207706_10542116 | 3300025933 | Bacteria | 1002 |
| 638 | Ga0207686_10000112 | 3300025934 | Bacteria | 65154 |
| 639 | Ga0207709_10001243 | 3300025935 | Bacteria | 18298 |
| 640 | Ga0207709_10104043 | 3300025935 | Bacteria | 1883 |
| 641 | Ga0207669_10001730 | 3300025937 | Bacteria | 9271 |
| 642 | Ga0207704_10001104 | 3300025938 | Bacteria | 12007 |
| 643 | Ga0207665_10000385 | 3300025939 | Bacteria | 30257 |
| 644 | Ga0207691_10012186 | 3300025940 | Bacteria | 8243 |
| 645 | Ga0207691_10016019 | 3300025940 | Bacteria | 7120 |
| 646 | Ga0207691_10092668 | 3300025940 | Bacteria | 2705 |
| 647 | Ga0207691_10144880 | 3300025940 | Bacteria | 2091 |
| 648 | Ga0207711_10003244 | 3300025941 | Bacteria | 14176 |
| 649 | Ga0207711_10018493 | 3300025941 | Bacteria | 5794 |
| 650 | Ga0207711_10049151 | 3300025941 | Bacteria | 3610 |
| 651 | Ga0207689_10000755 | 3300025942 | Bacteria | 31026 |
| 652 | Ga0207689_10000911 | 3300025942 | Bacteria | 28348 |
| 653 | Ga0207689_10516330 | 3300025942 | Bacteria | 1002 |
| 654 | Ga0207661_10000266 | 3300025944 | Bacteria | 33818 |
| 655 | Ga0207661_10020439 | 3300025944 | Bacteria | 4949 |
| 656 | Ga0207661_10020824 | 3300025944 | Bacteria | 4908 |
| 657 | Ga0207661_10040614 | 3300025944 | Bacteria | 3658 |
| 658 | Ga0207661_10046960 | 3300025944 | Bacteria | 3426 |
| 659 | Ga0207661_10088576 | 3300025944 | Bacteria | 2573 |
| 660 | Ga0207661_10101931 | 3300025944 | Bacteria | 2412 |
| 661 | Ga0207661_10102863 | 3300025944 | Bacteria | 2403 |
| 662 | Ga0207661_10130283 | 3300025944 | Bacteria | 2153 |
| 663 | Ga0207661_10199567 | 3300025944 | Bacteria | 1758 |
| 664 | Ga0207661_10221052 | 3300025944 | Bacteria | 1674 |
| 665 | Ga0207679_10001989 | 3300025945 | Bacteria | 12678 |
| 666 | Ga0207679_10022240 | 3300025945 | Bacteria | 4314 |
| 667 | Ga0207679_10051565 | 3300025945 | Bacteria | 3012 |
| 668 | Ga0207679_10054235 | 3300025945 | Bacteria | 2950 |
| 669 | Ga0207679_10058167 | 3300025945 | Bacteria | 2863 |
| 670 | Ga0207679_10109728 | 3300025945 | Bacteria | 2175 |
| 671 | Ga0207679_10115300 | 3300025945 | Bacteria | 2128 |
| 672 | Ga0207679_10124706 | 3300025945 | Bacteria | 2056 |
| 673 | Ga0207667_10002929 | 3300025949 | Bacteria | 21195 |
| 674 | Ga0207667_10027244 | 3300025949 | Bacteria | 6225 |
| 675 | Ga0207667_10044977 | 3300025949 | Bacteria | 4676 |
| 676 | Ga0207667_10234571 | 3300025949 | Bacteria | 1878 |
| 677 | Ga0207651_10376597 | 3300025960 | Bacteria | 1202 |
| 678 | Ga0207651_10589569 | 3300025960 | Bacteria | 971 |
| 679 | Ga0207712_10003463 | 3300025961 | Bacteria | 9965 |
| 680 | Ga0207712_10007741 | 3300025961 | Bacteria | 6792 |
| 681 | Ga0207712_10055730 | 3300025961 | Bacteria | 2782 |
| 682 | Ga0207712_10157785 | 3300025961 | Bacteria | 1759 |
| 683 | Ga0207668_10037344 | 3300025972 | Bacteria | 3250 |
| 684 | Ga0207668_10091785 | 3300025972 | Bacteria | 2233 |
| 685 | Ga0207668_10166705 | 3300025972 | Bacteria | 1723 |
| 686 | Ga0207668_10200757 | 3300025972 | Bacteria | 1588 |
| 687 | Ga0207668_10239707 | 3300025972 | Bacteria | 1467 |
| 688 | Ga0207668_10581859 | 3300025972 | Bacteria | 973 |
| 689 | Ga0207640_10002465 | 3300025981 | Bacteria | 9907 |
| 690 | Ga0207640_10017844 | 3300025981 | Bacteria | 4158 |
| 691 | Ga0207640_10026016 | 3300025981 | Bacteria | 3549 |
| 692 | Ga0207640_10049558 | 3300025981 | Bacteria | 2720 |
| 693 | Ga0207640_10089997 | 3300025981 | Bacteria | 2122 |
| 694 | Ga0207640_10301738 | 3300025981 | Bacteria | 1267 |
| 695 | Ga0207658_10022058 | 3300025986 | Bacteria | 4429 |
| 696 | Ga0207658_10232896 | 3300025986 | Bacteria | 1556 |
| 697 | Ga0207658_10241365 | 3300025986 | Bacteria | 1531 |
| 698 | Ga0207677_10015707 | 3300026023 | Bacteria | 4463 |
| 699 | Ga0207677_10182995 | 3300026023 | Bacteria | 1650 |
| 700 | Ga0207677_10300527 | 3300026023 | Bacteria | 1326 |
| 701 | Ga0207703_10066907 | 3300026035 | Bacteria | 2956 |
| 702 | Ga0207639_10215551 | 3300026041 | Bacteria | 1655 |
| 703 | Ga0207639_10705538 | 3300026041 | Bacteria | 936 |
| 704 | Ga0207678_10001786 | 3300026067 | Bacteria | 19698 |
| 705 | Ga0207678_10061517 | 3300026067 | Bacteria | 3229 |
| 706 | Ga0207678_10204722 | 3300026067 | Bacteria | 1688 |
| 707 | Ga0207678_10274790 | 3300026067 | Bacteria | 1445 |
| 708 | Ga0207678_10684829 | 3300026067 | Bacteria | 902 |
| 709 | Ga0207708_10038135 | 3300026075 | Bacteria | 3661 |
| 710 | Ga0207708_10056957 | 3300026075 | Bacteria | 2982 |
| 711 | Ga0207708_10057843 | 3300026075 | Bacteria | 2958 |
| 712 | Ga0207641_10433006 | 3300026088 | Bacteria | 1268 |
| 713 | Ga0207641_10509032 | 3300026088 | Bacteria | 1170 |
| 714 | Ga0207641_10875515 | 3300026088 | Bacteria | 891 |
| 715 | Ga0207641_10916326 | 3300026088 | Bacteria | 871 |
| 716 | Ga0207648_10000043 | 3300026089 | Bacteria | 113682 |
| 717 | Ga0207648_10070659 | 3300026089 | Bacteria | 3043 |
| 718 | Ga0207648_10081301 | 3300026089 | Bacteria | 2826 |
| 719 | Ga0207648_10140928 | 3300026089 | Bacteria | 2124 |
| 720 | Ga0207648_10214133 | 3300026089 | Bacteria | 1711 |
| 721 | Ga0207676_10066334 | 3300026095 | Bacteria | 2878 |
| 722 | Ga0207674_10001092 | 3300026116 | Bacteria | 35309 |
| 723 | Ga0207674_10004557 | 3300026116 | Bacteria | 16643 |
| 724 | Ga0207674_10010897 | 3300026116 | Bacteria | 10240 |
| 725 | Ga0207674_10035181 | 3300026116 | Bacteria | 5228 |
| 726 | Ga0207674_10045964 | 3300026116 | Bacteria | 4487 |
| 727 | Ga0207674_10059883 | 3300026116 | Bacteria | 3852 |
| 728 | Ga0207675_100000197 | 3300026118 | Bacteria | 55600 |
| 729 | Ga0207675_100009301 | 3300026118 | Bacteria | 9216 |
| 730 | Ga0207675_100066119 | 3300026118 | Bacteria | 3379 |
| 731 | Ga0207675_100283204 | 3300026118 | Bacteria | 1611 |
| 732 | Ga0207683_10003314 | 3300026121 | Bacteria | 14037 |
| 733 | Ga0207683_10024609 | 3300026121 | Bacteria | 5186 |
| 734 | Ga0207698_10007725 | 3300026142 | Bacteria | 6748 |
| 735 | Ga0207698_10015011 | 3300026142 | Bacteria | 5172 |
| 736 | Ga0207698_10058998 | 3300026142 | Bacteria | 2977 |
| 737 | Ga0207698_10121777 | 3300026142 | Bacteria | 2210 |
| 738 | Ga0207698_10154207 | 3300026142 | Bacteria | 1998 |
| 739 | Ga0207698_10448241 | 3300026142 | Bacteria | 1245 |
| 740 | Ga0209967_1001446 | 3300027364 | Bacteria | 3040 |
| 741 | Ga0209995_1001594 | 3300027471 | Bacteria | 3513 |
| 742 | Ga0209968_1002268 | 3300027526 | Bacteria | 2907 |
| 743 | Ga0209999_1001017 | 3300027543 | Bacteria | 4761 |
| 744 | Ga0209999_1001140 | 3300027543 | Bacteria | 4536 |
| 745 | Ga0209588_1022798 | 3300027671 | Bacteria | 1970 |
| 746 | Ga0209971_1004772 | 3300027682 | Bacteria | 3219 |
| 747 | Ga0209966_1003128 | 3300027695 | Bacteria | 2777 |
| 748 | Ga0209966_1005831 | 3300027695 | Bacteria | 2123 |
| 749 | Ga0209998_10000194 | 3300027717 | Bacteria | 21684 |
| 750 | Ga0207428_10171965 | 3300027907 | Bacteria | 1640 |
| 751 | Ga0268266_10395652 | 3300028379 | Bacteria | 1306 |
| 752 | Ga0268265_10083741 | 3300028380 | Bacteria | 2526 |
| 753 | Ga0268265_10096003 | 3300028380 | Bacteria | 2381 |
| 754 | Ga0268265_10102978 | 3300028380 | Bacteria | 2310 |
| 755 | Ga0268265_10344506 | 3300028380 | Bacteria | 1358 |
| 756 | Ga0268264_10007645 | 3300028381 | Bacteria | 9009 |
| 757 | Ga0268264_10168495 | 3300028381 | Bacteria | 1979 |
| 758 | Ga0268264_10183070 | 3300028381 | Bacteria | 1904 |
| 759 | Ga0265337_1001252 | 3300028556 | Bacteria | 12795 |
| 760 | Ga0265326_10001074 | 3300028558 | Bacteria | 9741 |
| 761 | Ga0265326_10003863 | 3300028558 | Bacteria | 4869 |
| 762 | Ga0265319_1000100 | 3300028563 | Bacteria | 66728 |
| 763 | Ga0265319_1000169 | 3300028563 | Bacteria | 49406 |
| 764 | Ga0265334_10001411 | 3300028573 | Bacteria | 11555 |
| 765 | Ga0265318_10001487 | 3300028577 | Bacteria | 13701 |
| 766 | Ga0265323_10000218 | 3300028653 | Bacteria | 33811 |
| 767 | Ga0265322_10000549 | 3300028654 | Bacteria | 14431 |
| 768 | Ga0265322_10002031 | 3300028654 | Bacteria | 6379 |
| 769 | Ga0265336_10000115 | 3300028666 | Bacteria | 59960 |
| 770 | Ga0307515_10127185 | 3300028794 | Bacteria | 2836 |
| 771 | Ga0265338_10001654 | 3300028800 | Bacteria | 35526 |
| 772 | Ga0265338_10005397 | 3300028800 | Bacteria | 16701 |
| 773 | Ga0265338_10005519 | 3300028800 | Bacteria | 16487 |
| 774 | Ga0265338_10005708 | 3300028800 | Bacteria | 16097 |
| 775 | Ga0265324_10001167 | 3300029957 | Bacteria | 15643 |
| 776 | Ga0265324_10005143 | 3300029957 | Bacteria | 5711 |
| 777 | Ga0265324_10005863 | 3300029957 | Bacteria | 5224 |
| 778 | Ga0265330_10000319 | 3300031235 | Bacteria | 34472 |
| 779 | Ga0265332_10000382 | 3300031238 | Bacteria | 32426 |
| 780 | Ga0265332_10148623 | 3300031238 | Bacteria | 980 |
| 781 | Ga0265320_10002083 | 3300031240 | Bacteria | 14085 |
| 782 | Ga0265320_10002134 | 3300031240 | Bacteria | 13874 |
| 783 | Ga0265325_10004251 | 3300031241 | Bacteria | 9088 |
| 784 | Ga0265325_10015601 | 3300031241 | Bacteria | 4268 |
| 785 | Ga0265329_10000073 | 3300031242 | Bacteria | 44995 |
| 786 | Ga0265340_10004960 | 3300031247 | Bacteria | 7398 |
| 787 | Ga0265339_10000297 | 3300031249 | Bacteria | 40447 |
| 788 | Ga0265331_10000963 | 3300031250 | Bacteria | 22892 |
| 789 | Ga0265327_10033503 | 3300031251 | Bacteria | 2861 |
| 790 | Ga0265316_10000247 | 3300031344 | Bacteria | 62442 |
| 791 | Ga0265316_10005834 | 3300031344 | Bacteria | 11873 |
| 792 | Ga0307408_100002006 | 3300031548 | Bacteria | 14703 |
| 793 | Ga0307408_100051172 | 3300031548 | Bacteria | 2974 |
| 794 | Ga0307408_100061987 | 3300031548 | Bacteria | 2731 |
| 795 | Ga0307408_100063300 | 3300031548 | Bacteria | 2706 |
| 796 | Ga0307408_100097461 | 3300031548 | Bacteria | 2234 |
| 797 | Ga0307408_100156029 | 3300031548 | Bacteria | 1807 |
| 798 | Ga0307408_100206896 | 3300031548 | Bacteria | 1592 |
| 799 | Ga0307408_100220320 | 3300031548 | Bacteria | 1548 |
| 800 | Ga0265313_10000580 | 3300031595 | Bacteria | 38083 |
| 801 | Ga0265314_10000285 | 3300031711 | Bacteria | 73539 |
| 802 | Ga0265314_10101911 | 3300031711 | Bacteria | 1843 |
| 803 | Ga0265342_10000764 | 3300031712 | Bacteria | 32819 |
| 804 | Ga0265342_10002715 | 3300031712 | Bacteria | 15069 |
| 805 | Ga0265342_10002983 | 3300031712 | Bacteria | 14207 |
| 806 | Ga0307405_10004222 | 3300031731 | Bacteria | 6759 |
| 807 | Ga0307405_10004860 | 3300031731 | Bacteria | 6415 |
| 808 | Ga0307405_10006609 | 3300031731 | Bacteria | 5719 |
| 809 | Ga0307405_10012109 | 3300031731 | Bacteria | 4551 |
| 810 | Ga0307405_10021653 | 3300031731 | Bacteria | 3618 |
| 811 | Ga0307405_10029235 | 3300031731 | Bacteria | 3219 |
| 812 | Ga0307405_10262344 | 3300031731 | Bacteria | 1291 |
| 813 | Ga0307413_10003779 | 3300031824 | Bacteria | 6451 |
| 814 | Ga0307413_10006790 | 3300031824 | Bacteria | 5259 |
| 815 | Ga0307413_10007348 | 3300031824 | Bacteria | 5109 |
| 816 | Ga0307413_10067889 | 3300031824 | Bacteria | 2231 |
| 817 | Ga0307413_10199897 | 3300031824 | Bacteria | 1443 |
| 818 | Ga0307413_10214025 | 3300031824 | Bacteria | 1402 |
| 819 | Ga0307410_10002673 | 3300031852 | Bacteria | 8694 |
| 820 | Ga0307410_10020830 | 3300031852 | Bacteria | 4021 |
| 821 | Ga0307410_10021209 | 3300031852 | Bacteria | 3991 |
| 822 | Ga0307410_10073357 | 3300031852 | Bacteria | 2379 |
| 823 | Ga0307406_10013122 | 3300031901 | Bacteria | 4738 |
| 824 | Ga0307406_10014255 | 3300031901 | Bacteria | 4570 |
| 825 | Ga0307406_10016148 | 3300031901 | Bacteria | 4333 |
| 826 | Ga0307406_10018816 | 3300031901 | Bacteria | 4043 |
| 827 | Ga0307406_10025477 | 3300031901 | Bacteria | 3542 |
| 828 | Ga0307406_10032349 | 3300031901 | Bacteria | 3193 |
| 829 | Ga0307406_10046751 | 3300031901 | Bacteria | 2724 |
| 830 | Ga0307407_10008351 | 3300031903 | Bacteria | 4746 |
| 831 | Ga0307407_10015673 | 3300031903 | Bacteria | 3755 |
| 832 | Ga0307412_10002809 | 3300031911 | Bacteria | 9665 |
| 833 | Ga0307412_10026618 | 3300031911 | Bacteria | 3597 |
| 834 | Ga0307412_10029152 | 3300031911 | Bacteria | 3462 |
| 835 | Ga0307412_10035677 | 3300031911 | Bacteria | 3179 |
| 836 | Ga0307412_10042004 | 3300031911 | Bacteria | 2967 |
| 837 | Ga0307412_10057573 | 3300031911 | Bacteria | 2595 |
| 838 | Ga0307412_10472828 | 3300031911 | Bacteria | 1038 |
| 839 | Ga0307409_100009742 | 3300031995 | Bacteria | 5924 |
| 840 | Ga0307409_100014998 | 3300031995 | Bacteria | 5066 |
| 841 | Ga0307409_100017651 | 3300031995 | Bacteria | 4765 |
| 842 | Ga0307409_100017868 | 3300031995 | Bacteria | 4743 |
| 843 | Ga0307409_100036606 | 3300031995 | Bacteria | 3609 |
| 844 | Ga0307409_100038563 | 3300031995 | Bacteria | 3535 |
| 845 | Ga0307409_100043283 | 3300031995 | Bacteria | 3379 |
| 846 | Ga0307409_100066157 | 3300031995 | Bacteria | 2848 |
| 847 | Ga0307409_100265762 | 3300031995 | Bacteria | 1577 |
| 848 | Ga0307409_100752330 | 3300031995 | Bacteria | 978 |
| 849 | Ga0307416_100001346 | 3300032002 | Bacteria | 13259 |
| 850 | Ga0307416_100003759 | 3300032002 | Bacteria | 9001 |
| 851 | Ga0307416_100007380 | 3300032002 | Bacteria | 6984 |
| 852 | Ga0307416_100022232 | 3300032002 | Bacteria | 4573 |
| 853 | Ga0307416_100025517 | 3300032002 | Bacteria | 4333 |
| 854 | Ga0307416_100061624 | 3300032002 | Bacteria | 3062 |
| 855 | Ga0307416_100127250 | 3300032002 | Bacteria | 2284 |
| 856 | Ga0307416_100361652 | 3300032002 | Bacteria | 1474 |
| 857 | Ga0307416_100471283 | 3300032002 | Bacteria | 1313 |
| 858 | Ga0307416_100546634 | 3300032002 | Bacteria | 1231 |
| 859 | Ga0307414_10002078 | 3300032004 | Bacteria | 10406 |
| 860 | Ga0307414_10015982 | 3300032004 | Bacteria | 4548 |
| 861 | Ga0307414_10179999 | 3300032004 | Bacteria | 1699 |
| 862 | Ga0307414_10266904 | 3300032004 | Bacteria | 1431 |
| 863 | Ga0307414_10449300 | 3300032004 | Bacteria | 1130 |
| 864 | Ga0307411_10000581 | 3300032005 | Bacteria | 13068 |
| 865 | Ga0307411_10069501 | 3300032005 | Bacteria | 2378 |
| 866 | Ga0307411_10079257 | 3300032005 | Bacteria | 2254 |
| 867 | Ga0307411_10185433 | 3300032005 | Bacteria | 1583 |
| 868 | Ga0307415_100009225 | 3300032126 | Bacteria | 5514 |
| 869 | Ga0307415_100013459 | 3300032126 | Bacteria | 4776 |
| 870 | Ga0307415_100030103 | 3300032126 | Bacteria | 3478 |
| 871 | Ga0307415_100050422 | 3300032126 | Bacteria | 2820 |
| 872 | Ga0307415_100079490 | 3300032126 | Bacteria | 2336 |
| 873 | Ga0316583_10088994 | 3300032133 | Bacteria | 1077 |
| 874 | Ga0373959_0009856 | 3300034820 | Bacteria | 1658 |
| 875 | Ga0373938_0004068 | 3300034957 | Bacteria | 2421 |
| 876 | Ga0373926_0008122 | 3300035083 | Bacteria | 3496 |
| 877 | Ga0373934_0008664 | 3300035086 | Bacteria | 3795 |
| 878 | Ga0373944_0002092 | 3300035089 | Bacteria | 5069 |
| 879 | Ga0373923_0002649 | 3300035111 | Bacteria | 5561 |
| 880 | Ga0373932_0035277 | 3300035112 | Bacteria | 1414 |
| 881 | Ga0373936_0048820 | 3300035113 | Bacteria | 1709 |
| 882 | Ga0373941_0005211 | 3300035115 | Bacteria | 3045 |
| 883 | Ga0373941_0066177 | 3300035115 | Bacteria | 1188 |
| 884 | Ga0373945_0003771 | 3300035116 | Bacteria | 4785 |
| 885 | Ga0373956_0000268 | 3300035119 | Bacteria | 20838 |
| 886 | Ga0373957_0001328 | 3300035120 | Bacteria | 6647 |
| 887 | Ga0373943_0018325 | 3300035170 | Bacteria | 3214 |
| 888 | Ga0373943_0139404 | 3300035170 | Bacteria | 1305 |
| 889 | Ga0373946_0001250 | 3300035171 | Bacteria | 8791 |
| 890 | Ga0373946_0099228 | 3300035171 | Bacteria | 1303 |
| 891 | Ga0373946_0209542 | 3300035171 | Bacteria | 937 |
| 892 | Ga0373955_0000375 | 3300035172 | Bacteria | 18828 |
| 893 | Ga0373955_0042312 | 3300035172 | Bacteria | 2445 |
| 894 | Ga0373942_0004857 | 3300035207 | Bacteria | 3118 |
| 895 | Ga0373961_0162862 | 3300035241 | Bacteria | 767 |
| 896 | Ga0316574_0014342 | 3300035398 | Bacteria | 4578 |
| 897 | Ga0373924_0001315 | 3300035410 | Bacteria | 7984 |
| 898 | Ga0373924_0151529 | 3300035410 | Bacteria | 1014 |
| 899 | Ga0373931_0005639 | 3300035691 | Bacteria | 5809 |
| 900 | Ga0373931_0049888 | 3300035691 | Bacteria | 2225 |
| 901 | Ga0373931_0091723 | 3300035691 | Bacteria | 1694 |
| 902 | Ga0373935_0046960 | 3300035692 | Bacteria | 2728 |
| 903 | Ga0373935_0104024 | 3300035692 | Bacteria | 1876 |
| 904 | Ga0373935_0114251 | 3300035692 | Bacteria | 1796 |
| 905 | Ga0373927_0001403 | 3300035695 | Bacteria | 18157 |
| 906 | Ga0373927_0016654 | 3300035695 | Bacteria | 4849 |
| 907 | Ga0373933_0000048 | 3300035724 | Bacteria | 74138 |
| 908 | Ga0373933_0005244 | 3300035724 | Bacteria | 7066 |
| 909 | Ga0373947_0159061 | 3300035725 | Bacteria | 1460 |
| 910 | Ga0373937_0000329 | 3300036401 | Bacteria | 45063 |
| 911 | Ga0373937_0001127 | 3300036401 | Bacteria | 22481 |
| 912 | Ga0373937_0447607 | 3300036401 | Bacteria | 1226 |
| 913 | Ga0373925_0000764 | 3300037068 | Bacteria | 29537 |
| 914 | Ga0395899_0020501 | 3300037312 | Bacteria | 5011 |
| 915 | Ga0395900_0020640 | 3300037418 | Bacteria | 6731 |
| 916 | Ga0395898_0042905 | 3300037466 | Bacteria | 4460 |
| 917 | Ga0395905_0038021 | 3300037471 | Bacteria | 4515 |
| 918 | Ga0395905_0468040 | 3300037471 | Bacteria | 1159 |
| 919 | Ga0395905_0656178 | 3300037471 | Bacteria | 951 |
| 920 | Ga0436364_1235499 | 3300037853 | Bacteria | 1029 |
| 921 | Ga0395901_0012864 | 3300038443 | Bacteria | 8487 |
| 922 | Ga0436365_1243926 | 3300039437 | Bacteria | 4969 |
| 923 | Ga0439448_0079057 | 3300042005 | Bacteria | 1103 |
| 924 | Ga0439446_0042563 | 3300042156 | Bacteria | 1340 |
| 925 | Ga0439434_0069709 | 3300042435 | Bacteria | 1106 |
| 926 | Ga0439464_0014277 | 3300042439 | Bacteria | 2134 |
| 927 | Ga0451577_0000109 | 3300042876 | Bacteria | 183296 |
| 928 | Ga0451577_0002556 | 3300042876 | Bacteria | 21471 |
| 929 | Ga0451577_0016505 | 3300042876 | Bacteria | 6837 |
| 930 | Ga0451577_0019993 | 3300042876 | Bacteria | 6150 |
| 931 | Ga0451577_0030104 | 3300042876 | Bacteria | 4905 |
| 932 | Ga0451577_0036278 | 3300042876 | Bacteria | 4438 |
| 933 | Ga0451577_0046106 | 3300042876 | Bacteria | 3900 |
| 934 | Ga0451577_0442633 | 3300042876 | Bacteria | 1180 |
| 935 | Ga0451577_0543424 | 3300042876 | Bacteria | 1055 |
| 936 | Ga0451577_0903633 | 3300042876 | Bacteria | 795 |
| 937 | Ga0453683_0004121 | 3300044673 | Bacteria | 10442 |
| 938 | Ga0453683_0004688 | 3300044673 | Bacteria | 9646 |
| 939 | Ga0453683_0018303 | 3300044673 | Bacteria | 4498 |
| 940 | Ga0453683_0033313 | 3300044673 | Bacteria | 3249 |
| 941 | Ga0466966_0031866 | 3300044684 | Bacteria | 3419 |
| 942 | Ga0466966_0063642 | 3300044684 | Bacteria | 2324 |
| 943 | Ga0466961_0017713 | 3300044693 | Bacteria | 4577 |
| 944 | Ga0466961_0091207 | 3300044693 | Bacteria | 1924 |
| 945 | Ga0466963_0194703 | 3300044694 | Bacteria | 1417 |
| 946 | Ga0466963_0224894 | 3300044694 | Bacteria | 1315 |
| 947 | Ga0453684_0000004 | 3300044712 | Bacteria | 1469893 |
| 948 | Ga0453684_0000332 | 3300044712 | Bacteria | 197651 |
| 949 | Ga0453684_0028563 | 3300044712 | Bacteria | 7954 |
| 950 | Ga0453684_0089547 | 3300044712 | Bacteria | 3805 |
| 951 | Ga0453684_0251225 | 3300044712 | Bacteria | 2030 |
| 952 | Ga0453684_0375474 | 3300044712 | Bacteria | 1597 |
| 953 | Ga0466959_0016555 | 3300045049 | Bacteria | 5390 |
| 954 | Ga0466959_0129847 | 3300045049 | Bacteria | 1786 |
| 955 | Ga0451576_0185451 | 3300045051 | Bacteria | 2173 |
| 956 | Ga0451576_0241660 | 3300045051 | Bacteria | 1886 |
| 957 | Ga0466967_0063446 | 3300045976 | Bacteria | 3283 |
| 958 | Ga0466967_0266377 | 3300045976 | Bacteria | 1640 |
| 959 | Ga0495592_0004119 | 3300046454 | Bacteria | 10583 |
| 960 | Ga0495603_0000562 | 3300046455 | Bacteria | 20800 |
| 961 | Ga0495590_0059664 | 3300046457 | Bacteria | 1335 |
| 962 | Ga0495629_0035680 | 3300046459 | Bacteria | 3514 |
| 963 | Ga0495629_0043348 | 3300046459 | Bacteria | 3159 |
| 964 | Ga0495629_0057124 | 3300046459 | Bacteria | 2729 |
| 965 | Ga0495629_0072958 | 3300046459 | Bacteria | 2397 |
| 966 | Ga0495651_0000222 | 3300046462 | Bacteria | 43370 |
| 967 | Ga0495651_0090723 | 3300046462 | Bacteria | 2292 |
| 968 | Ga0495651_0095693 | 3300046462 | Bacteria | 2220 |
| 969 | Ga0495653_0000050 | 3300046463 | Bacteria | 106233 |
| 970 | Ga0495653_0048621 | 3300046463 | Bacteria | 3273 |
| 971 | Ga0495653_0066752 | 3300046463 | Bacteria | 2705 |
| 972 | Ga0495580_0024389 | 3300046472 | Bacteria | 4428 |
| 973 | Ga0495580_0043293 | 3300046472 | Bacteria | 3204 |
| 974 | Ga0495580_0045913 | 3300046472 | Bacteria | 3101 |
| 975 | Ga0495580_0162776 | 3300046472 | Bacteria | 1544 |
| 976 | Ga0495582_0015133 | 3300046473 | Bacteria | 4244 |
| 977 | Ga0495582_0045460 | 3300046473 | Bacteria | 2418 |
| 978 | Ga0495582_0145889 | 3300046473 | Bacteria | 1342 |
| 979 | Ga0495639_0007465 | 3300046475 | Bacteria | 4693 |
| 980 | Ga0495639_0012626 | 3300046475 | Bacteria | 3644 |
| 981 | Ga0495639_0026325 | 3300046475 | Bacteria | 2570 |
| 982 | Ga0495639_0063738 | 3300046475 | Bacteria | 1693 |
| 983 | Ga0495662_0258621 | 3300046476 | Bacteria | 857 |
| 984 | Ga0495664_0019327 | 3300046477 | Bacteria | 3916 |
| 985 | Ga0495584_0092214 | 3300046491 | Bacteria | 1528 |
| 986 | Ga0495594_0013448 | 3300046499 | Bacteria | 4275 |
| 987 | Ga0495594_0026158 | 3300046499 | Bacteria | 3138 |
| 988 | Ga0495594_0039069 | 3300046499 | Bacteria | 2593 |
| 989 | Ga0495608_0000073 | 3300046511 | Bacteria | 76724 |
| 990 | Ga0495618_0007472 | 3300046514 | Bacteria | 6611 |
| 991 | Ga0495618_0034019 | 3300046514 | Bacteria | 3195 |
| 992 | Ga0495618_0092929 | 3300046514 | Bacteria | 1929 |
| 993 | Ga0495628_0000157 | 3300046516 | Bacteria | 59167 |
| 994 | Ga0495628_0009614 | 3300046516 | Bacteria | 8250 |
| 995 | Ga0495628_0081157 | 3300046516 | Bacteria | 2519 |
| 996 | Ga0495628_0149156 | 3300046516 | Bacteria | 1782 |
| 997 | Ga0495630_0001130 | 3300046517 | Bacteria | 18408 |
| 998 | Ga0495630_0007186 | 3300046517 | Bacteria | 7937 |
| 999 | Ga0495630_0010823 | 3300046517 | Bacteria | 6588 |
| 1000 | Ga0495630_0056237 | 3300046517 | Bacteria | 2948 |
| 1001 | Ga0495630_0372006 | 3300046517 | Bacteria | 1094 |
| 1002 | Ga0495666_0030573 | 3300046526 | Bacteria | 2642 |
| 1003 | Ga0495652_0001178 | 3300046529 | Bacteria | 29436 |
| 1004 | Ga0495652_0063127 | 3300046529 | Bacteria | 3120 |
| 1005 | Ga0495652_0074609 | 3300046529 | Bacteria | 2820 |
| 1006 | Ga0495665_0000137 | 3300046531 | Bacteria | 35494 |
| 1007 | Ga0495640_0025343 | 3300046533 | Bacteria | 4304 |
| 1008 | Ga0495640_0096528 | 3300046533 | Bacteria | 1945 |
| 1009 | Ga0495640_0142602 | 3300046533 | Bacteria | 1544 |
| 1010 | Ga0495586_0008259 | 3300046535 | Bacteria | 5542 |
| 1011 | Ga0495586_0022426 | 3300046535 | Bacteria | 3369 |
| 1012 | Ga0495586_0355736 | 3300046535 | Bacteria | 841 |
| 1013 | Ga0495587_0006400 | 3300046536 | Bacteria | 7682 |
| 1014 | Ga0495587_0009570 | 3300046536 | Bacteria | 6203 |
| 1015 | Ga0495587_0051602 | 3300046536 | Bacteria | 2431 |
| 1016 | Ga0495645_0000299 | 3300046543 | Bacteria | 36039 |
| 1017 | Ga0495645_0056876 | 3300046543 | Bacteria | 2840 |
| 1018 | Ga0495622_0032590 | 3300046557 | Bacteria | 2433 |
| 1019 | Ga0495667_0000191 | 3300046559 | Bacteria | 41960 |
| 1020 | Ga0495667_0000474 | 3300046559 | Bacteria | 25533 |
| 1021 | Ga0495667_0024916 | 3300046559 | Bacteria | 4031 |
| 1022 | Ga0495667_0105862 | 3300046559 | Bacteria | 1818 |
| 1023 | Ga0495634_0003518 | 3300046642 | Bacteria | 12547 |
| 1024 | Ga0495634_0069995 | 3300046642 | Bacteria | 2313 |
| 1025 | Ga0495634_0079444 | 3300046642 | Bacteria | 2148 |
| 1026 | Ga0495635_0000066 | 3300046663 | Bacteria | 64707 |
| 1027 | Ga0495659_0026699 | 3300046664 | Bacteria | 1987 |
| 1028 | Ga0495588_0000380 | 3300046674 | Bacteria | 25738 |
| 1029 | Ga0495588_0179956 | 3300046674 | Bacteria | 1117 |
| 1030 | Ga0495657_0000053 | 3300046675 | Bacteria | 100979 |
| 1031 | Ga0495657_0023972 | 3300046675 | Bacteria | 4353 |
| 1032 | Ga0495657_0110165 | 3300046675 | Bacteria | 1745 |
| 1033 | Ga0495599_0001415 | 3300046678 | Bacteria | 13735 |
| 1034 | Ga0495599_0067049 | 3300046678 | Bacteria | 2242 |
| 1035 | Ga0495623_0008532 | 3300046679 | Bacteria | 6654 |
| 1036 | Ga0495623_0030521 | 3300046679 | Bacteria | 3467 |
| 1037 | Ga0495623_0106385 | 3300046679 | Bacteria | 1704 |
| 1038 | Ga0495646_0061751 | 3300046680 | Bacteria | 2230 |
| 1039 | Ga0495658_0000248 | 3300046683 | Bacteria | 30893 |
| 1040 | Ga0495658_0037138 | 3300046683 | Bacteria | 2691 |
| 1041 | Ga0495658_0420752 | 3300046683 | Bacteria | 852 |
| 1042 | Ga0495669_0207308 | 3300046684 | Bacteria | 938 |
| 1043 | Ga0495613_0005336 | 3300046689 | Bacteria | 9655 |
| 1044 | Ga0495613_0252590 | 3300046689 | Bacteria | 1230 |
| 1045 | Ga0495613_0428717 | 3300046689 | Bacteria | 899 |
| 1046 | Ga0495600_0000032 | 3300046809 | Bacteria | 85490 |
| 1047 | Ga0495600_0128800 | 3300046809 | Bacteria | 1645 |
| 1048 | Ga0495581_0109486 | 3300047315 | Bacteria | 1606 |
| 1049 | Ga0495581_0231317 | 3300047315 | Bacteria | 1081 |
| 1050 | Ga0495604_0000051 | 3300047317 | Bacteria | 103371 |
| 1051 | Ga0495604_0150251 | 3300047317 | Bacteria | 1656 |
| 1052 | Ga0495604_0247428 | 3300047317 | Bacteria | 1217 |
| 1053 | Ga0495674_0001207 | 3300047319 | Bacteria | 25026 |
| 1054 | Ga0495674_0052030 | 3300047319 | Bacteria | 3607 |
| 1055 | Ga0495674_0343802 | 3300047319 | Bacteria | 1212 |
| 1056 | Ga0495674_0442411 | 3300047319 | Bacteria | 1045 |
| 1057 | Ga0495672_0008073 | 3300047320 | Bacteria | 7820 |
| 1058 | Ga0495676_0070292 | 3300047321 | Bacteria | 2697 |
| 1059 | Ga0495680_0009004 | 3300047322 | Bacteria | 9018 |
| 1060 | Ga0495680_0042807 | 3300047322 | Bacteria | 3590 |
| 1061 | Ga0495675_0000665 | 3300047444 | Bacteria | 21641 |
| 1062 | Ga0495675_0192954 | 3300047444 | Bacteria | 1242 |
| 1063 | Ga0495675_0248445 | 3300047444 | Bacteria | 1069 |
| 1064 | Ga0495684_0000062 | 3300047471 | Bacteria | 73594 |
| 1065 | Ga0495684_0045674 | 3300047471 | Bacteria | 3352 |
| 1066 | Ga0495684_0074382 | 3300047471 | Bacteria | 2581 |
| 1067 | Ga0495684_0118463 | 3300047471 | Bacteria | 1995 |
| 1068 | Ga0495593_0000178 | 3300047673 | Bacteria | 32900 |
| 1069 | Ga0495593_0027113 | 3300047673 | Bacteria | 3156 |
| 1070 | Ga0495602_0000245 | 3300048088 | Bacteria | 50884 |
| 1071 | Ga0495602_0092586 | 3300048088 | Bacteria | 2503 |
| 1072 | Ga0495602_0149486 | 3300048088 | Bacteria | 1838 |
| 1073 | Ga0495614_0081774 | 3300048089 | Bacteria | 1400 |
| 1074 | Ga0496101_0013792 | 3300048904 | Bacteria | 5423 |
| 1075 | Ga0496101_0287845 | 3300048904 | Bacteria | 1285 |
| 1076 | Ga0496102_0603960 | 3300048905 | Bacteria | 1020 |
| 1077 | Ga0496103_0205936 | 3300048906 | Bacteria | 1265 |
| 1078 | Ga0496104_0359636 | 3300048907 | Bacteria | 1368 |
| 1079 | Ga0496106_0058641 | 3300048909 | Bacteria | 2915 |
| 1080 | Ga0496106_0060003 | 3300048909 | Bacteria | 2883 |
| 1081 | Ga0496109_0011584 | 3300048912 | Bacteria | 7588 |
| 1082 | Ga0496110_0028643 | 3300048913 | Bacteria | 4786 |
| 1083 | Ga0496111_0058359 | 3300048914 | Bacteria | 2794 |
| 1084 | Ga0496112_0000381 | 3300048915 | Bacteria | 29095 |
| 1085 | Ga0496112_0000949 | 3300048915 | Bacteria | 21056 |
| 1086 | Ga0496112_0002076 | 3300048915 | Bacteria | 15887 |
| 1087 | Ga0496112_0070381 | 3300048915 | Bacteria | 3457 |
| 1088 | Ga0496112_0457270 | 3300048915 | Bacteria | 1214 |
| 1089 | Ga0496113_0016907 | 3300048916 | Bacteria | 5050 |
| 1090 | Ga0496114_0068395 | 3300048917 | Bacteria | 2982 |
| 1091 | Ga0501031_0031047 | 3300049568 | Bacteria | 3487 |
| 1092 | Ga0501031_0235300 | 3300049568 | Bacteria | 1191 |
| 1093 | Ga0501034_0043443 | 3300049571 | Bacteria | 4548 |
| 1094 | Ga0501034_0217737 | 3300049571 | Bacteria | 1863 |
| 1095 | Ga0501034_0326280 | 3300049571 | Bacteria | 1467 |
| 1096 | Ga0501036_0227478 | 3300049572 | Bacteria | 1566 |
| 1097 | Ga0501037_0355057 | 3300049573 | Bacteria | 1011 |
| 1098 | Ga0501038_0344403 | 3300049574 | Bacteria | 1162 |
| 1099 | Ga0501039_0038893 | 3300049575 | Bacteria | 3674 |
| 1100 | Ga0501039_0612719 | 3300049575 | Bacteria | 853 |
| 1101 | Ga0501040_0006397 | 3300049576 | Bacteria | 7649 |
| 1102 | Ga0501040_0110094 | 3300049576 | Bacteria | 1926 |
| 1103 | Ga0501040_0141672 | 3300049576 | Bacteria | 1694 |
| 1104 | Ga0501040_0253895 | 3300049576 | Bacteria | 1254 |
| 1105 | Ga0501041_0180991 | 3300049577 | Bacteria | 1319 |
| 1106 | Ga0501041_0333902 | 3300049577 | Bacteria | 957 |
| 1107 | Ga0501046_0199679 | 3300049580 | Bacteria | 1488 |
| 1108 | Ga0501046_0310223 | 3300049580 | Bacteria | 1151 |
| 1109 | Ga0501048_0110052 | 3300049582 | Bacteria | 1945 |
| 1110 | Ga0501048_0200132 | 3300049582 | Bacteria | 1416 |
| 1111 | Ga0501068_0123917 | 3300049584 | Bacteria | 1613 |
| 1112 | Ga0501069_0038928 | 3300049585 | Bacteria | 2625 |
| 1113 | Ga0501069_0324404 | 3300049585 | Bacteria | 905 |
| 1114 | Ga0501070_0642972 | 3300049586 | Bacteria | 843 |
| 1115 | Ga0501071_0370429 | 3300049587 | Bacteria | 1091 |
| 1116 | Ga0501072_0012568 | 3300049588 | Bacteria | 6471 |
| 1117 | Ga0501072_0132326 | 3300049588 | Bacteria | 1988 |
| 1118 | Ga0501072_0442603 | 3300049588 | Bacteria | 1029 |
| 1119 | Ga0501072_0481520 | 3300049588 | Bacteria | 982 |
| 1120 | Ga0501074_0162757 | 3300049590 | Bacteria | 1593 |
| 1121 | Ga0501075_0004754 | 3300049591 | Bacteria | 9232 |
| 1122 | Ga0501075_0134637 | 3300049591 | Bacteria | 1882 |
| 1123 | Ga0501075_0239470 | 3300049591 | Bacteria | 1383 |
| 1124 | Ga0501076_0083749 | 3300049592 | Bacteria | 2561 |
| 1125 | Ga0501076_0105901 | 3300049592 | Bacteria | 2270 |
| 1126 | Ga0501076_0199529 | 3300049592 | Bacteria | 1633 |
| 1127 | Ga0501076_0332238 | 3300049592 | Bacteria | 1247 |
| 1128 | Ga0501077_0025512 | 3300049593 | Bacteria | 3753 |
| 1129 | Ga0501077_0086085 | 3300049593 | Bacteria | 1992 |
| 1130 | Ga0501202_007952 | 3300049652 | Bacteria | 1926 |
| 1131 | Ga0501207_004020 | 3300049654 | Bacteria | 1986 |
| 1132 | Ga0501209_000108 | 3300049656 | Bacteria | 8554 |
| 1133 | Ga0501217_011639 | 3300049661 | Bacteria | 1950 |
| 1134 | Ga0501217_021028 | 3300049661 | Bacteria | 1538 |
| 1135 | Ga0501222_008998 | 3300049662 | Bacteria | 1322 |
| 1136 | Ga0501224_001565 | 3300049664 | Bacteria | 3054 |
| 1137 | Ga0501235_000604 | 3300049669 | Bacteria | 7242 |
| 1138 | Ga0501235_002665 | 3300049669 | Bacteria | 3842 |
| 1139 | Ga0501239_010467 | 3300049672 | Bacteria | 1023 |
| 1140 | Ga0501247_000137 | 3300049677 | Bacteria | 4349 |
| 1141 | Ga0501247_004167 | 3300049677 | Bacteria | 1572 |
| 1142 | Ga0501249_038625 | 3300049679 | Bacteria | 1078 |
| 1143 | Ga0501251_001500 | 3300049681 | Bacteria | 2188 |
| 1144 | Ga0501253_001444 | 3300049683 | Bacteria | 2426 |
| 1145 | Ga0501257_012144 | 3300049686 | Bacteria | 1969 |
| 1146 | Ga0501221_000448 | 3300049704 | Bacteria | 6413 |
| 1147 | Ga0501225_0000914 | 3300049705 | Bacteria | 9208 |
| 1148 | Ga0501234_001489 | 3300049707 | Bacteria | 3682 |
| 1149 | Ga0501079_0088003 | 3300049741 | Bacteria | 2405 |
| 1150 | Ga0501079_0128417 | 3300049741 | Bacteria | 1972 |
| 1151 | Ga0501079_0142060 | 3300049741 | Bacteria | 1870 |
| 1152 | Ga0501079_0149253 | 3300049741 | Bacteria | 1822 |
| 1153 | Ga0501079_0219181 | 3300049741 | Bacteria | 1486 |
| 1154 | Ga0501080_0133787 | 3300049742 | Bacteria | 2295 |
| 1155 | Ga0501080_0224474 | 3300049742 | Bacteria | 1718 |
| 1156 | Ga0501080_0311000 | 3300049742 | Bacteria | 1428 |
| 1157 | Ga0501080_0356272 | 3300049742 | Bacteria | 1320 |
| 1158 | Ga0501081_0080724 | 3300049743 | Bacteria | 2277 |
| 1159 | Ga0501081_0153786 | 3300049743 | Bacteria | 1654 |
| 1160 | Ga0501081_0154574 | 3300049743 | Bacteria | 1650 |
| 1161 | Ga0501081_0355385 | 3300049743 | Bacteria | 1080 |
| 1162 | Ga0501081_0393903 | 3300049743 | Bacteria | 1025 |
| 1163 | Ga0501081_0429260 | 3300049743 | Bacteria | 980 |
| 1164 | Ga0501083_0026838 | 3300049744 | Bacteria | 3979 |
| 1165 | Ga0501083_0150612 | 3300049744 | Bacteria | 1523 |
| 1166 | Ga0501263_001639 | 3300049760 | Bacteria | 2152 |
| 1167 | Ga0501268_000040 | 3300049765 | Bacteria | 10532 |
| 1168 | Ga0501268_004967 | 3300049765 | Bacteria | 1893 |
| 1169 | Ga0501268_006723 | 3300049765 | Bacteria | 1697 |
| 1170 | Ga0501271_002072 | 3300049768 | Bacteria | 1763 |
| 1171 | Ga0501283_005510 | 3300049779 | Bacteria | 1743 |
| 1172 | Ga0501035_0038522 | 3300049822 | Bacteria | 4328 |
| 1173 | Ga0501045_0023179 | 3300049824 | Bacteria | 4448 |
| 1174 | Ga0501045_0043259 | 3300049824 | Bacteria | 3279 |
| 1175 | Ga0501045_0149673 | 3300049824 | Bacteria | 1736 |
| 1176 | Ga0501045_0191513 | 3300049824 | Bacteria | 1524 |
| 1177 | Ga0501045_0355430 | 3300049824 | Bacteria | 1090 |
| 1178 | nmdc:mga05p37_155774_c1 | 3300050507 | Bacteria | 2792 |
| 1179 | nmdc:mga05p37_19421_c1 | 3300050507 | Bacteria | 8222 |
| 1180 | nmdc:mga05p37_197905_c1 | 3300050507 | Bacteria | 2436 |
| 1181 | nmdc:mga05p37_3197_c1 | 3300050507 | Bacteria | 19063 |
| 1182 | nmdc:mga05p37_745005_c1 | 3300050507 | Bacteria | 1081 |
| 1183 | nmdc:mga09592_1886_c1 | 3300050508 | Bacteria | 16873 |
| 1184 | nmdc:mga09592_289427_c1 | 3300050508 | Bacteria | 1420 |
| 1185 | nmdc:mga09592_35193_c1 | 3300050508 | Bacteria | 4191 |
| 1186 | nmdc:mga09592_3549_c1 | 3300050508 | Bacteria | 12593 |
| 1187 | nmdc:mga0qj67_176711_c1 | 3300050509 | Bacteria | 1734 |
| 1188 | nmdc:mga0qj67_2646_c1 | 3300050509 | Bacteria | 12830 |
| 1189 | nmdc:mga0qj67_311979_c1 | 3300050509 | Bacteria | 1273 |
| 1190 | nmdc:mga0qj67_477509_c1 | 3300050509 | Bacteria | 1003 |
| 1191 | nmdc:mga0qj67_5249_c1 | 3300050509 | Bacteria | 9447 |
| 1192 | nmdc:mga0qj67_77733_c1 | 3300050509 | Bacteria | 2655 |
| 1193 | nmdc:mga06r32_390614_c1 | 3300050510 | Bacteria | 1374 |
| 1194 | nmdc:mga06r32_449882_c1 | 3300050510 | Bacteria | 1267 |
| 1195 | nmdc:mga06r32_5005_c1 | 3300050510 | Bacteria | 11930 |
| 1196 | nmdc:mga06r32_52114_c1 | 3300050510 | Bacteria | 3918 |
| 1197 | nmdc:mga06r32_53042_c1 | 3300050510 | Bacteria | 3884 |
| 1198 | nmdc:mga06r32_80042_c1 | 3300050510 | Bacteria | 3179 |
| 1199 | nmdc:mga06r32_973687_c1 | 3300050510 | Bacteria | 802 |
| 1200 | nmdc:mga08y16_1009160_c1 | 3300050511 | Bacteria | 812 |
| 1201 | nmdc:mga08y16_41046_c1 | 3300050511 | Bacteria | 4847 |
| 1202 | nmdc:mga08y16_507848_c1 | 3300050511 | Bacteria | 1224 |
| 1203 | nmdc:mga08y16_56258_c1 | 3300050511 | Bacteria | 4112 |
| 1204 | nmdc:mga0n895_106819_c1 | 3300050512 | Bacteria | 2813 |
| 1205 | nmdc:mga0n895_14834_c1 | 3300050512 | Bacteria | 7091 |
| 1206 | nmdc:mga0n895_21058_c1 | 3300050512 | Bacteria | 6093 |
| 1207 | nmdc:mga0n895_295342_c1 | 3300050512 | Bacteria | 1643 |
| 1208 | nmdc:mga0n895_330294_c1 | 3300050512 | Bacteria | 1545 |
| 1209 | nmdc:mga0n895_468062_c1 | 3300050512 | Bacteria | 1272 |
| 1210 | nmdc:mga0n895_61534_c1 | 3300050512 | Bacteria | 3707 |
| 1211 | nmdc:mga0n895_63991_c1 | 3300050512 | Bacteria | 3638 |
| 1212 | nmdc:mga0n895_854_c1 | 3300050512 | Bacteria | 21915 |
| 1213 | nmdc:mga0rr50_13705_c1 | 3300050513 | Bacteria | 5290 |
| 1214 | nmdc:mga0rr50_187707_c1 | 3300050513 | Bacteria | 1693 |
| 1215 | nmdc:mga0rr50_209070_c1 | 3300050513 | Bacteria | 1607 |
| 1216 | nmdc:mga0rr50_315618_c1 | 3300050513 | Bacteria | 1310 |
| 1217 | nmdc:mga0rr50_48114_c1 | 3300050513 | Bacteria | 3151 |
| 1218 | nmdc:mga0rr50_562803_c1 | 3300050513 | Bacteria | 971 |
| 1219 | nmdc:mga0rr50_578522_c1 | 3300050513 | Bacteria | 957 |
| 1220 | nmdc:mga08x19_100260_c1 | 3300050514 | Bacteria | 1921 |
| 1221 | nmdc:mga08x19_10886_c1 | 3300050514 | Bacteria | 5470 |
| 1222 | nmdc:mga08x19_1110_c1 | 3300050514 | Bacteria | 16781 |
| 1223 | nmdc:mga08x19_14485_c1 | 3300050514 | Bacteria | 4782 |
| 1224 | nmdc:mga08x19_3198_c1 | 3300050514 | Bacteria | 9822 |
| 1225 | nmdc:mga08x19_33583_c1 | 3300050514 | Bacteria | 3238 |
| 1226 | nmdc:mga08x19_5006_c1 | 3300050514 | Bacteria | 7834 |
| 1227 | nmdc:mga08x19_52021_c1 | 3300050514 | Bacteria | 2633 |
| 1228 | nmdc:mga08x19_5823_c1 | 3300050514 | Bacteria | 7290 |
| 1229 | nmdc:mga08x19_85603_c1 | 3300050514 | Bacteria | 2074 |
| 1230 | nmdc:mga0a205_110082_c1 | 3300050515 | Bacteria | 2653 |
| 1231 | nmdc:mga0a205_14260_c1 | 3300050515 | Bacteria | 7410 |
| 1232 | nmdc:mga0a205_23409_c1 | 3300050515 | Bacteria | 5859 |
| 1233 | nmdc:mga0a205_23798_c1 | 3300050515 | Bacteria | 5813 |
| 1234 | nmdc:mga0a205_26058_c1 | 3300050515 | Bacteria | 5571 |
| 1235 | nmdc:mga0a205_5039_c1 | 3300050515 | Bacteria | 11897 |
| 1236 | Ga0495601_0002779 | 3300053077 | Bacteria | 9940 |
| 1237 | Ga0495601_0108896 | 3300053077 | Bacteria | 1793 |
| 1238 | Ga0495612_0000406 | 3300053078 | Bacteria | 17258 |
| 1239 | Ga0495619_0002199 | 3300053085 | Bacteria | 12920 |
| 1240 | Ga0495619_0104008 | 3300053085 | Bacteria | 1935 |
| 1241 | Ga0500583_0099532 | 3300053092 | Bacteria | 1423 |
| 1242 | Ga0501084_0132798 | 3300054114 | Bacteria | 2096 |
| 1243 | Ga0501084_0208731 | 3300054114 | Bacteria | 1648 |
| 1244 | Ga0501084_0238060 | 3300054114 | Bacteria | 1536 |
| 1245 | Ga0501084_0444570 | 3300054114 | Bacteria | 1096 |
| 1246 | Ga0501082_0061213 | 3300060353 | Bacteria | 3241 |
| 1247 | Ga0501082_0497858 | 3300060353 | Bacteria | 1065 |
| 1248 | Ga0501082_0500934 | 3300060353 | Bacteria | 1061 |
| 1249 | Ga0530510_0000078 | 3300061734 | Bacteria | 50426 |
| 1250 | Ga0530510_0109000 | 3300061734 | Bacteria | 2027 |
| 1251 | Ga0530510_0521225 | 3300061734 | Bacteria | 902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005615 | Ga0070702_100173395 | Ga0070702_1001733952 | 220 |
| 2 | 3300009098 | Ga0105245_10124898 | Ga0105245_101248983 | 220 |
| 3 | 3300005458 | Ga0070681_10001292 | Ga0070681_1000129222 | 221 |
| 4 | 3300005530 | Ga0070679_100000608 | Ga0070679_10000060828 | 221 |
| 5 | 3300009147 | Ga0114129_10199495 | Ga0114129_101994952 | 221 |
| 6 | 3300013307 | Ga0157372_10299974 | Ga0157372_102999743 | 221 |
| 7 | 3300025912 | Ga0207707_10011141 | Ga0207707_100111416 | 221 |
| 8 | 3300025917 | Ga0207660_10003331 | Ga0207660_100033319 | 221 |
| 9 | 3300025932 | Ga0207690_10012137 | Ga0207690_100121373 | 221 |
| 10 | 3300025933 | Ga0207706_10542116 | Ga0207706_105421161 | 221 |
| 11 | 3300034957 | Ga0373938_0004068 | Ga0373938_0004068_1135_1809 | 221 |
| 12 | 3300035115 | Ga0373941_0005211 | Ga0373941_0005211_1606_2280 | 221 |
| 13 | 3300035241 | Ga0373961_0162862 | Ga0373961_0162862_40_714 | 221 |
| 14 | 3300035691 | Ga0373931_0049888 | Ga0373931_0049888_1069_1743 | 221 |
| 15 | 3300050512 | nmdc:mga0n895_106819_c1 | nmdc:mga0n895_106819_c1_2097_2771 | 221 |
| 16 | 3300050515 | nmdc:mga0a205_5039_c1 | nmdc:mga0a205_5039_c1_4782_5456 | 221 |
| 17 | 3300047319 | Ga0495674_0442411 | Ga0495674_0442411_11_685 | 223 |
| 18 | 3300045976 | Ga0466967_0266377 | Ga0466967_0266377_941_1615 | 224 |
| 19 | 3300046689 | Ga0495613_0428717 | Ga0495613_0428717_186_860 | 224 |
| 20 | 3300049574 | Ga0501038_0344403 | Ga0501038_0344403_35_712 | 224 |
| 21 | 3300050510 | nmdc:mga06r32_973687_c1 | nmdc:mga06r32_973687_c1_41_739 | 224 |
| 22 | 3300050511 | nmdc:mga08y16_1009160_c1 | nmdc:mga08y16_1009160_c1_93_767 | 224 |
| 23 | 3300013100 | Ga0157373_10053152 | Ga0157373_100531522 | 225 |
| 24 | 3300054114 | Ga0501084_0132798 | Ga0501084_0132798_1406_2083 | 225 |
| 25 | 3300048906 | Ga0496103_0205936 | Ga0496103_0205936_207_1010 | 231 |
| 26 | 3300048909 | Ga0496106_0058641 | Ga0496106_0058641_1345_2148 | 231 |
| 27 | 3300046514 | Ga0495618_0092929 | Ga0495618_0092929_42_791 | 232 |
| 28 | 3300032002 | Ga0307416_100546634 | Ga0307416_1005466342 | 233 |
| 29 | 3300049576 | Ga0501040_0110094 | Ga0501040_0110094_20_724 | 234 |
| 30 | 3300046476 | Ga0495662_0258621 | Ga0495662_0258621_132_845 | 237 |
| 31 | 3300005347 | Ga0070668_100093855 | Ga0070668_1000938552 | 238 |
| 32 | 3300005364 | Ga0070673_100008731 | Ga0070673_1000087317 | 238 |
| 33 | 3300005543 | Ga0070672_100085773 | Ga0070672_1000857732 | 238 |
| 34 | 3300013308 | Ga0157375_10605034 | Ga0157375_106050342 | 238 |
| 35 | 3300025940 | Ga0207691_10092668 | Ga0207691_100926682 | 238 |
| 36 | 3300025960 | Ga0207651_10376597 | Ga0207651_103765972 | 238 |
| 37 | 3300005327 | Ga0070658_10054442 | Ga0070658_100544422 | 239 |
| 38 | 3300005329 | Ga0070683_100239943 | Ga0070683_1002399432 | 239 |
| 39 | 3300005366 | Ga0070659_100027964 | Ga0070659_1000279644 | 239 |
| 40 | 3300025909 | Ga0207705_10243867 | Ga0207705_102438672 | 239 |
| 41 | 3300025932 | Ga0207690_10208006 | Ga0207690_102080062 | 239 |
| 42 | 3300025944 | Ga0207661_10199567 | Ga0207661_101995672 | 239 |
| 43 | 3300031995 | Ga0307409_100066157 | Ga0307409_1000661572 | 239 |
| 44 | 3300032004 | Ga0307414_10266904 | Ga0307414_102669042 | 239 |
| 45 | 3300049656 | Ga0501209_000108 | Ga0501209_000108_3685_4455 | 239 |
| 46 | 3300049669 | Ga0501235_002665 | Ga0501235_002665_2174_2944 | 239 |
| 47 | 3300049677 | Ga0501247_000137 | Ga0501247_000137_69_839 | 239 |
| 48 | 3300049679 | Ga0501249_038625 | Ga0501249_038625_12_782 | 239 |
| 49 | 3300049683 | Ga0501253_001444 | Ga0501253_001444_12_782 | 239 |
| 50 | 3300049765 | Ga0501268_006723 | Ga0501268_006723_903_1673 | 239 |
| 51 | 3300049768 | Ga0501271_002072 | Ga0501271_002072_57_827 | 239 |
| 52 | 3300044673 | Ga0453683_0033313 | Ga0453683_0033313_252_1007 | 240 |
| 53 | 3300049586 | Ga0501070_0642972 | Ga0501070_0642972_31_768 | 242 |
| 54 | 3300005336 | Ga0070680_100006270 | Ga0070680_1000062702 | 243 |
| 55 | 3300005366 | Ga0070659_100030146 | Ga0070659_1000301461 | 243 |
| 56 | 3300005435 | Ga0070714_100013494 | Ga0070714_1000134942 | 243 |
| 57 | 3300005530 | Ga0070679_100016503 | Ga0070679_1000165031 | 243 |
| 58 | 3300005578 | Ga0068854_100034250 | Ga0068854_1000342502 | 243 |
| 59 | 3300005616 | Ga0068852_100055286 | Ga0068852_1000552862 | 243 |
| 60 | 3300009551 | Ga0105238_10027590 | Ga0105238_100275903 | 243 |
| 61 | 3300013104 | Ga0157370_10050227 | Ga0157370_100502273 | 243 |
| 62 | 3300025913 | Ga0207695_10261986 | Ga0207695_102619861 | 243 |
| 63 | 3300025917 | Ga0207660_10140630 | Ga0207660_101406302 | 243 |
| 64 | 3300025924 | Ga0207694_10019182 | Ga0207694_100191825 | 243 |
| 65 | 3300025929 | Ga0207664_10007050 | Ga0207664_100070502 | 243 |
| 66 | 3300025981 | Ga0207640_10026016 | Ga0207640_100260163 | 243 |
| 67 | 3300026067 | Ga0207678_10204722 | Ga0207678_102047222 | 243 |
| 68 | 3300026142 | Ga0207698_10015011 | Ga0207698_100150112 | 243 |
| 69 | 3300061734 | Ga0530510_0000078 | Ga0530510_0000078_19053_19787 | 243 |
| 70 | 3300005981 | Ga0081538_10050721 | Ga0081538_100507212 | 244 |
| 71 | 3300049577 | Ga0501041_0333902 | Ga0501041_0333902_90_851 | 244 |
| 72 | 3300049588 | Ga0501072_0481520 | Ga0501072_0481520_116_877 | 244 |
| 73 | 3300049741 | Ga0501079_0219181 | Ga0501079_0219181_685_1446 | 244 |
| 74 | 3300049743 | Ga0501081_0154574 | Ga0501081_0154574_602_1363 | 244 |
| 75 | 3300049743 | Ga0501081_0355385 | Ga0501081_0355385_243_1004 | 244 |
| 76 | 3300054114 | Ga0501084_0208731 | Ga0501084_0208731_561_1322 | 244 |
| 77 | 3300060353 | Ga0501082_0061213 | Ga0501082_0061213_1736_2497 | 244 |
| 78 | 3300061734 | Ga0530510_0109000 | Ga0530510_0109000_327_1088 | 244 |
| 79 | 3300005329 | Ga0070683_100183067 | Ga0070683_1001830672 | 245 |
| 80 | 3300025944 | Ga0207661_10102863 | Ga0207661_101028633 | 245 |
| 81 | 3300005548 | Ga0070665_100275791 | Ga0070665_1002757912 | 246 |
| 82 | 3300006846 | Ga0075430_100000158 | Ga0075430_10000015826 | 246 |
| 83 | 3300014325 | Ga0163163_10287927 | Ga0163163_102879272 | 246 |
| 84 | 3300046473 | Ga0495582_0045460 | Ga0495582_0045460_1366_2106 | 246 |
| 85 | 3300046683 | Ga0495658_0420752 | Ga0495658_0420752_44_784 | 246 |
| 86 | 3300050509 | nmdc:mga0qj67_2646_c1 | nmdc:mga0qj67_2646_c1_10148_10894 | 246 |
| 87 | 3300005353 | Ga0070669_100008716 | Ga0070669_1000087165 | 247 |
| 88 | 3300005354 | Ga0070675_100136223 | Ga0070675_1001362232 | 247 |
| 89 | 3300005457 | Ga0070662_100175049 | Ga0070662_1001750492 | 247 |
| 90 | 3300005459 | Ga0068867_100041713 | Ga0068867_1000417132 | 247 |
| 91 | 3300005468 | Ga0070707_100469507 | Ga0070707_1004695071 | 247 |
| 92 | 3300005518 | Ga0070699_100037937 | Ga0070699_1000379373 | 247 |
| 93 | 3300005518 | Ga0070699_100197440 | Ga0070699_1001974401 | 247 |
| 94 | 3300005564 | Ga0070664_100294411 | Ga0070664_1002944111 | 247 |
| 95 | 3300005577 | Ga0068857_100032635 | Ga0068857_1000326353 | 247 |
| 96 | 3300005719 | Ga0068861_100007877 | Ga0068861_1000078772 | 247 |
| 97 | 3300005844 | Ga0068862_100012176 | Ga0068862_1000121765 | 247 |
| 98 | 3300006846 | Ga0075430_100048026 | Ga0075430_1000480262 | 247 |
| 99 | 3300006846 | Ga0075430_100164489 | Ga0075430_1001644893 | 247 |
| 100 | 3300006880 | Ga0075429_100041536 | Ga0075429_1000415363 | 247 |
| 101 | 3300009147 | Ga0114129_10693858 | Ga0114129_106938581 | 247 |
| 102 | 3300009148 | Ga0105243_10334871 | Ga0105243_103348711 | 247 |
| 103 | 3300009553 | Ga0105249_10022608 | Ga0105249_100226083 | 247 |
| 104 | 3300013308 | Ga0157375_10088177 | Ga0157375_100881773 | 247 |
| 105 | 3300025922 | Ga0207646_10181255 | Ga0207646_101812552 | 247 |
| 106 | 3300025940 | Ga0207691_10016019 | Ga0207691_100160193 | 247 |
| 107 | 3300025945 | Ga0207679_10115300 | Ga0207679_101153002 | 247 |
| 108 | 3300025960 | Ga0207651_10589569 | Ga0207651_105895692 | 247 |
| 109 | 3300044673 | Ga0453683_0004688 | Ga0453683_0004688_6198_6977 | 247 |
| 110 | 3300050507 | nmdc:mga05p37_745005_c1 | nmdc:mga05p37_745005_c1_311_1057 | 247 |
| 111 | 3300050508 | nmdc:mga09592_289427_c1 | nmdc:mga09592_289427_c1_170_916 | 247 |
| 112 | 3300050509 | nmdc:mga0qj67_5249_c1 | nmdc:mga0qj67_5249_c1_4966_5718 | 247 |
| 113 | 3300005327 | Ga0070658_10035350 | Ga0070658_100353502 | 248 |
| 114 | 3300005329 | Ga0070683_100040754 | Ga0070683_1000407544 | 248 |
| 115 | 3300005336 | Ga0070680_100027460 | Ga0070680_1000274603 | 248 |
| 116 | 3300005339 | Ga0070660_100058628 | Ga0070660_1000586282 | 248 |
| 117 | 3300005339 | Ga0070660_100174291 | Ga0070660_1001742912 | 248 |
| 118 | 3300005341 | Ga0070691_10029397 | Ga0070691_100293972 | 248 |
| 119 | 3300005344 | Ga0070661_100029581 | Ga0070661_1000295813 | 248 |
| 120 | 3300005344 | Ga0070661_100111778 | Ga0070661_1001117781 | 248 |
| 121 | 3300005366 | Ga0070659_100042432 | Ga0070659_1000424322 | 248 |
| 122 | 3300005435 | Ga0070714_100034277 | Ga0070714_1000342772 | 248 |
| 123 | 3300005530 | Ga0070679_100047770 | Ga0070679_1000477702 | 248 |
| 124 | 3300005546 | Ga0070696_100145231 | Ga0070696_1001452312 | 248 |
| 125 | 3300005614 | Ga0068856_100055886 | Ga0068856_1000558863 | 248 |
| 126 | 3300005616 | Ga0068852_100009676 | Ga0068852_1000096763 | 248 |
| 127 | 3300006871 | Ga0075434_100127769 | Ga0075434_1001277692 | 248 |
| 128 | 3300009093 | Ga0105240_10190189 | Ga0105240_101901892 | 248 |
| 129 | 3300009174 | Ga0105241_10000019 | Ga0105241_1000001947 | 248 |
| 130 | 3300009545 | Ga0105237_10036092 | Ga0105237_100360924 | 248 |
| 131 | 3300009551 | Ga0105238_10013049 | Ga0105238_100130499 | 248 |
| 132 | 3300009551 | Ga0105238_10711097 | Ga0105238_107110972 | 248 |
| 133 | 3300013102 | Ga0157371_10074288 | Ga0157371_100742882 | 248 |
| 134 | 3300013104 | Ga0157370_10112049 | Ga0157370_101120492 | 248 |
| 135 | 3300013105 | Ga0157369_10108231 | Ga0157369_101082312 | 248 |
| 136 | 3300013307 | Ga0157372_10046586 | Ga0157372_100465865 | 248 |
| 137 | 3300013307 | Ga0157372_10695174 | Ga0157372_106951742 | 248 |
| 138 | 3300025908 | Ga0207643_10060545 | Ga0207643_100605452 | 248 |
| 139 | 3300025909 | Ga0207705_10029338 | Ga0207705_100293383 | 248 |
| 140 | 3300025911 | Ga0207654_10000962 | Ga0207654_100009626 | 248 |
| 141 | 3300025913 | Ga0207695_10564740 | Ga0207695_105647401 | 248 |
| 142 | 3300025919 | Ga0207657_10007417 | Ga0207657_1000741712 | 248 |
| 143 | 3300025919 | Ga0207657_10017181 | Ga0207657_100171816 | 248 |
| 144 | 3300025919 | Ga0207657_10355490 | Ga0207657_103554902 | 248 |
| 145 | 3300025920 | Ga0207649_10038609 | Ga0207649_100386094 | 248 |
| 146 | 3300025921 | Ga0207652_10020371 | Ga0207652_100203714 | 248 |
| 147 | 3300025923 | Ga0207681_10020095 | Ga0207681_100200952 | 248 |
| 148 | 3300025924 | Ga0207694_10070725 | Ga0207694_100707252 | 248 |
| 149 | 3300025929 | Ga0207664_10053021 | Ga0207664_100530212 | 248 |
| 150 | 3300025931 | Ga0207644_10126524 | Ga0207644_101265242 | 248 |
| 151 | 3300025932 | Ga0207690_10129885 | Ga0207690_101298852 | 248 |
| 152 | 3300025935 | Ga0207709_10104043 | Ga0207709_101040432 | 248 |
| 153 | 3300025944 | Ga0207661_10221052 | Ga0207661_102210522 | 248 |
| 154 | 3300025949 | Ga0207667_10044977 | Ga0207667_100449772 | 248 |
| 155 | 3300025961 | Ga0207712_10003463 | Ga0207712_100034638 | 248 |
| 156 | 3300025981 | Ga0207640_10089997 | Ga0207640_100899972 | 248 |
| 157 | 3300025986 | Ga0207658_10241365 | Ga0207658_102413652 | 248 |
| 158 | 3300026067 | Ga0207678_10001786 | Ga0207678_1000178611 | 248 |
| 159 | 3300026075 | Ga0207708_10038135 | Ga0207708_100381353 | 248 |
| 160 | 3300026089 | Ga0207648_10140928 | Ga0207648_101409282 | 248 |
| 161 | 3300026116 | Ga0207674_10035181 | Ga0207674_100351813 | 248 |
| 162 | 3300026118 | Ga0207675_100066119 | Ga0207675_1000661192 | 248 |
| 163 | 3300026142 | Ga0207698_10058998 | Ga0207698_100589982 | 248 |
| 164 | 3300026142 | Ga0207698_10121777 | Ga0207698_101217772 | 248 |
| 165 | 3300028380 | Ga0268265_10096003 | Ga0268265_100960032 | 248 |
| 166 | 3300031251 | Ga0265327_10033503 | Ga0265327_100335032 | 248 |
| 167 | 3300031711 | Ga0265314_10101911 | Ga0265314_101019112 | 248 |
| 168 | 3300037853 | Ga0436364_1235499 | Ga0436364_1235499_26_772 | 248 |
| 169 | 3300042876 | Ga0451577_0903633 | Ga0451577_0903633_29_778 | 248 |
| 170 | 3300044684 | Ga0466966_0063642 | Ga0466966_0063642_1500_2246 | 248 |
| 171 | 3300044693 | Ga0466961_0017713 | Ga0466961_0017713_3417_4163 | 248 |
| 172 | 3300044693 | Ga0466961_0091207 | Ga0466961_0091207_135_881 | 248 |
| 173 | 3300045049 | Ga0466959_0016555 | Ga0466959_0016555_3122_3868 | 248 |
| 174 | 3300046559 | Ga0495667_0024916 | Ga0495667_0024916_2791_3537 | 248 |
| 175 | 3300050511 | nmdc:mga08y16_41046_c1 | nmdc:mga08y16_41046_c1_2937_3704 | 248 |
| 176 | 3300053092 | Ga0500583_0099532 | Ga0500583_0099532_157_903 | 248 |
| 177 | iso_pu_bacteria | 2895511927 | 2895517961 | 248 |
| 178 | 3300005328 | Ga0070676_10110410 | Ga0070676_101104102 | 249 |
| 179 | 3300005366 | Ga0070659_100212643 | Ga0070659_1002126432 | 249 |
| 180 | 3300005468 | Ga0070707_100131992 | Ga0070707_1001319922 | 249 |
| 181 | 3300005518 | Ga0070699_100041992 | Ga0070699_1000419924 | 249 |
| 182 | 3300005518 | Ga0070699_100110896 | Ga0070699_1001108962 | 249 |
| 183 | 3300005563 | Ga0068855_100862231 | Ga0068855_1008622311 | 249 |
| 184 | 3300006846 | Ga0075430_100044776 | Ga0075430_1000447765 | 249 |
| 185 | 3300006880 | Ga0075429_100029580 | Ga0075429_1000295803 | 249 |
| 186 | 3300009093 | Ga0105240_10136507 | Ga0105240_101365073 | 249 |
| 187 | 3300013308 | Ga0157375_10694135 | Ga0157375_106941352 | 249 |
| 188 | 3300025913 | Ga0207695_10170463 | Ga0207695_101704632 | 249 |
| 189 | 3300025920 | Ga0207649_10223509 | Ga0207649_102235092 | 249 |
| 190 | 3300025922 | Ga0207646_10038019 | Ga0207646_100380193 | 249 |
| 191 | 3300025922 | Ga0207646_10198958 | Ga0207646_101989582 | 249 |
| 192 | 3300027471 | Ga0209995_1001594 | Ga0209995_10015942 | 249 |
| 193 | 3300027526 | Ga0209968_1002268 | Ga0209968_10022682 | 249 |
| 194 | 3300027543 | Ga0209999_1001140 | Ga0209999_10011402 | 249 |
| 195 | 3300027695 | Ga0209966_1003128 | Ga0209966_10031282 | 249 |
| 196 | 3300027717 | Ga0209998_10000194 | Ga0209998_100001941 | 249 |
| 197 | 3300031731 | Ga0307405_10029235 | Ga0307405_100292352 | 249 |
| 198 | 3300031824 | Ga0307413_10214025 | Ga0307413_102140252 | 249 |
| 199 | 3300031901 | Ga0307406_10032349 | Ga0307406_100323495 | 249 |
| 200 | 3300031911 | Ga0307412_10029152 | Ga0307412_100291524 | 249 |
| 201 | 3300031911 | Ga0307412_10472828 | Ga0307412_104728282 | 249 |
| 202 | 3300031995 | Ga0307409_100038563 | Ga0307409_1000385632 | 249 |
| 203 | 3300032002 | Ga0307416_100025517 | Ga0307416_1000255175 | 249 |
| 204 | 3300046463 | Ga0495653_0048621 | Ga0495653_0048621_1008_1757 | 249 |
| 205 | 3300046675 | Ga0495657_0110165 | Ga0495657_0110165_979_1728 | 249 |
| 206 | 3300047317 | Ga0495604_0247428 | Ga0495604_0247428_275_1024 | 249 |
| 207 | 3300049652 | Ga0501202_007952 | Ga0501202_007952_1016_1765 | 249 |
| 208 | 3300049654 | Ga0501207_004020 | Ga0501207_004020_272_1021 | 249 |
| 209 | 3300049661 | Ga0501217_011639 | Ga0501217_011639_200_949 | 249 |
| 210 | 3300049662 | Ga0501222_008998 | Ga0501222_008998_273_1022 | 249 |
| 211 | 3300049664 | Ga0501224_001565 | Ga0501224_001565_995_1744 | 249 |
| 212 | 3300049669 | Ga0501235_000604 | Ga0501235_000604_2392_3141 | 249 |
| 213 | 3300049672 | Ga0501239_010467 | Ga0501239_010467_93_842 | 249 |
| 214 | 3300049677 | Ga0501247_004167 | Ga0501247_004167_805_1554 | 249 |
| 215 | 3300049681 | Ga0501251_001500 | Ga0501251_001500_1123_1872 | 249 |
| 216 | 3300049686 | Ga0501257_012144 | Ga0501257_012144_16_765 | 249 |
| 217 | 3300049704 | Ga0501221_000448 | Ga0501221_000448_2735_3484 | 249 |
| 218 | 3300049705 | Ga0501225_0000914 | Ga0501225_0000914_4623_5372 | 249 |
| 219 | 3300049707 | Ga0501234_001489 | Ga0501234_001489_1681_2430 | 249 |
| 220 | 3300049760 | Ga0501263_001639 | Ga0501263_001639_1391_2140 | 249 |
| 221 | 3300049765 | Ga0501268_000040 | Ga0501268_000040_4057_4806 | 249 |
| 222 | 3300005329 | Ga0070683_100022256 | Ga0070683_1000222564 | 250 |
| 223 | 3300005458 | Ga0070681_10275201 | Ga0070681_102752012 | 250 |
| 224 | 3300005518 | Ga0070699_100553093 | Ga0070699_1005530932 | 250 |
| 225 | 3300005530 | Ga0070679_100195433 | Ga0070679_1001954332 | 250 |
| 226 | 3300014968 | Ga0157379_10197600 | Ga0157379_101976002 | 250 |
| 227 | 3300025944 | Ga0207661_10020824 | Ga0207661_100208243 | 250 |
| 228 | 3300025945 | Ga0207679_10124706 | Ga0207679_101247062 | 250 |
| 229 | 3300031548 | Ga0307408_100061987 | Ga0307408_1000619872 | 250 |
| 230 | 3300031731 | Ga0307405_10004860 | Ga0307405_100048604 | 250 |
| 231 | 3300031824 | Ga0307413_10067889 | Ga0307413_100678892 | 250 |
| 232 | 3300031852 | Ga0307410_10021209 | Ga0307410_100212094 | 250 |
| 233 | 3300031901 | Ga0307406_10016148 | Ga0307406_100161484 | 250 |
| 234 | 3300031911 | Ga0307412_10035677 | Ga0307412_100356774 | 250 |
| 235 | 3300031995 | Ga0307409_100014998 | Ga0307409_1000149985 | 250 |
| 236 | 3300032002 | Ga0307416_100022232 | Ga0307416_1000222323 | 250 |
| 237 | 3300032002 | Ga0307416_100361652 | Ga0307416_1003616522 | 250 |
| 238 | 3300032005 | Ga0307411_10185433 | Ga0307411_101854332 | 250 |
| 239 | 3300032126 | Ga0307415_100009225 | Ga0307415_1000092252 | 250 |
| 240 | 3300032126 | Ga0307415_100079490 | Ga0307415_1000794902 | 250 |
| 241 | 3300048904 | Ga0496101_0287845 | Ga0496101_0287845_251_1003 | 250 |
| 242 | 3300048905 | Ga0496102_0603960 | Ga0496102_0603960_141_893 | 250 |
| 243 | 3300048915 | Ga0496112_0070381 | Ga0496112_0070381_2199_2960 | 250 |
| 244 | 3300049568 | Ga0501031_0235300 | Ga0501031_0235300_223_975 | 250 |
| 245 | 3300049576 | Ga0501040_0141672 | Ga0501040_0141672_867_1619 | 250 |
| 246 | 3300049582 | Ga0501048_0110052 | Ga0501048_0110052_315_1067 | 250 |
| 247 | 3300049587 | Ga0501071_0370429 | Ga0501071_0370429_11_763 | 250 |
| 248 | 3300049591 | Ga0501075_0134637 | Ga0501075_0134637_111_863 | 250 |
| 249 | 3300049591 | Ga0501075_0239470 | Ga0501075_0239470_66_818 | 250 |
| 250 | 3300049592 | Ga0501076_0083749 | Ga0501076_0083749_985_1737 | 250 |
| 251 | 3300049592 | Ga0501076_0105901 | Ga0501076_0105901_818_1570 | 250 |
| 252 | 3300049741 | Ga0501079_0128417 | Ga0501079_0128417_1146_1898 | 250 |
| 253 | 3300049742 | Ga0501080_0133787 | Ga0501080_0133787_207_959 | 250 |
| 254 | 3300049742 | Ga0501080_0224474 | Ga0501080_0224474_30_782 | 250 |
| 255 | 3300049743 | Ga0501081_0393903 | Ga0501081_0393903_225_977 | 250 |
| 256 | 3300049744 | Ga0501083_0150612 | Ga0501083_0150612_122_874 | 250 |
| 257 | 3300049824 | Ga0501045_0043259 | Ga0501045_0043259_963_1715 | 250 |
| 258 | 3300049824 | Ga0501045_0149673 | Ga0501045_0149673_915_1667 | 250 |
| 259 | 3300061734 | Ga0530510_0521225 | Ga0530510_0521225_28_780 | 250 |
| 260 | 3300005293 | Ga0065715_10151452 | Ga0065715_101514522 | 251 |
| 261 | 3300005329 | Ga0070683_100064429 | Ga0070683_1000644294 | 251 |
| 262 | 3300005329 | Ga0070683_100257895 | Ga0070683_1002578952 | 251 |
| 263 | 3300005335 | Ga0070666_10006434 | Ga0070666_100064348 | 251 |
| 264 | 3300005336 | Ga0070680_100008958 | Ga0070680_1000089587 | 251 |
| 265 | 3300005337 | Ga0070682_100000969 | Ga0070682_1000009697 | 251 |
| 266 | 3300005353 | Ga0070669_100087621 | Ga0070669_1000876212 | 251 |
| 267 | 3300005356 | Ga0070674_100000031 | Ga0070674_10000003153 | 251 |
| 268 | 3300005406 | Ga0070703_10014251 | Ga0070703_100142512 | 251 |
| 269 | 3300005406 | Ga0070703_10066636 | Ga0070703_100666362 | 251 |
| 270 | 3300005434 | Ga0070709_10001476 | Ga0070709_100014769 | 251 |
| 271 | 3300005439 | Ga0070711_100000009 | Ga0070711_10000000958 | 251 |
| 272 | 3300005440 | Ga0070705_100010188 | Ga0070705_1000101882 | 251 |
| 273 | 3300005440 | Ga0070705_100164056 | Ga0070705_1001640562 | 251 |
| 274 | 3300005440 | Ga0070705_100279069 | Ga0070705_1002790691 | 251 |
| 275 | 3300005440 | Ga0070705_100357133 | Ga0070705_1003571331 | 251 |
| 276 | 3300005441 | Ga0070700_100035256 | Ga0070700_1000352563 | 251 |
| 277 | 3300005444 | Ga0070694_100002417 | Ga0070694_10000241711 | 251 |
| 278 | 3300005444 | Ga0070694_100004958 | Ga0070694_1000049584 | 251 |
| 279 | 3300005444 | Ga0070694_100019920 | Ga0070694_1000199202 | 251 |
| 280 | 3300005445 | Ga0070708_100075545 | Ga0070708_1000755452 | 251 |
| 281 | 3300005445 | Ga0070708_100076744 | Ga0070708_1000767442 | 251 |
| 282 | 3300005457 | Ga0070662_100000206 | Ga0070662_10000020616 | 251 |
| 283 | 3300005458 | Ga0070681_10020791 | Ga0070681_100207913 | 251 |
| 284 | 3300005459 | Ga0068867_100000341 | Ga0068867_10000034111 | 251 |
| 285 | 3300005467 | Ga0070706_100109203 | Ga0070706_1001092032 | 251 |
| 286 | 3300005468 | Ga0070707_100222611 | Ga0070707_1002226112 | 251 |
| 287 | 3300005468 | Ga0070707_100321207 | Ga0070707_1003212071 | 251 |
| 288 | 3300005471 | Ga0070698_100001472 | Ga0070698_1000014725 | 251 |
| 289 | 3300005471 | Ga0070698_100350440 | Ga0070698_1003504402 | 251 |
| 290 | 3300005518 | Ga0070699_100022150 | Ga0070699_1000221503 | 251 |
| 291 | 3300005518 | Ga0070699_100029350 | Ga0070699_1000293502 | 251 |
| 292 | 3300005518 | Ga0070699_100102349 | Ga0070699_1001023492 | 251 |
| 293 | 3300005518 | Ga0070699_100102571 | Ga0070699_1001025712 | 251 |
| 294 | 3300005530 | Ga0070679_100007573 | Ga0070679_10000757310 | 251 |
| 295 | 3300005536 | Ga0070697_100140714 | Ga0070697_1001407142 | 251 |
| 296 | 3300005536 | Ga0070697_100260267 | Ga0070697_1002602672 | 251 |
| 297 | 3300005539 | Ga0068853_100004232 | Ga0068853_1000042323 | 251 |
| 298 | 3300005539 | Ga0068853_100530904 | Ga0068853_1005309041 | 251 |
| 299 | 3300005543 | Ga0070672_100179464 | Ga0070672_1001794642 | 251 |
| 300 | 3300005544 | Ga0070686_100004210 | Ga0070686_1000042108 | 251 |
| 301 | 3300005545 | Ga0070695_100006476 | Ga0070695_1000064767 | 251 |
| 302 | 3300005545 | Ga0070695_100007435 | Ga0070695_1000074356 | 251 |
| 303 | 3300005545 | Ga0070695_100036976 | Ga0070695_1000369762 | 251 |
| 304 | 3300005545 | Ga0070695_100069975 | Ga0070695_1000699752 | 251 |
| 305 | 3300005546 | Ga0070696_100003906 | Ga0070696_1000039062 | 251 |
| 306 | 3300005546 | Ga0070696_100006413 | Ga0070696_1000064137 | 251 |
| 307 | 3300005546 | Ga0070696_100008347 | Ga0070696_1000083472 | 251 |
| 308 | 3300005547 | Ga0070693_100019448 | Ga0070693_1000194483 | 251 |
| 309 | 3300005547 | Ga0070693_100208744 | Ga0070693_1002087442 | 251 |
| 310 | 3300005549 | Ga0070704_100000701 | Ga0070704_1000007015 | 251 |
| 311 | 3300005549 | Ga0070704_100091327 | Ga0070704_1000913272 | 251 |
| 312 | 3300005549 | Ga0070704_100363790 | Ga0070704_1003637901 | 251 |
| 313 | 3300005563 | Ga0068855_100056570 | Ga0068855_1000565703 | 251 |
| 314 | 3300005578 | Ga0068854_100007149 | Ga0068854_1000071492 | 251 |
| 315 | 3300005616 | Ga0068852_100596017 | Ga0068852_1005960172 | 251 |
| 316 | 3300005617 | Ga0068859_100319717 | Ga0068859_1003197172 | 251 |
| 317 | 3300005718 | Ga0068866_10000048 | Ga0068866_1000004830 | 251 |
| 318 | 3300005719 | Ga0068861_100009043 | Ga0068861_1000090436 | 251 |
| 319 | 3300005842 | Ga0068858_100021966 | Ga0068858_1000219667 | 251 |
| 320 | 3300005843 | Ga0068860_100151385 | Ga0068860_1001513852 | 251 |
| 321 | 3300005844 | Ga0068862_100010499 | Ga0068862_1000104993 | 251 |
| 322 | 3300006173 | Ga0070716_100084807 | Ga0070716_1000848072 | 251 |
| 323 | 3300006175 | Ga0070712_100043380 | Ga0070712_1000433802 | 251 |
| 324 | 3300006358 | Ga0068871_100220782 | Ga0068871_1002207822 | 251 |
| 325 | 3300006844 | Ga0075428_100002193 | Ga0075428_1000021938 | 251 |
| 326 | 3300006846 | Ga0075430_100013207 | Ga0075430_1000132074 | 251 |
| 327 | 3300006846 | Ga0075430_100427800 | Ga0075430_1004278002 | 251 |
| 328 | 3300006847 | Ga0075431_100060004 | Ga0075431_1000600042 | 251 |
| 329 | 3300006847 | Ga0075431_100089007 | Ga0075431_1000890072 | 251 |
| 330 | 3300006847 | Ga0075431_100726340 | Ga0075431_1007263402 | 251 |
| 331 | 3300006852 | Ga0075433_10087845 | Ga0075433_100878452 | 251 |
| 332 | 3300006852 | Ga0075433_10380246 | Ga0075433_103802462 | 251 |
| 333 | 3300006871 | Ga0075434_100001890 | Ga0075434_1000018902 | 251 |
| 334 | 3300006881 | Ga0068865_100001170 | Ga0068865_1000011709 | 251 |
| 335 | 3300006914 | Ga0075436_100011722 | Ga0075436_1000117222 | 251 |
| 336 | 3300006914 | Ga0075436_100035435 | Ga0075436_1000354353 | 251 |
| 337 | 3300006914 | Ga0075436_100049244 | Ga0075436_1000492443 | 251 |
| 338 | 3300006914 | Ga0075436_100062488 | Ga0075436_1000624883 | 251 |
| 339 | 3300006914 | Ga0075436_100070933 | Ga0075436_1000709332 | 251 |
| 340 | 3300006914 | Ga0075436_100147524 | Ga0075436_1001475242 | 251 |
| 341 | 3300006914 | Ga0075436_100488417 | Ga0075436_1004884171 | 251 |
| 342 | 3300006931 | Ga0097620_100319733 | Ga0097620_1003197332 | 251 |
| 343 | 3300007076 | Ga0075435_100022387 | Ga0075435_1000223872 | 251 |
| 344 | 3300007076 | Ga0075435_100302269 | Ga0075435_1003022692 | 251 |
| 345 | 3300009093 | Ga0105240_10075669 | Ga0105240_100756692 | 251 |
| 346 | 3300009098 | Ga0105245_10034539 | Ga0105245_100345393 | 251 |
| 347 | 3300009147 | Ga0114129_10004057 | Ga0114129_100040578 | 251 |
| 348 | 3300009148 | Ga0105243_10003585 | Ga0105243_1000358510 | 251 |
| 349 | 3300009174 | Ga0105241_10000716 | Ga0105241_1000071611 | 251 |
| 350 | 3300009174 | Ga0105241_10158319 | Ga0105241_101583192 | 251 |
| 351 | 3300009176 | Ga0105242_10000251 | Ga0105242_1000025123 | 251 |
| 352 | 3300009177 | Ga0105248_10001792 | Ga0105248_1000179211 | 251 |
| 353 | 3300009553 | Ga0105249_10023634 | Ga0105249_100236342 | 251 |
| 354 | 3300009553 | Ga0105249_10137800 | Ga0105249_101378002 | 251 |
| 355 | 3300009553 | Ga0105249_10164727 | Ga0105249_101647272 | 251 |
| 356 | 3300010375 | Ga0105239_10013449 | Ga0105239_100134498 | 251 |
| 357 | 3300011119 | Ga0105246_10296660 | Ga0105246_102966602 | 251 |
| 358 | 3300013296 | Ga0157374_10000354 | Ga0157374_1000035432 | 251 |
| 359 | 3300013296 | Ga0157374_10118697 | Ga0157374_101186972 | 251 |
| 360 | 3300013297 | Ga0157378_10001585 | Ga0157378_1000158513 | 251 |
| 361 | 3300013306 | Ga0163162_10001791 | Ga0163162_100017919 | 251 |
| 362 | 3300013306 | Ga0163162_10043019 | Ga0163162_100430192 | 251 |
| 363 | 3300013307 | Ga0157372_10101356 | Ga0157372_101013562 | 251 |
| 364 | 3300013307 | Ga0157372_10146411 | Ga0157372_101464112 | 251 |
| 365 | 3300013307 | Ga0157372_10389340 | Ga0157372_103893401 | 251 |
| 366 | 3300013307 | Ga0157372_10560591 | Ga0157372_105605911 | 251 |
| 367 | 3300013308 | Ga0157375_10021674 | Ga0157375_100216745 | 251 |
| 368 | 3300014326 | Ga0157380_10020140 | Ga0157380_100201406 | 251 |
| 369 | 3300014968 | Ga0157379_10084462 | Ga0157379_100844622 | 251 |
| 370 | 3300025885 | Ga0207653_10000906 | Ga0207653_100009069 | 251 |
| 371 | 3300025885 | Ga0207653_10016500 | Ga0207653_100165002 | 251 |
| 372 | 3300025885 | Ga0207653_10067324 | Ga0207653_100673242 | 251 |
| 373 | 3300025898 | Ga0207692_10288434 | Ga0207692_102884342 | 251 |
| 374 | 3300025899 | Ga0207642_10000833 | Ga0207642_100008333 | 251 |
| 375 | 3300025903 | Ga0207680_10035155 | Ga0207680_100351552 | 251 |
| 376 | 3300025907 | Ga0207645_10001078 | Ga0207645_1000107814 | 251 |
| 377 | 3300025910 | Ga0207684_10007226 | Ga0207684_100072266 | 251 |
| 378 | 3300025910 | Ga0207684_10065162 | Ga0207684_100651623 | 251 |
| 379 | 3300025911 | Ga0207654_10157982 | Ga0207654_101579822 | 251 |
| 380 | 3300025912 | Ga0207707_10001431 | Ga0207707_1000143111 | 251 |
| 381 | 3300025916 | Ga0207663_10000013 | Ga0207663_1000001398 | 251 |
| 382 | 3300025917 | Ga0207660_10007979 | Ga0207660_100079793 | 251 |
| 383 | 3300025921 | Ga0207652_10004478 | Ga0207652_100044787 | 251 |
| 384 | 3300025921 | Ga0207652_10450690 | Ga0207652_104506901 | 251 |
| 385 | 3300025922 | Ga0207646_10002838 | Ga0207646_100028385 | 251 |
| 386 | 3300025922 | Ga0207646_10009959 | Ga0207646_100099595 | 251 |
| 387 | 3300025922 | Ga0207646_10083049 | Ga0207646_100830492 | 251 |
| 388 | 3300025922 | Ga0207646_10163452 | Ga0207646_101634522 | 251 |
| 389 | 3300025923 | Ga0207681_10021437 | Ga0207681_100214372 | 251 |
| 390 | 3300025923 | Ga0207681_10037604 | Ga0207681_100376043 | 251 |
| 391 | 3300025927 | Ga0207687_10053510 | Ga0207687_100535102 | 251 |
| 392 | 3300025929 | Ga0207664_10027416 | Ga0207664_100274162 | 251 |
| 393 | 3300025933 | Ga0207706_10000096 | Ga0207706_1000009675 | 251 |
| 394 | 3300025934 | Ga0207686_10000112 | Ga0207686_1000011218 | 251 |
| 395 | 3300025935 | Ga0207709_10001243 | Ga0207709_100012436 | 251 |
| 396 | 3300025937 | Ga0207669_10001730 | Ga0207669_100017304 | 251 |
| 397 | 3300025938 | Ga0207704_10001104 | Ga0207704_100011049 | 251 |
| 398 | 3300025940 | Ga0207691_10144880 | Ga0207691_101448802 | 251 |
| 399 | 3300025941 | Ga0207711_10003244 | Ga0207711_1000324415 | 251 |
| 400 | 3300025942 | Ga0207689_10000911 | Ga0207689_1000091121 | 251 |
| 401 | 3300025942 | Ga0207689_10516330 | Ga0207689_105163302 | 251 |
| 402 | 3300025944 | Ga0207661_10040614 | Ga0207661_100406143 | 251 |
| 403 | 3300025944 | Ga0207661_10046960 | Ga0207661_100469602 | 251 |
| 404 | 3300025949 | Ga0207667_10027244 | Ga0207667_100272442 | 251 |
| 405 | 3300025961 | Ga0207712_10007741 | Ga0207712_100077413 | 251 |
| 406 | 3300025961 | Ga0207712_10055730 | Ga0207712_100557302 | 251 |
| 407 | 3300025972 | Ga0207668_10037344 | Ga0207668_100373443 | 251 |
| 408 | 3300025972 | Ga0207668_10166705 | Ga0207668_101667052 | 251 |
| 409 | 3300025981 | Ga0207640_10017844 | Ga0207640_100178443 | 251 |
| 410 | 3300025986 | Ga0207658_10022058 | Ga0207658_100220584 | 251 |
| 411 | 3300026067 | Ga0207678_10684829 | Ga0207678_106848291 | 251 |
| 412 | 3300026075 | Ga0207708_10057843 | Ga0207708_100578432 | 251 |
| 413 | 3300026089 | Ga0207648_10000043 | Ga0207648_1000004353 | 251 |
| 414 | 3300026118 | Ga0207675_100009301 | Ga0207675_1000093016 | 251 |
| 415 | 3300026118 | Ga0207675_100283204 | Ga0207675_1002832041 | 251 |
| 416 | 3300026121 | Ga0207683_10003314 | Ga0207683_100033149 | 251 |
| 417 | 3300026142 | Ga0207698_10448241 | Ga0207698_104482411 | 251 |
| 418 | 3300027671 | Ga0209588_1022798 | Ga0209588_10227982 | 251 |
| 419 | 3300028380 | Ga0268265_10083741 | Ga0268265_100837412 | 251 |
| 420 | 3300028381 | Ga0268264_10007645 | Ga0268264_100076453 | 251 |
| 421 | 3300028381 | Ga0268264_10168495 | Ga0268264_101684952 | 251 |
| 422 | 3300028800 | Ga0265338_10001654 | Ga0265338_1000165437 | 251 |
| 423 | 3300031241 | Ga0265325_10015601 | Ga0265325_100156015 | 251 |
| 424 | 3300031548 | Ga0307408_100002006 | Ga0307408_1000020066 | 251 |
| 425 | 3300031548 | Ga0307408_100156029 | Ga0307408_1001560292 | 251 |
| 426 | 3300031731 | Ga0307405_10004222 | Ga0307405_100042228 | 251 |
| 427 | 3300031731 | Ga0307405_10262344 | Ga0307405_102623442 | 251 |
| 428 | 3300031901 | Ga0307406_10013122 | Ga0307406_100131222 | 251 |
| 429 | 3300031901 | Ga0307406_10046751 | Ga0307406_100467512 | 251 |
| 430 | 3300031911 | Ga0307412_10042004 | Ga0307412_100420043 | 251 |
| 431 | 3300031995 | Ga0307409_100043283 | Ga0307409_1000432833 | 251 |
| 432 | 3300032002 | Ga0307416_100061624 | Ga0307416_1000616242 | 251 |
| 433 | 3300032126 | Ga0307415_100030103 | Ga0307415_1000301032 | 251 |
| 434 | 3300035398 | Ga0316574_0014342 | Ga0316574_0014342_3782_4543 | 251 |
| 435 | 3300037471 | Ga0395905_0468040 | Ga0395905_0468040_102_872 | 251 |
| 436 | 3300042876 | Ga0451577_0000109 | Ga0451577_0000109_149420_150178 | 251 |
| 437 | 3300044673 | Ga0453683_0004121 | Ga0453683_0004121_5366_6124 | 251 |
| 438 | 3300044673 | Ga0453683_0018303 | Ga0453683_0018303_3270_4025 | 251 |
| 439 | 3300044684 | Ga0466966_0031866 | Ga0466966_0031866_1773_2543 | 251 |
| 440 | 3300044694 | Ga0466963_0224894 | Ga0466963_0224894_510_1280 | 251 |
| 441 | 3300044712 | Ga0453684_0000004 | Ga0453684_0000004_1081777_1082535 | 251 |
| 442 | 3300045049 | Ga0466959_0129847 | Ga0466959_0129847_276_1040 | 251 |
| 443 | 3300046557 | Ga0495622_0032590 | Ga0495622_0032590_1572_2327 | 251 |
| 444 | 3300046684 | Ga0495669_0207308 | Ga0495669_0207308_66_824 | 251 |
| 445 | 3300048904 | Ga0496101_0013792 | Ga0496101_0013792_1306_2061 | 251 |
| 446 | 3300048909 | Ga0496106_0060003 | Ga0496106_0060003_1249_2004 | 251 |
| 447 | 3300048917 | Ga0496114_0068395 | Ga0496114_0068395_740_1495 | 251 |
| 448 | 3300049575 | Ga0501039_0612719 | Ga0501039_0612719_14_799 | 251 |
| 449 | 3300049592 | Ga0501076_0332238 | Ga0501076_0332238_324_1094 | 251 |
| 450 | 3300049661 | Ga0501217_021028 | Ga0501217_021028_421_1191 | 251 |
| 451 | 3300049741 | Ga0501079_0088003 | Ga0501079_0088003_366_1136 | 251 |
| 452 | 3300049741 | Ga0501079_0142060 | Ga0501079_0142060_486_1241 | 251 |
| 453 | 3300049743 | Ga0501081_0153786 | Ga0501081_0153786_522_1292 | 251 |
| 454 | 3300050507 | nmdc:mga05p37_3197_c1 | nmdc:mga05p37_3197_c1_12994_13764 | 251 |
| 455 | 3300050509 | nmdc:mga0qj67_311979_c1 | nmdc:mga0qj67_311979_c1_48_803 | 251 |
| 456 | 3300050510 | nmdc:mga06r32_390614_c1 | nmdc:mga06r32_390614_c1_296_1051 | 251 |
| 457 | 3300050510 | nmdc:mga06r32_449882_c1 | nmdc:mga06r32_449882_c1_301_1071 | 251 |
| 458 | 3300050510 | nmdc:mga06r32_80042_c1 | nmdc:mga06r32_80042_c1_329_1084 | 251 |
| 459 | 3300050512 | nmdc:mga0n895_21058_c1 | nmdc:mga0n895_21058_c1_4825_5595 | 251 |
| 460 | 3300050512 | nmdc:mga0n895_854_c1 | nmdc:mga0n895_854_c1_15506_16276 | 251 |
| 461 | 3300050513 | nmdc:mga0rr50_187707_c1 | nmdc:mga0rr50_187707_c1_514_1284 | 251 |
| 462 | 3300050513 | nmdc:mga0rr50_209070_c1 | nmdc:mga0rr50_209070_c1_253_1023 | 251 |
| 463 | 3300050514 | nmdc:mga08x19_100260_c1 | nmdc:mga08x19_100260_c1_601_1356 | 251 |
| 464 | 3300050514 | nmdc:mga08x19_1110_c1 | nmdc:mga08x19_1110_c1_12435_13226 | 251 |
| 465 | 3300050514 | nmdc:mga08x19_14485_c1 | nmdc:mga08x19_14485_c1_1986_2756 | 251 |
| 466 | 3300050514 | nmdc:mga08x19_3198_c1 | nmdc:mga08x19_3198_c1_1716_2480 | 251 |
| 467 | 3300050514 | nmdc:mga08x19_33583_c1 | nmdc:mga08x19_33583_c1_2318_3076 | 251 |
| 468 | 3300050514 | nmdc:mga08x19_5823_c1 | nmdc:mga08x19_5823_c1_2450_3223 | 251 |
| 469 | 3300050515 | nmdc:mga0a205_23409_c1 | nmdc:mga0a205_23409_c1_3228_3998 | 251 |
| 470 | 3300054114 | Ga0501084_0444570 | Ga0501084_0444570_95_865 | 251 |
| 471 | 3300060353 | Ga0501082_0497858 | Ga0501082_0497858_165_920 | 251 |
| 472 | iso_pu_bacteria | 2887375801 | 2887378722 | 251 |
| 473 | 3300004800 | Ga0058861_12069260 | Ga0058861_120692602 | 252 |
| 474 | 3300004803 | Ga0058862_10049606 | Ga0058862_100496062 | 252 |
| 475 | 3300005289 | Ga0065704_10006494 | Ga0065704_100064941 | 252 |
| 476 | 3300005295 | Ga0065707_10043917 | Ga0065707_100439171 | 252 |
| 477 | 3300005295 | Ga0065707_10115807 | Ga0065707_101158071 | 252 |
| 478 | 3300005329 | Ga0070683_100002754 | Ga0070683_10000275411 | 252 |
| 479 | 3300005329 | Ga0070683_100062308 | Ga0070683_1000623084 | 252 |
| 480 | 3300005330 | Ga0070690_100114752 | Ga0070690_1001147522 | 252 |
| 481 | 3300005331 | Ga0070670_100343809 | Ga0070670_1003438092 | 252 |
| 482 | 3300005334 | Ga0068869_100004425 | Ga0068869_1000044257 | 252 |
| 483 | 3300005336 | Ga0070680_100030681 | Ga0070680_1000306814 | 252 |
| 484 | 3300005336 | Ga0070680_100172497 | Ga0070680_1001724972 | 252 |
| 485 | 3300005336 | Ga0070680_100228288 | Ga0070680_1002282882 | 252 |
| 486 | 3300005337 | Ga0070682_100130206 | Ga0070682_1001302062 | 252 |
| 487 | 3300005340 | Ga0070689_100090750 | Ga0070689_1000907502 | 252 |
| 488 | 3300005340 | Ga0070689_100451767 | Ga0070689_1004517671 | 252 |
| 489 | 3300005341 | Ga0070691_10129826 | Ga0070691_101298261 | 252 |
| 490 | 3300005344 | Ga0070661_100010786 | Ga0070661_1000107866 | 252 |
| 491 | 3300005344 | Ga0070661_100011176 | Ga0070661_1000111765 | 252 |
| 492 | 3300005355 | Ga0070671_100006816 | Ga0070671_10000681611 | 252 |
| 493 | 3300005366 | Ga0070659_100013907 | Ga0070659_1000139074 | 252 |
| 494 | 3300005434 | Ga0070709_10023862 | Ga0070709_100238622 | 252 |
| 495 | 3300005434 | Ga0070709_10162982 | Ga0070709_101629821 | 252 |
| 496 | 3300005434 | Ga0070709_10211216 | Ga0070709_102112162 | 252 |
| 497 | 3300005435 | Ga0070714_100046215 | Ga0070714_1000462152 | 252 |
| 498 | 3300005435 | Ga0070714_100187059 | Ga0070714_1001870592 | 252 |
| 499 | 3300005436 | Ga0070713_100000083 | Ga0070713_1000000838 | 252 |
| 500 | 3300005436 | Ga0070713_100203717 | Ga0070713_1002037172 | 252 |
| 501 | 3300005437 | Ga0070710_10018647 | Ga0070710_100186474 | 252 |
| 502 | 3300005439 | Ga0070711_100000946 | Ga0070711_10000094611 | 252 |
| 503 | 3300005458 | Ga0070681_10007697 | Ga0070681_100076974 | 252 |
| 504 | 3300005458 | Ga0070681_10012170 | Ga0070681_100121706 | 252 |
| 505 | 3300005471 | Ga0070698_100001439 | Ga0070698_1000014394 | 252 |
| 506 | 3300005471 | Ga0070698_100284546 | Ga0070698_1002845462 | 252 |
| 507 | 3300005518 | Ga0070699_100161807 | Ga0070699_1001618072 | 252 |
| 508 | 3300005518 | Ga0070699_100184491 | Ga0070699_1001844911 | 252 |
| 509 | 3300005530 | Ga0070679_100007243 | Ga0070679_10000724311 | 252 |
| 510 | 3300005530 | Ga0070679_100026951 | Ga0070679_1000269514 | 252 |
| 511 | 3300005530 | Ga0070679_100122830 | Ga0070679_1001228302 | 252 |
| 512 | 3300005530 | Ga0070679_100364673 | Ga0070679_1003646732 | 252 |
| 513 | 3300005535 | Ga0070684_100028396 | Ga0070684_1000283962 | 252 |
| 514 | 3300005535 | Ga0070684_100060352 | Ga0070684_1000603521 | 252 |
| 515 | 3300005539 | Ga0068853_100314379 | Ga0068853_1003143792 | 252 |
| 516 | 3300005539 | Ga0068853_100408700 | Ga0068853_1004087002 | 252 |
| 517 | 3300005545 | Ga0070695_100021263 | Ga0070695_1000212634 | 252 |
| 518 | 3300005545 | Ga0070695_100146044 | Ga0070695_1001460442 | 252 |
| 519 | 3300005546 | Ga0070696_100004602 | Ga0070696_1000046027 | 252 |
| 520 | 3300005563 | Ga0068855_100019763 | Ga0068855_1000197635 | 252 |
| 521 | 3300005564 | Ga0070664_100172892 | Ga0070664_1001728922 | 252 |
| 522 | 3300005564 | Ga0070664_100395866 | Ga0070664_1003958662 | 252 |
| 523 | 3300005577 | Ga0068857_100044817 | Ga0068857_1000448174 | 252 |
| 524 | 3300005578 | Ga0068854_100022840 | Ga0068854_1000228405 | 252 |
| 525 | 3300005615 | Ga0070702_100011576 | Ga0070702_1000115762 | 252 |
| 526 | 3300005616 | Ga0068852_100017011 | Ga0068852_1000170112 | 252 |
| 527 | 3300005616 | Ga0068852_100761968 | Ga0068852_1007619682 | 252 |
| 528 | 3300005617 | Ga0068859_100004322 | Ga0068859_10000432212 | 252 |
| 529 | 3300005617 | Ga0068859_100250507 | Ga0068859_1002505072 | 252 |
| 530 | 3300005618 | Ga0068864_100017774 | Ga0068864_1000177742 | 252 |
| 531 | 3300005840 | Ga0068870_10033736 | Ga0068870_100337362 | 252 |
| 532 | 3300005841 | Ga0068863_100015626 | Ga0068863_1000156266 | 252 |
| 533 | 3300005841 | Ga0068863_100931988 | Ga0068863_1009319881 | 252 |
| 534 | 3300005842 | Ga0068858_100030024 | Ga0068858_1000300245 | 252 |
| 535 | 3300005843 | Ga0068860_100020074 | Ga0068860_1000200744 | 252 |
| 536 | 3300006028 | Ga0070717_10001061 | Ga0070717_100010613 | 252 |
| 537 | 3300006028 | Ga0070717_10396173 | Ga0070717_103961732 | 252 |
| 538 | 3300006175 | Ga0070712_100103070 | Ga0070712_1001030702 | 252 |
| 539 | 3300006846 | Ga0075430_100054096 | Ga0075430_1000540964 | 252 |
| 540 | 3300006847 | Ga0075431_100204048 | Ga0075431_1002040482 | 252 |
| 541 | 3300006880 | Ga0075429_100096822 | Ga0075429_1000968222 | 252 |
| 542 | 3300006914 | Ga0075436_100001297 | Ga0075436_10000129715 | 252 |
| 543 | 3300006914 | Ga0075436_100060385 | Ga0075436_1000603852 | 252 |
| 544 | 3300006914 | Ga0075436_100065574 | Ga0075436_1000655742 | 252 |
| 545 | 3300006931 | Ga0097620_100004322 | Ga0097620_10000432212 | 252 |
| 546 | 3300006931 | Ga0097620_100168039 | Ga0097620_1001680392 | 252 |
| 547 | 3300006931 | Ga0097620_100250507 | Ga0097620_1002505072 | 252 |
| 548 | 3300007076 | Ga0075435_100071326 | Ga0075435_1000713263 | 252 |
| 549 | 3300009093 | Ga0105240_10004744 | Ga0105240_1000474424 | 252 |
| 550 | 3300009093 | Ga0105240_10030521 | Ga0105240_100305216 | 252 |
| 551 | 3300009093 | Ga0105240_10837557 | Ga0105240_108375572 | 252 |
| 552 | 3300009094 | Ga0111539_10349587 | Ga0111539_103495872 | 252 |
| 553 | 3300009098 | Ga0105245_10011101 | Ga0105245_100111012 | 252 |
| 554 | 3300009147 | Ga0114129_10273053 | Ga0114129_102730532 | 252 |
| 555 | 3300009174 | Ga0105241_10208895 | Ga0105241_102088952 | 252 |
| 556 | 3300009174 | Ga0105241_10283202 | Ga0105241_102832022 | 252 |
| 557 | 3300009176 | Ga0105242_10000787 | Ga0105242_1000078723 | 252 |
| 558 | 3300009177 | Ga0105248_10020594 | Ga0105248_100205944 | 252 |
| 559 | 3300009177 | Ga0105248_10303970 | Ga0105248_103039701 | 252 |
| 560 | 3300009545 | Ga0105237_10397393 | Ga0105237_103973932 | 252 |
| 561 | 3300009545 | Ga0105237_10664197 | Ga0105237_106641972 | 252 |
| 562 | 3300009551 | Ga0105238_10108332 | Ga0105238_101083322 | 252 |
| 563 | 3300009551 | Ga0105238_10646960 | Ga0105238_106469602 | 252 |
| 564 | 3300013100 | Ga0157373_10014172 | Ga0157373_100141723 | 252 |
| 565 | 3300013100 | Ga0157373_10047874 | Ga0157373_100478742 | 252 |
| 566 | 3300013100 | Ga0157373_10199721 | Ga0157373_101997212 | 252 |
| 567 | 3300013100 | Ga0157373_10221174 | Ga0157373_102211742 | 252 |
| 568 | 3300013102 | Ga0157371_10161379 | Ga0157371_101613792 | 252 |
| 569 | 3300013104 | Ga0157370_10010642 | Ga0157370_100106423 | 252 |
| 570 | 3300013104 | Ga0157370_10096803 | Ga0157370_100968032 | 252 |
| 571 | 3300013104 | Ga0157370_10111131 | Ga0157370_101111312 | 252 |
| 572 | 3300013104 | Ga0157370_10153672 | Ga0157370_101536722 | 252 |
| 573 | 3300013104 | Ga0157370_10169733 | Ga0157370_101697332 | 252 |
| 574 | 3300013104 | Ga0157370_10516081 | Ga0157370_105160812 | 252 |
| 575 | 3300013105 | Ga0157369_10002977 | Ga0157369_1000297710 | 252 |
| 576 | 3300013105 | Ga0157369_10029240 | Ga0157369_100292403 | 252 |
| 577 | 3300013105 | Ga0157369_10326382 | Ga0157369_103263822 | 252 |
| 578 | 3300013105 | Ga0157369_10627721 | Ga0157369_106277212 | 252 |
| 579 | 3300013296 | Ga0157374_10032848 | Ga0157374_100328484 | 252 |
| 580 | 3300013297 | Ga0157378_10205775 | Ga0157378_102057752 | 252 |
| 581 | 3300013307 | Ga0157372_10028719 | Ga0157372_100287194 | 252 |
| 582 | 3300013307 | Ga0157372_10042712 | Ga0157372_100427126 | 252 |
| 583 | 3300013307 | Ga0157372_10072521 | Ga0157372_100725214 | 252 |
| 584 | 3300013307 | Ga0157372_10094586 | Ga0157372_100945862 | 252 |
| 585 | 3300013307 | Ga0157372_10125276 | Ga0157372_101252762 | 252 |
| 586 | 3300013307 | Ga0157372_10143253 | Ga0157372_101432532 | 252 |
| 587 | 3300013307 | Ga0157372_10316634 | Ga0157372_103166342 | 252 |
| 588 | 3300013307 | Ga0157372_10931767 | Ga0157372_109317672 | 252 |
| 589 | 3300014325 | Ga0163163_10002166 | Ga0163163_100021662 | 252 |
| 590 | 3300014325 | Ga0163163_10118424 | Ga0163163_101184242 | 252 |
| 591 | 3300014968 | Ga0157379_10249520 | Ga0157379_102495202 | 252 |
| 592 | 3300014969 | Ga0157376_10008108 | Ga0157376_100081084 | 252 |
| 593 | 3300017792 | Ga0163161_10464326 | Ga0163161_104643262 | 252 |
| 594 | 3300020070 | Ga0206356_10024056 | Ga0206356_100240562 | 252 |
| 595 | 3300020070 | Ga0206356_10142434 | Ga0206356_101424342 | 252 |
| 596 | 3300020070 | Ga0206356_10968049 | Ga0206356_109680492 | 252 |
| 597 | 3300020070 | Ga0206356_11526478 | Ga0206356_115264782 | 252 |
| 598 | 3300020078 | Ga0206352_10462765 | Ga0206352_104627652 | 252 |
| 599 | 3300020080 | Ga0206350_10138413 | Ga0206350_101384132 | 252 |
| 600 | 3300022467 | Ga0224712_10060979 | Ga0224712_100609792 | 252 |
| 601 | 3300025893 | Ga0207682_10013260 | Ga0207682_100132602 | 252 |
| 602 | 3300025898 | Ga0207692_10011979 | Ga0207692_100119792 | 252 |
| 603 | 3300025898 | Ga0207692_10174924 | Ga0207692_101749242 | 252 |
| 604 | 3300025903 | Ga0207680_10064790 | Ga0207680_100647902 | 252 |
| 605 | 3300025906 | Ga0207699_10014488 | Ga0207699_100144882 | 252 |
| 606 | 3300025906 | Ga0207699_10019691 | Ga0207699_100196912 | 252 |
| 607 | 3300025908 | Ga0207643_10011540 | Ga0207643_100115403 | 252 |
| 608 | 3300025911 | Ga0207654_10127999 | Ga0207654_101279991 | 252 |
| 609 | 3300025912 | Ga0207707_10002091 | Ga0207707_1000209110 | 252 |
| 610 | 3300025912 | Ga0207707_10007219 | Ga0207707_100072197 | 252 |
| 611 | 3300025912 | Ga0207707_10022038 | Ga0207707_100220382 | 252 |
| 612 | 3300025912 | Ga0207707_10447202 | Ga0207707_104472022 | 252 |
| 613 | 3300025913 | Ga0207695_10005716 | Ga0207695_100057166 | 252 |
| 614 | 3300025913 | Ga0207695_10015949 | Ga0207695_100159495 | 252 |
| 615 | 3300025913 | Ga0207695_10192180 | Ga0207695_101921802 | 252 |
| 616 | 3300025913 | Ga0207695_10317467 | Ga0207695_103174672 | 252 |
| 617 | 3300025916 | Ga0207663_10012478 | Ga0207663_100124783 | 252 |
| 618 | 3300025916 | Ga0207663_10116407 | Ga0207663_101164072 | 252 |
| 619 | 3300025917 | Ga0207660_10013079 | Ga0207660_100130795 | 252 |
| 620 | 3300025917 | Ga0207660_10013174 | Ga0207660_100131744 | 252 |
| 621 | 3300025917 | Ga0207660_10050281 | Ga0207660_100502813 | 252 |
| 622 | 3300025917 | Ga0207660_10140615 | Ga0207660_101406152 | 252 |
| 623 | 3300025919 | Ga0207657_10026711 | Ga0207657_100267115 | 252 |
| 624 | 3300025919 | Ga0207657_10176416 | Ga0207657_101764161 | 252 |
| 625 | 3300025920 | Ga0207649_10007938 | Ga0207649_100079384 | 252 |
| 626 | 3300025921 | Ga0207652_10005744 | Ga0207652_100057446 | 252 |
| 627 | 3300025921 | Ga0207652_10053599 | Ga0207652_100535992 | 252 |
| 628 | 3300025921 | Ga0207652_10057994 | Ga0207652_100579941 | 252 |
| 629 | 3300025921 | Ga0207652_10061824 | Ga0207652_100618242 | 252 |
| 630 | 3300025921 | Ga0207652_10103249 | Ga0207652_101032492 | 252 |
| 631 | 3300025921 | Ga0207652_10108342 | Ga0207652_101083422 | 252 |
| 632 | 3300025925 | Ga0207650_10016927 | Ga0207650_100169272 | 252 |
| 633 | 3300025925 | Ga0207650_10391217 | Ga0207650_103912172 | 252 |
| 634 | 3300025926 | Ga0207659_10004878 | Ga0207659_100048787 | 252 |
| 635 | 3300025927 | Ga0207687_10019366 | Ga0207687_100193661 | 252 |
| 636 | 3300025928 | Ga0207700_10000243 | Ga0207700_100002435 | 252 |
| 637 | 3300025928 | Ga0207700_10127337 | Ga0207700_101273372 | 252 |
| 638 | 3300025928 | Ga0207700_10460212 | Ga0207700_104602122 | 252 |
| 639 | 3300025929 | Ga0207664_10014315 | Ga0207664_100143152 | 252 |
| 640 | 3300025929 | Ga0207664_10096305 | Ga0207664_100963052 | 252 |
| 641 | 3300025929 | Ga0207664_10102772 | Ga0207664_101027722 | 252 |
| 642 | 3300025929 | Ga0207664_10408112 | Ga0207664_104081121 | 252 |
| 643 | 3300025932 | Ga0207690_10039738 | Ga0207690_100397384 | 252 |
| 644 | 3300025942 | Ga0207689_10000755 | Ga0207689_1000075510 | 252 |
| 645 | 3300025944 | Ga0207661_10020439 | Ga0207661_100204395 | 252 |
| 646 | 3300025945 | Ga0207679_10001989 | Ga0207679_100019895 | 252 |
| 647 | 3300025945 | Ga0207679_10058167 | Ga0207679_100581674 | 252 |
| 648 | 3300025945 | Ga0207679_10109728 | Ga0207679_101097282 | 252 |
| 649 | 3300025949 | Ga0207667_10234571 | Ga0207667_102345712 | 252 |
| 650 | 3300025972 | Ga0207668_10239707 | Ga0207668_102397072 | 252 |
| 651 | 3300025981 | Ga0207640_10002465 | Ga0207640_100024656 | 252 |
| 652 | 3300025981 | Ga0207640_10049558 | Ga0207640_100495582 | 252 |
| 653 | 3300025986 | Ga0207658_10232896 | Ga0207658_102328961 | 252 |
| 654 | 3300026035 | Ga0207703_10066907 | Ga0207703_100669072 | 252 |
| 655 | 3300026041 | Ga0207639_10215551 | Ga0207639_102155512 | 252 |
| 656 | 3300026088 | Ga0207641_10875515 | Ga0207641_108755152 | 252 |
| 657 | 3300026088 | Ga0207641_10916326 | Ga0207641_109163261 | 252 |
| 658 | 3300026116 | Ga0207674_10001092 | Ga0207674_100010922 | 252 |
| 659 | 3300026142 | Ga0207698_10007725 | Ga0207698_100077255 | 252 |
| 660 | 3300027364 | Ga0209967_1001446 | Ga0209967_10014462 | 252 |
| 661 | 3300027543 | Ga0209999_1001017 | Ga0209999_10010174 | 252 |
| 662 | 3300027682 | Ga0209971_1004772 | Ga0209971_10047722 | 252 |
| 663 | 3300027695 | Ga0209966_1005831 | Ga0209966_10058312 | 252 |
| 664 | 3300027907 | Ga0207428_10171965 | Ga0207428_101719652 | 252 |
| 665 | 3300028381 | Ga0268264_10183070 | Ga0268264_101830702 | 252 |
| 666 | 3300028556 | Ga0265337_1001252 | Ga0265337_10012525 | 252 |
| 667 | 3300028558 | Ga0265326_10001074 | Ga0265326_100010747 | 252 |
| 668 | 3300028558 | Ga0265326_10003863 | Ga0265326_100038632 | 252 |
| 669 | 3300028563 | Ga0265319_1000100 | Ga0265319_100010030 | 252 |
| 670 | 3300028563 | Ga0265319_1000169 | Ga0265319_100016933 | 252 |
| 671 | 3300028573 | Ga0265334_10001411 | Ga0265334_100014115 | 252 |
| 672 | 3300028577 | Ga0265318_10001487 | Ga0265318_100014873 | 252 |
| 673 | 3300028653 | Ga0265323_10000218 | Ga0265323_1000021822 | 252 |
| 674 | 3300028654 | Ga0265322_10000549 | Ga0265322_100005496 | 252 |
| 675 | 3300028654 | Ga0265322_10002031 | Ga0265322_100020315 | 252 |
| 676 | 3300028666 | Ga0265336_10000115 | Ga0265336_1000011537 | 252 |
| 677 | 3300028794 | Ga0307515_10127185 | Ga0307515_101271855 | 252 |
| 678 | 3300028800 | Ga0265338_10005397 | Ga0265338_1000539712 | 252 |
| 679 | 3300028800 | Ga0265338_10005519 | Ga0265338_100055199 | 252 |
| 680 | 3300028800 | Ga0265338_10005708 | Ga0265338_100057088 | 252 |
| 681 | 3300029957 | Ga0265324_10001167 | Ga0265324_100011677 | 252 |
| 682 | 3300029957 | Ga0265324_10005143 | Ga0265324_100051437 | 252 |
| 683 | 3300029957 | Ga0265324_10005863 | Ga0265324_100058632 | 252 |
| 684 | 3300031235 | Ga0265330_10000319 | Ga0265330_1000031921 | 252 |
| 685 | 3300031238 | Ga0265332_10000382 | Ga0265332_1000038210 | 252 |
| 686 | 3300031238 | Ga0265332_10148623 | Ga0265332_101486231 | 252 |
| 687 | 3300031240 | Ga0265320_10002083 | Ga0265320_1000208320 | 252 |
| 688 | 3300031240 | Ga0265320_10002134 | Ga0265320_100021348 | 252 |
| 689 | 3300031241 | Ga0265325_10004251 | Ga0265325_100042516 | 252 |
| 690 | 3300031242 | Ga0265329_10000073 | Ga0265329_100000737 | 252 |
| 691 | 3300031247 | Ga0265340_10004960 | Ga0265340_100049603 | 252 |
| 692 | 3300031249 | Ga0265339_10000297 | Ga0265339_100002976 | 252 |
| 693 | 3300031250 | Ga0265331_10000963 | Ga0265331_1000096325 | 252 |
| 694 | 3300031344 | Ga0265316_10000247 | Ga0265316_1000024721 | 252 |
| 695 | 3300031344 | Ga0265316_10005834 | Ga0265316_1000583413 | 252 |
| 696 | 3300031595 | Ga0265313_10000580 | Ga0265313_1000058039 | 252 |
| 697 | 3300031711 | Ga0265314_10000285 | Ga0265314_1000028543 | 252 |
| 698 | 3300031712 | Ga0265342_10000764 | Ga0265342_1000076420 | 252 |
| 699 | 3300031712 | Ga0265342_10002715 | Ga0265342_1000271516 | 252 |
| 700 | 3300031995 | Ga0307409_100017651 | Ga0307409_1000176512 | 252 |
| 701 | 3300032002 | Ga0307416_100127250 | Ga0307416_1001272502 | 252 |
| 702 | 3300032133 | Ga0316583_10088994 | Ga0316583_100889942 | 252 |
| 703 | 3300035083 | Ga0373926_0008122 | Ga0373926_0008122_2266_3039 | 252 |
| 704 | 3300035089 | Ga0373944_0002092 | Ga0373944_0002092_4166_4939 | 252 |
| 705 | 3300035111 | Ga0373923_0002649 | Ga0373923_0002649_1180_1953 | 252 |
| 706 | 3300035113 | Ga0373936_0048820 | Ga0373936_0048820_900_1673 | 252 |
| 707 | 3300035116 | Ga0373945_0003771 | Ga0373945_0003771_3824_4597 | 252 |
| 708 | 3300035119 | Ga0373956_0000268 | Ga0373956_0000268_15851_16624 | 252 |
| 709 | 3300035120 | Ga0373957_0001328 | Ga0373957_0001328_937_1710 | 252 |
| 710 | 3300035170 | Ga0373943_0018325 | Ga0373943_0018325_2115_2888 | 252 |
| 711 | 3300035171 | Ga0373946_0001250 | Ga0373946_0001250_5538_6311 | 252 |
| 712 | 3300035171 | Ga0373946_0209542 | Ga0373946_0209542_73_846 | 252 |
| 713 | 3300035172 | Ga0373955_0000375 | Ga0373955_0000375_13686_14459 | 252 |
| 714 | 3300035410 | Ga0373924_0001315 | Ga0373924_0001315_348_1121 | 252 |
| 715 | 3300035691 | Ga0373931_0005639 | Ga0373931_0005639_4278_5042 | 252 |
| 716 | 3300035691 | Ga0373931_0091723 | Ga0373931_0091723_538_1302 | 252 |
| 717 | 3300035692 | Ga0373935_0046960 | Ga0373935_0046960_216_989 | 252 |
| 718 | 3300035695 | Ga0373927_0001403 | Ga0373927_0001403_15236_16009 | 252 |
| 719 | 3300035724 | Ga0373933_0000048 | Ga0373933_0000048_12457_13230 | 252 |
| 720 | 3300035725 | Ga0373947_0159061 | Ga0373947_0159061_460_1233 | 252 |
| 721 | 3300036401 | Ga0373937_0001127 | Ga0373937_0001127_16267_17040 | 252 |
| 722 | 3300036401 | Ga0373937_0447607 | Ga0373937_0447607_174_938 | 252 |
| 723 | 3300037068 | Ga0373925_0000764 | Ga0373925_0000764_4369_5142 | 252 |
| 724 | 3300042439 | Ga0439464_0014277 | Ga0439464_0014277_897_1655 | 252 |
| 725 | 3300042876 | Ga0451577_0002556 | Ga0451577_0002556_17950_18708 | 252 |
| 726 | 3300042876 | Ga0451577_0019993 | Ga0451577_0019993_4530_5288 | 252 |
| 727 | 3300042876 | Ga0451577_0036278 | Ga0451577_0036278_880_1638 | 252 |
| 728 | 3300042876 | Ga0451577_0442633 | Ga0451577_0442633_221_979 | 252 |
| 729 | 3300042876 | Ga0451577_0543424 | Ga0451577_0543424_96_869 | 252 |
| 730 | 3300044712 | Ga0453684_0000332 | Ga0453684_0000332_193344_194102 | 252 |
| 731 | 3300044712 | Ga0453684_0251225 | Ga0453684_0251225_525_1283 | 252 |
| 732 | 3300044712 | Ga0453684_0375474 | Ga0453684_0375474_103_861 | 252 |
| 733 | 3300045051 | Ga0451576_0185451 | Ga0451576_0185451_1000_1767 | 252 |
| 734 | 3300045976 | Ga0466967_0063446 | Ga0466967_0063446_1657_2430 | 252 |
| 735 | 3300046454 | Ga0495592_0004119 | Ga0495592_0004119_4834_5607 | 252 |
| 736 | 3300046455 | Ga0495603_0000562 | Ga0495603_0000562_14384_15157 | 252 |
| 737 | 3300046457 | Ga0495590_0059664 | Ga0495590_0059664_83_850 | 252 |
| 738 | 3300046459 | Ga0495629_0043348 | Ga0495629_0043348_239_1012 | 252 |
| 739 | 3300046459 | Ga0495629_0057124 | Ga0495629_0057124_1606_2370 | 252 |
| 740 | 3300046459 | Ga0495629_0072958 | Ga0495629_0072958_1439_2197 | 252 |
| 741 | 3300046462 | Ga0495651_0000222 | Ga0495651_0000222_16035_16808 | 252 |
| 742 | 3300046463 | Ga0495653_0000050 | Ga0495653_0000050_48908_49681 | 252 |
| 743 | 3300046472 | Ga0495580_0043293 | Ga0495580_0043293_158_931 | 252 |
| 744 | 3300046473 | Ga0495582_0015133 | Ga0495582_0015133_1070_1828 | 252 |
| 745 | 3300046473 | Ga0495582_0145889 | Ga0495582_0145889_362_1135 | 252 |
| 746 | 3300046475 | Ga0495639_0012626 | Ga0495639_0012626_2672_3445 | 252 |
| 747 | 3300046475 | Ga0495639_0026325 | Ga0495639_0026325_922_1680 | 252 |
| 748 | 3300046477 | Ga0495664_0019327 | Ga0495664_0019327_718_1476 | 252 |
| 749 | 3300046499 | Ga0495594_0039069 | Ga0495594_0039069_702_1460 | 252 |
| 750 | 3300046511 | Ga0495608_0000073 | Ga0495608_0000073_73245_74018 | 252 |
| 751 | 3300046514 | Ga0495618_0007472 | Ga0495618_0007472_5301_6059 | 252 |
| 752 | 3300046514 | Ga0495618_0034019 | Ga0495618_0034019_566_1339 | 252 |
| 753 | 3300046516 | Ga0495628_0000157 | Ga0495628_0000157_50074_50847 | 252 |
| 754 | 3300046516 | Ga0495628_0149156 | Ga0495628_0149156_418_1176 | 252 |
| 755 | 3300046517 | Ga0495630_0001130 | Ga0495630_0001130_66_839 | 252 |
| 756 | 3300046517 | Ga0495630_0007186 | Ga0495630_0007186_4743_5516 | 252 |
| 757 | 3300046517 | Ga0495630_0056237 | Ga0495630_0056237_1173_1931 | 252 |
| 758 | 3300046529 | Ga0495652_0001178 | Ga0495652_0001178_12163_12936 | 252 |
| 759 | 3300046531 | Ga0495665_0000137 | Ga0495665_0000137_11707_12480 | 252 |
| 760 | 3300046533 | Ga0495640_0025343 | Ga0495640_0025343_127_885 | 252 |
| 761 | 3300046533 | Ga0495640_0096528 | Ga0495640_0096528_817_1590 | 252 |
| 762 | 3300046535 | Ga0495586_0008259 | Ga0495586_0008259_2167_2925 | 252 |
| 763 | 3300046535 | Ga0495586_0355736 | Ga0495586_0355736_39_797 | 252 |
| 764 | 3300046536 | Ga0495587_0009570 | Ga0495587_0009570_467_1240 | 252 |
| 765 | 3300046543 | Ga0495645_0000299 | Ga0495645_0000299_16036_16809 | 252 |
| 766 | 3300046543 | Ga0495645_0056876 | Ga0495645_0056876_1258_2022 | 252 |
| 767 | 3300046559 | Ga0495667_0000191 | Ga0495667_0000191_11636_12409 | 252 |
| 768 | 3300046642 | Ga0495634_0003518 | Ga0495634_0003518_5862_6620 | 252 |
| 769 | 3300046642 | Ga0495634_0079444 | Ga0495634_0079444_691_1464 | 252 |
| 770 | 3300046663 | Ga0495635_0000066 | Ga0495635_0000066_26563_27336 | 252 |
| 771 | 3300046674 | Ga0495588_0000380 | Ga0495588_0000380_24488_25261 | 252 |
| 772 | 3300046675 | Ga0495657_0000053 | Ga0495657_0000053_27951_28724 | 252 |
| 773 | 3300046678 | Ga0495599_0001415 | Ga0495599_0001415_4475_5248 | 252 |
| 774 | 3300046678 | Ga0495599_0067049 | Ga0495599_0067049_34_792 | 252 |
| 775 | 3300046679 | Ga0495623_0008532 | Ga0495623_0008532_1779_2552 | 252 |
| 776 | 3300046683 | Ga0495658_0000248 | Ga0495658_0000248_28743_29516 | 252 |
| 777 | 3300046683 | Ga0495658_0037138 | Ga0495658_0037138_586_1344 | 252 |
| 778 | 3300046689 | Ga0495613_0005336 | Ga0495613_0005336_1184_1957 | 252 |
| 779 | 3300046689 | Ga0495613_0252590 | Ga0495613_0252590_162_935 | 252 |
| 780 | 3300046809 | Ga0495600_0000032 | Ga0495600_0000032_27006_27779 | 252 |
| 781 | 3300047315 | Ga0495581_0109486 | Ga0495581_0109486_701_1474 | 252 |
| 782 | 3300047317 | Ga0495604_0000051 | Ga0495604_0000051_50057_50830 | 252 |
| 783 | 3300047319 | Ga0495674_0001207 | Ga0495674_0001207_4181_4954 | 252 |
| 784 | 3300047321 | Ga0495676_0070292 | Ga0495676_0070292_880_1638 | 252 |
| 785 | 3300047322 | Ga0495680_0009004 | Ga0495680_0009004_4698_5456 | 252 |
| 786 | 3300047322 | Ga0495680_0042807 | Ga0495680_0042807_844_1617 | 252 |
| 787 | 3300047444 | Ga0495675_0000665 | Ga0495675_0000665_11141_11914 | 252 |
| 788 | 3300047471 | Ga0495684_0000062 | Ga0495684_0000062_16267_17040 | 252 |
| 789 | 3300047471 | Ga0495684_0045674 | Ga0495684_0045674_201_959 | 252 |
| 790 | 3300047673 | Ga0495593_0000178 | Ga0495593_0000178_31971_32744 | 252 |
| 791 | 3300047673 | Ga0495593_0027113 | Ga0495593_0027113_189_962 | 252 |
| 792 | 3300048088 | Ga0495602_0000245 | Ga0495602_0000245_22285_23058 | 252 |
| 793 | 3300048089 | Ga0495614_0081774 | Ga0495614_0081774_530_1288 | 252 |
| 794 | 3300048907 | Ga0496104_0359636 | Ga0496104_0359636_282_1046 | 252 |
| 795 | 3300048912 | Ga0496109_0011584 | Ga0496109_0011584_5413_6249 | 252 |
| 796 | 3300048913 | Ga0496110_0028643 | Ga0496110_0028643_1071_1907 | 252 |
| 797 | 3300048914 | Ga0496111_0058359 | Ga0496111_0058359_203_1039 | 252 |
| 798 | 3300048915 | Ga0496112_0000381 | Ga0496112_0000381_19900_20664 | 252 |
| 799 | 3300048915 | Ga0496112_0002076 | Ga0496112_0002076_11099_11935 | 252 |
| 800 | 3300048916 | Ga0496113_0016907 | Ga0496113_0016907_3935_4699 | 252 |
| 801 | 3300049571 | Ga0501034_0217737 | Ga0501034_0217737_344_1108 | 252 |
| 802 | 3300049576 | Ga0501040_0006397 | Ga0501040_0006397_6405_7169 | 252 |
| 803 | 3300049743 | Ga0501081_0429260 | Ga0501081_0429260_37_801 | 252 |
| 804 | 3300049779 | Ga0501283_005510 | Ga0501283_005510_792_1562 | 252 |
| 805 | 3300050508 | nmdc:mga09592_35193_c1 | nmdc:mga09592_35193_c1_912_1676 | 252 |
| 806 | 3300050509 | nmdc:mga0qj67_176711_c1 | nmdc:mga0qj67_176711_c1_138_902 | 252 |
| 807 | 3300050509 | nmdc:mga0qj67_477509_c1 | nmdc:mga0qj67_477509_c1_166_930 | 252 |
| 808 | 3300050509 | nmdc:mga0qj67_77733_c1 | nmdc:mga0qj67_77733_c1_181_945 | 252 |
| 809 | 3300050510 | nmdc:mga06r32_52114_c1 | nmdc:mga06r32_52114_c1_535_1299 | 252 |
| 810 | 3300050511 | nmdc:mga08y16_507848_c1 | nmdc:mga08y16_507848_c1_137_925 | 252 |
| 811 | 3300050511 | nmdc:mga08y16_56258_c1 | nmdc:mga08y16_56258_c1_2618_3376 | 252 |
| 812 | 3300050513 | nmdc:mga0rr50_578522_c1 | nmdc:mga0rr50_578522_c1_110_877 | 252 |
| 813 | 3300050514 | nmdc:mga08x19_10886_c1 | nmdc:mga08x19_10886_c1_1799_2560 | 252 |
| 814 | 3300050514 | nmdc:mga08x19_52021_c1 | nmdc:mga08x19_52021_c1_525_1292 | 252 |
| 815 | 3300053077 | Ga0495601_0002779 | Ga0495601_0002779_8222_8995 | 252 |
| 816 | 3300053078 | Ga0495612_0000406 | Ga0495612_0000406_4161_4934 | 252 |
| 817 | 3300053085 | Ga0495619_0002199 | Ga0495619_0002199_10117_10890 | 252 |
| 818 | 3300005328 | Ga0070676_10004169 | Ga0070676_100041697 | 253 |
| 819 | 3300005329 | Ga0070683_100099343 | Ga0070683_1000993432 | 253 |
| 820 | 3300005336 | Ga0070680_100026034 | Ga0070680_1000260343 | 253 |
| 821 | 3300005336 | Ga0070680_100073783 | Ga0070680_1000737831 | 253 |
| 822 | 3300005337 | Ga0070682_100000734 | Ga0070682_10000073411 | 253 |
| 823 | 3300005337 | Ga0070682_100005193 | Ga0070682_1000051933 | 253 |
| 824 | 3300005338 | Ga0068868_100001690 | Ga0068868_10000169012 | 253 |
| 825 | 3300005341 | Ga0070691_10094372 | Ga0070691_100943722 | 253 |
| 826 | 3300005345 | Ga0070692_10283019 | Ga0070692_102830191 | 253 |
| 827 | 3300005347 | Ga0070668_100572496 | Ga0070668_1005724961 | 253 |
| 828 | 3300005353 | Ga0070669_100030646 | Ga0070669_1000306462 | 253 |
| 829 | 3300005355 | Ga0070671_100023258 | Ga0070671_1000232581 | 253 |
| 830 | 3300005355 | Ga0070671_100219010 | Ga0070671_1002190102 | 253 |
| 831 | 3300005356 | Ga0070674_100056773 | Ga0070674_1000567731 | 253 |
| 832 | 3300005364 | Ga0070673_100014635 | Ga0070673_1000146357 | 253 |
| 833 | 3300005366 | Ga0070659_100034971 | Ga0070659_1000349712 | 253 |
| 834 | 3300005434 | Ga0070709_10008761 | Ga0070709_100087613 | 253 |
| 835 | 3300005434 | Ga0070709_10596653 | Ga0070709_105966531 | 253 |
| 836 | 3300005437 | Ga0070710_10016685 | Ga0070710_100166852 | 253 |
| 837 | 3300005439 | Ga0070711_100041611 | Ga0070711_1000416112 | 253 |
| 838 | 3300005439 | Ga0070711_100113196 | Ga0070711_1001131963 | 253 |
| 839 | 3300005441 | Ga0070700_100036045 | Ga0070700_1000360453 | 253 |
| 840 | 3300005456 | Ga0070678_100067503 | Ga0070678_1000675032 | 253 |
| 841 | 3300005457 | Ga0070662_100381231 | Ga0070662_1003812312 | 253 |
| 842 | 3300005458 | Ga0070681_10105072 | Ga0070681_101050722 | 253 |
| 843 | 3300005459 | Ga0068867_100027999 | Ga0068867_1000279992 | 253 |
| 844 | 3300005459 | Ga0068867_100220746 | Ga0068867_1002207462 | 253 |
| 845 | 3300005518 | Ga0070699_100000063 | Ga0070699_10000006344 | 253 |
| 846 | 3300005530 | Ga0070679_100068952 | Ga0070679_1000689522 | 253 |
| 847 | 3300005530 | Ga0070679_100215457 | Ga0070679_1002154572 | 253 |
| 848 | 3300005535 | Ga0070684_100000212 | Ga0070684_10000021237 | 253 |
| 849 | 3300005545 | Ga0070695_100001374 | Ga0070695_10000137410 | 253 |
| 850 | 3300005547 | Ga0070693_100070305 | Ga0070693_1000703052 | 253 |
| 851 | 3300005549 | Ga0070704_100228732 | Ga0070704_1002287322 | 253 |
| 852 | 3300005563 | Ga0068855_100004308 | Ga0068855_10000430812 | 253 |
| 853 | 3300005563 | Ga0068855_100267059 | Ga0068855_1002670592 | 253 |
| 854 | 3300005563 | Ga0068855_100437458 | Ga0068855_1004374582 | 253 |
| 855 | 3300005564 | Ga0070664_100021929 | Ga0070664_1000219294 | 253 |
| 856 | 3300005616 | Ga0068852_100751719 | Ga0068852_1007517191 | 253 |
| 857 | 3300005718 | Ga0068866_10077480 | Ga0068866_100774802 | 253 |
| 858 | 3300005844 | Ga0068862_100142275 | Ga0068862_1001422752 | 253 |
| 859 | 3300005937 | Ga0081455_10066458 | Ga0081455_100664583 | 253 |
| 860 | 3300006173 | Ga0070716_100000911 | Ga0070716_1000009112 | 253 |
| 861 | 3300006175 | Ga0070712_100407614 | Ga0070712_1004076141 | 253 |
| 862 | 3300006844 | Ga0075428_100042612 | Ga0075428_1000426126 | 253 |
| 863 | 3300006847 | Ga0075431_100136207 | Ga0075431_1001362072 | 253 |
| 864 | 3300006852 | Ga0075433_10015768 | Ga0075433_100157687 | 253 |
| 865 | 3300006852 | Ga0075433_10044601 | Ga0075433_100446012 | 253 |
| 866 | 3300006871 | Ga0075434_100012547 | Ga0075434_1000125478 | 253 |
| 867 | 3300006871 | Ga0075434_100162518 | Ga0075434_1001625182 | 253 |
| 868 | 3300006871 | Ga0075434_100179294 | Ga0075434_1001792942 | 253 |
| 869 | 3300006880 | Ga0075429_100000263 | Ga0075429_10000026330 | 253 |
| 870 | 3300006881 | Ga0068865_100007259 | Ga0068865_1000072598 | 253 |
| 871 | 3300006914 | Ga0075436_100012281 | Ga0075436_1000122813 | 253 |
| 872 | 3300006914 | Ga0075436_100161322 | Ga0075436_1001613222 | 253 |
| 873 | 3300007076 | Ga0075435_100314638 | Ga0075435_1003146382 | 253 |
| 874 | 3300007788 | Ga0099795_10024610 | Ga0099795_100246102 | 253 |
| 875 | 3300009093 | Ga0105240_10294332 | Ga0105240_102943322 | 253 |
| 876 | 3300009098 | Ga0105245_10010423 | Ga0105245_100104239 | 253 |
| 877 | 3300009098 | Ga0105245_10036786 | Ga0105245_100367864 | 253 |
| 878 | 3300009147 | Ga0114129_10071105 | Ga0114129_100711052 | 253 |
| 879 | 3300009148 | Ga0105243_10128101 | Ga0105243_101281012 | 253 |
| 880 | 3300009177 | Ga0105248_10086695 | Ga0105248_100866952 | 253 |
| 881 | 3300009177 | Ga0105248_10296390 | Ga0105248_102963902 | 253 |
| 882 | 3300009545 | Ga0105237_10146238 | Ga0105237_101462382 | 253 |
| 883 | 3300009545 | Ga0105237_10372259 | Ga0105237_103722591 | 253 |
| 884 | 3300013105 | Ga0157369_10262924 | Ga0157369_102629241 | 253 |
| 885 | 3300013297 | Ga0157378_10034310 | Ga0157378_100343102 | 253 |
| 886 | 3300013297 | Ga0157378_10056354 | Ga0157378_100563544 | 253 |
| 887 | 3300013297 | Ga0157378_10126749 | Ga0157378_101267491 | 253 |
| 888 | 3300013307 | Ga0157372_10008172 | Ga0157372_1000817213 | 253 |
| 889 | 3300013307 | Ga0157372_10022604 | Ga0157372_100226043 | 253 |
| 890 | 3300020077 | Ga0206351_10878209 | Ga0206351_108782092 | 253 |
| 891 | 3300025893 | Ga0207682_10024834 | Ga0207682_100248342 | 253 |
| 892 | 3300025899 | Ga0207642_10132429 | Ga0207642_101324291 | 253 |
| 893 | 3300025906 | Ga0207699_10060529 | Ga0207699_100605292 | 253 |
| 894 | 3300025907 | Ga0207645_10013509 | Ga0207645_100135092 | 253 |
| 895 | 3300025912 | Ga0207707_10015965 | Ga0207707_100159656 | 253 |
| 896 | 3300025913 | Ga0207695_10188662 | Ga0207695_101886622 | 253 |
| 897 | 3300025916 | Ga0207663_10097790 | Ga0207663_100977902 | 253 |
| 898 | 3300025917 | Ga0207660_10045477 | Ga0207660_100454772 | 253 |
| 899 | 3300025921 | Ga0207652_10001513 | Ga0207652_1000151322 | 253 |
| 900 | 3300025921 | Ga0207652_10099393 | Ga0207652_100993932 | 253 |
| 901 | 3300025923 | Ga0207681_10134732 | Ga0207681_101347322 | 253 |
| 902 | 3300025924 | Ga0207694_10033445 | Ga0207694_100334454 | 253 |
| 903 | 3300025927 | Ga0207687_10021988 | Ga0207687_100219884 | 253 |
| 904 | 3300025927 | Ga0207687_10221565 | Ga0207687_102215652 | 253 |
| 905 | 3300025931 | Ga0207644_10447831 | Ga0207644_104478312 | 253 |
| 906 | 3300025933 | Ga0207706_10003039 | Ga0207706_100030392 | 253 |
| 907 | 3300025939 | Ga0207665_10000385 | Ga0207665_1000038521 | 253 |
| 908 | 3300025944 | Ga0207661_10000266 | Ga0207661_1000026627 | 253 |
| 909 | 3300025945 | Ga0207679_10054235 | Ga0207679_100542352 | 253 |
| 910 | 3300025949 | Ga0207667_10002929 | Ga0207667_1000292920 | 253 |
| 911 | 3300025972 | Ga0207668_10581859 | Ga0207668_105818591 | 253 |
| 912 | 3300025981 | Ga0207640_10301738 | Ga0207640_103017381 | 253 |
| 913 | 3300026023 | Ga0207677_10015707 | Ga0207677_100157072 | 253 |
| 914 | 3300026023 | Ga0207677_10300527 | Ga0207677_103005272 | 253 |
| 915 | 3300026067 | Ga0207678_10274790 | Ga0207678_102747902 | 253 |
| 916 | 3300026075 | Ga0207708_10056957 | Ga0207708_100569571 | 253 |
| 917 | 3300026089 | Ga0207648_10070659 | Ga0207648_100706592 | 253 |
| 918 | 3300026089 | Ga0207648_10081301 | Ga0207648_100813012 | 253 |
| 919 | 3300026089 | Ga0207648_10214133 | Ga0207648_102141331 | 253 |
| 920 | 3300026116 | Ga0207674_10004557 | Ga0207674_1000455719 | 253 |
| 921 | 3300026121 | Ga0207683_10024609 | Ga0207683_100246092 | 253 |
| 922 | 3300028380 | Ga0268265_10344506 | Ga0268265_103445062 | 253 |
| 923 | 3300031548 | Ga0307408_100063300 | Ga0307408_1000633002 | 253 |
| 924 | 3300031731 | Ga0307405_10021653 | Ga0307405_100216534 | 253 |
| 925 | 3300031901 | Ga0307406_10018816 | Ga0307406_100188164 | 253 |
| 926 | 3300032002 | Ga0307416_100471283 | Ga0307416_1004712832 | 253 |
| 927 | 3300032004 | Ga0307414_10179999 | Ga0307414_101799992 | 253 |
| 928 | 3300032004 | Ga0307414_10449300 | Ga0307414_104493001 | 253 |
| 929 | 3300034820 | Ga0373959_0009856 | Ga0373959_0009856_585_1355 | 253 |
| 930 | 3300035112 | Ga0373932_0035277 | Ga0373932_0035277_422_1192 | 253 |
| 931 | 3300035115 | Ga0373941_0066177 | Ga0373941_0066177_57_827 | 253 |
| 932 | 3300035170 | Ga0373943_0139404 | Ga0373943_0139404_336_1100 | 253 |
| 933 | 3300035171 | Ga0373946_0099228 | Ga0373946_0099228_350_1114 | 253 |
| 934 | 3300035207 | Ga0373942_0004857 | Ga0373942_0004857_329_1099 | 253 |
| 935 | 3300035692 | Ga0373935_0104024 | Ga0373935_0104024_101_865 | 253 |
| 936 | 3300042876 | Ga0451577_0016505 | Ga0451577_0016505_5037_5804 | 253 |
| 937 | 3300046459 | Ga0495629_0035680 | Ga0495629_0035680_1623_2390 | 253 |
| 938 | 3300046472 | Ga0495580_0045913 | Ga0495580_0045913_681_1448 | 253 |
| 939 | 3300046475 | Ga0495639_0007465 | Ga0495639_0007465_1065_1832 | 253 |
| 940 | 3300046491 | Ga0495584_0092214 | Ga0495584_0092214_476_1240 | 253 |
| 941 | 3300046517 | Ga0495630_0010823 | Ga0495630_0010823_5256_6023 | 253 |
| 942 | 3300046526 | Ga0495666_0030573 | Ga0495666_0030573_242_1009 | 253 |
| 943 | 3300046559 | Ga0495667_0000474 | Ga0495667_0000474_13624_14391 | 253 |
| 944 | 3300046675 | Ga0495657_0023972 | Ga0495657_0023972_229_996 | 253 |
| 945 | 3300046679 | Ga0495623_0106385 | Ga0495623_0106385_627_1394 | 253 |
| 946 | 3300046680 | Ga0495646_0061751 | Ga0495646_0061751_1306_2073 | 253 |
| 947 | 3300047315 | Ga0495581_0231317 | Ga0495581_0231317_159_926 | 253 |
| 948 | 3300047319 | Ga0495674_0052030 | Ga0495674_0052030_1854_2621 | 253 |
| 949 | 3300047471 | Ga0495684_0074382 | Ga0495684_0074382_561_1328 | 253 |
| 950 | 3300048088 | Ga0495602_0092586 | Ga0495602_0092586_171_938 | 253 |
| 951 | 3300048915 | Ga0496112_0000949 | Ga0496112_0000949_4286_5056 | 253 |
| 952 | 3300049824 | Ga0501045_0355430 | Ga0501045_0355430_260_1021 | 253 |
| 953 | 3300050507 | nmdc:mga05p37_155774_c1 | nmdc:mga05p37_155774_c1_1432_2193 | 253 |
| 954 | 3300050507 | nmdc:mga05p37_197905_c1 | nmdc:mga05p37_197905_c1_375_1145 | 253 |
| 955 | 3300050508 | nmdc:mga09592_1886_c1 | nmdc:mga09592_1886_c1_14618_15379 | 253 |
| 956 | 3300050510 | nmdc:mga06r32_53042_c1 | nmdc:mga06r32_53042_c1_2812_3573 | 253 |
| 957 | 3300050512 | nmdc:mga0n895_330294_c1 | nmdc:mga0n895_330294_c1_318_1079 | 253 |
| 958 | 3300050514 | nmdc:mga08x19_5006_c1 | nmdc:mga08x19_5006_c1_3972_4742 | 253 |
| 959 | 3300050514 | nmdc:mga08x19_85603_c1 | nmdc:mga08x19_85603_c1_805_1575 | 253 |
| 960 | 3300005329 | Ga0070683_100036398 | Ga0070683_1000363982 | 254 |
| 961 | 3300005331 | Ga0070670_100055309 | Ga0070670_1000553091 | 254 |
| 962 | 3300005336 | Ga0070680_100279694 | Ga0070680_1002796941 | 254 |
| 963 | 3300005340 | Ga0070689_100439768 | Ga0070689_1004397681 | 254 |
| 964 | 3300005842 | Ga0068858_100194229 | Ga0068858_1001942292 | 254 |
| 965 | 3300006871 | Ga0075434_100019973 | Ga0075434_1000199736 | 254 |
| 966 | 3300007076 | Ga0075435_100018950 | Ga0075435_1000189503 | 254 |
| 967 | 3300009177 | Ga0105248_10019128 | Ga0105248_1001912810 | 254 |
| 968 | 3300009177 | Ga0105248_10171291 | Ga0105248_101712912 | 254 |
| 969 | 3300013308 | Ga0157375_11273999 | Ga0157375_112739991 | 254 |
| 970 | 3300014325 | Ga0163163_10050109 | Ga0163163_100501094 | 254 |
| 971 | 3300014968 | Ga0157379_10015995 | Ga0157379_100159953 | 254 |
| 972 | 3300014969 | Ga0157376_10534413 | Ga0157376_105344131 | 254 |
| 973 | 3300025899 | Ga0207642_10095217 | Ga0207642_100952172 | 254 |
| 974 | 3300025925 | Ga0207650_10030026 | Ga0207650_100300262 | 254 |
| 975 | 3300025926 | Ga0207659_10594550 | Ga0207659_105945501 | 254 |
| 976 | 3300025941 | Ga0207711_10018493 | Ga0207711_100184933 | 254 |
| 977 | 3300025972 | Ga0207668_10200757 | Ga0207668_102007572 | 254 |
| 978 | 3300026088 | Ga0207641_10509032 | Ga0207641_105090321 | 254 |
| 979 | 3300026095 | Ga0207676_10066334 | Ga0207676_100663342 | 254 |
| 980 | 3300031824 | Ga0307413_10199897 | Ga0307413_101998972 | 254 |
| 981 | 3300031995 | Ga0307409_100752330 | Ga0307409_1007523301 | 254 |
| 982 | 3300042876 | Ga0451577_0046106 | Ga0451577_0046106_609_1376 | 254 |
| 983 | 3300044712 | Ga0453684_0089547 | Ga0453684_0089547_897_1664 | 254 |
| 984 | 3300045051 | Ga0451576_0241660 | Ga0451576_0241660_335_1102 | 254 |
| 985 | 3300047320 | Ga0495672_0008073 | Ga0495672_0008073_4008_4778 | 254 |
| 986 | 3300049571 | Ga0501034_0326280 | Ga0501034_0326280_573_1337 | 254 |
| 987 | 3300049573 | Ga0501037_0355057 | Ga0501037_0355057_180_944 | 254 |
| 988 | 3300049822 | Ga0501035_0038522 | Ga0501035_0038522_3392_4156 | 254 |
| 989 | 3300049824 | Ga0501045_0191513 | Ga0501045_0191513_550_1317 | 254 |
| 990 | 3300050512 | nmdc:mga0n895_295342_c1 | nmdc:mga0n895_295342_c1_713_1492 | 254 |
| 991 | 3300050513 | nmdc:mga0rr50_13705_c1 | nmdc:mga0rr50_13705_c1_2469_3248 | 254 |
| 992 | 3300005329 | Ga0070683_100003542 | Ga0070683_10000354212 | 255 |
| 993 | 3300005336 | Ga0070680_100004005 | Ga0070680_1000040053 | 255 |
| 994 | 3300005436 | Ga0070713_100001130 | Ga0070713_10000113010 | 255 |
| 995 | 3300005458 | Ga0070681_10243420 | Ga0070681_102434202 | 255 |
| 996 | 3300005458 | Ga0070681_10285019 | Ga0070681_102850192 | 255 |
| 997 | 3300005530 | Ga0070679_100048845 | Ga0070679_1000488452 | 255 |
| 998 | 3300005535 | Ga0070684_100010985 | Ga0070684_1000109852 | 255 |
| 999 | 3300005535 | Ga0070684_100130303 | Ga0070684_1001303032 | 255 |
| 1000 | 3300005577 | Ga0068857_100243826 | Ga0068857_1002438262 | 255 |
| 1001 | 3300009174 | Ga0105241_10124929 | Ga0105241_101249292 | 255 |
| 1002 | 3300013100 | Ga0157373_10182621 | Ga0157373_101826212 | 255 |
| 1003 | 3300013104 | Ga0157370_10000311 | Ga0157370_1000031155 | 255 |
| 1004 | 3300013104 | Ga0157370_10049871 | Ga0157370_100498714 | 255 |
| 1005 | 3300013307 | Ga0157372_10243070 | Ga0157372_102430702 | 255 |
| 1006 | 3300020070 | Ga0206356_10634794 | Ga0206356_106347942 | 255 |
| 1007 | 3300025911 | Ga0207654_10179755 | Ga0207654_101797551 | 255 |
| 1008 | 3300025912 | Ga0207707_10020488 | Ga0207707_100204883 | 255 |
| 1009 | 3300025912 | Ga0207707_10218880 | Ga0207707_102188801 | 255 |
| 1010 | 3300025913 | Ga0207695_10028639 | Ga0207695_100286392 | 255 |
| 1011 | 3300025917 | Ga0207660_10035605 | Ga0207660_100356052 | 255 |
| 1012 | 3300025921 | Ga0207652_10016515 | Ga0207652_100165154 | 255 |
| 1013 | 3300025944 | Ga0207661_10101931 | Ga0207661_101019312 | 255 |
| 1014 | 3300025944 | Ga0207661_10130283 | Ga0207661_101302832 | 255 |
| 1015 | 3300026116 | Ga0207674_10045964 | Ga0207674_100459645 | 255 |
| 1016 | 3300031548 | Ga0307408_100051172 | Ga0307408_1000511722 | 255 |
| 1017 | 3300031712 | Ga0265342_10002983 | Ga0265342_100029839 | 255 |
| 1018 | 3300031731 | Ga0307405_10006609 | Ga0307405_100066094 | 255 |
| 1019 | 3300031824 | Ga0307413_10006790 | Ga0307413_100067903 | 255 |
| 1020 | 3300031852 | Ga0307410_10020830 | Ga0307410_100208302 | 255 |
| 1021 | 3300031903 | Ga0307407_10015673 | Ga0307407_100156733 | 255 |
| 1022 | 3300031911 | Ga0307412_10002809 | Ga0307412_100028098 | 255 |
| 1023 | 3300031995 | Ga0307409_100009742 | Ga0307409_1000097425 | 255 |
| 1024 | 3300032002 | Ga0307416_100003759 | Ga0307416_1000037592 | 255 |
| 1025 | 3300032004 | Ga0307414_10015982 | Ga0307414_100159825 | 255 |
| 1026 | 3300032005 | Ga0307411_10079257 | Ga0307411_100792572 | 255 |
| 1027 | 3300032126 | Ga0307415_100013459 | Ga0307415_1000134593 | 255 |
| 1028 | 3300035086 | Ga0373934_0008664 | Ga0373934_0008664_271_1047 | 255 |
| 1029 | 3300035172 | Ga0373955_0042312 | Ga0373955_0042312_158_934 | 255 |
| 1030 | 3300035410 | Ga0373924_0151529 | Ga0373924_0151529_52_828 | 255 |
| 1031 | 3300035724 | Ga0373933_0005244 | Ga0373933_0005244_3287_4063 | 255 |
| 1032 | 3300036401 | Ga0373937_0000329 | Ga0373937_0000329_21200_21976 | 255 |
| 1033 | 3300037312 | Ga0395899_0020501 | Ga0395899_0020501_2217_2990 | 255 |
| 1034 | 3300037418 | Ga0395900_0020640 | Ga0395900_0020640_4660_5433 | 255 |
| 1035 | 3300037466 | Ga0395898_0042905 | Ga0395898_0042905_2492_3265 | 255 |
| 1036 | 3300038443 | Ga0395901_0012864 | Ga0395901_0012864_7623_8396 | 255 |
| 1037 | 3300046462 | Ga0495651_0095693 | Ga0495651_0095693_196_972 | 255 |
| 1038 | 3300046463 | Ga0495653_0066752 | Ga0495653_0066752_296_1072 | 255 |
| 1039 | 3300046475 | Ga0495639_0063738 | Ga0495639_0063738_518_1294 | 255 |
| 1040 | 3300046516 | Ga0495628_0009614 | Ga0495628_0009614_5764_6540 | 255 |
| 1041 | 3300046529 | Ga0495652_0063127 | Ga0495652_0063127_1584_2360 | 255 |
| 1042 | 3300046536 | Ga0495587_0006400 | Ga0495587_0006400_6681_7457 | 255 |
| 1043 | 3300046679 | Ga0495623_0030521 | Ga0495623_0030521_1520_2296 | 255 |
| 1044 | 3300046809 | Ga0495600_0128800 | Ga0495600_0128800_506_1282 | 255 |
| 1045 | 3300047317 | Ga0495604_0150251 | Ga0495604_0150251_609_1385 | 255 |
| 1046 | 3300047319 | Ga0495674_0343802 | Ga0495674_0343802_391_1167 | 255 |
| 1047 | 3300047444 | Ga0495675_0248445 | Ga0495675_0248445_104_880 | 255 |
| 1048 | 3300049584 | Ga0501068_0123917 | Ga0501068_0123917_689_1456 | 255 |
| 1049 | 3300049593 | Ga0501077_0086085 | Ga0501077_0086085_94_861 | 255 |
| 1050 | 3300053077 | Ga0495601_0108896 | Ga0495601_0108896_285_1061 | 255 |
| 1051 | 3300053085 | Ga0495619_0104008 | Ga0495619_0104008_396_1172 | 255 |
| 1052 | 3300005289 | Ga0065704_10094572 | Ga0065704_100945722 | 256 |
| 1053 | 3300005295 | Ga0065707_10002538 | Ga0065707_100025382 | 256 |
| 1054 | 3300005328 | Ga0070676_10201227 | Ga0070676_102012272 | 256 |
| 1055 | 3300005329 | Ga0070683_100000167 | Ga0070683_10000016739 | 256 |
| 1056 | 3300005329 | Ga0070683_100067226 | Ga0070683_1000672262 | 256 |
| 1057 | 3300005329 | Ga0070683_100096920 | Ga0070683_1000969202 | 256 |
| 1058 | 3300005335 | Ga0070666_10198684 | Ga0070666_101986842 | 256 |
| 1059 | 3300005336 | Ga0070680_100064404 | Ga0070680_1000644042 | 256 |
| 1060 | 3300005338 | Ga0068868_100033101 | Ga0068868_1000331014 | 256 |
| 1061 | 3300005340 | Ga0070689_100092574 | Ga0070689_1000925742 | 256 |
| 1062 | 3300005343 | Ga0070687_100089947 | Ga0070687_1000899471 | 256 |
| 1063 | 3300005344 | Ga0070661_100152697 | Ga0070661_1001526971 | 256 |
| 1064 | 3300005347 | Ga0070668_100202352 | Ga0070668_1002023521 | 256 |
| 1065 | 3300005366 | Ga0070659_100009038 | Ga0070659_1000090386 | 256 |
| 1066 | 3300005367 | Ga0070667_100132179 | Ga0070667_1001321791 | 256 |
| 1067 | 3300005434 | Ga0070709_10049249 | Ga0070709_100492493 | 256 |
| 1068 | 3300005440 | Ga0070705_100327896 | Ga0070705_1003278961 | 256 |
| 1069 | 3300005445 | Ga0070708_100000075 | Ga0070708_10000007554 | 256 |
| 1070 | 3300005445 | Ga0070708_100004873 | Ga0070708_10000487313 | 256 |
| 1071 | 3300005445 | Ga0070708_100143567 | Ga0070708_1001435672 | 256 |
| 1072 | 3300005455 | Ga0070663_100015483 | Ga0070663_1000154833 | 256 |
| 1073 | 3300005457 | Ga0070662_100060350 | Ga0070662_1000603503 | 256 |
| 1074 | 3300005458 | Ga0070681_10051531 | Ga0070681_100515312 | 256 |
| 1075 | 3300005467 | Ga0070706_100009626 | Ga0070706_1000096266 | 256 |
| 1076 | 3300005467 | Ga0070706_100021390 | Ga0070706_1000213904 | 256 |
| 1077 | 3300005468 | Ga0070707_100006739 | Ga0070707_1000067394 | 256 |
| 1078 | 3300005468 | Ga0070707_100294352 | Ga0070707_1002943522 | 256 |
| 1079 | 3300005471 | Ga0070698_100011487 | Ga0070698_1000114874 | 256 |
| 1080 | 3300005471 | Ga0070698_100027831 | Ga0070698_1000278313 | 256 |
| 1081 | 3300005518 | Ga0070699_100007997 | Ga0070699_10000799714 | 256 |
| 1082 | 3300005518 | Ga0070699_100009667 | Ga0070699_1000096677 | 256 |
| 1083 | 3300005518 | Ga0070699_100036215 | Ga0070699_1000362154 | 256 |
| 1084 | 3300005518 | Ga0070699_100110974 | Ga0070699_1001109743 | 256 |
| 1085 | 3300005530 | Ga0070679_100435705 | Ga0070679_1004357051 | 256 |
| 1086 | 3300005530 | Ga0070679_100597469 | Ga0070679_1005974691 | 256 |
| 1087 | 3300005535 | Ga0070684_100036065 | Ga0070684_1000360653 | 256 |
| 1088 | 3300005535 | Ga0070684_100137842 | Ga0070684_1001378422 | 256 |
| 1089 | 3300005535 | Ga0070684_100188076 | Ga0070684_1001880762 | 256 |
| 1090 | 3300005536 | Ga0070697_100008915 | Ga0070697_1000089157 | 256 |
| 1091 | 3300005536 | Ga0070697_100009287 | Ga0070697_1000092873 | 256 |
| 1092 | 3300005543 | Ga0070672_100026672 | Ga0070672_1000266723 | 256 |
| 1093 | 3300005563 | Ga0068855_100503572 | Ga0068855_1005035722 | 256 |
| 1094 | 3300005564 | Ga0070664_100114073 | Ga0070664_1001140731 | 256 |
| 1095 | 3300005577 | Ga0068857_100011109 | Ga0068857_1000111096 | 256 |
| 1096 | 3300005614 | Ga0068856_100160048 | Ga0068856_1001600482 | 256 |
| 1097 | 3300005618 | Ga0068864_100247571 | Ga0068864_1002475712 | 256 |
| 1098 | 3300005719 | Ga0068861_100019081 | Ga0068861_1000190812 | 256 |
| 1099 | 3300005842 | Ga0068858_100196931 | Ga0068858_1001969312 | 256 |
| 1100 | 3300005844 | Ga0068862_100132445 | Ga0068862_1001324452 | 256 |
| 1101 | 3300006058 | Ga0075432_10130116 | Ga0075432_101301161 | 256 |
| 1102 | 3300006844 | Ga0075428_100051192 | Ga0075428_1000511923 | 256 |
| 1103 | 3300006844 | Ga0075428_100057685 | Ga0075428_1000576852 | 256 |
| 1104 | 3300006844 | Ga0075428_100071962 | Ga0075428_1000719623 | 256 |
| 1105 | 3300006847 | Ga0075431_100006275 | Ga0075431_10000627510 | 256 |
| 1106 | 3300006847 | Ga0075431_100529777 | Ga0075431_1005297772 | 256 |
| 1107 | 3300006852 | Ga0075433_10023858 | Ga0075433_100238583 | 256 |
| 1108 | 3300006852 | Ga0075433_10029664 | Ga0075433_100296642 | 256 |
| 1109 | 3300006852 | Ga0075433_10035491 | Ga0075433_100354912 | 256 |
| 1110 | 3300006852 | Ga0075433_10104854 | Ga0075433_101048542 | 256 |
| 1111 | 3300006871 | Ga0075434_100093491 | Ga0075434_1000934913 | 256 |
| 1112 | 3300006880 | Ga0075429_100014752 | Ga0075429_1000147525 | 256 |
| 1113 | 3300006914 | Ga0075436_100008948 | Ga0075436_1000089485 | 256 |
| 1114 | 3300007076 | Ga0075435_100115161 | Ga0075435_1001151612 | 256 |
| 1115 | 3300007076 | Ga0075435_100470554 | Ga0075435_1004705541 | 256 |
| 1116 | 3300009147 | Ga0114129_10097509 | Ga0114129_100975092 | 256 |
| 1117 | 3300009177 | Ga0105248_10154882 | Ga0105248_101548823 | 256 |
| 1118 | 3300009553 | Ga0105249_10332136 | Ga0105249_103321362 | 256 |
| 1119 | 3300011119 | Ga0105246_10545717 | Ga0105246_105457172 | 256 |
| 1120 | 3300013102 | Ga0157371_10205901 | Ga0157371_102059011 | 256 |
| 1121 | 3300013105 | Ga0157369_10255814 | Ga0157369_102558142 | 256 |
| 1122 | 3300025315 | Ga0207697_10006392 | Ga0207697_100063925 | 256 |
| 1123 | 3300025906 | Ga0207699_10000990 | Ga0207699_1000099010 | 256 |
| 1124 | 3300025910 | Ga0207684_10005196 | Ga0207684_1000519611 | 256 |
| 1125 | 3300025910 | Ga0207684_10044459 | Ga0207684_100444591 | 256 |
| 1126 | 3300025912 | Ga0207707_10033649 | Ga0207707_100336494 | 256 |
| 1127 | 3300025915 | Ga0207693_10031705 | Ga0207693_100317053 | 256 |
| 1128 | 3300025916 | Ga0207663_10067351 | Ga0207663_100673512 | 256 |
| 1129 | 3300025918 | Ga0207662_10186218 | Ga0207662_101862182 | 256 |
| 1130 | 3300025920 | Ga0207649_10045358 | Ga0207649_100453582 | 256 |
| 1131 | 3300025920 | Ga0207649_10057496 | Ga0207649_100574963 | 256 |
| 1132 | 3300025921 | Ga0207652_10285114 | Ga0207652_102851142 | 256 |
| 1133 | 3300025922 | Ga0207646_10002828 | Ga0207646_1000282823 | 256 |
| 1134 | 3300025932 | Ga0207690_10054671 | Ga0207690_100546711 | 256 |
| 1135 | 3300025933 | Ga0207706_10184546 | Ga0207706_101845462 | 256 |
| 1136 | 3300025940 | Ga0207691_10012186 | Ga0207691_100121864 | 256 |
| 1137 | 3300025941 | Ga0207711_10049151 | Ga0207711_100491513 | 256 |
| 1138 | 3300025944 | Ga0207661_10088576 | Ga0207661_100885761 | 256 |
| 1139 | 3300025945 | Ga0207679_10022240 | Ga0207679_100222405 | 256 |
| 1140 | 3300025945 | Ga0207679_10051565 | Ga0207679_100515652 | 256 |
| 1141 | 3300025972 | Ga0207668_10091785 | Ga0207668_100917852 | 256 |
| 1142 | 3300026023 | Ga0207677_10182995 | Ga0207677_101829952 | 256 |
| 1143 | 3300026041 | Ga0207639_10705538 | Ga0207639_107055381 | 256 |
| 1144 | 3300026067 | Ga0207678_10061517 | Ga0207678_100615172 | 256 |
| 1145 | 3300026088 | Ga0207641_10433006 | Ga0207641_104330061 | 256 |
| 1146 | 3300026116 | Ga0207674_10010897 | Ga0207674_100108973 | 256 |
| 1147 | 3300026116 | Ga0207674_10059883 | Ga0207674_100598833 | 256 |
| 1148 | 3300026118 | Ga0207675_100000197 | Ga0207675_10000019747 | 256 |
| 1149 | 3300026142 | Ga0207698_10154207 | Ga0207698_101542072 | 256 |
| 1150 | 3300028379 | Ga0268266_10395652 | Ga0268266_103956522 | 256 |
| 1151 | 3300028380 | Ga0268265_10102978 | Ga0268265_101029782 | 256 |
| 1152 | 3300031548 | Ga0307408_100097461 | Ga0307408_1000974612 | 256 |
| 1153 | 3300031548 | Ga0307408_100206896 | Ga0307408_1002068962 | 256 |
| 1154 | 3300031731 | Ga0307405_10012109 | Ga0307405_100121092 | 256 |
| 1155 | 3300031824 | Ga0307413_10003779 | Ga0307413_100037799 | 256 |
| 1156 | 3300031824 | Ga0307413_10007348 | Ga0307413_100073484 | 256 |
| 1157 | 3300031852 | Ga0307410_10002673 | Ga0307410_100026735 | 256 |
| 1158 | 3300031852 | Ga0307410_10073357 | Ga0307410_100733572 | 256 |
| 1159 | 3300031901 | Ga0307406_10014255 | Ga0307406_100142553 | 256 |
| 1160 | 3300031901 | Ga0307406_10025477 | Ga0307406_100254771 | 256 |
| 1161 | 3300031903 | Ga0307407_10008351 | Ga0307407_100083514 | 256 |
| 1162 | 3300031911 | Ga0307412_10026618 | Ga0307412_100266182 | 256 |
| 1163 | 3300031911 | Ga0307412_10057573 | Ga0307412_100575731 | 256 |
| 1164 | 3300031995 | Ga0307409_100017868 | Ga0307409_1000178684 | 256 |
| 1165 | 3300031995 | Ga0307409_100036606 | Ga0307409_1000366062 | 256 |
| 1166 | 3300032002 | Ga0307416_100001346 | Ga0307416_10000134611 | 256 |
| 1167 | 3300032002 | Ga0307416_100007380 | Ga0307416_1000073804 | 256 |
| 1168 | 3300032004 | Ga0307414_10002078 | Ga0307414_100020787 | 256 |
| 1169 | 3300032005 | Ga0307411_10000581 | Ga0307411_1000058111 | 256 |
| 1170 | 3300032005 | Ga0307411_10069501 | Ga0307411_100695012 | 256 |
| 1171 | 3300032126 | Ga0307415_100050422 | Ga0307415_1000504222 | 256 |
| 1172 | 3300035692 | Ga0373935_0114251 | Ga0373935_0114251_982_1761 | 256 |
| 1173 | 3300035695 | Ga0373927_0016654 | Ga0373927_0016654_3239_4018 | 256 |
| 1174 | 3300037471 | Ga0395905_0038021 | Ga0395905_0038021_1285_2070 | 256 |
| 1175 | 3300037471 | Ga0395905_0656178 | Ga0395905_0656178_73_858 | 256 |
| 1176 | 3300039437 | Ga0436365_1243926 | Ga0436365_1243926_2736_3512 | 256 |
| 1177 | 3300042005 | Ga0439448_0079057 | Ga0439448_0079057_22_798 | 256 |
| 1178 | 3300042876 | Ga0451577_0030104 | Ga0451577_0030104_591_1379 | 256 |
| 1179 | 3300044694 | Ga0466963_0194703 | Ga0466963_0194703_39_815 | 256 |
| 1180 | 3300044712 | Ga0453684_0028563 | Ga0453684_0028563_6318_7106 | 256 |
| 1181 | 3300046472 | Ga0495580_0024389 | Ga0495580_0024389_3634_4413 | 256 |
| 1182 | 3300046499 | Ga0495594_0013448 | Ga0495594_0013448_3277_4056 | 256 |
| 1183 | 3300046517 | Ga0495630_0372006 | Ga0495630_0372006_40_819 | 256 |
| 1184 | 3300046535 | Ga0495586_0022426 | Ga0495586_0022426_255_1034 | 256 |
| 1185 | 3300046674 | Ga0495588_0179956 | Ga0495588_0179956_141_920 | 256 |
| 1186 | 3300048915 | Ga0496112_0457270 | Ga0496112_0457270_359_1138 | 256 |
| 1187 | 3300049568 | Ga0501031_0031047 | Ga0501031_0031047_1315_2100 | 256 |
| 1188 | 3300049575 | Ga0501039_0038893 | Ga0501039_0038893_767_1552 | 256 |
| 1189 | 3300049576 | Ga0501040_0253895 | Ga0501040_0253895_146_931 | 256 |
| 1190 | 3300049577 | Ga0501041_0180991 | Ga0501041_0180991_64_837 | 256 |
| 1191 | 3300049580 | Ga0501046_0199679 | Ga0501046_0199679_334_1119 | 256 |
| 1192 | 3300049580 | Ga0501046_0310223 | Ga0501046_0310223_259_1032 | 256 |
| 1193 | 3300049585 | Ga0501069_0324404 | Ga0501069_0324404_89_871 | 256 |
| 1194 | 3300049588 | Ga0501072_0132326 | Ga0501072_0132326_595_1368 | 256 |
| 1195 | 3300049591 | Ga0501075_0004754 | Ga0501075_0004754_4468_5253 | 256 |
| 1196 | 3300049592 | Ga0501076_0199529 | Ga0501076_0199529_395_1180 | 256 |
| 1197 | 3300049593 | Ga0501077_0025512 | Ga0501077_0025512_2710_3495 | 256 |
| 1198 | 3300049741 | Ga0501079_0149253 | Ga0501079_0149253_272_1057 | 256 |
| 1199 | 3300049744 | Ga0501083_0026838 | Ga0501083_0026838_2983_3768 | 256 |
| 1200 | 3300049765 | Ga0501268_004967 | Ga0501268_004967_1095_1880 | 256 |
| 1201 | 3300049824 | Ga0501045_0023179 | Ga0501045_0023179_1501_2286 | 256 |
| 1202 | 3300050507 | nmdc:mga05p37_19421_c1 | nmdc:mga05p37_19421_c1_578_1363 | 256 |
| 1203 | 3300050508 | nmdc:mga09592_3549_c1 | nmdc:mga09592_3549_c1_1509_2294 | 256 |
| 1204 | 3300050510 | nmdc:mga06r32_5005_c1 | nmdc:mga06r32_5005_c1_5497_6282 | 256 |
| 1205 | 3300050512 | nmdc:mga0n895_14834_c1 | nmdc:mga0n895_14834_c1_3884_4678 | 256 |
| 1206 | 3300050512 | nmdc:mga0n895_468062_c1 | nmdc:mga0n895_468062_c1_11_796 | 256 |
| 1207 | 3300050512 | nmdc:mga0n895_61534_c1 | nmdc:mga0n895_61534_c1_1822_2598 | 256 |
| 1208 | 3300050512 | nmdc:mga0n895_63991_c1 | nmdc:mga0n895_63991_c1_287_1072 | 256 |
| 1209 | 3300050513 | nmdc:mga0rr50_315618_c1 | nmdc:mga0rr50_315618_c1_460_1245 | 256 |
| 1210 | 3300050513 | nmdc:mga0rr50_48114_c1 | nmdc:mga0rr50_48114_c1_11_796 | 256 |
| 1211 | 3300050513 | nmdc:mga0rr50_562803_c1 | nmdc:mga0rr50_562803_c1_153_929 | 256 |
| 1212 | 3300050515 | nmdc:mga0a205_110082_c1 | nmdc:mga0a205_110082_c1_319_1113 | 256 |
| 1213 | 3300050515 | nmdc:mga0a205_14260_c1 | nmdc:mga0a205_14260_c1_6113_6889 | 256 |
| 1214 | 3300050515 | nmdc:mga0a205_23798_c1 | nmdc:mga0a205_23798_c1_11_796 | 256 |
| 1215 | 3300050515 | nmdc:mga0a205_26058_c1 | nmdc:mga0a205_26058_c1_3568_4353 | 256 |
| 1216 | 3300054114 | Ga0501084_0238060 | Ga0501084_0238060_420_1205 | 256 |
| 1217 | 3300005535 | Ga0070684_100353416 | Ga0070684_1003534162 | 257 |
| 1218 | 3300009553 | Ga0105249_10249384 | Ga0105249_102493842 | 257 |
| 1219 | 3300025961 | Ga0207712_10157785 | Ga0207712_101577852 | 257 |
| 1220 | 3300031548 | Ga0307408_100220320 | Ga0307408_1002203202 | 257 |
| 1221 | 3300046462 | Ga0495651_0090723 | Ga0495651_0090723_1448_2221 | 257 |
| 1222 | 3300046472 | Ga0495580_0162776 | Ga0495580_0162776_73_870 | 257 |
| 1223 | 3300046499 | Ga0495594_0026158 | Ga0495594_0026158_213_986 | 257 |
| 1224 | 3300046516 | Ga0495628_0081157 | Ga0495628_0081157_1656_2429 | 257 |
| 1225 | 3300046529 | Ga0495652_0074609 | Ga0495652_0074609_2012_2785 | 257 |
| 1226 | 3300046533 | Ga0495640_0142602 | Ga0495640_0142602_107_880 | 257 |
| 1227 | 3300046536 | Ga0495587_0051602 | Ga0495587_0051602_1580_2353 | 257 |
| 1228 | 3300046559 | Ga0495667_0105862 | Ga0495667_0105862_83_856 | 257 |
| 1229 | 3300046642 | Ga0495634_0069995 | Ga0495634_0069995_46_819 | 257 |
| 1230 | 3300047444 | Ga0495675_0192954 | Ga0495675_0192954_395_1168 | 257 |
| 1231 | 3300047471 | Ga0495684_0118463 | Ga0495684_0118463_1148_1921 | 257 |
| 1232 | 3300048088 | Ga0495602_0149486 | Ga0495602_0149486_68_841 | 257 |
| 1233 | 3300049571 | Ga0501034_0043443 | Ga0501034_0043443_2537_3310 | 257 |
| 1234 | 3300049572 | Ga0501036_0227478 | Ga0501036_0227478_505_1278 | 257 |
| 1235 | 3300049585 | Ga0501069_0038928 | Ga0501069_0038928_1556_2329 | 257 |
| 1236 | 3300049588 | Ga0501072_0012568 | Ga0501072_0012568_2282_3055 | 257 |
| 1237 | 3300049588 | Ga0501072_0442603 | Ga0501072_0442603_29_802 | 257 |
| 1238 | 3300049590 | Ga0501074_0162757 | Ga0501074_0162757_336_1109 | 257 |
| 1239 | 3300049742 | Ga0501080_0311000 | Ga0501080_0311000_314_1087 | 257 |
| 1240 | 3300049742 | Ga0501080_0356272 | Ga0501080_0356272_357_1130 | 257 |
| 1241 | 3300049743 | Ga0501081_0080724 | Ga0501081_0080724_672_1445 | 257 |
| 1242 | 3300060353 | Ga0501082_0500934 | Ga0501082_0500934_98_871 | 257 |
| 1243 | 3300005467 | Ga0070706_100268626 | Ga0070706_1002686262 | 259 |
| 1244 | 3300005471 | Ga0070698_100035975 | Ga0070698_1000359752 | 259 |
| 1245 | 3300025910 | Ga0207684_10040882 | Ga0207684_100408823 | 259 |
| 1246 | 3300025921 | Ga0207652_10004726 | Ga0207652_100047269 | 259 |
| 1247 | 3300031995 | Ga0307409_100265762 | Ga0307409_1002657622 | 259 |
| 1248 | 3300049582 | Ga0501048_0200132 | Ga0501048_0200132_502_1293 | 259 |
| 1249 | 3300003203 | JGI25406J46586_10005498 | JGI25406J46586_100054985 | 260 |
| 1250 | 3300005985 | Ga0081539_10000117 | Ga0081539_10000117117 | 260 |
| 1251 | 3300042156 | Ga0439446_0042563 | Ga0439446_0042563_23_853 | 260 |
| 1252 | 3300042435 | Ga0439434_0069709 | Ga0439434_0069709_247_1077 | 260 |
| 1253 | 3300046664 | Ga0495659_0026699 | Ga0495659_0026699_907_1695 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5awf-assembly1.cif.gz_D | crystal structure of sufb-sufc-sufd complex from escherichia coli | 0.9576 | 1 | 230 |
| 2zu0-assembly1.cif.gz_C | crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis | 0.9514 | 1 | 243 |
| 5awf-assembly1.cif.gz_D | crystal structure of sufb-sufc-sufd complex from escherichia coli | 0.9339 | 1 | 230 |
| 2zu0-assembly1.cif.gz_C | crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis | 0.9327 | 1 | 243 |
| 2d3w-assembly1.cif.gz_C | crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery | 0.9201 | 1 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZY7_2_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.963 | 2 | 247 | 3.40.50.300 |
| af_Q8ILW0_99_346_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9589 | 1 | 244 | 3.40.50.300 |
| af_Q8ILW0_99_346_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9401 | 1 | 244 | 3.40.50.300 |
| af_Q2FZY7_2_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9331 | 2 | 247 | 3.40.50.300 |
| af_Q60350_5_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9082 | 1 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382HLW2-F1-model_v4 | ABC transporter domain-containing protein | 0.9827 | 8 | 236 |
GO:0005524
GO:0016887 |
| AF-A0A537HGZ3-F1-model_v4 | Fe-S cluster assembly ATPase SufC | 0.9784 | 2 | 249 |
GO:0005524
GO:0016887 |
| AF-A0A200QTB1-F1-model_v4 | ABC transporter-like | 0.9773 | 1 | 245 |
GO:0005524
GO:0016887 |
| AF-A0A7X6GVV0-F1-model_v4 | deleted | 0.9754 | 1 | 247 |
|
| AF-A0A382HLW2-F1-model_v4 | ABC transporter domain-containing protein | 0.9743 | 8 | 236 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar