F492146

General Info

Members Datasets Scaffolds Average Seq Length
1247 408 1247 91

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100068443|Ga0075428_1000684435
Length 106
Sequence LREPQSGLCNLRNPMAVTVKIPTQLRSVTSGDAETAVDGATTVGEVLDGLYERYDGLRERIAEDGDLRRFVNVYVGGEDIRFLDGLDTEVEDGDEVTILPAVAGGS

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
196 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
253 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
258 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
259 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
260 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
261 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
368 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
369 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
398 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
399 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
403 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
408 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.81
Nodule 0
Rhizoplane 6.66
Rhizosphere 87.73
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01BPN70 2088090003 Bacteria 506
2 JGI24740J21852_10029359 3300001979 Bacteria 1806
3 JGI24737J22298_10019574 3300001990 Bacteria 2164
4 JGI24735J21928_10049785 3300002067 Bacteria 1210
5 JGI24034J26672_10003687 3300002239 Bacteria 2141
6 JGI24742J22300_10016165 3300002244 Bacteria 1258
7 JGI25407J50210_10002254 3300003373 Bacteria 4519
8 JGI25407J50210_10016283 3300003373 Bacteria 1925
9 JGI25407J50210_10040191 3300003373 Bacteria 1199
10 JGI25407J50210_10042331 3300003373 Bacteria 1165
11 JGI25407J50210_10148685 3300003373 Unclassified 577
12 JGI25407J50210_10155187 3300003373 Bacteria 564
13 JGI25407J50210_10158911 3300003373 Bacteria 556
14 JGI25407J50210_10175961 3300003373 Bacteria 527
15 JGI25404J52841_10130377 3300003659 Unclassified 531
16 Ga0070658_10065691 3300005327 Bacteria 2962
17 Ga0070658_11707452 3300005327 Bacteria 545
18 Ga0070676_10060656 3300005328 Bacteria 2247
19 Ga0070683_100022894 3300005329 Bacteria 5586
20 Ga0070683_100036000 3300005329 Bacteria 4528
21 Ga0070683_100070215 3300005329 Bacteria 3267
22 Ga0070683_100632014 3300005329 Bacteria 1025
23 Ga0070683_101236410 3300005329 Bacteria 718
24 Ga0070683_101695435 3300005329 Bacteria 608
25 Ga0070690_101294809 3300005330 Bacteria 584
26 Ga0070690_101781614 3300005330 Bacteria 502
27 Ga0070670_100700478 3300005331 Bacteria 911
28 Ga0068869_100904279 3300005334 Bacteria 764
29 Ga0068869_101023048 3300005334 Bacteria 720
30 Ga0070680_100003235 3300005336 Bacteria 12123
31 Ga0070680_101724910 3300005336 Bacteria 543
32 Ga0070680_101755220 3300005336 Bacteria 538
33 Ga0070682_100392758 3300005337 Bacteria 1047
34 Ga0070682_101051562 3300005337 Bacteria 679
35 Ga0070682_101139933 3300005337 Bacteria 655
36 Ga0070682_101911320 3300005337 Bacteria 520
37 Ga0068868_101273691 3300005338 Bacteria 682
38 Ga0068868_101716420 3300005338 Bacteria 592
39 Ga0068868_102111166 3300005338 Bacteria 536
40 Ga0070660_100086390 3300005339 Bacteria 2468
41 Ga0070660_101025008 3300005339 Bacteria 698
42 Ga0070689_100599406 3300005340 Bacteria 954
43 Ga0070691_10202242 3300005341 Bacteria 1044
44 Ga0070691_10259332 3300005341 Bacteria 935
45 Ga0070661_100183762 3300005344 Bacteria 1592
46 Ga0070692_10108688 3300005345 Bacteria 1531
47 Ga0070692_11119985 3300005345 Bacteria 557
48 Ga0070692_11138936 3300005345 Bacteria 553
49 Ga0070668_100035270 3300005347 Bacteria 3814
50 Ga0070668_100171844 3300005347 Bacteria 1765
51 Ga0070668_100220943 3300005347 Bacteria 1563
52 Ga0070668_100704034 3300005347 Bacteria 891
53 Ga0070668_100753757 3300005347 Bacteria 862
54 Ga0070668_102026876 3300005347 Bacteria 531
55 Ga0070669_100214154 3300005353 Bacteria 1521
56 Ga0070675_100140528 3300005354 Bacteria 2064
57 Ga0070671_100404361 3300005355 Bacteria 1168
58 Ga0070674_100247049 3300005356 Bacteria 1400
59 Ga0070659_100000052 3300005366 Bacteria 96862
60 Ga0070659_100001769 3300005366 Bacteria 15519
61 Ga0070659_100036169 3300005366 Bacteria 3848
62 Ga0070659_100703598 3300005366 Bacteria 874
63 Ga0070659_101627298 3300005366 Bacteria 577
64 Ga0070667_101523443 3300005367 Bacteria 628
65 Ga0070714_100001337 3300005435 Bacteria 17795
66 Ga0070714_100247677 3300005435 Bacteria 1647
67 Ga0070714_100547345 3300005435 Bacteria 1108
68 Ga0070714_100721507 3300005435 Bacteria 963
69 Ga0070713_100384333 3300005436 Bacteria 1308
70 Ga0070713_100556350 3300005436 Bacteria 1086
71 Ga0070713_100677482 3300005436 Bacteria 983
72 Ga0070710_10000004 3300005437 Bacteria 270399
73 Ga0070710_10177940 3300005437 Bacteria 1330
74 Ga0070701_11134311 3300005438 Bacteria 552
75 Ga0070711_100055054 3300005439 Bacteria 2747
76 Ga0070711_100283925 3300005439 Bacteria 1311
77 Ga0070705_100005534 3300005440 Bacteria 6161
78 Ga0070705_100590518 3300005440 Bacteria 858
79 Ga0070700_100166414 3300005441 Bacteria 1523
80 Ga0070700_101138623 3300005441 Bacteria 649
81 Ga0070700_101438526 3300005441 Bacteria 584
82 Ga0070700_101859525 3300005441 Bacteria 520
83 Ga0070694_101187572 3300005444 Bacteria 639
84 Ga0070708_101064600 3300005445 Bacteria 758
85 Ga0070663_101109259 3300005455 Bacteria 692
86 Ga0070663_101133463 3300005455 Bacteria 685
87 Ga0070662_100025882 3300005457 Bacteria 4056
88 Ga0070662_100858756 3300005457 Bacteria 773
89 Ga0070681_10013391 3300005458 Bacteria 8148
90 Ga0070681_10081595 3300005458 Bacteria 3190
91 Ga0070681_10148842 3300005458 Bacteria 2269
92 Ga0070681_10526926 3300005458 Bacteria 1095
93 Ga0070681_10596429 3300005458 Bacteria 1019
94 Ga0068867_100141551 3300005459 Bacteria 1880
95 Ga0068867_100400410 3300005459 Bacteria 1157
96 Ga0068867_100753460 3300005459 Bacteria 864
97 Ga0068867_100884259 3300005459 Bacteria 803
98 Ga0068867_101493881 3300005459 Bacteria 629
99 Ga0070685_10276726 3300005466 Bacteria 1122
100 Ga0070706_100974963 3300005467 Bacteria 782
101 Ga0070698_101322624 3300005471 Bacteria 671
102 Ga0070699_101219516 3300005518 Bacteria 690
103 Ga0070679_100014554 3300005530 Bacteria 7558
104 Ga0070679_100023402 3300005530 Bacteria 6046
105 Ga0070679_100079902 3300005530 Bacteria 3260
106 Ga0070679_100103485 3300005530 Bacteria 2833
107 Ga0070679_100167247 3300005530 Bacteria 2172
108 Ga0070684_100042488 3300005535 Bacteria 3924
109 Ga0070684_100177969 3300005535 Bacteria 1933
110 Ga0070684_100384564 3300005535 Bacteria 1293
111 Ga0070684_100385174 3300005535 Bacteria 1292
112 Ga0070684_100955401 3300005535 Bacteria 804
113 Ga0070684_101494628 3300005535 Bacteria 636
114 Ga0068853_100468020 3300005539 Bacteria 1187
115 Ga0070672_100389896 3300005543 Bacteria 1193
116 Ga0070686_100542115 3300005544 Bacteria 909
117 Ga0070686_100757840 3300005544 Bacteria 779
118 Ga0070686_101020987 3300005544 Bacteria 679
119 Ga0070686_101867847 3300005544 Bacteria 512
120 Ga0070695_100313601 3300005545 Bacteria 1163
121 Ga0070696_100129375 3300005546 Bacteria 1836
122 Ga0070696_100703652 3300005546 Bacteria 824
123 Ga0070696_101013526 3300005546 Bacteria 694
124 Ga0070693_100188745 3300005547 Bacteria 1332
125 Ga0070693_101659354 3300005547 Bacteria 503
126 Ga0070665_100002098 3300005548 Bacteria 22331
127 Ga0070704_100062477 3300005549 Bacteria 2670
128 Ga0070704_100123583 3300005549 Bacteria 1993
129 Ga0070704_100216168 3300005549 Bacteria 1556
130 Ga0070704_100389134 3300005549 Bacteria 1187
131 Ga0070704_100772195 3300005549 Bacteria 857
132 Ga0070704_101346754 3300005549 Bacteria 654
133 Ga0068855_100831070 3300005563 Unclassified 980
134 Ga0070664_100068242 3300005564 Bacteria 3040
135 Ga0070664_100079237 3300005564 Bacteria 2827
136 Ga0070664_100533011 3300005564 Bacteria 1085
137 Ga0070664_101095571 3300005564 Bacteria 750
138 Ga0070664_102194499 3300005564 Bacteria 524
139 Ga0068857_100174736 3300005577 Bacteria 1953
140 Ga0068857_101599755 3300005577 Bacteria 636
141 Ga0068857_101647772 3300005577 Bacteria 627
142 Ga0068854_100102148 3300005578 Bacteria 2151
143 Ga0068854_100166704 3300005578 Bacteria 1711
144 Ga0068854_100777388 3300005578 Bacteria 833
145 Ga0068854_101016308 3300005578 Bacteria 735
146 Ga0068854_101253451 3300005578 Bacteria 666
147 Ga0068856_100013529 3300005614 Bacteria 7897
148 Ga0068856_102125987 3300005614 Bacteria 571
149 Ga0070702_100189938 3300005615 Bacteria 1351
150 Ga0068852_100011744 3300005616 Bacteria 6613
151 Ga0068852_101599261 3300005616 Bacteria 674
152 Ga0068852_102361695 3300005616 Bacteria 552
153 Ga0068852_102581169 3300005616 Bacteria 528
154 Ga0068859_101033608 3300005617 Bacteria 903
155 Ga0068859_101614833 3300005617 Bacteria 716
156 Ga0068864_101128529 3300005618 Bacteria 781
157 Ga0068864_101425917 3300005618 Bacteria 695
158 Ga0068866_10000008 3300005718 Bacteria 117658
159 Ga0068866_10101494 3300005718 Bacteria 1588
160 Ga0068866_10624164 3300005718 Bacteria 731
161 Ga0068861_100009531 3300005719 Bacteria 6709
162 Ga0068861_100240266 3300005719 Bacteria 1540
163 Ga0068861_100548577 3300005719 Bacteria 1053
164 Ga0068851_10972812 3300005834 Bacteria 534
165 Ga0068863_101029286 3300005841 Bacteria 827
166 Ga0068858_101633421 3300005842 Unclassified 636
167 Ga0068860_102137408 3300005843 Bacteria 581
168 Ga0068862_101131957 3300005844 Bacteria 779
169 Ga0068862_101576972 3300005844 Bacteria 663
170 Ga0068862_101976663 3300005844 Bacteria 594
171 Ga0081455_10053723 3300005937 Bacteria 3440
172 Ga0081455_10111002 3300005937 Bacteria 2179
173 Ga0081538_10000020 3300005981 Bacteria 139567
174 Ga0081538_10000316 3300005981 Bacteria 55223
175 Ga0081538_10000486 3300005981 Bacteria 44589
176 Ga0081538_10000526 3300005981 Bacteria 42457
177 Ga0081538_10000796 3300005981 Bacteria 34251
178 Ga0081538_10006314 3300005981 Bacteria 10468
179 Ga0081538_10008324 3300005981 Bacteria 8829
180 Ga0081538_10009245 3300005981 Bacteria 8254
181 Ga0081538_10016481 3300005981 Bacteria 5661
182 Ga0081538_10023958 3300005981 Bacteria 4366
183 Ga0081538_10030544 3300005981 Bacteria 3655
184 Ga0081538_10030794 3300005981 Bacteria 3634
185 Ga0081538_10045609 3300005981 Bacteria 2715
186 Ga0081538_10133014 3300005981 Bacteria 1164
187 Ga0081538_10234719 3300005981 Bacteria 713
188 Ga0081538_10302301 3300005981 Bacteria 587
189 Ga0081538_10342458 3300005981 Bacteria 542
190 Ga0081538_10361788 3300005981 Bacteria 524
191 Ga0081540_1000100 3300005983 Bacteria 91640
192 Ga0081540_1000366 3300005983 Bacteria 45428
193 Ga0081540_1091037 3300005983 Bacteria 1341
194 Ga0081540_1340535 3300005983 Bacteria 513
195 Ga0081539_10105485 3300005985 Bacteria 1428
196 Ga0070717_10000019 3300006028 Bacteria 178051
197 Ga0070717_10109701 3300006028 Bacteria 2352
198 Ga0070717_11157562 3300006028 Bacteria 704
199 Ga0070717_11468368 3300006028 Bacteria 619
200 Ga0075365_10018720 3300006038 Bacteria 4264
201 Ga0075365_10053076 3300006038 Bacteria 2684
202 Ga0075365_10216648 3300006038 Bacteria 1343
203 Ga0075365_10276879 3300006038 Bacteria 1180
204 Ga0075365_10351272 3300006038 Bacteria 1039
205 Ga0075365_10697437 3300006038 Bacteria 717
206 Ga0075365_10777700 3300006038 Bacteria 676
207 Ga0075365_10827540 3300006038 Bacteria 653
208 Ga0075363_100045544 3300006048 Bacteria 2326
209 Ga0075363_100592830 3300006048 Bacteria 663
210 Ga0075363_100801474 3300006048 Bacteria 573
211 Ga0075363_100882187 3300006048 Bacteria 547
212 Ga0075364_10108190 3300006051 Bacteria 1854
213 Ga0075364_10216601 3300006051 Bacteria 1299
214 Ga0070715_10000021 3300006163 Bacteria 119283
215 Ga0070715_10102751 3300006163 Bacteria 1336
216 Ga0070716_100328989 3300006173 Bacteria 1074
217 Ga0070712_100000004 3300006175 Bacteria 215464
218 Ga0070712_100035657 3300006175 Bacteria 3377
219 Ga0070712_101236984 3300006175 Bacteria 650
220 Ga0075367_10729014 3300006178 Bacteria 631
221 Ga0075428_100068443 3300006844 Bacteria 3884
222 Ga0075428_100145532 3300006844 Bacteria 2575
223 Ga0075428_100270136 3300006844 Bacteria 1830
224 Ga0075428_100587610 3300006844 Bacteria 1190
225 Ga0075428_100928243 3300006844 Bacteria 923
226 Ga0075428_101726401 3300006844 Bacteria 653
227 Ga0075428_101976211 3300006844 Bacteria 605
228 Ga0075430_100002367 3300006846 Bacteria 15665
229 Ga0075430_100010271 3300006846 Bacteria 7927
230 Ga0075430_100082658 3300006846 Bacteria 2691
231 Ga0075430_100102046 3300006846 Bacteria 2395
232 Ga0075430_100102063 3300006846 Bacteria 2394
233 Ga0075430_100128027 3300006846 Bacteria 2117
234 Ga0075430_100182410 3300006846 Bacteria 1746
235 Ga0075430_100236941 3300006846 Bacteria 1512
236 Ga0075430_100627388 3300006846 Bacteria 887
237 Ga0075431_100008439 3300006847 Bacteria 10315
238 Ga0075431_100023074 3300006847 Bacteria 6362
239 Ga0075431_100034536 3300006847 Bacteria 5209
240 Ga0075431_100277815 3300006847 Bacteria 1696
241 Ga0075431_100617676 3300006847 Bacteria 1067
242 Ga0075431_101344468 3300006847 Bacteria 675
243 Ga0075431_101421403 3300006847 Bacteria 653
244 Ga0075433_10004260 3300006852 Bacteria 11112
245 Ga0075433_10029521 3300006852 Bacteria 4673
246 Ga0075433_10884530 3300006852 Bacteria 779
247 Ga0075434_100003126 3300006871 Bacteria 14752
248 Ga0075434_100204106 3300006871 Bacteria 1997
249 Ga0075434_101570376 3300006871 Bacteria 667
250 Ga0075429_100028882 3300006880 Bacteria 4817
251 Ga0075429_100029685 3300006880 Bacteria 4750
252 Ga0075429_100069921 3300006880 Bacteria 3056
253 Ga0075429_100073181 3300006880 Bacteria 2985
254 Ga0075429_100272994 3300006880 Bacteria 1481
255 Ga0068865_100069738 3300006881 Bacteria 2489
256 Ga0068865_101881500 3300006881 Bacteria 542
257 Ga0068865_102079943 3300006881 Bacteria 516
258 Ga0068865_102114646 3300006881 Bacteria 512
259 Ga0075436_101212156 3300006914 Bacteria 570
260 Ga0097620_101033598 3300006931 Bacteria 903
261 Ga0097620_101614903 3300006931 Bacteria 716
262 Ga0075435_101186219 3300007076 Bacteria 668
263 Ga0105240_10006899 3300009093 Bacteria 16596
264 Ga0105240_10042151 3300009093 Bacteria 5819
265 Ga0105240_10893013 3300009093 Bacteria 957
266 Ga0105240_12262726 3300009093 Bacteria 563
267 Ga0105240_12599976 3300009093 Bacteria 523
268 Ga0111539_10127738 3300009094 Bacteria 2978
269 Ga0111539_10172182 3300009094 Bacteria 2529
270 Ga0111539_10188911 3300009094 Bacteria 2404
271 Ga0111539_10373319 3300009094 Bacteria 1660
272 Ga0111539_10702719 3300009094 Bacteria 1177
273 Ga0111539_10843792 3300009094 Bacteria 1066
274 Ga0111539_10966187 3300009094 Bacteria 990
275 Ga0111539_11231261 3300009094 Bacteria 869
276 Ga0111539_11272681 3300009094 Bacteria 854
277 Ga0111539_11760825 3300009094 Bacteria 718
278 Ga0111539_11858587 3300009094 Bacteria 698
279 Ga0111539_11903395 3300009094 Bacteria 690
280 Ga0111539_11910599 3300009094 Bacteria 688
281 Ga0111539_12577307 3300009094 Bacteria 590
282 Ga0111539_12989619 3300009094 Bacteria 546
283 Ga0105245_10039550 3300009098 Bacteria 4198
284 Ga0105245_10041413 3300009098 Bacteria 4106
285 Ga0105245_10196901 3300009098 Bacteria 1933
286 Ga0105245_10207973 3300009098 Bacteria 1882
287 Ga0105245_10373026 3300009098 Bacteria 1419
288 Ga0105245_10445572 3300009098 Bacteria 1302
289 Ga0105245_10553621 3300009098 Bacteria 1172
290 Ga0105245_10843931 3300009098 Bacteria 956
291 Ga0105245_11443252 3300009098 Bacteria 738
292 Ga0105245_11591461 3300009098 Bacteria 705
293 Ga0105245_11784443 3300009098 Bacteria 668
294 Ga0105247_10001706 3300009101 Bacteria 15492
295 Ga0105247_11542917 3300009101 Bacteria 543
296 Ga0114129_10001353 3300009147 Bacteria 32898
297 Ga0114129_10001766 3300009147 Bacteria 29481
298 Ga0114129_10012393 3300009147 Bacteria 12136
299 Ga0114129_10032936 3300009147 Bacteria 7323
300 Ga0114129_10085014 3300009147 Bacteria 4390
301 Ga0114129_10186493 3300009147 Bacteria 2819
302 Ga0114129_10196371 3300009147 Bacteria 2736
303 Ga0114129_10238029 3300009147 Bacteria 2448
304 Ga0114129_10654996 3300009147 Bacteria 1355
305 Ga0114129_10706759 3300009147 Bacteria 1295
306 Ga0114129_10728118 3300009147 Bacteria 1272
307 Ga0114129_10890314 3300009147 Bacteria 1129
308 Ga0114129_10939175 3300009147 Bacteria 1093
309 Ga0114129_11099713 3300009147 Bacteria 995
310 Ga0114129_11161126 3300009147 Bacteria 964
311 Ga0114129_13251609 3300009147 Bacteria 527
312 Ga0105243_10096657 3300009148 Bacteria 2444
313 Ga0105243_10137382 3300009148 Bacteria 2081
314 Ga0105243_10756102 3300009148 Bacteria 953
315 Ga0105243_11099009 3300009148 Bacteria 803
316 Ga0105243_11358251 3300009148 Bacteria 730
317 Ga0105243_11591693 3300009148 Bacteria 680
318 Ga0105243_11966964 3300009148 Bacteria 618
319 Ga0105241_11235511 3300009174 Bacteria 709
320 Ga0105241_11715307 3300009174 Bacteria 611
321 Ga0105242_10478061 3300009176 Bacteria 1180
322 Ga0105242_10730563 3300009176 Bacteria 972
323 Ga0105242_11046578 3300009176 Bacteria 827
324 Ga0105242_11489099 3300009176 Bacteria 707
325 Ga0105242_11946905 3300009176 Bacteria 629
326 Ga0105242_12412313 3300009176 Bacteria 573
327 Ga0105248_10466985 3300009177 Bacteria 1422
328 Ga0105248_10558717 3300009177 Bacteria 1291
329 Ga0105237_10486964 3300009545 Bacteria 1240
330 Ga0105237_12675576 3300009545 Bacteria 510
331 Ga0105238_10000055 3300009551 Bacteria 139232
332 Ga0105238_10006420 3300009551 Bacteria 11698
333 Ga0105238_10622579 3300009551 Bacteria 1088
334 Ga0105238_13019884 3300009551 Bacteria 505
335 Ga0105249_10007747 3300009553 Bacteria 9358
336 Ga0105249_10163914 3300009553 Bacteria 2150
337 Ga0105249_10427712 3300009553 Bacteria 1359
338 Ga0105249_10463430 3300009553 Bacteria 1308
339 Ga0105249_11319800 3300009553 Bacteria 793
340 Ga0105249_11690394 3300009553 Bacteria 705
341 Ga0105249_12188160 3300009553 Bacteria 626
342 Ga0105239_10069246 3300010375 Bacteria 3877
343 Ga0105239_11323342 3300010375 Unclassified 831
344 Ga0105239_12271096 3300010375 Bacteria 631
345 Ga0105239_12618169 3300010375 Bacteria 588
346 Ga0105246_10032024 3300011119 Bacteria 3484
347 Ga0105246_10272909 3300011119 Bacteria 1353
348 Ga0105246_10615190 3300011119 Bacteria 941
349 Ga0105246_11474831 3300011119 Bacteria 638
350 Ga0157313_1036071 3300012503 Bacteria 586
351 Ga0157373_10946615 3300013100 Bacteria 641
352 Ga0157373_11020722 3300013100 Bacteria 618
353 Ga0157371_10038032 3300013102 Bacteria 3444
354 Ga0157371_10535397 3300013102 Bacteria 867
355 Ga0157371_11049536 3300013102 Bacteria 623
356 Ga0157370_10006818 3300013104 Bacteria 12519
357 Ga0157370_10009424 3300013104 Bacteria 10435
358 Ga0157369_10083922 3300013105 Bacteria 3406
359 Ga0157369_10812174 3300013105 Bacteria 961
360 Ga0157369_12202112 3300013105 Bacteria 559
361 Ga0157374_10000486 3300013296 Bacteria 35981
362 Ga0157374_11384739 3300013296 Bacteria 726
363 Ga0157378_10911306 3300013297 Bacteria 910
364 Ga0157378_11154143 3300013297 Bacteria 813
365 Ga0163162_10774214 3300013306 Bacteria 1078
366 Ga0163162_13112011 3300013306 Bacteria 533
367 Ga0157372_10158948 3300013307 Bacteria 2611
368 Ga0157372_10209146 3300013307 Bacteria 2261
369 Ga0157372_10277387 3300013307 Bacteria 1949
370 Ga0157372_11889407 3300013307 Bacteria 686
371 Ga0157372_12121916 3300013307 Bacteria 646
372 Ga0157372_12209078 3300013307 Bacteria 632
373 Ga0157372_12343478 3300013307 Bacteria 613
374 Ga0157375_10143923 3300013308 Bacteria 2513
375 Ga0157375_10577319 3300013308 Bacteria 1285
376 Ga0157375_11667078 3300013308 Bacteria 755
377 Ga0163163_10066394 3300014325 Bacteria 3583
378 Ga0163163_10114974 3300014325 Bacteria 2722
379 Ga0163163_10324123 3300014325 Bacteria 1594
380 Ga0163163_11106650 3300014325 Bacteria 855
381 Ga0157380_10078364 3300014326 Bacteria 2695
382 Ga0157380_10361377 3300014326 Bacteria 1362
383 Ga0157380_10713761 3300014326 Bacteria 1009
384 Ga0157380_10922074 3300014326 Bacteria 901
385 Ga0157379_11082006 3300014968 Bacteria 767
386 Ga0157379_12249395 3300014968 Bacteria 542
387 Ga0163161_10893499 3300017792 Bacteria 752
388 Ga0163161_10895310 3300017792 Bacteria 751
389 Ga0197907_10398747 3300020069 Unclassified 559
390 Ga0197907_10447489 3300020069 Unclassified 702
391 Ga0197907_11459507 3300020069 Bacteria 741
392 Ga0206356_10263124 3300020070 Bacteria 1207
393 Ga0206356_10616121 3300020070 Bacteria 2303
394 Ga0206356_10692343 3300020070 Bacteria 534
395 Ga0206349_1457925 3300020075 Bacteria 1711
396 Ga0206352_11075035 3300020078 Unclassified 573
397 Ga0206350_11381714 3300020080 Bacteria 982
398 Ga0206354_10119565 3300020081 Bacteria 621
399 Ga0206354_10271309 3300020081 Bacteria 1647
400 Ga0206354_10296703 3300020081 Bacteria 1464
401 Ga0206353_10202888 3300020082 Bacteria 1020
402 Ga0206353_11680112 3300020082 Bacteria 3854
403 Ga0206353_11886593 3300020082 Bacteria 534
404 Ga0213873_10092166 3300021358 Bacteria 862
405 Ga0213873_10107793 3300021358 Bacteria 807
406 Ga0213874_10002224 3300021377 Bacteria 4131
407 Ga0213876_10055763 3300021384 Bacteria 2086
408 Ga0213876_10130484 3300021384 Bacteria 1336
409 Ga0213876_10378840 3300021384 Bacteria 752
410 Ga0213875_10009523 3300021388 Bacteria 4920
411 Ga0213875_10396594 3300021388 Bacteria 658
412 Ga0224712_10645480 3300022467 Unclassified 519
413 Ga0207692_10000002 3300025898 Bacteria 453100
414 Ga0207692_10042051 3300025898 Bacteria 2266
415 Ga0207692_10943789 3300025898 Bacteria 568
416 Ga0207642_10000002 3300025899 Bacteria 658166
417 Ga0207642_10043149 3300025899 Bacteria 1987
418 Ga0207642_10121232 3300025899 Bacteria 1349
419 Ga0207710_10000157 3300025900 Bacteria 72764
420 Ga0207688_10121473 3300025901 Bacteria 1525
421 Ga0207688_10500477 3300025901 Bacteria 761
422 Ga0207688_10629848 3300025901 Bacteria 677
423 Ga0207680_11008429 3300025903 Bacteria 596
424 Ga0207647_10094814 3300025904 Bacteria 1777
425 Ga0207685_10000054 3300025905 Bacteria 35900
426 Ga0207685_10101261 3300025905 Bacteria 1232
427 Ga0207643_10280706 3300025908 Bacteria 1033
428 Ga0207643_10317187 3300025908 Bacteria 973
429 Ga0207705_10092413 3300025909 Bacteria 2217
430 Ga0207705_10224427 3300025909 Bacteria 1428
431 Ga0207705_10366792 3300025909 Bacteria 1111
432 Ga0207684_10493448 3300025910 Bacteria 1050
433 Ga0207684_11522468 3300025910 Bacteria 544
434 Ga0207707_10082264 3300025912 Bacteria 2811
435 Ga0207707_10105365 3300025912 Bacteria 2465
436 Ga0207707_10252943 3300025912 Bacteria 1530
437 Ga0207707_10439286 3300025912 Bacteria 1117
438 Ga0207707_10978503 3300025912 Bacteria 695
439 Ga0207695_10656539 3300025913 Unclassified 930
440 Ga0207671_10073401 3300025914 Bacteria 2555
441 Ga0207693_10000017 3300025915 Bacteria 139308
442 Ga0207693_10007317 3300025915 Bacteria 9081
443 Ga0207693_10209570 3300025915 Bacteria 1532
444 Ga0207663_10041078 3300025916 Bacteria 2816
445 Ga0207663_10087499 3300025916 Bacteria 2057
446 Ga0207663_10174848 3300025916 Bacteria 1528
447 Ga0207660_10013331 3300025917 Bacteria 5386
448 Ga0207660_10908409 3300025917 Bacteria 718
449 Ga0207657_10015215 3300025919 Bacteria 7463
450 Ga0207657_10024542 3300025919 Bacteria 5576
451 Ga0207657_10032447 3300025919 Bacteria 4718
452 Ga0207657_10264666 3300025919 Bacteria 1368
453 Ga0207657_10399266 3300025919 Bacteria 1081
454 Ga0207657_11423809 3300025919 Bacteria 520
455 Ga0207649_10605926 3300025920 Bacteria 843
456 Ga0207649_11341161 3300025920 Bacteria 566
457 Ga0207652_10001733 3300025921 Bacteria 19037
458 Ga0207652_10210612 3300025921 Bacteria 1750
459 Ga0207652_10537574 3300025921 Bacteria 1051
460 Ga0207652_11087242 3300025921 Bacteria 700
461 Ga0207652_11222040 3300025921 Bacteria 653
462 Ga0207681_10500747 3300025923 Bacteria 994
463 Ga0207681_10560909 3300025923 Bacteria 941
464 Ga0207694_10000063 3300025924 Bacteria 139700
465 Ga0207694_10052034 3300025924 Bacteria 3175
466 Ga0207650_10532676 3300025925 Bacteria 984
467 Ga0207659_10563877 3300025926 Bacteria 969
468 Ga0207659_11515994 3300025926 Bacteria 573
469 Ga0207687_10233819 3300025927 Bacteria 1453
470 Ga0207687_10303265 3300025927 Bacteria 1287
471 Ga0207687_10392946 3300025927 Bacteria 1139
472 Ga0207687_10541847 3300025927 Bacteria 975
473 Ga0207687_10701670 3300025927 Bacteria 859
474 Ga0207687_11042530 3300025927 Bacteria 702
475 Ga0207687_11112135 3300025927 Bacteria 679
476 Ga0207687_11340627 3300025927 Bacteria 615
477 Ga0207700_10305807 3300025928 Bacteria 1374
478 Ga0207700_10819662 3300025928 Bacteria 832
479 Ga0207700_10950900 3300025928 Bacteria 769
480 Ga0207664_10000004 3300025929 Bacteria 493014
481 Ga0207664_10001287 3300025929 Bacteria 16542
482 Ga0207664_10099009 3300025929 Bacteria 2405
483 Ga0207664_10273872 3300025929 Bacteria 1479
484 Ga0207664_10364503 3300025929 Bacteria 1281
485 Ga0207664_11121557 3300025929 Bacteria 703
486 Ga0207664_11153924 3300025929 Bacteria 692
487 Ga0207664_11445807 3300025929 Bacteria 609
488 Ga0207644_10883543 3300025931 Bacteria 749
489 Ga0207690_10000061 3300025932 Bacteria 98910
490 Ga0207690_10033640 3300025932 Bacteria 3297
491 Ga0207690_10053568 3300025932 Bacteria 2708
492 Ga0207690_10303568 3300025932 Bacteria 1250
493 Ga0207706_10029017 3300025933 Bacteria 4940
494 Ga0207706_10074324 3300025933 Bacteria 2989
495 Ga0207706_10765319 3300025933 Bacteria 822
496 Ga0207706_11714284 3300025933 Bacteria 505
497 Ga0207709_10223893 3300025935 Bacteria 1358
498 Ga0207709_10344509 3300025935 Bacteria 1123
499 Ga0207709_10487667 3300025935 Bacteria 959
500 Ga0207709_10529460 3300025935 Bacteria 924
501 Ga0207709_10747884 3300025935 Bacteria 786
502 Ga0207709_10818772 3300025935 Bacteria 752
503 Ga0207709_10939249 3300025935 Bacteria 704
504 Ga0207669_10000026 3300025937 Bacteria 92199
505 Ga0207669_10329366 3300025937 Bacteria 1172
506 Ga0207669_10541818 3300025937 Bacteria 938
507 Ga0207669_11412101 3300025937 Bacteria 593
508 Ga0207669_11441183 3300025937 Bacteria 587
509 Ga0207704_10681243 3300025938 Bacteria 849
510 Ga0207665_10199493 3300025939 Bacteria 1457
511 Ga0207691_10454496 3300025940 Bacteria 1090
512 Ga0207711_10282404 3300025941 Bacteria 1529
513 Ga0207661_10004460 3300025944 Bacteria 9836
514 Ga0207661_10022742 3300025944 Bacteria 4726
515 Ga0207661_10027597 3300025944 Bacteria 4338
516 Ga0207661_10039531 3300025944 Bacteria 3702
517 Ga0207661_10260278 3300025944 Bacteria 1545
518 Ga0207661_10261300 3300025944 Bacteria 1542
519 Ga0207661_10319698 3300025944 Bacteria 1395
520 Ga0207661_10579153 3300025944 Bacteria 1029
521 Ga0207661_10582912 3300025944 Bacteria 1026
522 Ga0207661_10669324 3300025944 Bacteria 954
523 Ga0207661_10846102 3300025944 Bacteria 842
524 Ga0207679_10115413 3300025945 Bacteria 2127
525 Ga0207679_10195241 3300025945 Bacteria 1686
526 Ga0207679_10506525 3300025945 Bacteria 1078
527 Ga0207679_10568413 3300025945 Bacteria 1019
528 Ga0207667_11012643 3300025949 Bacteria 817
529 Ga0207712_10258064 3300025961 Bacteria 1412
530 Ga0207712_10596394 3300025961 Bacteria 955
531 Ga0207712_11067052 3300025961 Bacteria 718
532 Ga0207668_10022893 3300025972 Bacteria 4006
533 Ga0207668_10345064 3300025972 Bacteria 1243
534 Ga0207668_10482316 3300025972 Bacteria 1064
535 Ga0207668_10592328 3300025972 Bacteria 965
536 Ga0207668_10638540 3300025972 Bacteria 931
537 Ga0207668_11447689 3300025972 Bacteria 620
538 Ga0207640_10021426 3300025981 Bacteria 3851
539 Ga0207640_10160319 3300025981 Bacteria 1663
540 Ga0207640_10219958 3300025981 Bacteria 1453
541 Ga0207658_10243740 3300025986 Bacteria 1524
542 Ga0207658_11288330 3300025986 Bacteria 668
543 Ga0207677_10203954 3300026023 Bacteria 1574
544 Ga0207677_11043414 3300026023 Bacteria 743
545 Ga0207677_11708302 3300026023 Bacteria 584
546 Ga0207677_12068366 3300026023 Unclassified 529
547 Ga0207677_12160282 3300026023 Bacteria 518
548 Ga0207703_11781195 3300026035 Unclassified 592
549 Ga0207639_10418044 3300026041 Bacteria 1211
550 Ga0207678_10350887 3300026067 Bacteria 1272
551 Ga0207678_11477093 3300026067 Bacteria 600
552 Ga0207708_10015960 3300026075 Bacteria 5640
553 Ga0207708_10074867 3300026075 Bacteria 2595
554 Ga0207708_10196641 3300026075 Bacteria 1607
555 Ga0207708_10664741 3300026075 Bacteria 888
556 Ga0207708_11062449 3300026075 Bacteria 705
557 Ga0207708_11123585 3300026075 Bacteria 686
558 Ga0207708_11907667 3300026075 Bacteria 521
559 Ga0207702_10069999 3300026078 Bacteria 3017
560 Ga0207702_10165843 3300026078 Bacteria 2021
561 Ga0207702_11458584 3300026078 Bacteria 678
562 Ga0207641_11565609 3300026088 Bacteria 661
563 Ga0207648_10095280 3300026089 Bacteria 2603
564 Ga0207648_10153544 3300026089 Bacteria 2032
565 Ga0207676_10528689 3300026095 Bacteria 1124
566 Ga0207676_12405291 3300026095 Bacteria 524
567 Ga0207674_10060651 3300026116 Bacteria 3824
568 Ga0207674_10288656 3300026116 Bacteria 1589
569 Ga0207674_10771155 3300026116 Bacteria 928
570 Ga0207675_100006700 3300026118 Bacteria 10889
571 Ga0207675_100197006 3300026118 Bacteria 1934
572 Ga0207675_100592470 3300026118 Bacteria 1111
573 Ga0207675_101353004 3300026118 Bacteria 733
574 Ga0207675_102317010 3300026118 Bacteria 550
575 Ga0207683_10524544 3300026121 Bacteria 1095
576 Ga0207683_11662791 3300026121 Bacteria 588
577 Ga0207698_10221625 3300026142 Bacteria 1710
578 Ga0207698_10313173 3300026142 Bacteria 1466
579 Ga0207698_10362859 3300026142 Bacteria 1372
580 Ga0207698_12056343 3300026142 Bacteria 585
581 Ga0207698_12432044 3300026142 Bacteria 535
582 Ga0209983_1069531 3300027665 Bacteria 783
583 Ga0207428_10065295 3300027907 Bacteria 2871
584 Ga0207428_10125159 3300027907 Bacteria 1969
585 Ga0207428_10135223 3300027907 Bacteria 1885
586 Ga0207428_10450700 3300027907 Bacteria 938
587 Ga0268266_10006356 3300028379 Bacteria 10831
588 Ga0268265_10447918 3300028380 Bacteria 1205
589 Ga0268265_11341997 3300028380 Bacteria 716
590 Ga0268264_10805357 3300028381 Bacteria 939
591 Ga0265326_10000055 3300028558 Bacteria 66050
592 Ga0265319_1000668 3300028563 Bacteria 22474
593 Ga0265334_10000002 3300028573 Bacteria 325014
594 Ga0265334_10353605 3300028573 Bacteria 502
595 Ga0265318_10023246 3300028577 Bacteria 2472
596 Ga0265336_10008426 3300028666 Bacteria 3617
597 Ga0265338_10002429 3300028800 Bacteria 27994
598 Ga0265338_10247471 3300028800 Bacteria 1317
599 Ga0265338_10488746 3300028800 Bacteria 868
600 Ga0265324_10010259 3300029957 Bacteria 3620
601 Ga0307511_10174789 3300030521 Bacteria 1171
602 Ga0265770_1150929 3300030878 Unclassified 510
603 Ga0265320_10336483 3300031240 Bacteria 667
604 Ga0265340_10516002 3300031247 Bacteria 526
605 Ga0265327_10020649 3300031251 Bacteria 4003
606 Ga0307408_100176899 3300031548 Bacteria 1708
607 Ga0307408_100739547 3300031548 Bacteria 887
608 Ga0307408_100826038 3300031548 Bacteria 843
609 Ga0307408_102015716 3300031548 Bacteria 555
610 Ga0307408_102429473 3300031548 Bacteria 509
611 Ga0316579_10313941 3300031691 Bacteria 758
612 Ga0316576_10015088 3300031727 Bacteria 5176
613 Ga0316578_10054379 3300031728 Bacteria 2348
614 Ga0316578_10400928 3300031728 Bacteria 813
615 Ga0307516_10840929 3300031730 Bacteria 581
616 Ga0307405_10119287 3300031731 Bacteria 1802
617 Ga0307405_10182437 3300031731 Bacteria 1508
618 Ga0307405_10374451 3300031731 Bacteria 1106
619 Ga0307405_10747377 3300031731 Bacteria 814
620 Ga0307413_10032546 3300031824 Bacteria 2957
621 Ga0307413_10100962 3300031824 Bacteria 1906
622 Ga0307413_10128082 3300031824 Bacteria 1732
623 Ga0307413_10169885 3300031824 Bacteria 1542
624 Ga0307413_10519217 3300031824 Bacteria 960
625 Ga0307413_12188061 3300031824 Bacteria 501
626 Ga0307410_10020672 3300031852 Bacteria 4033
627 Ga0307410_10023114 3300031852 Bacteria 3858
628 Ga0307410_10053498 3300031852 Bacteria 2732
629 Ga0307410_10116216 3300031852 Bacteria 1943
630 Ga0307410_10166136 3300031852 Bacteria 1658
631 Ga0307410_10718033 3300031852 Bacteria 844
632 Ga0307410_11377785 3300031852 Bacteria 619
633 Ga0307406_10014323 3300031901 Bacteria 4561
634 Ga0307406_10035805 3300031901 Bacteria 3055
635 Ga0307406_10142795 3300031901 Bacteria 1697
636 Ga0307406_10176132 3300031901 Bacteria 1553
637 Ga0307406_10316024 3300031901 Bacteria 1206
638 Ga0307407_10010943 3300031903 Bacteria 4299
639 Ga0307407_10029964 3300031903 Bacteria 2929
640 Ga0307407_10136379 3300031903 Bacteria 1577
641 Ga0307407_10166881 3300031903 Bacteria 1446
642 Ga0307407_10270629 3300031903 Bacteria 1172
643 Ga0307407_10727500 3300031903 Bacteria 750
644 Ga0307407_11304683 3300031903 Bacteria 570
645 Ga0307412_10142268 3300031911 Bacteria 1759
646 Ga0307412_10348578 3300031911 Bacteria 1188
647 Ga0307412_10639520 3300031911 Bacteria 906
648 Ga0307409_100022486 3300031995 Bacteria 4349
649 Ga0307409_100067446 3300031995 Bacteria 2825
650 Ga0307409_100137973 3300031995 Bacteria 2096
651 Ga0307409_100239582 3300031995 Bacteria 1650
652 Ga0307409_100424827 3300031995 Bacteria 1276
653 Ga0307409_100487396 3300031995 Bacteria 1198
654 Ga0307409_101652512 3300031995 Bacteria 669
655 Ga0307409_102511552 3300031995 Bacteria 544
656 Ga0307409_102953779 3300031995 Bacteria 502
657 Ga0307416_100040585 3300032002 Bacteria 3617
658 Ga0307416_100044688 3300032002 Bacteria 3480
659 Ga0307416_100117348 3300032002 Bacteria 2362
660 Ga0307416_100440492 3300032002 Bacteria 1353
661 Ga0307416_100950548 3300032002 Bacteria 961
662 Ga0307416_101000922 3300032002 Bacteria 939
663 Ga0307416_101198300 3300032002 Bacteria 865
664 Ga0307416_101299249 3300032002 Bacteria 833
665 Ga0307416_101311271 3300032002 Bacteria 830
666 Ga0307416_101494886 3300032002 Bacteria 781
667 Ga0307416_101749010 3300032002 Bacteria 726
668 Ga0307416_101920349 3300032002 Bacteria 695
669 Ga0307416_102696664 3300032002 Bacteria 594
670 Ga0307416_103331950 3300032002 Bacteria 538
671 Ga0307414_10041832 3300032004 Bacteria 3108
672 Ga0307414_10085781 3300032004 Bacteria 2321
673 Ga0307414_10086068 3300032004 Bacteria 2318
674 Ga0307414_10913460 3300032004 Bacteria 805
675 Ga0307414_12313794 3300032004 Bacteria 502
676 Ga0307411_10011464 3300032005 Bacteria 4786
677 Ga0307411_10123147 3300032005 Bacteria 1880
678 Ga0307411_10348122 3300032005 Bacteria 1207
679 Ga0307411_10795011 3300032005 Bacteria 832
680 Ga0307411_12247098 3300032005 Bacteria 512
681 Ga0307415_100004435 3300032126 Bacteria 7279
682 Ga0307415_100019353 3300032126 Bacteria 4132
683 Ga0307415_100131046 3300032126 Bacteria 1898
684 Ga0307415_100176455 3300032126 Bacteria 1672
685 Ga0307415_100274037 3300032126 Bacteria 1384
686 Ga0307415_100931861 3300032126 Bacteria 803
687 Ga0307415_101288229 3300032126 Bacteria 692
688 Ga0307415_101486506 3300032126 Bacteria 648
689 Ga0307415_101779492 3300032126 Bacteria 596
690 Ga0373929_0051240 3300035085 Bacteria 944
691 Ga0373934_0118179 3300035086 Bacteria 1078
692 Ga0373949_0186905 3300035090 Bacteria 616
693 Ga0373939_0217159 3300035114 Bacteria 730
694 Ga0373941_0031493 3300035115 Bacteria 1581
695 Ga0373956_0386972 3300035119 Bacteria 667
696 Ga0373957_0234279 3300035120 Bacteria 770
697 Ga0373943_0333905 3300035170 Bacteria 866
698 Ga0373943_0781343 3300035170 Bacteria 568
699 Ga0373955_0212644 3300035172 Bacteria 1153
700 Ga0373961_0020105 3300035241 Bacteria 1762
701 Ga0316574_0129697 3300035398 Bacteria 1622
702 Ga0316574_0159256 3300035398 Bacteria 1454
703 Ga0373924_0426923 3300035410 Bacteria 593
704 Ga0373935_0623536 3300035692 Bacteria 790
705 Ga0373933_0041028 3300035724 Bacteria 2730
706 Ga0373947_0438878 3300035725 Bacteria 884
707 Ga0373947_0993939 3300035725 Bacteria 572
708 Ga0373937_0067935 3300036401 Bacteria 3285
709 Ga0316584_1168891 3300036712 Bacteria 508
710 Ga0373925_0453028 3300037068 Bacteria 1051
711 Ga0373925_1381972 3300037068 Bacteria 577
712 Ga0395899_0145523 3300037312 Bacteria 1683
713 Ga0395899_0442078 3300037312 Bacteria 853
714 Ga0395899_0452305 3300037312 Bacteria 841
715 Ga0395899_0861317 3300037312 Bacteria 555
716 Ga0395900_0004473 3300037418 Bacteria 14805
717 Ga0395900_0521628 3300037418 Bacteria 1136
718 Ga0395900_0686340 3300037418 Bacteria 958
719 Ga0395900_0918122 3300037418 Bacteria 798
720 Ga0395900_0955592 3300037418 Bacteria 778
721 Ga0395900_0998396 3300037418 Bacteria 757
722 Ga0395900_1268272 3300037418 Bacteria 651
723 Ga0395900_1791967 3300037418 Bacteria 524
724 Ga0395900_1844507 3300037418 Bacteria 515
725 Ga0395898_0010899 3300037466 Bacteria 9485
726 Ga0395898_0019765 3300037466 Bacteria 6849
727 Ga0395898_0092869 3300037466 Bacteria 2902
728 Ga0395898_0122781 3300037466 Bacteria 2489
729 Ga0395898_0150795 3300037466 Bacteria 2224
730 Ga0395898_0179814 3300037466 Bacteria 2022
731 Ga0395898_0270008 3300037466 Bacteria 1622
732 Ga0395898_0318891 3300037466 Bacteria 1483
733 Ga0395898_0380894 3300037466 Bacteria 1345
734 Ga0395898_0885241 3300037466 Bacteria 831
735 Ga0395898_1564967 3300037466 Bacteria 584
736 Ga0395905_0022103 3300037471 Bacteria 6017
737 Ga0395905_0177392 3300037471 Bacteria 2000
738 Ga0395905_1151938 3300037471 Bacteria 679
739 Ga0395905_1338159 3300037471 Bacteria 620
740 Ga0436364_0056691 3300037853 Bacteria 802
741 Ga0436364_0182733 3300037853 Bacteria 1146
742 Ga0436364_0340935 3300037853 Bacteria 2034
743 Ga0436364_0396625 3300037853 Bacteria 18286
744 Ga0436364_0596104 3300037853 Bacteria 833
745 Ga0436364_0633473 3300037853 Bacteria 529
746 Ga0436364_0683105 3300037853 Bacteria 861
747 Ga0436364_0927829 3300037853 Bacteria 621
748 Ga0436364_1256858 3300037853 Bacteria 1631
749 Ga0395901_0003277 3300038443 Bacteria 16298
750 Ga0395901_0004095 3300038443 Bacteria 14694
751 Ga0395901_0020476 3300038443 Bacteria 6770
752 Ga0395901_0184211 3300038443 Bacteria 2190
753 Ga0395901_0298635 3300038443 Bacteria 1670
754 Ga0395901_0345950 3300038443 Bacteria 1535
755 Ga0395901_0542179 3300038443 Bacteria 1180
756 Ga0395901_0728090 3300038443 Bacteria 987
757 Ga0395901_1009683 3300038443 Bacteria 807
758 Ga0395901_1262649 3300038443 Unclassified 702
759 Ga0395901_1263702 3300038443 Bacteria 701
760 Ga0436365_0317228 3300039437 Bacteria 1425
761 Ga0436365_0810329 3300039437 Bacteria 1508
762 Ga0436365_0880813 3300039437 Bacteria 6869
763 Ga0436365_1739237 3300039437 Bacteria 4411
764 Ga0436365_1769610 3300039437 Unclassified 569
765 Ga0436365_1916648 3300039437 Bacteria 2104
766 Ga0436360_0288203 3300039438 Bacteria 773
767 Ga0436360_0582220 3300039438 Bacteria 656
768 Ga0436360_0586945 3300039438 Bacteria 1156
769 Ga0436360_1226577 3300039438 Bacteria 746
770 Ga0436361_0134666 3300039447 Bacteria 685
771 Ga0436363_0694210 3300039450 Bacteria 669
772 Ga0436363_1256778 3300039450 Bacteria 710
773 Ga0436363_1312051 3300039450 Bacteria 598
774 Ga0436363_1718526 3300039450 Bacteria 44980
775 Ga0436362_0190713 3300039453 Bacteria 2233
776 Ga0436362_0442845 3300039453 Bacteria 574
777 Ga0436362_0758568 3300039453 Bacteria 1720
778 Ga0436362_0805187 3300039453 Bacteria 786
779 Ga0436362_1183670 3300039453 Bacteria 1635
780 Ga0451787_247203 3300041441 Bacteria 524
781 Ga0451798_0674024 3300041458 Bacteria 821
782 Ga0451807_2747498 3300041486 Bacteria 791
783 Ga0451849_0824546 3300041505 Bacteria 623
784 Ga0451849_1485368 3300041505 Bacteria 549
785 Ga0451853_0810194 3300041512 Bacteria 603
786 Ga0451853_0900918 3300041512 Bacteria 3142
787 Ga0451853_1695930 3300041512 Bacteria 769
788 Ga0451853_2103379 3300041512 Bacteria 623
789 Ga0451853_2911824 3300041512 Bacteria 532
790 Ga0439450_003123 3300042008 Bacteria 2701
791 Ga0439450_089173 3300042008 Bacteria 773
792 Ga0439454_088417 3300042011 Bacteria 570
793 Ga0439463_097293 3300042016 Bacteria 758
794 Ga0439463_163450 3300042016 Bacteria 577
795 Ga0439464_0075527 3300042439 Bacteria 1001
796 Ga0439440_0112817 3300042993 Bacteria 749
797 Ga0466969_0127322 3300044656 Bacteria 1182
798 Ga0466969_0336148 3300044656 Bacteria 683
799 Ga0466969_0382067 3300044656 Bacteria 639
800 Ga0466969_0538022 3300044656 Bacteria 534
801 Ga0466972_0198445 3300044658 Bacteria 940
802 Ga0466965_0230568 3300044683 Bacteria 989
803 Ga0466965_0266163 3300044683 Bacteria 922
804 Ga0466966_0565864 3300044684 Bacteria 684
805 Ga0466966_0774208 3300044684 Bacteria 578
806 Ga0466961_0006870 3300044693 Bacteria 7239
807 Ga0466961_0089433 3300044693 Bacteria 1945
808 Ga0466961_0489346 3300044693 Bacteria 743
809 Ga0466961_0846509 3300044693 Bacteria 545
810 Ga0466961_0956501 3300044693 Bacteria 509
811 Ga0466963_0020630 3300044694 Bacteria 4144
812 Ga0466963_0030187 3300044694 Bacteria 3496
813 Ga0466963_0050839 3300044694 Bacteria 2744
814 Ga0466963_0078185 3300044694 Bacteria 2236
815 Ga0466963_0129431 3300044694 Bacteria 1742
816 Ga0466963_0765826 3300044694 Bacteria 681
817 Ga0466963_0863666 3300044694 Bacteria 638
818 Ga0466964_0470112 3300044706 Bacteria 670
819 Ga0466971_0081739 3300044719 Bacteria 1474
820 Ga0466971_0091718 3300044719 Bacteria 1392
821 Ga0466971_0363148 3300044719 Bacteria 702
822 Ga0466968_0052512 3300044735 Bacteria 1744
823 Ga0466968_0515028 3300044735 Bacteria 597
824 Ga0466968_0622832 3300044735 Bacteria 546
825 Ga0466968_0662974 3300044735 Bacteria 530
826 Ga0466957_0150879 3300044842 Bacteria 1503
827 Ga0466957_0151976 3300044842 Bacteria 1498
828 Ga0466957_0267188 3300044842 Bacteria 1141
829 Ga0466957_1215953 3300044842 Bacteria 545
830 Ga0466957_1292834 3300044842 Bacteria 529
831 Ga0466960_0641750 3300044901 Bacteria 633
832 Ga0466959_0003480 3300045049 Bacteria 10310
833 Ga0466959_0021206 3300045049 Bacteria 4791
834 Ga0466959_0044695 3300045049 Bacteria 3263
835 Ga0466959_0090795 3300045049 Bacteria 2194
836 Ga0466959_0255359 3300045049 Bacteria 1208
837 Ga0466959_0345427 3300045049 Bacteria 1015
838 Ga0466959_0719930 3300045049 Bacteria 668
839 Ga0466958_0001313 3300045836 Bacteria 11713
840 Ga0466958_0022239 3300045836 Bacteria 3713
841 Ga0466958_0041206 3300045836 Bacteria 2777
842 Ga0466958_0105709 3300045836 Bacteria 1754
843 Ga0466958_0207372 3300045836 Bacteria 1248
844 Ga0466958_0383796 3300045836 Bacteria 906
845 Ga0466958_0561216 3300045836 Bacteria 742
846 Ga0466958_0728816 3300045836 Bacteria 646
847 Ga0466958_0993190 3300045836 Bacteria 548
848 Ga0466958_1070098 3300045836 Unclassified 526
849 Ga0466958_1158554 3300045836 Bacteria 505
850 Ga0466967_0031652 3300045976 Bacteria 4456
851 Ga0466967_0206195 3300045976 Bacteria 1863
852 Ga0466967_0249157 3300045976 Bacteria 1696
853 Ga0466967_0366262 3300045976 Bacteria 1397
854 Ga0466967_0393285 3300045976 Bacteria 1348
855 Ga0466967_0541911 3300045976 Bacteria 1145
856 Ga0466967_0610525 3300045976 Bacteria 1077
857 Ga0466967_0983702 3300045976 Bacteria 840
858 Ga0466967_1325246 3300045976 Bacteria 717
859 Ga0466967_1567210 3300045976 Bacteria 656
860 Ga0466967_1908475 3300045976 Bacteria 591
861 Ga0495592_0111914 3300046454 Bacteria 1931
862 Ga0495592_0239613 3300046454 Bacteria 1204
863 Ga0495590_0092263 3300046457 Bacteria 1072
864 Ga0495641_0253496 3300046461 Bacteria 791
865 Ga0495651_0036612 3300046462 Bacteria 3820
866 Ga0495651_0107857 3300046462 Bacteria 2063
867 Ga0495653_0183335 3300046463 Bacteria 1434
868 Ga0495582_0517078 3300046473 Bacteria 690
869 Ga0495605_0221020 3300046474 Bacteria 819
870 Ga0495605_0248353 3300046474 Bacteria 762
871 Ga0495605_0377255 3300046474 Bacteria 592
872 Ga0495584_0291750 3300046491 Bacteria 829
873 Ga0495585_0044918 3300046492 Bacteria 2467
874 Ga0495594_0000089 3300046499 Bacteria 41876
875 Ga0495596_0042225 3300046500 Bacteria 1797
876 Ga0495596_0094145 3300046500 Bacteria 1163
877 Ga0495596_0180014 3300046500 Bacteria 822
878 Ga0495583_0182782 3300046506 Bacteria 858
879 Ga0495608_0030787 3300046511 Bacteria 3630
880 Ga0495608_0783119 3300046511 Bacteria 564
881 Ga0495616_0335532 3300046513 Bacteria 632
882 Ga0495616_0420852 3300046513 Bacteria 546
883 Ga0495618_0156676 3300046514 Bacteria 1453
884 Ga0495620_0354263 3300046515 Bacteria 556
885 Ga0495628_0043322 3300046516 Bacteria 3586
886 Ga0495628_0665260 3300046516 Bacteria 738
887 Ga0495630_0455713 3300046517 Bacteria 980
888 Ga0495630_1521653 3300046517 Bacteria 502
889 Ga0495631_0329464 3300046518 Bacteria 650
890 Ga0495637_0144297 3300046520 Bacteria 902
891 Ga0495644_0118963 3300046523 Bacteria 1004
892 Ga0495644_0275555 3300046523 Bacteria 656
893 Ga0495644_0343902 3300046523 Bacteria 587
894 Ga0495666_0221737 3300046526 Bacteria 866
895 Ga0495642_0055414 3300046528 Bacteria 1637
896 Ga0495652_0000037 3300046529 Bacteria 133232
897 Ga0495652_0076599 3300046529 Bacteria 2774
898 Ga0495652_0601503 3300046529 Bacteria 750
899 Ga0495665_0629179 3300046531 Bacteria 535
900 Ga0495586_0294396 3300046535 Bacteria 930
901 Ga0495587_0038649 3300046536 Bacteria 2860
902 Ga0495598_0005076 3300046537 Bacteria 2894
903 Ga0495609_0433996 3300046538 Bacteria 523
904 Ga0495621_0017300 3300046539 Bacteria 2328
905 Ga0495621_0265268 3300046539 Bacteria 704
906 Ga0495645_0082948 3300046543 Bacteria 2298
907 Ga0495645_0529090 3300046543 Bacteria 733
908 Ga0495622_0000080 3300046557 Bacteria 85557
909 Ga0495667_0006950 3300046559 Bacteria 7674
910 Ga0495668_0166265 3300046616 Bacteria 1208
911 Ga0495668_0644374 3300046616 Bacteria 586
912 Ga0495668_0718011 3300046616 Bacteria 553
913 Ga0495634_0203860 3300046642 Bacteria 1227
914 Ga0495625_0140908 3300046660 Bacteria 1627
915 Ga0495625_0440789 3300046660 Bacteria 806
916 Ga0495635_0086089 3300046663 Bacteria 2150
917 Ga0495661_0628099 3300046665 Bacteria 503
918 Ga0495657_0092277 3300046675 Bacteria 1940
919 Ga0495623_0485752 3300046679 Bacteria 654
920 Ga0495646_0019644 3300046680 Bacteria 4274
921 Ga0495646_0086605 3300046680 Bacteria 1816
922 Ga0495646_0549652 3300046680 Bacteria 590
923 Ga0495613_0193447 3300046689 Bacteria 1437
924 Ga0495613_0906065 3300046689 Bacteria 570
925 Ga0495670_0299768 3300046691 Bacteria 861
926 Ga0495670_0301546 3300046691 Bacteria 859
927 Ga0495670_0365798 3300046691 Bacteria 777
928 Ga0495649_0002403 3300046694 Bacteria 13212
929 Ga0495589_0094904 3300046794 Bacteria 1447
930 Ga0495589_0330276 3300046794 Bacteria 704
931 Ga0495589_0437455 3300046794 Bacteria 599
932 Ga0495600_0604306 3300046809 Bacteria 666
933 Ga0495581_0280699 3300047315 Bacteria 974
934 Ga0495581_0628907 3300047315 Bacteria 621
935 Ga0495604_0000180 3300047317 Bacteria 56391
936 Ga0495604_0007642 3300047317 Bacteria 8561
937 Ga0495674_0094695 3300047319 Bacteria 2547
938 Ga0495674_0283349 3300047319 Bacteria 1357
939 Ga0495672_0118269 3300047320 Bacteria 1413
940 Ga0495672_0176430 3300047320 Bacteria 1085
941 Ga0495672_0494971 3300047320 Bacteria 544
942 Ga0495676_0138728 3300047321 Bacteria 1745
943 Ga0495676_0276604 3300047321 Bacteria 1138
944 Ga0495680_0014675 3300047322 Bacteria 6776
945 Ga0495680_0280645 3300047322 Bacteria 1174
946 Ga0495677_0076956 3300047445 Bacteria 1248
947 Ga0495679_214771 3300047446 Bacteria 504
948 Ga0495684_0016197 3300047471 Bacteria 5740
949 Ga0495686_0495880 3300047472 Bacteria 644
950 Ga0495593_0517974 3300047673 Bacteria 598
951 Ga0495602_0008743 3300048088 Bacteria 10571
952 Ga0495614_0357210 3300048089 Bacteria 682
953 Ga0495614_0616965 3300048089 Unclassified 522
954 Ga0495615_0203319 3300048090 Bacteria 612
955 Ga0496100_1235958 3300048903 Bacteria 589
956 Ga0496101_0316683 3300048904 Bacteria 1224
957 Ga0496102_0098230 3300048905 Bacteria 2717
958 Ga0496102_0641245 3300048905 Bacteria 985
959 Ga0496102_0741041 3300048905 Bacteria 905
960 Ga0496102_0962908 3300048905 Bacteria 774
961 Ga0496102_1300863 3300048905 Bacteria 646
962 Ga0496102_1401763 3300048905 Bacteria 618
963 Ga0496102_1960039 3300048905 Bacteria 502
964 Ga0496103_0215359 3300048906 Bacteria 1235
965 Ga0496103_0869993 3300048906 Bacteria 566
966 Ga0496103_0893648 3300048906 Bacteria 557
967 Ga0496104_0006244 3300048907 Bacteria 10470
968 Ga0496104_0353921 3300048907 Bacteria 1381
969 Ga0496104_1065809 3300048907 Bacteria 712
970 Ga0496105_0090304 3300048908 Bacteria 2530
971 Ga0496105_0163811 3300048908 Bacteria 1825
972 Ga0496105_0180512 3300048908 Bacteria 1729
973 Ga0496105_0198849 3300048908 Bacteria 1636
974 Ga0496105_1095164 3300048908 Bacteria 592
975 Ga0496107_0243501 3300048910 Bacteria 1338
976 Ga0496107_0432123 3300048910 Bacteria 979
977 Ga0496108_0121040 3300048911 Bacteria 2245
978 Ga0496108_0246111 3300048911 Bacteria 1555
979 Ga0496108_0319490 3300048911 Bacteria 1354
980 Ga0496108_0453966 3300048911 Bacteria 1120
981 Ga0496108_0509898 3300048911 Bacteria 1050
982 Ga0496108_0814172 3300048911 Bacteria 805
983 Ga0496108_0928548 3300048911 Bacteria 746
984 Ga0496108_1009682 3300048911 Bacteria 710
985 Ga0496108_1083416 3300048911 Bacteria 681
986 Ga0496108_1388363 3300048911 Bacteria 588
987 Ga0496109_0028156 3300048912 Bacteria 5024
988 Ga0496109_0072284 3300048912 Bacteria 3168
989 Ga0496109_0133105 3300048912 Bacteria 2322
990 Ga0496109_0268041 3300048912 Bacteria 1609
991 Ga0496109_0293234 3300048912 Unclassified 1533
992 Ga0496109_0389996 3300048912 Bacteria 1316
993 Ga0496109_0401507 3300048912 Bacteria 1295
994 Ga0496109_0588685 3300048912 Bacteria 1048
995 Ga0496109_1059659 3300048912 Bacteria 748
996 Ga0496109_1252570 3300048912 Bacteria 678
997 Ga0496109_1267237 3300048912 Bacteria 673
998 Ga0496110_0043633 3300048913 Bacteria 3916
999 Ga0496110_0048116 3300048913 Bacteria 3737
1000 Ga0496110_0107444 3300048913 Bacteria 2505
1001 Ga0496110_0110955 3300048913 Bacteria 2465
1002 Ga0496110_0136839 3300048913 Bacteria 2214
1003 Ga0496110_0360790 3300048913 Bacteria 1324
1004 Ga0496110_0574314 3300048913 Bacteria 1024
1005 Ga0496110_0618428 3300048913 Bacteria 982
1006 Ga0496111_0015567 3300048914 Bacteria 5225
1007 Ga0496111_0061048 3300048914 Bacteria 2733
1008 Ga0496111_0102855 3300048914 Bacteria 2100
1009 Ga0496111_0127703 3300048914 Bacteria 1880
1010 Ga0496111_0161076 3300048914 Bacteria 1666
1011 Ga0496111_0270593 3300048914 Bacteria 1260
1012 Ga0496111_1198506 3300048914 Bacteria 538
1013 Ga0496112_0003200 3300048915 Bacteria 13476
1014 Ga0496112_0005721 3300048915 Bacteria 10802
1015 Ga0496112_0008760 3300048915 Bacteria 9077
1016 Ga0496112_0017553 3300048915 Bacteria 6727
1017 Ga0496112_0160487 3300048915 Bacteria 2215
1018 Ga0496112_0294528 3300048915 Bacteria 1568
1019 Ga0496112_0371325 3300048915 Bacteria 1372
1020 Ga0496112_0715086 3300048915 Bacteria 929
1021 Ga0496112_0933414 3300048915 Bacteria 789
1022 Ga0496113_0017081 3300048916 Bacteria 5030
1023 Ga0496113_0051309 3300048916 Bacteria 3078
1024 Ga0496113_0076010 3300048916 Bacteria 2564
1025 Ga0496113_0133213 3300048916 Bacteria 1952
1026 Ga0496113_0183507 3300048916 Bacteria 1659
1027 Ga0496113_0681845 3300048916 Bacteria 821
1028 Ga0496113_0777530 3300048916 Bacteria 761
1029 Ga0496113_0924196 3300048916 Bacteria 689
1030 Ga0496114_0107052 3300048917 Bacteria 2393
1031 Ga0496114_0286170 3300048917 Bacteria 1454
1032 Ga0496115_0053430 3300048918 Bacteria 3242
1033 Ga0496115_0993439 3300048918 Bacteria 642
1034 Ga0496115_1378039 3300048918 Bacteria 522
1035 Ga0496124_0333864 3300048927 Bacteria 1080
1036 Ga0501031_0061766 3300049568 Bacteria 2441
1037 Ga0501031_0223400 3300049568 Bacteria 1226
1038 Ga0501031_0620695 3300049568 Bacteria 695
1039 Ga0501032_0026816 3300049569 Bacteria 3960
1040 Ga0501032_0462187 3300049569 Bacteria 813
1041 Ga0501032_0678851 3300049569 Bacteria 653
1042 Ga0501032_0782093 3300049569 Bacteria 603
1043 Ga0501033_0022701 3300049570 Bacteria 4732
1044 Ga0501033_0613749 3300049570 Bacteria 745
1045 Ga0501033_1040333 3300049570 Bacteria 546
1046 Ga0501034_0007459 3300049571 Bacteria 11640
1047 Ga0501034_0351400 3300049571 Bacteria 1402
1048 Ga0501034_0416241 3300049571 Bacteria 1265
1049 Ga0501034_0648631 3300049571 Bacteria 957
1050 Ga0501034_0710558 3300049571 Bacteria 903
1051 Ga0501036_0704035 3300049572 Bacteria 834
1052 Ga0501036_1041126 3300049572 Bacteria 669
1053 Ga0501036_1464734 3300049572 Bacteria 553
1054 Ga0501037_0007442 3300049573 Bacteria 8008
1055 Ga0501038_0044559 3300049574 Bacteria 3852
1056 Ga0501038_0280777 3300049574 Bacteria 1311
1057 Ga0501038_0749752 3300049574 Bacteria 728
1058 Ga0501039_0009178 3300049575 Bacteria 7536
1059 Ga0501039_0188063 3300049575 Bacteria 1624
1060 Ga0501039_0388229 3300049575 Bacteria 1097
1061 Ga0501039_0602231 3300049575 Bacteria 861
1062 Ga0501039_0801166 3300049575 Bacteria 735
1063 Ga0501039_1000910 3300049575 Bacteria 649
1064 Ga0501040_0073682 3300049576 Bacteria 2360
1065 Ga0501040_0167812 3300049576 Bacteria 1553
1066 Ga0501040_0390735 3300049576 Bacteria 999
1067 Ga0501040_0781426 3300049576 Bacteria 691
1068 Ga0501041_0023172 3300049577 Bacteria 3723
1069 Ga0501041_0027445 3300049577 Bacteria 3431
1070 Ga0501041_0565537 3300049577 Bacteria 725
1071 Ga0501041_0844737 3300049577 Bacteria 588
1072 Ga0501042_0183811 3300049578 Bacteria 1508
1073 Ga0501042_0316661 3300049578 Bacteria 1127
1074 Ga0501042_0417922 3300049578 Bacteria 972
1075 Ga0501042_0830635 3300049578 Bacteria 673
1076 Ga0501042_1182692 3300049578 Bacteria 557
1077 Ga0501043_0144817 3300049579 Bacteria 1860
1078 Ga0501043_1275843 3300049579 Bacteria 513
1079 Ga0501046_0170505 3300049580 Bacteria 1634
1080 Ga0501046_0324103 3300049580 Bacteria 1122
1081 Ga0501047_0047006 3300049581 Bacteria 4170
1082 Ga0501047_0102736 3300049581 Bacteria 2738
1083 Ga0501047_0875130 3300049581 Bacteria 712
1084 Ga0501048_0036756 3300049582 Bacteria 3519
1085 Ga0501048_0313175 3300049582 Bacteria 1118
1086 Ga0501048_0346919 3300049582 Bacteria 1059
1087 Ga0501048_0512255 3300049582 Bacteria 860
1088 Ga0501048_0852219 3300049582 Bacteria 655
1089 Ga0501048_1259973 3300049582 Bacteria 532
1090 Ga0501067_0014003 3300049583 Bacteria 4444
1091 Ga0501067_0363294 3300049583 Bacteria 807
1092 Ga0501068_0069572 3300049584 Bacteria 2146
1093 Ga0501068_0152016 3300049584 Bacteria 1455
1094 Ga0501068_0448998 3300049584 Bacteria 834
1095 Ga0501069_0003466 3300049585 Bacteria 8121
1096 Ga0501069_0815103 3300049585 Bacteria 566
1097 Ga0501070_0100146 3300049586 Bacteria 2397
1098 Ga0501070_0281669 3300049586 Bacteria 1356
1099 Ga0501070_0772670 3300049586 Bacteria 756
1100 Ga0501070_1178293 3300049586 Bacteria 589
1101 Ga0501071_0054443 3300049587 Bacteria 2887
1102 Ga0501071_0792259 3300049587 Bacteria 731
1103 Ga0501071_0872256 3300049587 Bacteria 694
1104 Ga0501071_0957945 3300049587 Bacteria 661
1105 Ga0501072_0085589 3300049588 Bacteria 2501
1106 Ga0501072_0183994 3300049588 Bacteria 1667
1107 Ga0501072_0823431 3300049588 Bacteria 726
1108 Ga0501072_0949454 3300049588 Bacteria 671
1109 Ga0501073_0018408 3300049589 Bacteria 5048
1110 Ga0501074_0070465 3300049590 Bacteria 2513
1111 Ga0501074_0569495 3300049590 Bacteria 802
1112 Ga0501074_0741325 3300049590 Bacteria 693
1113 Ga0501074_0847468 3300049590 Bacteria 644
1114 Ga0501075_0169841 3300049591 Bacteria 1664
1115 Ga0501075_0205835 3300049591 Bacteria 1501
1116 Ga0501075_0610774 3300049591 Bacteria 832
1117 Ga0501075_0835381 3300049591 Bacteria 701
1118 Ga0501075_1024984 3300049591 Bacteria 627
1119 Ga0501075_1514277 3300049591 Bacteria 508
1120 Ga0501076_0102038 3300049592 Bacteria 2313
1121 Ga0501077_0319658 3300049593 Bacteria 989
1122 Ga0501079_1099602 3300049741 Bacteria 626
1123 Ga0501079_1129306 3300049741 Bacteria 617
1124 Ga0501079_1621248 3300049741 Bacteria 509
1125 Ga0501080_0296913 3300049742 Bacteria 1466
1126 Ga0501081_0056532 3300049743 Bacteria 2712
1127 Ga0501081_0523380 3300049743 Bacteria 885
1128 Ga0501081_0712185 3300049743 Bacteria 754
1129 Ga0501081_0782213 3300049743 Bacteria 718
1130 Ga0501081_1147752 3300049743 Bacteria 588
1131 Ga0501083_0139571 3300049744 Bacteria 1587
1132 Ga0501035_0120119 3300049822 Bacteria 2298
1133 Ga0501035_0955005 3300049822 Bacteria 676
1134 Ga0501035_1038453 3300049822 Bacteria 643
1135 Ga0501035_1049988 3300049822 Bacteria 638
1136 Ga0501035_1058631 3300049822 Bacteria 635
1137 Ga0501044_0155168 3300049823 Bacteria 2269
1138 Ga0501044_0724393 3300049823 Bacteria 878
1139 Ga0501044_0939507 3300049823 Bacteria 738
1140 Ga0501044_1068581 3300049823 Bacteria 677
1141 Ga0501045_0011031 3300049824 Bacteria 6334
1142 Ga0501045_0069046 3300049824 Bacteria 2597
1143 Ga0501045_0131179 3300049824 Bacteria 1863
1144 Ga0501045_0497683 3300049824 Bacteria 905
1145 Ga0501045_0741403 3300049824 Bacteria 724
1146 nmdc:mga03n38_162620_c1 3300050490 Bacteria 1131
1147 nmdc:mga03n38_288707_c1 3300050490 Bacteria 878
1148 nmdc:mga03n38_511612_c1 3300050490 Bacteria 675
1149 nmdc:mga03n38_532606_c1 3300050490 Bacteria 663
1150 nmdc:mga00v17_29534_c1 3300050491 Bacteria 3218
1151 nmdc:mga00v17_31587_c1 3300050491 Bacteria 3124
1152 nmdc:mga0yw44_116189_c1 3300050492 Bacteria 1719
1153 nmdc:mga0yw44_123420_c1 3300050492 Bacteria 1670
1154 nmdc:mga0yw44_21241_c1 3300050492 Bacteria 3618
1155 nmdc:mga0yw44_226755_c1 3300050492 Bacteria 1239
1156 nmdc:mga0yw44_39211_c1 3300050492 Bacteria 2807
1157 nmdc:mga0yw44_39304_c2 3300050492 Bacteria 1876
1158 nmdc:mga0yw44_630870_c1 3300050492 Bacteria 728
1159 nmdc:mga0yw44_741915_c1 3300050492 Bacteria 667
1160 nmdc:mga06z11_475450_c1 3300050494 Bacteria 756
1161 nmdc:mga06z11_861233_c1 3300050494 Bacteria 552
1162 nmdc:mga07m45_598102_c1 3300050496 Bacteria 637
1163 nmdc:mga05p37_1092287_c1 3300050507 Bacteria 836
1164 nmdc:mga05p37_1213059_c1 3300050507 Bacteria 778
1165 nmdc:mga05p37_1304567_c1 3300050507 Bacteria 740
1166 nmdc:mga05p37_167164_c1 3300050507 Bacteria 2684
1167 nmdc:mga05p37_1730138_c1 3300050507 Unclassified 608
1168 nmdc:mga05p37_219144_c1 3300050507 Bacteria 2297
1169 nmdc:mga05p37_287446_c1 3300050507 Bacteria 1258
1170 nmdc:mga05p37_354916_c1 3300050507 Bacteria 1725
1171 nmdc:mga05p37_380651_c1 3300050507 Bacteria 1654
1172 nmdc:mga05p37_38150_c1 3300050507 Bacteria 5891
1173 nmdc:mga05p37_4838_c1 3300050507 Bacteria 15752
1174 nmdc:mga05p37_569766_c1 3300050507 Bacteria 1285
1175 nmdc:mga05p37_663716_c1 3300050507 Bacteria 757
1176 nmdc:mga05p37_722940_c1 3300050507 Bacteria 1102
1177 nmdc:mga05p37_99282_c1 3300050507 Bacteria 3586
1178 nmdc:mga09592_1527485_c1 3300050508 Bacteria 542
1179 nmdc:mga09592_235122_c1 3300050508 Bacteria 1588
1180 nmdc:mga09592_26552_c1 3300050508 Bacteria 4799
1181 nmdc:mga0qj67_112351_c1 3300050509 Bacteria 2199
1182 nmdc:mga0qj67_1174959_c1 3300050509 Bacteria 598
1183 nmdc:mga0qj67_1457790_c1 3300050509 Bacteria 527
1184 nmdc:mga0qj67_1878_c1 3300050509 Bacteria 14896
1185 nmdc:mga0qj67_219923_c1 3300050509 Bacteria 1542
1186 nmdc:mga0qj67_270501_c1 3300050509 Bacteria 1378
1187 nmdc:mga0qj67_58414_c1 3300050509 Bacteria 3059
1188 nmdc:mga0qj67_615442_c1 3300050509 Bacteria 868
1189 nmdc:mga0qj67_6768_c1 3300050509 Bacteria 8427
1190 nmdc:mga0qj67_698310_c1 3300050509 Bacteria 807
1191 nmdc:mga0qj67_702803_c1 3300050509 Bacteria 804
1192 nmdc:mga0qj67_835175_c1 3300050509 Bacteria 728
1193 nmdc:mga06r32_1039497_c1 3300050510 Bacteria 770
1194 nmdc:mga06r32_1489137_c1 3300050510 Bacteria 617
1195 nmdc:mga06r32_1662783_c1 3300050510 Bacteria 576
1196 nmdc:mga06r32_1726856_c1 3300050510 Bacteria 562
1197 nmdc:mga06r32_191804_c1 3300050510 Bacteria 2031
1198 nmdc:mga06r32_249219_c1 3300050510 Unclassified 1763
1199 nmdc:mga06r32_448567_c1 3300050510 Bacteria 1270
1200 nmdc:mga06r32_51501_c1 3300050510 Bacteria 3941
1201 nmdc:mga08y16_1110075_c1 3300050511 Bacteria 765
1202 nmdc:mga08y16_1291533_c1 3300050511 Bacteria 697
1203 nmdc:mga08y16_12932_c2 3300050511 Bacteria 3032
1204 nmdc:mga08y16_161005_c1 3300050511 Bacteria 2332
1205 nmdc:mga08y16_1635126_c1 3300050511 Bacteria 601
1206 nmdc:mga08y16_1953964_c1 3300050511 Bacteria 537
1207 nmdc:mga08y16_276127_c1 3300050511 Bacteria 1734
1208 nmdc:mga08y16_88912_c1 3300050511 Bacteria 3219
1209 nmdc:mga0n895_11607_c1 3300050512 Bacteria 7868
1210 nmdc:mga0n895_1493435_c1 3300050512 Bacteria 642
1211 nmdc:mga0n895_1678045_c1 3300050512 Bacteria 598
1212 nmdc:mga0n895_679282_c1 3300050512 Bacteria 1027
1213 nmdc:mga0a205_1365641_c1 3300050515 Bacteria 556
1214 nmdc:mga0a205_222744_c1 3300050515 Bacteria 1771
1215 nmdc:mga0a205_2890_c1 3300050515 Bacteria 15196
1216 nmdc:mga0a205_43_c1 3300050515 Bacteria 51209
1217 Ga0495601_0030105 3300053077 Bacteria 3370
1218 Ga0495601_0625823 3300053077 Bacteria 689
1219 Ga0495612_0005082 3300053078 Bacteria 5449
1220 Ga0495612_0264583 3300053078 Bacteria 767
1221 Ga0495655_0060228 3300053083 Bacteria 1033
1222 Ga0495655_0064566 3300053083 Bacteria 1008
1223 Ga0495655_0195226 3300053083 Bacteria 659
1224 Ga0495655_0299496 3300053083 Unclassified 552
1225 Ga0495595_0001706 3300053084 Bacteria 8601
1226 Ga0495595_0117487 3300053084 Bacteria 1294
1227 Ga0495619_0102675 3300053085 Bacteria 1947
1228 Ga0495619_0877217 3300053085 Bacteria 604
1229 Ga0495619_1106653 3300053085 Bacteria 527
1230 Ga0500554_141551 3300053102 Bacteria 813
1231 Ga0500556_0000723 3300053104 Bacteria 19906
1232 Ga0500616_0003272 3300053153 Bacteria 12504
1233 Ga0501084_0037523 3300054114 Bacteria 4049
1234 Ga0501084_0095424 3300054114 Bacteria 2498
1235 Ga0501084_0246289 3300054114 Bacteria 1509
1236 Ga0501084_0363937 3300054114 Bacteria 1222
1237 Ga0501084_0816701 3300054114 Bacteria 785
1238 Ga0501084_1376083 3300054114 Bacteria 591
1239 Ga0501084_1445863 3300054114 Bacteria 576
1240 Ga0501082_0004774 3300060353 Bacteria 11825
1241 Ga0501082_0467067 3300060353 Bacteria 1103
1242 Ga0466962_0154436 3300061719 Bacteria 1114
1243 Ga0466962_0209005 3300061719 Bacteria 955
1244 Ga0466962_0247253 3300061719 Bacteria 876
1245 Ga0466962_0667188 3300061719 Bacteria 532
1246 Ga0530510_0057001 3300061734 Bacteria 2823
1247 Ga0530510_0330342 3300061734 Bacteria 1144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041458 Ga0451798_0674024 Ga0451798_0674024_89_340 82
2 3300005981 Ga0081538_10023958 Ga0081538_100239583 83
3 3300005549 Ga0070704_101346754 Ga0070704_1013467541 85
4 3300009094 Ga0111539_11903395 Ga0111539_119033952 85
5 3300009147 Ga0114129_10728118 Ga0114129_107281182 85
6 3300032002 Ga0307416_100440492 Ga0307416_1004404922 85
7 3300032004 Ga0307414_12313794 Ga0307414_123137942 85
8 3300032005 Ga0307411_10348122 Ga0307411_103481222 85
9 3300046538 Ga0495609_0433996 Ga0495609_0433996_68_346 85
10 3300050507 nmdc:mga05p37_287446_c1 nmdc:mga05p37_287446_c1_305_583 85
11 3300050511 nmdc:mga08y16_1110075_c1 nmdc:mga08y16_1110075_c1_86_364 85
12 3300025972 Ga0207668_10638540 Ga0207668_106385402 86
13 3300049569 Ga0501032_0678851 Ga0501032_0678851_334_612 86
14 3300049570 Ga0501033_0613749 Ga0501033_0613749_335_613 86
15 3300049575 Ga0501039_0188063 Ga0501039_0188063_948_1226 86
16 3300049576 Ga0501040_0167812 Ga0501040_0167812_31_309 86
17 3300049577 Ga0501041_0027445 Ga0501041_0027445_422_700 86
18 3300049580 Ga0501046_0170505 Ga0501046_0170505_323_601 86
19 3300049582 Ga0501048_0512255 Ga0501048_0512255_197_475 86
20 3300049588 Ga0501072_0183994 Ga0501072_0183994_581_859 86
21 3300049591 Ga0501075_0169841 Ga0501075_0169841_1161_1439 86
22 3300049592 Ga0501076_0102038 Ga0501076_0102038_18_293 86
23 3300049741 Ga0501079_1099602 Ga0501079_1099602_227_505 86
24 3300049743 Ga0501081_0712185 Ga0501081_0712185_20_298 86
25 3300049822 Ga0501035_0955005 Ga0501035_0955005_117_395 86
26 3300049824 Ga0501045_0011031 Ga0501045_0011031_2987_3265 86
27 3300050507 nmdc:mga05p37_167164_c1 nmdc:mga05p37_167164_c1_1144_1407 86
28 3300050508 nmdc:mga09592_235122_c1 nmdc:mga09592_235122_c1_1185_1448 86
29 3300050509 nmdc:mga0qj67_1174959_c1 nmdc:mga0qj67_1174959_c1_109_372 86
30 3300054114 Ga0501084_0363937 Ga0501084_0363937_439_717 86
31 3300036712 Ga0316584_1168891 Ga0316584_1168891_128_391 87
32 3300005719 Ga0068861_100548577 Ga0068861_1005485772 88
33 3300009098 Ga0105245_11591461 Ga0105245_115914612 88
34 3300037418 Ga0395900_1844507 Ga0395900_1844507_141_413 88
35 3300046529 Ga0495652_0601503 Ga0495652_0601503_29_298 88
36 3300046616 Ga0495668_0644374 Ga0495668_0644374_149_418 88
37 3300046660 Ga0495625_0140908 Ga0495625_0140908_71_340 88
38 3300046660 Ga0495625_0440789 Ga0495625_0440789_501_770 88
39 3300046665 Ga0495661_0628099 Ga0495661_0628099_112_381 88
40 3300046794 Ga0495589_0330276 Ga0495589_0330276_274_543 88
41 3300047320 Ga0495672_0494971 Ga0495672_0494971_105_374 88
42 3300047321 Ga0495676_0138728 Ga0495676_0138728_1444_1713 88
43 3300048911 Ga0496108_0453966 Ga0496108_0453966_365_634 88
44 3300048911 Ga0496108_0509898 Ga0496108_0509898_529_798 88
45 3300048912 Ga0496109_1252570 Ga0496109_1252570_88_354 88
46 3300048913 Ga0496110_0574314 Ga0496110_0574314_515_784 88
47 3300048915 Ga0496112_0371325 Ga0496112_0371325_474_740 88
48 3300049574 Ga0501038_0749752 Ga0501038_0749752_373_642 88
49 3300049576 Ga0501040_0781426 Ga0501040_0781426_305_571 88
50 3300049578 Ga0501042_0316661 Ga0501042_0316661_761_1027 88
51 3300049587 Ga0501071_0792259 Ga0501071_0792259_44_310 88
52 3300049588 Ga0501072_0085589 Ga0501072_0085589_203_469 88
53 3300049591 Ga0501075_0205835 Ga0501075_0205835_1180_1446 88
54 3300049822 Ga0501035_1038453 Ga0501035_1038453_228_500 88
55 3300049823 Ga0501044_0939507 Ga0501044_0939507_11_280 88
56 3300049824 Ga0501045_0497683 Ga0501045_0497683_332_598 88
57 3300005355 Ga0070671_100404361 Ga0070671_1004043612 89
58 3300005466 Ga0070685_10276726 Ga0070685_102767262 89
59 3300005544 Ga0070686_100757840 Ga0070686_1007578402 89
60 3300005549 Ga0070704_100772195 Ga0070704_1007721952 89
61 3300005617 Ga0068859_101614833 Ga0068859_1016148332 89
62 3300005843 Ga0068860_102137408 Ga0068860_1021374082 89
63 3300006931 Ga0097620_101614903 Ga0097620_1016149032 89
64 3300009098 Ga0105245_10196901 Ga0105245_101969012 89
65 3300009148 Ga0105243_11099009 Ga0105243_110990092 89
66 3300009176 Ga0105242_10478061 Ga0105242_104780612 89
67 3300009177 Ga0105248_10466985 Ga0105248_104669853 89
68 3300013105 Ga0157369_12202112 Ga0157369_122021122 89
69 3300013306 Ga0163162_13112011 Ga0163162_131120112 89
70 3300013307 Ga0157372_10277387 Ga0157372_102773872 89
71 3300014325 Ga0163163_10114974 Ga0163163_101149742 89
72 3300020082 Ga0206353_11886593 Ga0206353_118865932 89
73 3300025901 Ga0207688_10629848 Ga0207688_106298482 89
74 3300025903 Ga0207680_11008429 Ga0207680_110084292 89
75 3300025926 Ga0207659_11515994 Ga0207659_115159942 89
76 3300025927 Ga0207687_10303265 Ga0207687_103032653 89
77 3300025931 Ga0207644_10883543 Ga0207644_108835432 89
78 3300025933 Ga0207706_11714284 Ga0207706_117142842 89
79 3300025941 Ga0207711_10282404 Ga0207711_102824043 89
80 3300025944 Ga0207661_10319698 Ga0207661_103196982 89
81 3300025944 Ga0207661_10669324 Ga0207661_106693242 89
82 3300026088 Ga0207641_11565609 Ga0207641_115656092 89
83 3300026095 Ga0207676_10528689 Ga0207676_105286892 89
84 3300026121 Ga0207683_11662791 Ga0207683_116627912 89
85 3300026142 Ga0207698_10362859 Ga0207698_103628593 89
86 3300037418 Ga0395900_0955592 Ga0395900_0955592_242_514 89
87 3300037418 Ga0395900_1791967 Ga0395900_1791967_86_358 89
88 3300037466 Ga0395898_0150795 Ga0395898_0150795_422_694 89
89 3300037466 Ga0395898_0885241 Ga0395898_0885241_249_521 89
90 3300037471 Ga0395905_1338159 Ga0395905_1338159_269_541 89
91 3300038443 Ga0395901_0020476 Ga0395901_0020476_2120_2392 89
92 3300038443 Ga0395901_0184211 Ga0395901_0184211_736_1008 89
93 3300038443 Ga0395901_0345950 Ga0395901_0345950_24_296 89
94 3300038443 Ga0395901_1263702 Ga0395901_1263702_343_615 89
95 3300041505 Ga0451849_0824546 Ga0451849_0824546_149_421 89
96 3300041512 Ga0451853_2103379 Ga0451853_2103379_324_596 89
97 3300044683 Ga0466965_0230568 Ga0466965_0230568_125_394 89
98 3300046454 Ga0495592_0239613 Ga0495592_0239613_915_1184 89
99 3300048904 Ga0496101_0316683 Ga0496101_0316683_263_535 89
100 3300048905 Ga0496102_0741041 Ga0496102_0741041_64_336 89
101 3300048906 Ga0496103_0215359 Ga0496103_0215359_852_1124 89
102 3300048907 Ga0496104_0006244 Ga0496104_0006244_9445_9717 89
103 3300048908 Ga0496105_0090304 Ga0496105_0090304_449_721 89
104 3300048908 Ga0496105_0198849 Ga0496105_0198849_747_1019 89
105 3300048910 Ga0496107_0243501 Ga0496107_0243501_52_324 89
106 3300048911 Ga0496108_0814172 Ga0496108_0814172_509_781 89
107 3300048911 Ga0496108_1009682 Ga0496108_1009682_420_692 89
108 3300048911 Ga0496108_1083416 Ga0496108_1083416_131_403 89
109 3300048912 Ga0496109_0072284 Ga0496109_0072284_1898_2170 89
110 3300048912 Ga0496109_0133105 Ga0496109_0133105_1264_1536 89
111 3300048912 Ga0496109_0588685 Ga0496109_0588685_671_943 89
112 3300048913 Ga0496110_0136839 Ga0496110_0136839_150_422 89
113 3300048914 Ga0496111_0127703 Ga0496111_0127703_1017_1289 89
114 3300048915 Ga0496112_0005721 Ga0496112_0005721_1412_1684 89
115 3300048915 Ga0496112_0008760 Ga0496112_0008760_732_1004 89
116 3300048915 Ga0496112_0017553 Ga0496112_0017553_3157_3429 89
117 3300048916 Ga0496113_0076010 Ga0496113_0076010_319_591 89
118 3300048916 Ga0496113_0924196 Ga0496113_0924196_276_548 89
119 3300048917 Ga0496114_0107052 Ga0496114_0107052_1703_1975 89
120 3300048918 Ga0496115_0993439 Ga0496115_0993439_173_445 89
121 3300048918 Ga0496115_1378039 Ga0496115_1378039_89_361 89
122 3300050512 nmdc:mga0n895_1493435_c1 nmdc:mga0n895_1493435_c1_188_460 89
123 3300053078 Ga0495612_0005082 Ga0495612_0005082_2938_3207 89
124 3300053083 Ga0495655_0064566 Ga0495655_0064566_232_507 89
125 3300053083 Ga0495655_0195226 Ga0495655_0195226_215_487 89
126 3300054114 Ga0501084_1445863 Ga0501084_1445863_279_548 89
127 3300001979 JGI24740J21852_10029359 JGI24740J21852_100293592 90
128 3300001990 JGI24737J22298_10019574 JGI24737J22298_100195742 90
129 3300002067 JGI24735J21928_10049785 JGI24735J21928_100497852 90
130 3300002239 JGI24034J26672_10003687 JGI24034J26672_100036872 90
131 3300002244 JGI24742J22300_10016165 JGI24742J22300_100161652 90
132 3300003373 JGI25407J50210_10148685 JGI25407J50210_101486852 90
133 3300003659 JGI25404J52841_10130377 JGI25404J52841_101303772 90
134 3300005327 Ga0070658_11707452 Ga0070658_117074521 90
135 3300005329 Ga0070683_100036000 Ga0070683_1000360006 90
136 3300005329 Ga0070683_101236410 Ga0070683_1012364102 90
137 3300005330 Ga0070690_101294809 Ga0070690_1012948092 90
138 3300005331 Ga0070670_100700478 Ga0070670_1007004782 90
139 3300005336 Ga0070680_101724910 Ga0070680_1017249102 90
140 3300005336 Ga0070680_101755220 Ga0070680_1017552201 90
141 3300005337 Ga0070682_101051562 Ga0070682_1010515621 90
142 3300005337 Ga0070682_101139933 Ga0070682_1011399331 90
143 3300005338 Ga0068868_101716420 Ga0068868_1017164202 90
144 3300005338 Ga0068868_102111166 Ga0068868_1021111661 90
145 3300005339 Ga0070660_101025008 Ga0070660_1010250082 90
146 3300005340 Ga0070689_100599406 Ga0070689_1005994062 90
147 3300005341 Ga0070691_10259332 Ga0070691_102593321 90
148 3300005345 Ga0070692_10108688 Ga0070692_101086882 90
149 3300005347 Ga0070668_100220943 Ga0070668_1002209432 90
150 3300005347 Ga0070668_100704034 Ga0070668_1007040342 90
151 3300005347 Ga0070668_100753757 Ga0070668_1007537571 90
152 3300005347 Ga0070668_102026876 Ga0070668_1020268761 90
153 3300005353 Ga0070669_100214154 Ga0070669_1002141542 90
154 3300005354 Ga0070675_100140528 Ga0070675_1001405284 90
155 3300005356 Ga0070674_100247049 Ga0070674_1002470492 90
156 3300005366 Ga0070659_100000052 Ga0070659_10000005280 90
157 3300005366 Ga0070659_100036169 Ga0070659_1000361693 90
158 3300005366 Ga0070659_100703598 Ga0070659_1007035982 90
159 3300005366 Ga0070659_101627298 Ga0070659_1016272981 90
160 3300005367 Ga0070667_101523443 Ga0070667_1015234431 90
161 3300005435 Ga0070714_100001337 Ga0070714_10000133714 90
162 3300005435 Ga0070714_100247677 Ga0070714_1002476772 90
163 3300005435 Ga0070714_100547345 Ga0070714_1005473452 90
164 3300005435 Ga0070714_100721507 Ga0070714_1007215072 90
165 3300005436 Ga0070713_100384333 Ga0070713_1003843331 90
166 3300005436 Ga0070713_100556350 Ga0070713_1005563502 90
167 3300005436 Ga0070713_100677482 Ga0070713_1006774821 90
168 3300005437 Ga0070710_10000004 Ga0070710_10000004173 90
169 3300005437 Ga0070710_10177940 Ga0070710_101779401 90
170 3300005439 Ga0070711_100055054 Ga0070711_1000550543 90
171 3300005439 Ga0070711_100283925 Ga0070711_1002839252 90
172 3300005440 Ga0070705_100005534 Ga0070705_1000055345 90
173 3300005440 Ga0070705_100590518 Ga0070705_1005905182 90
174 3300005444 Ga0070694_101187572 Ga0070694_1011875721 90
175 3300005445 Ga0070708_101064600 Ga0070708_1010646002 90
176 3300005455 Ga0070663_101133463 Ga0070663_1011334631 90
177 3300005458 Ga0070681_10526926 Ga0070681_105269262 90
178 3300005458 Ga0070681_10596429 Ga0070681_105964292 90
179 3300005459 Ga0068867_100141551 Ga0068867_1001415514 90
180 3300005459 Ga0068867_100400410 Ga0068867_1004004102 90
181 3300005459 Ga0068867_100884259 Ga0068867_1008842592 90
182 3300005459 Ga0068867_101493881 Ga0068867_1014938812 90
183 3300005467 Ga0070706_100974963 Ga0070706_1009749632 90
184 3300005471 Ga0070698_101322624 Ga0070698_1013226242 90
185 3300005518 Ga0070699_101219516 Ga0070699_1012195162 90
186 3300005530 Ga0070679_100014554 Ga0070679_1000145542 90
187 3300005530 Ga0070679_100167247 Ga0070679_1001672472 90
188 3300005535 Ga0070684_100177969 Ga0070684_1001779692 90
189 3300005535 Ga0070684_100385174 Ga0070684_1003851742 90
190 3300005535 Ga0070684_101494628 Ga0070684_1014946281 90
191 3300005543 Ga0070672_100389896 Ga0070672_1003898962 90
192 3300005544 Ga0070686_100542115 Ga0070686_1005421152 90
193 3300005544 Ga0070686_101020987 Ga0070686_1010209871 90
194 3300005544 Ga0070686_101867847 Ga0070686_1018678471 90
195 3300005545 Ga0070695_100313601 Ga0070695_1003136012 90
196 3300005546 Ga0070696_101013526 Ga0070696_1010135262 90
197 3300005548 Ga0070665_100002098 Ga0070665_10000209823 90
198 3300005549 Ga0070704_100062477 Ga0070704_1000624775 90
199 3300005549 Ga0070704_100216168 Ga0070704_1002161682 90
200 3300005564 Ga0070664_100068242 Ga0070664_1000682422 90
201 3300005564 Ga0070664_100533011 Ga0070664_1005330112 90
202 3300005564 Ga0070664_102194499 Ga0070664_1021944992 90
203 3300005577 Ga0068857_100174736 Ga0068857_1001747362 90
204 3300005577 Ga0068857_101599755 Ga0068857_1015997552 90
205 3300005577 Ga0068857_101647772 Ga0068857_1016477722 90
206 3300005578 Ga0068854_100777388 Ga0068854_1007773882 90
207 3300005578 Ga0068854_101016308 Ga0068854_1010163082 90
208 3300005578 Ga0068854_101253451 Ga0068854_1012534511 90
209 3300005616 Ga0068852_102361695 Ga0068852_1023616952 90
210 3300005616 Ga0068852_102581169 Ga0068852_1025811692 90
211 3300005617 Ga0068859_101033608 Ga0068859_1010336082 90
212 3300005618 Ga0068864_101128529 Ga0068864_1011285292 90
213 3300005618 Ga0068864_101425917 Ga0068864_1014259172 90
214 3300005718 Ga0068866_10000008 Ga0068866_10000008119 90
215 3300005718 Ga0068866_10101494 Ga0068866_101014942 90
216 3300005718 Ga0068866_10624164 Ga0068866_106241641 90
217 3300005719 Ga0068861_100240266 Ga0068861_1002402662 90
218 3300005834 Ga0068851_10972812 Ga0068851_109728122 90
219 3300005841 Ga0068863_101029286 Ga0068863_1010292862 90
220 3300005844 Ga0068862_101131957 Ga0068862_1011319572 90
221 3300005844 Ga0068862_101976663 Ga0068862_1019766632 90
222 3300005981 Ga0081538_10000486 Ga0081538_1000048628 90
223 3300005981 Ga0081538_10030544 Ga0081538_100305443 90
224 3300005981 Ga0081538_10133014 Ga0081538_101330142 90
225 3300005981 Ga0081538_10302301 Ga0081538_103023012 90
226 3300005983 Ga0081540_1000100 Ga0081540_10001002 90
227 3300005983 Ga0081540_1000366 Ga0081540_100036624 90
228 3300005983 Ga0081540_1340535 Ga0081540_13405351 90
229 3300006028 Ga0070717_10000019 Ga0070717_1000001932 90
230 3300006028 Ga0070717_10109701 Ga0070717_101097012 90
231 3300006028 Ga0070717_11157562 Ga0070717_111575622 90
232 3300006028 Ga0070717_11468368 Ga0070717_114683682 90
233 3300006038 Ga0075365_10018720 Ga0075365_100187205 90
234 3300006038 Ga0075365_10053076 Ga0075365_100530762 90
235 3300006038 Ga0075365_10216648 Ga0075365_102166482 90
236 3300006038 Ga0075365_10276879 Ga0075365_102768792 90
237 3300006038 Ga0075365_10697437 Ga0075365_106974372 90
238 3300006038 Ga0075365_10827540 Ga0075365_108275402 90
239 3300006048 Ga0075363_100045544 Ga0075363_1000455444 90
240 3300006048 Ga0075363_100592830 Ga0075363_1005928302 90
241 3300006048 Ga0075363_100801474 Ga0075363_1008014742 90
242 3300006048 Ga0075363_100882187 Ga0075363_1008821872 90
243 3300006051 Ga0075364_10108190 Ga0075364_101081901 90
244 3300006051 Ga0075364_10216601 Ga0075364_102166012 90
245 3300006163 Ga0070715_10000021 Ga0070715_100000217 90
246 3300006163 Ga0070715_10102751 Ga0070715_101027512 90
247 3300006173 Ga0070716_100328989 Ga0070716_1003289891 90
248 3300006175 Ga0070712_100000004 Ga0070712_10000000476 90
249 3300006175 Ga0070712_100035657 Ga0070712_1000356572 90
250 3300006175 Ga0070712_101236984 Ga0070712_1012369841 90
251 3300006844 Ga0075428_100145532 Ga0075428_1001455324 90
252 3300006844 Ga0075428_101726401 Ga0075428_1017264011 90
253 3300006844 Ga0075428_101976211 Ga0075428_1019762112 90
254 3300006846 Ga0075430_100010271 Ga0075430_1000102719 90
255 3300006846 Ga0075430_100082658 Ga0075430_1000826582 90
256 3300006846 Ga0075430_100182410 Ga0075430_1001824102 90
257 3300006846 Ga0075430_100236941 Ga0075430_1002369413 90
258 3300006846 Ga0075430_100627388 Ga0075430_1006273882 90
259 3300006847 Ga0075431_100008439 Ga0075431_1000084392 90
260 3300006847 Ga0075431_100277815 Ga0075431_1002778152 90
261 3300006847 Ga0075431_100617676 Ga0075431_1006176762 90
262 3300006852 Ga0075433_10004260 Ga0075433_100042604 90
263 3300006852 Ga0075433_10029521 Ga0075433_100295212 90
264 3300006852 Ga0075433_10884530 Ga0075433_108845302 90
265 3300006871 Ga0075434_100003126 Ga0075434_10000312615 90
266 3300006871 Ga0075434_100204106 Ga0075434_1002041063 90
267 3300006871 Ga0075434_101570376 Ga0075434_1015703762 90
268 3300006880 Ga0075429_100028882 Ga0075429_1000288822 90
269 3300006880 Ga0075429_100029685 Ga0075429_1000296852 90
270 3300006880 Ga0075429_100069921 Ga0075429_1000699213 90
271 3300006881 Ga0068865_100069738 Ga0068865_1000697384 90
272 3300006881 Ga0068865_101881500 Ga0068865_1018815002 90
273 3300006881 Ga0068865_102079943 Ga0068865_1020799431 90
274 3300006914 Ga0075436_101212156 Ga0075436_1012121562 90
275 3300006931 Ga0097620_101033598 Ga0097620_1010335982 90
276 3300007076 Ga0075435_101186219 Ga0075435_1011862191 90
277 3300009093 Ga0105240_10006899 Ga0105240_1000689910 90
278 3300009093 Ga0105240_10893013 Ga0105240_108930131 90
279 3300009093 Ga0105240_12599976 Ga0105240_125999761 90
280 3300009094 Ga0111539_10172182 Ga0111539_101721823 90
281 3300009094 Ga0111539_10373319 Ga0111539_103733192 90
282 3300009094 Ga0111539_11272681 Ga0111539_112726812 90
283 3300009094 Ga0111539_11760825 Ga0111539_117608252 90
284 3300009094 Ga0111539_11858587 Ga0111539_118585872 90
285 3300009094 Ga0111539_12989619 Ga0111539_129896192 90
286 3300009098 Ga0105245_10041413 Ga0105245_100414132 90
287 3300009098 Ga0105245_10373026 Ga0105245_103730262 90
288 3300009098 Ga0105245_10445572 Ga0105245_104455722 90
289 3300009098 Ga0105245_10553621 Ga0105245_105536212 90
290 3300009098 Ga0105245_10843931 Ga0105245_108439312 90
291 3300009098 Ga0105245_11443252 Ga0105245_114432522 90
292 3300009101 Ga0105247_10001706 Ga0105247_1000170611 90
293 3300009147 Ga0114129_10001353 Ga0114129_1000135319 90
294 3300009147 Ga0114129_10001766 Ga0114129_1000176610 90
295 3300009147 Ga0114129_10012393 Ga0114129_1001239318 90
296 3300009147 Ga0114129_10706759 Ga0114129_107067592 90
297 3300009147 Ga0114129_10939175 Ga0114129_109391752 90
298 3300009147 Ga0114129_11099713 Ga0114129_110997132 90
299 3300009147 Ga0114129_11161126 Ga0114129_111611263 90
300 3300009147 Ga0114129_13251609 Ga0114129_132516092 90
301 3300009148 Ga0105243_10096657 Ga0105243_100966572 90
302 3300009148 Ga0105243_10137382 Ga0105243_101373824 90
303 3300009148 Ga0105243_10756102 Ga0105243_107561022 90
304 3300009148 Ga0105243_11358251 Ga0105243_113582512 90
305 3300009148 Ga0105243_11591693 Ga0105243_115916931 90
306 3300009174 Ga0105241_11715307 Ga0105241_117153072 90
307 3300009176 Ga0105242_10730563 Ga0105242_107305632 90
308 3300009176 Ga0105242_11046578 Ga0105242_110465782 90
309 3300009176 Ga0105242_11489099 Ga0105242_114890992 90
310 3300009176 Ga0105242_12412313 Ga0105242_124123132 90
311 3300009551 Ga0105238_10000055 Ga0105238_1000005521 90
312 3300009551 Ga0105238_10622579 Ga0105238_106225793 90
313 3300009553 Ga0105249_10163914 Ga0105249_101639142 90
314 3300009553 Ga0105249_10427712 Ga0105249_104277124 90
315 3300009553 Ga0105249_10463430 Ga0105249_104634302 90
316 3300009553 Ga0105249_11319800 Ga0105249_113198002 90
317 3300010375 Ga0105239_10069246 Ga0105239_100692467 90
318 3300010375 Ga0105239_12618169 Ga0105239_126181692 90
319 3300011119 Ga0105246_10032024 Ga0105246_100320245 90
320 3300011119 Ga0105246_10272909 Ga0105246_102729092 90
321 3300011119 Ga0105246_10615190 Ga0105246_106151902 90
322 3300011119 Ga0105246_11474831 Ga0105246_114748312 90
323 3300013100 Ga0157373_10946615 Ga0157373_109466151 90
324 3300013100 Ga0157373_11020722 Ga0157373_110207222 90
325 3300013102 Ga0157371_10535397 Ga0157371_105353972 90
326 3300013102 Ga0157371_11049536 Ga0157371_110495362 90
327 3300013296 Ga0157374_10000486 Ga0157374_1000048615 90
328 3300013296 Ga0157374_11384739 Ga0157374_113847392 90
329 3300013297 Ga0157378_10911306 Ga0157378_109113062 90
330 3300013297 Ga0157378_11154143 Ga0157378_111541432 90
331 3300013307 Ga0157372_11889407 Ga0157372_118894071 90
332 3300013307 Ga0157372_12209078 Ga0157372_122090782 90
333 3300013308 Ga0157375_10143923 Ga0157375_101439232 90
334 3300013308 Ga0157375_10577319 Ga0157375_105773191 90
335 3300013308 Ga0157375_11667078 Ga0157375_116670781 90
336 3300014325 Ga0163163_10324123 Ga0163163_103241232 90
337 3300014325 Ga0163163_11106650 Ga0163163_111066502 90
338 3300014326 Ga0157380_10078364 Ga0157380_100783642 90
339 3300014326 Ga0157380_10361377 Ga0157380_103613772 90
340 3300014326 Ga0157380_10713761 Ga0157380_107137612 90
341 3300014968 Ga0157379_11082006 Ga0157379_110820062 90
342 3300014968 Ga0157379_12249395 Ga0157379_122493952 90
343 3300017792 Ga0163161_10893499 Ga0163161_108934992 90
344 3300017792 Ga0163161_10895310 Ga0163161_108953102 90
345 3300020070 Ga0206356_10616121 Ga0206356_106161212 90
346 3300020075 Ga0206349_1457925 Ga0206349_14579252 90
347 3300020081 Ga0206354_10119565 Ga0206354_101195652 90
348 3300020081 Ga0206354_10296703 Ga0206354_102967032 90
349 3300021358 Ga0213873_10092166 Ga0213873_100921662 90
350 3300021377 Ga0213874_10002224 Ga0213874_100022245 90
351 3300021384 Ga0213876_10055763 Ga0213876_100557633 90
352 3300021384 Ga0213876_10130484 Ga0213876_101304842 90
353 3300021384 Ga0213876_10378840 Ga0213876_103788402 90
354 3300021388 Ga0213875_10009523 Ga0213875_100095232 90
355 3300021388 Ga0213875_10396594 Ga0213875_103965941 90
356 3300025898 Ga0207692_10000002 Ga0207692_10000002108 90
357 3300025898 Ga0207692_10042051 Ga0207692_100420511 90
358 3300025898 Ga0207692_10943789 Ga0207692_109437891 90
359 3300025899 Ga0207642_10000002 Ga0207642_10000002550 90
360 3300025899 Ga0207642_10043149 Ga0207642_100431493 90
361 3300025899 Ga0207642_10121232 Ga0207642_101212323 90
362 3300025900 Ga0207710_10000157 Ga0207710_1000015764 90
363 3300025901 Ga0207688_10121473 Ga0207688_101214732 90
364 3300025904 Ga0207647_10094814 Ga0207647_100948142 90
365 3300025905 Ga0207685_10000054 Ga0207685_1000005417 90
366 3300025905 Ga0207685_10101261 Ga0207685_101012612 90
367 3300025908 Ga0207643_10280706 Ga0207643_102807061 90
368 3300025908 Ga0207643_10317187 Ga0207643_103171872 90
369 3300025909 Ga0207705_10224427 Ga0207705_102244272 90
370 3300025909 Ga0207705_10366792 Ga0207705_103667922 90
371 3300025910 Ga0207684_10493448 Ga0207684_104934482 90
372 3300025910 Ga0207684_11522468 Ga0207684_115224681 90
373 3300025912 Ga0207707_10105365 Ga0207707_101053651 90
374 3300025912 Ga0207707_10439286 Ga0207707_104392862 90
375 3300025912 Ga0207707_10978503 Ga0207707_109785032 90
376 3300025915 Ga0207693_10000017 Ga0207693_10000017141 90
377 3300025915 Ga0207693_10007317 Ga0207693_100073173 90
378 3300025915 Ga0207693_10209570 Ga0207693_102095701 90
379 3300025916 Ga0207663_10041078 Ga0207663_100410783 90
380 3300025916 Ga0207663_10087499 Ga0207663_100874992 90
381 3300025916 Ga0207663_10174848 Ga0207663_101748482 90
382 3300025917 Ga0207660_10908409 Ga0207660_109084092 90
383 3300025919 Ga0207657_10015215 Ga0207657_100152157 90
384 3300025919 Ga0207657_10024542 Ga0207657_100245422 90
385 3300025919 Ga0207657_10264666 Ga0207657_102646661 90
386 3300025919 Ga0207657_10399266 Ga0207657_103992662 90
387 3300025920 Ga0207649_11341161 Ga0207649_113411612 90
388 3300025921 Ga0207652_10001733 Ga0207652_1000173313 90
389 3300025921 Ga0207652_11087242 Ga0207652_110872422 90
390 3300025923 Ga0207681_10500747 Ga0207681_105007472 90
391 3300025923 Ga0207681_10560909 Ga0207681_105609093 90
392 3300025924 Ga0207694_10000063 Ga0207694_10000063120 90
393 3300025925 Ga0207650_10532676 Ga0207650_105326761 90
394 3300025927 Ga0207687_10233819 Ga0207687_102338192 90
395 3300025927 Ga0207687_10392946 Ga0207687_103929462 90
396 3300025927 Ga0207687_10541847 Ga0207687_105418472 90
397 3300025927 Ga0207687_10701670 Ga0207687_107016701 90
398 3300025927 Ga0207687_11042530 Ga0207687_110425302 90
399 3300025927 Ga0207687_11112135 Ga0207687_111121351 90
400 3300025927 Ga0207687_11340627 Ga0207687_113406271 90
401 3300025928 Ga0207700_10305807 Ga0207700_103058072 90
402 3300025928 Ga0207700_10819662 Ga0207700_108196621 90
403 3300025928 Ga0207700_10950900 Ga0207700_109509001 90
404 3300025929 Ga0207664_10000004 Ga0207664_10000004348 90
405 3300025929 Ga0207664_10001287 Ga0207664_100012877 90
406 3300025929 Ga0207664_10099009 Ga0207664_100990095 90
407 3300025929 Ga0207664_10273872 Ga0207664_102738722 90
408 3300025929 Ga0207664_10364503 Ga0207664_103645032 90
409 3300025929 Ga0207664_11121557 Ga0207664_111215572 90
410 3300025929 Ga0207664_11153924 Ga0207664_111539241 90
411 3300025929 Ga0207664_11445807 Ga0207664_114458072 90
412 3300025932 Ga0207690_10000061 Ga0207690_1000006174 90
413 3300025932 Ga0207690_10053568 Ga0207690_100535683 90
414 3300025932 Ga0207690_10303568 Ga0207690_103035683 90
415 3300025933 Ga0207706_10074324 Ga0207706_100743242 90
416 3300025935 Ga0207709_10223893 Ga0207709_102238931 90
417 3300025935 Ga0207709_10344509 Ga0207709_103445092 90
418 3300025935 Ga0207709_10487667 Ga0207709_104876672 90
419 3300025935 Ga0207709_10529460 Ga0207709_105294602 90
420 3300025935 Ga0207709_10747884 Ga0207709_107478842 90
421 3300025935 Ga0207709_10818772 Ga0207709_108187722 90
422 3300025935 Ga0207709_10939249 Ga0207709_109392492 90
423 3300025937 Ga0207669_10000026 Ga0207669_1000002610 90
424 3300025937 Ga0207669_10329366 Ga0207669_103293662 90
425 3300025938 Ga0207704_10681243 Ga0207704_106812432 90
426 3300025939 Ga0207665_10199493 Ga0207665_101994932 90
427 3300025940 Ga0207691_10454496 Ga0207691_104544963 90
428 3300025944 Ga0207661_10004460 Ga0207661_100044605 90
429 3300025944 Ga0207661_10027597 Ga0207661_100275972 90
430 3300025944 Ga0207661_10260278 Ga0207661_102602783 90
431 3300025944 Ga0207661_10261300 Ga0207661_102613002 90
432 3300025944 Ga0207661_10579153 Ga0207661_105791532 90
433 3300025944 Ga0207661_10846102 Ga0207661_108461022 90
434 3300025945 Ga0207679_10195241 Ga0207679_101952415 90
435 3300025945 Ga0207679_10506525 Ga0207679_105065253 90
436 3300025961 Ga0207712_10258064 Ga0207712_102580642 90
437 3300025961 Ga0207712_10596394 Ga0207712_105963942 90
438 3300025972 Ga0207668_10345064 Ga0207668_103450642 90
439 3300025972 Ga0207668_10592328 Ga0207668_105923282 90
440 3300025981 Ga0207640_10219958 Ga0207640_102199581 90
441 3300025986 Ga0207658_10243740 Ga0207658_102437402 90
442 3300025986 Ga0207658_11288330 Ga0207658_112883302 90
443 3300026023 Ga0207677_10203954 Ga0207677_102039543 90
444 3300026023 Ga0207677_11708302 Ga0207677_117083022 90
445 3300026023 Ga0207677_12160282 Ga0207677_121602822 90
446 3300026067 Ga0207678_10350887 Ga0207678_103508872 90
447 3300026067 Ga0207678_11477093 Ga0207678_114770932 90
448 3300026075 Ga0207708_10074867 Ga0207708_100748671 90
449 3300026078 Ga0207702_10165843 Ga0207702_101658433 90
450 3300026089 Ga0207648_10095280 Ga0207648_100952804 90
451 3300026089 Ga0207648_10153544 Ga0207648_101535442 90
452 3300026095 Ga0207676_12405291 Ga0207676_124052911 90
453 3300026116 Ga0207674_10060651 Ga0207674_100606512 90
454 3300026116 Ga0207674_10288656 Ga0207674_102886564 90
455 3300026116 Ga0207674_10771155 Ga0207674_107711552 90
456 3300026118 Ga0207675_100197006 Ga0207675_1001970062 90
457 3300026118 Ga0207675_100592470 Ga0207675_1005924702 90
458 3300026118 Ga0207675_102317010 Ga0207675_1023170101 90
459 3300026121 Ga0207683_10524544 Ga0207683_105245442 90
460 3300026142 Ga0207698_10313173 Ga0207698_103131733 90
461 3300026142 Ga0207698_12056343 Ga0207698_120563432 90
462 3300026142 Ga0207698_12432044 Ga0207698_124320441 90
463 3300027907 Ga0207428_10135223 Ga0207428_101352233 90
464 3300028379 Ga0268266_10006356 Ga0268266_100063565 90
465 3300028380 Ga0268265_10447918 Ga0268265_104479182 90
466 3300028381 Ga0268264_10805357 Ga0268264_108053572 90
467 3300028558 Ga0265326_10000055 Ga0265326_1000005538 90
468 3300028563 Ga0265319_1000668 Ga0265319_100066810 90
469 3300028573 Ga0265334_10000002 Ga0265334_10000002152 90
470 3300028573 Ga0265334_10353605 Ga0265334_103536052 90
471 3300028577 Ga0265318_10023246 Ga0265318_100232467 90
472 3300028666 Ga0265336_10008426 Ga0265336_100084262 90
473 3300028800 Ga0265338_10002429 Ga0265338_1000242915 90
474 3300028800 Ga0265338_10247471 Ga0265338_102474712 90
475 3300028800 Ga0265338_10488746 Ga0265338_104887462 90
476 3300029957 Ga0265324_10010259 Ga0265324_100102592 90
477 3300030521 Ga0307511_10174789 Ga0307511_101747892 90
478 3300030878 Ga0265770_1150929 Ga0265770_11509292 90
479 3300031240 Ga0265320_10336483 Ga0265320_103364832 90
480 3300031247 Ga0265340_10516002 Ga0265340_105160021 90
481 3300031251 Ga0265327_10020649 Ga0265327_100206493 90
482 3300031548 Ga0307408_100826038 Ga0307408_1008260382 90
483 3300031548 Ga0307408_102429473 Ga0307408_1024294732 90
484 3300031691 Ga0316579_10313941 Ga0316579_103139412 90
485 3300031727 Ga0316576_10015088 Ga0316576_100150883 90
486 3300031728 Ga0316578_10054379 Ga0316578_100543794 90
487 3300031728 Ga0316578_10400928 Ga0316578_104009282 90
488 3300031730 Ga0307516_10840929 Ga0307516_108409292 90
489 3300031824 Ga0307413_10128082 Ga0307413_101280822 90
490 3300031824 Ga0307413_10519217 Ga0307413_105192172 90
491 3300031852 Ga0307410_10020672 Ga0307410_100206725 90
492 3300031901 Ga0307406_10316024 Ga0307406_103160242 90
493 3300031903 Ga0307407_10166881 Ga0307407_101668812 90
494 3300031995 Ga0307409_100022486 Ga0307409_1000224864 90
495 3300031995 Ga0307409_102511552 Ga0307409_1025115522 90
496 3300032002 Ga0307416_100950548 Ga0307416_1009505482 90
497 3300032002 Ga0307416_101299249 Ga0307416_1012992492 90
498 3300032002 Ga0307416_101749010 Ga0307416_1017490102 90
499 3300032004 Ga0307414_10085781 Ga0307414_100857815 90
500 3300032004 Ga0307414_10913460 Ga0307414_109134603 90
501 3300032126 Ga0307415_100274037 Ga0307415_1002740372 90
502 3300032126 Ga0307415_101288229 Ga0307415_1012882292 90
503 3300032126 Ga0307415_101486506 Ga0307415_1014865062 90
504 3300032126 Ga0307415_101779492 Ga0307415_1017794922 90
505 3300035086 Ga0373934_0118179 Ga0373934_0118179_86_361 90
506 3300035119 Ga0373956_0386972 Ga0373956_0386972_93_368 90
507 3300035120 Ga0373957_0234279 Ga0373957_0234279_227_502 90
508 3300035170 Ga0373943_0333905 Ga0373943_0333905_443_718 90
509 3300035172 Ga0373955_0212644 Ga0373955_0212644_559_834 90
510 3300035398 Ga0316574_0129697 Ga0316574_0129697_1026_1298 90
511 3300035398 Ga0316574_0159256 Ga0316574_0159256_447_719 90
512 3300035410 Ga0373924_0426923 Ga0373924_0426923_39_314 90
513 3300035692 Ga0373935_0623536 Ga0373935_0623536_235_510 90
514 3300035724 Ga0373933_0041028 Ga0373933_0041028_503_778 90
515 3300035725 Ga0373947_0993939 Ga0373947_0993939_199_474 90
516 3300036401 Ga0373937_0067935 Ga0373937_0067935_366_641 90
517 3300037312 Ga0395899_0442078 Ga0395899_0442078_225_497 90
518 3300037312 Ga0395899_0452305 Ga0395899_0452305_195_467 90
519 3300037418 Ga0395900_0004473 Ga0395900_0004473_13898_14173 90
520 3300037418 Ga0395900_0521628 Ga0395900_0521628_537_809 90
521 3300037418 Ga0395900_1268272 Ga0395900_1268272_22_294 90
522 3300037466 Ga0395898_0019765 Ga0395898_0019765_3656_3931 90
523 3300037466 Ga0395898_0122781 Ga0395898_0122781_1892_2164 90
524 3300037466 Ga0395898_0318891 Ga0395898_0318891_904_1176 90
525 3300037466 Ga0395898_0380894 Ga0395898_0380894_996_1268 90
526 3300037466 Ga0395898_1564967 Ga0395898_1564967_251_523 90
527 3300037471 Ga0395905_0177392 Ga0395905_0177392_543_815 90
528 3300037471 Ga0395905_1151938 Ga0395905_1151938_180_452 90
529 3300037853 Ga0436364_0056691 Ga0436364_0056691_380_652 90
530 3300037853 Ga0436364_0182733 Ga0436364_0182733_820_1092 90
531 3300037853 Ga0436364_0340935 Ga0436364_0340935_41_313 90
532 3300037853 Ga0436364_0396625 Ga0436364_0396625_12917_13189 90
533 3300037853 Ga0436364_0596104 Ga0436364_0596104_502_774 90
534 3300037853 Ga0436364_0633473 Ga0436364_0633473_162_434 90
535 3300037853 Ga0436364_0683105 Ga0436364_0683105_149_421 90
536 3300037853 Ga0436364_0927829 Ga0436364_0927829_230_502 90
537 3300037853 Ga0436364_1256858 Ga0436364_1256858_1090_1365 90
538 3300038443 Ga0395901_0298635 Ga0395901_0298635_591_866 90
539 3300039437 Ga0436365_0317228 Ga0436365_0317228_768_1040 90
540 3300039437 Ga0436365_0880813 Ga0436365_0880813_5079_5351 90
541 3300039437 Ga0436365_1739237 Ga0436365_1739237_3676_3948 90
542 3300039437 Ga0436365_1769610 Ga0436365_1769610_267_539 90
543 3300039437 Ga0436365_1916648 Ga0436365_1916648_619_891 90
544 3300039438 Ga0436360_0288203 Ga0436360_0288203_184_492 90
545 3300039438 Ga0436360_0582220 Ga0436360_0582220_46_318 90
546 3300039438 Ga0436360_0586945 Ga0436360_0586945_711_983 90
547 3300039438 Ga0436360_1226577 Ga0436360_1226577_27_299 90
548 3300039447 Ga0436361_0134666 Ga0436361_0134666_186_458 90
549 3300039450 Ga0436363_0694210 Ga0436363_0694210_132_404 90
550 3300039450 Ga0436363_1256778 Ga0436363_1256778_89_364 90
551 3300039450 Ga0436363_1312051 Ga0436363_1312051_210_482 90
552 3300039450 Ga0436363_1718526 Ga0436363_1718526_36114_36386 90
553 3300039453 Ga0436362_0442845 Ga0436362_0442845_182_454 90
554 3300039453 Ga0436362_0758568 Ga0436362_0758568_578_850 90
555 3300039453 Ga0436362_0805187 Ga0436362_0805187_452_724 90
556 3300039453 Ga0436362_1183670 Ga0436362_1183670_554_826 90
557 3300041441 Ga0451787_247203 Ga0451787_247203_66_341 90
558 3300041512 Ga0451853_0810194 Ga0451853_0810194_245_520 90
559 3300041512 Ga0451853_0900918 Ga0451853_0900918_503_775 90
560 3300042008 Ga0439450_003123 Ga0439450_003123_985_1260 90
561 3300042016 Ga0439463_097293 Ga0439463_097293_465_740 90
562 3300042439 Ga0439464_0075527 Ga0439464_0075527_81_356 90
563 3300044656 Ga0466969_0127322 Ga0466969_0127322_220_495 90
564 3300044656 Ga0466969_0336148 Ga0466969_0336148_51_323 90
565 3300044656 Ga0466969_0382067 Ga0466969_0382067_299_571 90
566 3300044656 Ga0466969_0538022 Ga0466969_0538022_215_487 90
567 3300044658 Ga0466972_0198445 Ga0466972_0198445_561_833 90
568 3300044683 Ga0466965_0266163 Ga0466965_0266163_24_299 90
569 3300044684 Ga0466966_0565864 Ga0466966_0565864_199_471 90
570 3300044684 Ga0466966_0774208 Ga0466966_0774208_234_509 90
571 3300044693 Ga0466961_0006870 Ga0466961_0006870_1451_1723 90
572 3300044693 Ga0466961_0089433 Ga0466961_0089433_348_620 90
573 3300044693 Ga0466961_0489346 Ga0466961_0489346_26_298 90
574 3300044693 Ga0466961_0846509 Ga0466961_0846509_199_471 90
575 3300044693 Ga0466961_0956501 Ga0466961_0956501_75_347 90
576 3300044694 Ga0466963_0020630 Ga0466963_0020630_236_508 90
577 3300044694 Ga0466963_0030187 Ga0466963_0030187_1291_1563 90
578 3300044694 Ga0466963_0050839 Ga0466963_0050839_429_701 90
579 3300044694 Ga0466963_0078185 Ga0466963_0078185_1313_1585 90
580 3300044694 Ga0466963_0129431 Ga0466963_0129431_265_537 90
581 3300044694 Ga0466963_0765826 Ga0466963_0765826_276_548 90
582 3300044694 Ga0466963_0863666 Ga0466963_0863666_207_479 90
583 3300044706 Ga0466964_0470112 Ga0466964_0470112_216_488 90
584 3300044719 Ga0466971_0081739 Ga0466971_0081739_1012_1284 90
585 3300044719 Ga0466971_0091718 Ga0466971_0091718_844_1116 90
586 3300044719 Ga0466971_0363148 Ga0466971_0363148_186_461 90
587 3300044735 Ga0466968_0052512 Ga0466968_0052512_1405_1683 90
588 3300044735 Ga0466968_0515028 Ga0466968_0515028_260_532 90
589 3300044735 Ga0466968_0622832 Ga0466968_0622832_58_330 90
590 3300044735 Ga0466968_0662974 Ga0466968_0662974_216_488 90
591 3300044842 Ga0466957_0150879 Ga0466957_0150879_879_1151 90
592 3300044842 Ga0466957_0151976 Ga0466957_0151976_675_947 90
593 3300044842 Ga0466957_0267188 Ga0466957_0267188_88_360 90
594 3300044842 Ga0466957_1215953 Ga0466957_1215953_243_515 90
595 3300044842 Ga0466957_1292834 Ga0466957_1292834_239_511 90
596 3300044901 Ga0466960_0641750 Ga0466960_0641750_164_436 90
597 3300045049 Ga0466959_0003480 Ga0466959_0003480_1778_2050 90
598 3300045049 Ga0466959_0021206 Ga0466959_0021206_4198_4470 90
599 3300045049 Ga0466959_0044695 Ga0466959_0044695_2601_2876 90
600 3300045049 Ga0466959_0090795 Ga0466959_0090795_924_1196 90
601 3300045049 Ga0466959_0255359 Ga0466959_0255359_755_1030 90
602 3300045049 Ga0466959_0345427 Ga0466959_0345427_21_293 90
603 3300045049 Ga0466959_0719930 Ga0466959_0719930_271_543 90
604 3300045836 Ga0466958_0001313 Ga0466958_0001313_4847_5119 90
605 3300045836 Ga0466958_0022239 Ga0466958_0022239_2813_3085 90
606 3300045836 Ga0466958_0041206 Ga0466958_0041206_2458_2730 90
607 3300045836 Ga0466958_0105709 Ga0466958_0105709_221_493 90
608 3300045836 Ga0466958_0207372 Ga0466958_0207372_210_482 90
609 3300045836 Ga0466958_0383796 Ga0466958_0383796_233_505 90
610 3300045836 Ga0466958_0728816 Ga0466958_0728816_81_353 90
611 3300045836 Ga0466958_0993190 Ga0466958_0993190_148_420 90
612 3300045836 Ga0466958_1070098 Ga0466958_1070098_134_406 90
613 3300045836 Ga0466958_1158554 Ga0466958_1158554_73_345 90
614 3300045976 Ga0466967_0206195 Ga0466967_0206195_1059_1331 90
615 3300045976 Ga0466967_0249157 Ga0466967_0249157_301_573 90
616 3300045976 Ga0466967_0366262 Ga0466967_0366262_435_707 90
617 3300045976 Ga0466967_0393285 Ga0466967_0393285_610_885 90
618 3300045976 Ga0466967_0541911 Ga0466967_0541911_801_1073 90
619 3300045976 Ga0466967_0610525 Ga0466967_0610525_181_453 90
620 3300045976 Ga0466967_1567210 Ga0466967_1567210_173_445 90
621 3300045976 Ga0466967_1908475 Ga0466967_1908475_126_398 90
622 3300046454 Ga0495592_0111914 Ga0495592_0111914_971_1246 90
623 3300046461 Ga0495641_0253496 Ga0495641_0253496_380_655 90
624 3300046462 Ga0495651_0036612 Ga0495651_0036612_2655_2930 90
625 3300046462 Ga0495651_0107857 Ga0495651_0107857_1506_1778 90
626 3300046463 Ga0495653_0183335 Ga0495653_0183335_878_1153 90
627 3300046473 Ga0495582_0517078 Ga0495582_0517078_372_647 90
628 3300046474 Ga0495605_0221020 Ga0495605_0221020_320_592 90
629 3300046474 Ga0495605_0377255 Ga0495605_0377255_75_350 90
630 3300046491 Ga0495584_0291750 Ga0495584_0291750_239_511 90
631 3300046499 Ga0495594_0000089 Ga0495594_0000089_35515_35787 90
632 3300046500 Ga0495596_0180014 Ga0495596_0180014_513_785 90
633 3300046506 Ga0495583_0182782 Ga0495583_0182782_161_433 90
634 3300046511 Ga0495608_0030787 Ga0495608_0030787_979_1254 90
635 3300046511 Ga0495608_0783119 Ga0495608_0783119_82_357 90
636 3300046513 Ga0495616_0420852 Ga0495616_0420852_121_393 90
637 3300046514 Ga0495618_0156676 Ga0495618_0156676_976_1251 90
638 3300046516 Ga0495628_0043322 Ga0495628_0043322_792_1067 90
639 3300046516 Ga0495628_0665260 Ga0495628_0665260_277_552 90
640 3300046517 Ga0495630_0455713 Ga0495630_0455713_90_365 90
641 3300046517 Ga0495630_1521653 Ga0495630_1521653_101_373 90
642 3300046518 Ga0495631_0329464 Ga0495631_0329464_339_611 90
643 3300046523 Ga0495644_0343902 Ga0495644_0343902_280_555 90
644 3300046526 Ga0495666_0221737 Ga0495666_0221737_495_770 90
645 3300046529 Ga0495652_0000037 Ga0495652_0000037_22047_22319 90
646 3300046529 Ga0495652_0076599 Ga0495652_0076599_733_1008 90
647 3300046531 Ga0495665_0629179 Ga0495665_0629179_119_394 90
648 3300046535 Ga0495586_0294396 Ga0495586_0294396_588_863 90
649 3300046536 Ga0495587_0038649 Ga0495587_0038649_545_817 90
650 3300046537 Ga0495598_0005076 Ga0495598_0005076_923_1195 90
651 3300046539 Ga0495621_0017300 Ga0495621_0017300_171_443 90
652 3300046543 Ga0495645_0082948 Ga0495645_0082948_341_613 90
653 3300046543 Ga0495645_0529090 Ga0495645_0529090_50_325 90
654 3300046557 Ga0495622_0000080 Ga0495622_0000080_79694_79966 90
655 3300046559 Ga0495667_0006950 Ga0495667_0006950_2291_2566 90
656 3300046616 Ga0495668_0718011 Ga0495668_0718011_83_355 90
657 3300046642 Ga0495634_0203860 Ga0495634_0203860_71_346 90
658 3300046663 Ga0495635_0086089 Ga0495635_0086089_868_1143 90
659 3300046675 Ga0495657_0092277 Ga0495657_0092277_965_1240 90
660 3300046679 Ga0495623_0485752 Ga0495623_0485752_279_554 90
661 3300046680 Ga0495646_0019644 Ga0495646_0019644_1783_2058 90
662 3300046680 Ga0495646_0086605 Ga0495646_0086605_697_972 90
663 3300046680 Ga0495646_0549652 Ga0495646_0549652_186_461 90
664 3300046689 Ga0495613_0193447 Ga0495613_0193447_792_1067 90
665 3300046691 Ga0495670_0301546 Ga0495670_0301546_246_518 90
666 3300046694 Ga0495649_0002403 Ga0495649_0002403_2356_2628 90
667 3300046809 Ga0495600_0604306 Ga0495600_0604306_134_409 90
668 3300047315 Ga0495581_0280699 Ga0495581_0280699_276_551 90
669 3300047315 Ga0495581_0628907 Ga0495581_0628907_88_363 90
670 3300047317 Ga0495604_0000180 Ga0495604_0000180_20258_20533 90
671 3300047317 Ga0495604_0007642 Ga0495604_0007642_5631_5906 90
672 3300047319 Ga0495674_0094695 Ga0495674_0094695_914_1189 90
673 3300047319 Ga0495674_0283349 Ga0495674_0283349_776_1051 90
674 3300047322 Ga0495680_0014675 Ga0495680_0014675_3641_3916 90
675 3300047322 Ga0495680_0280645 Ga0495680_0280645_858_1133 90
676 3300047446 Ga0495679_214771 Ga0495679_214771_17_289 90
677 3300047471 Ga0495684_0016197 Ga0495684_0016197_2160_2435 90
678 3300047472 Ga0495686_0495880 Ga0495686_0495880_68_346 90
679 3300047673 Ga0495593_0517974 Ga0495593_0517974_217_492 90
680 3300048088 Ga0495602_0008743 Ga0495602_0008743_7992_8267 90
681 3300048089 Ga0495614_0357210 Ga0495614_0357210_19_291 90
682 3300048089 Ga0495614_0616965 Ga0495614_0616965_64_339 90
683 3300048903 Ga0496100_1235958 Ga0496100_1235958_115_387 90
684 3300048905 Ga0496102_0098230 Ga0496102_0098230_1623_1901 90
685 3300048905 Ga0496102_1300863 Ga0496102_1300863_106_378 90
686 3300048905 Ga0496102_1401763 Ga0496102_1401763_89_364 90
687 3300048905 Ga0496102_1960039 Ga0496102_1960039_24_296 90
688 3300048906 Ga0496103_0869993 Ga0496103_0869993_48_320 90
689 3300048907 Ga0496104_0353921 Ga0496104_0353921_67_342 90
690 3300048907 Ga0496104_1065809 Ga0496104_1065809_18_290 90
691 3300048908 Ga0496105_0163811 Ga0496105_0163811_566_841 90
692 3300048908 Ga0496105_0180512 Ga0496105_0180512_1240_1515 90
693 3300048910 Ga0496107_0432123 Ga0496107_0432123_522_800 90
694 3300048911 Ga0496108_0246111 Ga0496108_0246111_1145_1420 90
695 3300048911 Ga0496108_0928548 Ga0496108_0928548_304_579 90
696 3300048912 Ga0496109_0028156 Ga0496109_0028156_1533_1805 90
697 3300048912 Ga0496109_0268041 Ga0496109_0268041_189_461 90
698 3300048912 Ga0496109_0389996 Ga0496109_0389996_351_626 90
699 3300048912 Ga0496109_1267237 Ga0496109_1267237_338_610 90
700 3300048913 Ga0496110_0043633 Ga0496110_0043633_3308_3580 90
701 3300048913 Ga0496110_0048116 Ga0496110_0048116_2033_2308 90
702 3300048913 Ga0496110_0110955 Ga0496110_0110955_425_697 90
703 3300048913 Ga0496110_0360790 Ga0496110_0360790_420_695 90
704 3300048913 Ga0496110_0618428 Ga0496110_0618428_107_379 90
705 3300048914 Ga0496111_0061048 Ga0496111_0061048_651_923 90
706 3300048914 Ga0496111_0102855 Ga0496111_0102855_1224_1496 90
707 3300048914 Ga0496111_0270593 Ga0496111_0270593_708_983 90
708 3300048914 Ga0496111_1198506 Ga0496111_1198506_213_485 90
709 3300048915 Ga0496112_0003200 Ga0496112_0003200_11527_11799 90
710 3300048915 Ga0496112_0294528 Ga0496112_0294528_323_598 90
711 3300048915 Ga0496112_0715086 Ga0496112_0715086_453_725 90
712 3300048915 Ga0496112_0933414 Ga0496112_0933414_252_527 90
713 3300048916 Ga0496113_0017081 Ga0496113_0017081_4107_4379 90
714 3300048916 Ga0496113_0051309 Ga0496113_0051309_1652_1924 90
715 3300048916 Ga0496113_0183507 Ga0496113_0183507_223_498 90
716 3300048916 Ga0496113_0681845 Ga0496113_0681845_248_523 90
717 3300048917 Ga0496114_0286170 Ga0496114_0286170_806_1081 90
718 3300048918 Ga0496115_0053430 Ga0496115_0053430_400_675 90
719 3300048927 Ga0496124_0333864 Ga0496124_0333864_673_945 90
720 3300049568 Ga0501031_0061766 Ga0501031_0061766_1428_1703 90
721 3300049569 Ga0501032_0026816 Ga0501032_0026816_567_842 90
722 3300049569 Ga0501032_0462187 Ga0501032_0462187_255_530 90
723 3300049570 Ga0501033_0022701 Ga0501033_0022701_267_542 90
724 3300049570 Ga0501033_1040333 Ga0501033_1040333_146_421 90
725 3300049571 Ga0501034_0007459 Ga0501034_0007459_1325_1600 90
726 3300049571 Ga0501034_0351400 Ga0501034_0351400_743_1018 90
727 3300049571 Ga0501034_0416241 Ga0501034_0416241_485_760 90
728 3300049571 Ga0501034_0648631 Ga0501034_0648631_396_671 90
729 3300049571 Ga0501034_0710558 Ga0501034_0710558_279_551 90
730 3300049572 Ga0501036_0704035 Ga0501036_0704035_530_805 90
731 3300049572 Ga0501036_1464734 Ga0501036_1464734_67_339 90
732 3300049573 Ga0501037_0007442 Ga0501037_0007442_7440_7715 90
733 3300049574 Ga0501038_0044559 Ga0501038_0044559_291_566 90
734 3300049575 Ga0501039_0009178 Ga0501039_0009178_4308_4583 90
735 3300049575 Ga0501039_0388229 Ga0501039_0388229_314_586 90
736 3300049578 Ga0501042_0830635 Ga0501042_0830635_135_413 90
737 3300049578 Ga0501042_1182692 Ga0501042_1182692_235_510 90
738 3300049579 Ga0501043_0144817 Ga0501043_0144817_285_560 90
739 3300049579 Ga0501043_1275843 Ga0501043_1275843_80_355 90
740 3300049581 Ga0501047_0047006 Ga0501047_0047006_3675_3950 90
741 3300049581 Ga0501047_0102736 Ga0501047_0102736_1893_2168 90
742 3300049581 Ga0501047_0875130 Ga0501047_0875130_224_499 90
743 3300049582 Ga0501048_0036756 Ga0501048_0036756_141_416 90
744 3300049583 Ga0501067_0014003 Ga0501067_0014003_2221_2496 90
745 3300049584 Ga0501068_0069572 Ga0501068_0069572_307_582 90
746 3300049584 Ga0501068_0152016 Ga0501068_0152016_1007_1279 90
747 3300049584 Ga0501068_0448998 Ga0501068_0448998_316_591 90
748 3300049585 Ga0501069_0003466 Ga0501069_0003466_4509_4784 90
749 3300049585 Ga0501069_0815103 Ga0501069_0815103_184_462 90
750 3300049586 Ga0501070_0100146 Ga0501070_0100146_550_825 90
751 3300049586 Ga0501070_0281669 Ga0501070_0281669_828_1106 90
752 3300049586 Ga0501070_0772670 Ga0501070_0772670_399_674 90
753 3300049586 Ga0501070_1178293 Ga0501070_1178293_292_567 90
754 3300049587 Ga0501071_0054443 Ga0501071_0054443_93_368 90
755 3300049587 Ga0501071_0957945 Ga0501071_0957945_159_431 90
756 3300049589 Ga0501073_0018408 Ga0501073_0018408_1250_1525 90
757 3300049590 Ga0501074_0070465 Ga0501074_0070465_2163_2438 90
758 3300049590 Ga0501074_0569495 Ga0501074_0569495_236_508 90
759 3300049590 Ga0501074_0847468 Ga0501074_0847468_361_633 90
760 3300049591 Ga0501075_0835381 Ga0501075_0835381_352_624 90
761 3300049591 Ga0501075_1024984 Ga0501075_1024984_161_433 90
762 3300049741 Ga0501079_1129306 Ga0501079_1129306_162_437 90
763 3300049742 Ga0501080_0296913 Ga0501080_0296913_77_352 90
764 3300049743 Ga0501081_0523380 Ga0501081_0523380_547_819 90
765 3300049743 Ga0501081_0782213 Ga0501081_0782213_71_346 90
766 3300049744 Ga0501083_0139571 Ga0501083_0139571_448_723 90
767 3300049822 Ga0501035_0120119 Ga0501035_0120119_675_950 90
768 3300049822 Ga0501035_1049988 Ga0501035_1049988_279_554 90
769 3300049823 Ga0501044_0155168 Ga0501044_0155168_338_613 90
770 3300049823 Ga0501044_0724393 Ga0501044_0724393_310_585 90
771 3300049823 Ga0501044_1068581 Ga0501044_1068581_352_627 90
772 3300050490 nmdc:mga03n38_162620_c1 nmdc:mga03n38_162620_c1_717_992 90
773 3300050490 nmdc:mga03n38_288707_c1 nmdc:mga03n38_288707_c1_489_761 90
774 3300050490 nmdc:mga03n38_511612_c1 nmdc:mga03n38_511612_c1_172_450 90
775 3300050490 nmdc:mga03n38_532606_c1 nmdc:mga03n38_532606_c1_159_437 90
776 3300050491 nmdc:mga00v17_29534_c1 nmdc:mga00v17_29534_c1_783_1055 90
777 3300050491 nmdc:mga00v17_31587_c1 nmdc:mga00v17_31587_c1_1760_2032 90
778 3300050492 nmdc:mga0yw44_123420_c1 nmdc:mga0yw44_123420_c1_567_839 90
779 3300050492 nmdc:mga0yw44_21241_c1 nmdc:mga0yw44_21241_c1_2454_2726 90
780 3300050492 nmdc:mga0yw44_226755_c1 nmdc:mga0yw44_226755_c1_221_493 90
781 3300050492 nmdc:mga0yw44_39211_c1 nmdc:mga0yw44_39211_c1_368_646 90
782 3300050492 nmdc:mga0yw44_39304_c2 nmdc:mga0yw44_39304_c2_1366_1650 90
783 3300050492 nmdc:mga0yw44_630870_c1 nmdc:mga0yw44_630870_c1_123_395 90
784 3300050492 nmdc:mga0yw44_741915_c1 nmdc:mga0yw44_741915_c1_66_344 90
785 3300050494 nmdc:mga06z11_475450_c1 nmdc:mga06z11_475450_c1_177_449 90
786 3300050496 nmdc:mga07m45_598102_c1 nmdc:mga07m45_598102_c1_143_421 90
787 3300050507 nmdc:mga05p37_1092287_c1 nmdc:mga05p37_1092287_c1_246_518 90
788 3300050507 nmdc:mga05p37_1213059_c1 nmdc:mga05p37_1213059_c1_164_439 90
789 3300050507 nmdc:mga05p37_1730138_c1 nmdc:mga05p37_1730138_c1_208_489 90
790 3300050507 nmdc:mga05p37_38150_c1 nmdc:mga05p37_38150_c1_2397_2669 90
791 3300050507 nmdc:mga05p37_4838_c1 nmdc:mga05p37_4838_c1_10249_10524 90
792 3300050507 nmdc:mga05p37_722940_c1 nmdc:mga05p37_722940_c1_224_496 90
793 3300050508 nmdc:mga09592_1527485_c1 nmdc:mga09592_1527485_c1_253_528 90
794 3300050508 nmdc:mga09592_26552_c1 nmdc:mga09592_26552_c1_652_924 90
795 3300050509 nmdc:mga0qj67_1878_c1 nmdc:mga0qj67_1878_c1_691_966 90
796 3300050509 nmdc:mga0qj67_58414_c1 nmdc:mga0qj67_58414_c1_2005_2277 90
797 3300050509 nmdc:mga0qj67_615442_c1 nmdc:mga0qj67_615442_c1_64_339 90
798 3300050509 nmdc:mga0qj67_698310_c1 nmdc:mga0qj67_698310_c1_164_439 90
799 3300050509 nmdc:mga0qj67_702803_c1 nmdc:mga0qj67_702803_c1_344_619 90
800 3300050509 nmdc:mga0qj67_835175_c1 nmdc:mga0qj67_835175_c1_48_320 90
801 3300050510 nmdc:mga06r32_1489137_c1 nmdc:mga06r32_1489137_c1_143_415 90
802 3300050510 nmdc:mga06r32_1662783_c1 nmdc:mga06r32_1662783_c1_268_546 90
803 3300050510 nmdc:mga06r32_51501_c1 nmdc:mga06r32_51501_c1_3165_3437 90
804 3300050511 nmdc:mga08y16_1291533_c1 nmdc:mga08y16_1291533_c1_25_300 90
805 3300050511 nmdc:mga08y16_161005_c1 nmdc:mga08y16_161005_c1_660_932 90
806 3300050511 nmdc:mga08y16_1635126_c1 nmdc:mga08y16_1635126_c1_276_554 90
807 3300050511 nmdc:mga08y16_276127_c1 nmdc:mga08y16_276127_c1_85_360 90
808 3300050512 nmdc:mga0n895_11607_c1 nmdc:mga0n895_11607_c1_5145_5420 90
809 3300050512 nmdc:mga0n895_1678045_c1 nmdc:mga0n895_1678045_c1_98_376 90
810 3300050512 nmdc:mga0n895_679282_c1 nmdc:mga0n895_679282_c1_442_714 90
811 3300050515 nmdc:mga0a205_222744_c1 nmdc:mga0a205_222744_c1_932_1204 90
812 3300050515 nmdc:mga0a205_2890_c1 nmdc:mga0a205_2890_c1_4583_4858 90
813 3300050515 nmdc:mga0a205_43_c1 nmdc:mga0a205_43_c1_46961_47236 90
814 3300053077 Ga0495601_0030105 Ga0495601_0030105_2409_2681 90
815 3300053077 Ga0495601_0625823 Ga0495601_0625823_97_372 90
816 3300053078 Ga0495612_0264583 Ga0495612_0264583_430_702 90
817 3300053083 Ga0495655_0060228 Ga0495655_0060228_606_881 90
818 3300053083 Ga0495655_0299496 Ga0495655_0299496_144_416 90
819 3300053084 Ga0495595_0001706 Ga0495595_0001706_3444_3719 90
820 3300053084 Ga0495595_0117487 Ga0495595_0117487_272_544 90
821 3300053085 Ga0495619_0102675 Ga0495619_0102675_1495_1770 90
822 3300053085 Ga0495619_0877217 Ga0495619_0877217_319_591 90
823 3300053085 Ga0495619_1106653 Ga0495619_1106653_123_395 90
824 3300053102 Ga0500554_141551 Ga0500554_141551_340_612 90
825 3300053104 Ga0500556_0000723 Ga0500556_0000723_13669_13947 90
826 3300053153 Ga0500616_0003272 Ga0500616_0003272_5845_6123 90
827 3300054114 Ga0501084_0095424 Ga0501084_0095424_983_1255 90
828 3300054114 Ga0501084_0816701 Ga0501084_0816701_265_540 90
829 3300060353 Ga0501082_0004774 Ga0501082_0004774_7328_7603 90
830 3300061719 Ga0466962_0154436 Ga0466962_0154436_156_428 90
831 3300061719 Ga0466962_0247253 Ga0466962_0247253_165_437 90
832 3300061719 Ga0466962_0667188 Ga0466962_0667188_64_351 90
833 2088090003 LJN_F7QKVOU01BPN70 LJN_00395700 91
834 3300003373 JGI25407J50210_10002254 JGI25407J50210_100022543 91
835 3300003373 JGI25407J50210_10016283 JGI25407J50210_100162831 91
836 3300003373 JGI25407J50210_10040191 JGI25407J50210_100401911 91
837 3300003373 JGI25407J50210_10042331 JGI25407J50210_100423311 91
838 3300003373 JGI25407J50210_10155187 JGI25407J50210_101551871 91
839 3300003373 JGI25407J50210_10158911 JGI25407J50210_101589112 91
840 3300003373 JGI25407J50210_10175961 JGI25407J50210_101759611 91
841 3300005327 Ga0070658_10065691 Ga0070658_100656914 91
842 3300005328 Ga0070676_10060656 Ga0070676_100606562 91
843 3300005329 Ga0070683_100022894 Ga0070683_1000228947 91
844 3300005329 Ga0070683_100070215 Ga0070683_1000702152 91
845 3300005329 Ga0070683_100632014 Ga0070683_1006320142 91
846 3300005329 Ga0070683_101695435 Ga0070683_1016954351 91
847 3300005330 Ga0070690_101781614 Ga0070690_1017816142 91
848 3300005334 Ga0068869_100904279 Ga0068869_1009042792 91
849 3300005334 Ga0068869_101023048 Ga0068869_1010230481 91
850 3300005336 Ga0070680_100003235 Ga0070680_10000323513 91
851 3300005337 Ga0070682_100392758 Ga0070682_1003927582 91
852 3300005337 Ga0070682_101911320 Ga0070682_1019113201 91
853 3300005338 Ga0068868_101273691 Ga0068868_1012736912 91
854 3300005339 Ga0070660_100086390 Ga0070660_1000863903 91
855 3300005341 Ga0070691_10202242 Ga0070691_102022421 91
856 3300005344 Ga0070661_100183762 Ga0070661_1001837624 91
857 3300005345 Ga0070692_11119985 Ga0070692_111199852 91
858 3300005345 Ga0070692_11138936 Ga0070692_111389362 91
859 3300005347 Ga0070668_100035270 Ga0070668_1000352704 91
860 3300005347 Ga0070668_100171844 Ga0070668_1001718442 91
861 3300005366 Ga0070659_100001769 Ga0070659_1000017693 91
862 3300005438 Ga0070701_11134311 Ga0070701_111343111 91
863 3300005441 Ga0070700_100166414 Ga0070700_1001664142 91
864 3300005441 Ga0070700_101138623 Ga0070700_1011386232 91
865 3300005441 Ga0070700_101438526 Ga0070700_1014385261 91
866 3300005441 Ga0070700_101859525 Ga0070700_1018595251 91
867 3300005455 Ga0070663_101109259 Ga0070663_1011092592 91
868 3300005457 Ga0070662_100025882 Ga0070662_1000258822 91
869 3300005457 Ga0070662_100858756 Ga0070662_1008587561 91
870 3300005458 Ga0070681_10013391 Ga0070681_100133919 91
871 3300005458 Ga0070681_10081595 Ga0070681_100815952 91
872 3300005458 Ga0070681_10148842 Ga0070681_101488423 91
873 3300005459 Ga0068867_100753460 Ga0068867_1007534602 91
874 3300005530 Ga0070679_100023402 Ga0070679_1000234023 91
875 3300005530 Ga0070679_100079902 Ga0070679_1000799022 91
876 3300005530 Ga0070679_100103485 Ga0070679_1001034855 91
877 3300005535 Ga0070684_100042488 Ga0070684_1000424882 91
878 3300005535 Ga0070684_100384564 Ga0070684_1003845642 91
879 3300005535 Ga0070684_100955401 Ga0070684_1009554012 91
880 3300005539 Ga0068853_100468020 Ga0068853_1004680202 91
881 3300005546 Ga0070696_100129375 Ga0070696_1001293752 91
882 3300005546 Ga0070696_100703652 Ga0070696_1007036523 91
883 3300005547 Ga0070693_100188745 Ga0070693_1001887452 91
884 3300005547 Ga0070693_101659354 Ga0070693_1016593542 91
885 3300005549 Ga0070704_100123583 Ga0070704_1001235832 91
886 3300005549 Ga0070704_100389134 Ga0070704_1003891341 91
887 3300005563 Ga0068855_100831070 Ga0068855_1008310702 91
888 3300005564 Ga0070664_100079237 Ga0070664_1000792372 91
889 3300005564 Ga0070664_101095571 Ga0070664_1010955712 91
890 3300005578 Ga0068854_100102148 Ga0068854_1001021483 91
891 3300005578 Ga0068854_100166704 Ga0068854_1001667042 91
892 3300005614 Ga0068856_100013529 Ga0068856_1000135293 91
893 3300005614 Ga0068856_102125987 Ga0068856_1021259872 91
894 3300005615 Ga0070702_100189938 Ga0070702_1001899382 91
895 3300005616 Ga0068852_100011744 Ga0068852_1000117442 91
896 3300005616 Ga0068852_101599261 Ga0068852_1015992612 91
897 3300005719 Ga0068861_100009531 Ga0068861_1000095315 91
898 3300005842 Ga0068858_101633421 Ga0068858_1016334212 91
899 3300005844 Ga0068862_101576972 Ga0068862_1015769722 91
900 3300005937 Ga0081455_10053723 Ga0081455_100537232 91
901 3300005937 Ga0081455_10111002 Ga0081455_101110022 91
902 3300005981 Ga0081538_10000020 Ga0081538_1000002098 91
903 3300005981 Ga0081538_10000316 Ga0081538_1000031610 91
904 3300005981 Ga0081538_10000526 Ga0081538_1000052638 91
905 3300005981 Ga0081538_10000796 Ga0081538_1000079628 91
906 3300005981 Ga0081538_10006314 Ga0081538_1000631411 91
907 3300005981 Ga0081538_10008324 Ga0081538_100083241 91
908 3300005981 Ga0081538_10009245 Ga0081538_100092453 91
909 3300005981 Ga0081538_10016481 Ga0081538_100164812 91
910 3300005981 Ga0081538_10030794 Ga0081538_100307942 91
911 3300005981 Ga0081538_10045609 Ga0081538_100456094 91
912 3300005981 Ga0081538_10234719 Ga0081538_102347192 91
913 3300005981 Ga0081538_10342458 Ga0081538_103424581 91
914 3300005981 Ga0081538_10361788 Ga0081538_103617882 91
915 3300005983 Ga0081540_1091037 Ga0081540_10910371 91
916 3300005985 Ga0081539_10105485 Ga0081539_101054852 91
917 3300006038 Ga0075365_10351272 Ga0075365_103512722 91
918 3300006038 Ga0075365_10777700 Ga0075365_107777002 91
919 3300006178 Ga0075367_10729014 Ga0075367_107290142 91
920 3300006844 Ga0075428_100068443 Ga0075428_1000684435 91
921 3300006844 Ga0075428_100270136 Ga0075428_1002701362 91
922 3300006844 Ga0075428_100587610 Ga0075428_1005876102 91
923 3300006844 Ga0075428_100928243 Ga0075428_1009282432 91
924 3300006846 Ga0075430_100002367 Ga0075430_10000236712 91
925 3300006846 Ga0075430_100102046 Ga0075430_1001020462 91
926 3300006846 Ga0075430_100102063 Ga0075430_1001020632 91
927 3300006846 Ga0075430_100128027 Ga0075430_1001280272 91
928 3300006847 Ga0075431_100023074 Ga0075431_1000230745 91
929 3300006847 Ga0075431_100034536 Ga0075431_10003453610 91
930 3300006847 Ga0075431_101344468 Ga0075431_1013444681 91
931 3300006847 Ga0075431_101421403 Ga0075431_1014214032 91
932 3300006880 Ga0075429_100073181 Ga0075429_1000731815 91
933 3300006880 Ga0075429_100272994 Ga0075429_1002729942 91
934 3300006881 Ga0068865_102114646 Ga0068865_1021146462 91
935 3300009093 Ga0105240_10042151 Ga0105240_100421512 91
936 3300009093 Ga0105240_12262726 Ga0105240_122627261 91
937 3300009094 Ga0111539_10127738 Ga0111539_101277382 91
938 3300009094 Ga0111539_10188911 Ga0111539_101889113 91
939 3300009094 Ga0111539_10702719 Ga0111539_107027192 91
940 3300009094 Ga0111539_10843792 Ga0111539_108437921 91
941 3300009094 Ga0111539_10966187 Ga0111539_109661872 91
942 3300009094 Ga0111539_11231261 Ga0111539_112312612 91
943 3300009094 Ga0111539_11910599 Ga0111539_119105992 91
944 3300009094 Ga0111539_12577307 Ga0111539_125773071 91
945 3300009098 Ga0105245_10039550 Ga0105245_100395502 91
946 3300009098 Ga0105245_10207973 Ga0105245_102079732 91
947 3300009098 Ga0105245_11784443 Ga0105245_117844432 91
948 3300009101 Ga0105247_11542917 Ga0105247_115429172 91
949 3300009147 Ga0114129_10032936 Ga0114129_100329365 91
950 3300009147 Ga0114129_10085014 Ga0114129_100850145 91
951 3300009147 Ga0114129_10186493 Ga0114129_101864931 91
952 3300009147 Ga0114129_10196371 Ga0114129_101963712 91
953 3300009147 Ga0114129_10238029 Ga0114129_102380293 91
954 3300009147 Ga0114129_10654996 Ga0114129_106549962 91
955 3300009147 Ga0114129_10890314 Ga0114129_108903142 91
956 3300009148 Ga0105243_11966964 Ga0105243_119669642 91
957 3300009174 Ga0105241_11235511 Ga0105241_112355112 91
958 3300009176 Ga0105242_11946905 Ga0105242_119469052 91
959 3300009177 Ga0105248_10558717 Ga0105248_105587173 91
960 3300009545 Ga0105237_10486964 Ga0105237_104869642 91
961 3300009545 Ga0105237_12675576 Ga0105237_126755761 91
962 3300009551 Ga0105238_10006420 Ga0105238_1000642010 91
963 3300009551 Ga0105238_13019884 Ga0105238_130198842 91
964 3300009553 Ga0105249_10007747 Ga0105249_100077476 91
965 3300009553 Ga0105249_11690394 Ga0105249_116903941 91
966 3300009553 Ga0105249_12188160 Ga0105249_121881602 91
967 3300010375 Ga0105239_11323342 Ga0105239_113233422 91
968 3300010375 Ga0105239_12271096 Ga0105239_122710962 91
969 3300012503 Ga0157313_1036071 Ga0157313_10360712 91
970 3300013102 Ga0157371_10038032 Ga0157371_100380323 91
971 3300013104 Ga0157370_10006818 Ga0157370_100068181 91
972 3300013104 Ga0157370_10009424 Ga0157370_1000942414 91
973 3300013105 Ga0157369_10083922 Ga0157369_100839224 91
974 3300013105 Ga0157369_10812174 Ga0157369_108121742 91
975 3300013306 Ga0163162_10774214 Ga0163162_107742142 91
976 3300013307 Ga0157372_10158948 Ga0157372_101589482 91
977 3300013307 Ga0157372_10209146 Ga0157372_102091461 91
978 3300013307 Ga0157372_12121916 Ga0157372_121219162 91
979 3300013307 Ga0157372_12343478 Ga0157372_123434782 91
980 3300014325 Ga0163163_10066394 Ga0163163_100663945 91
981 3300014326 Ga0157380_10922074 Ga0157380_109220742 91
982 3300020069 Ga0197907_10398747 Ga0197907_103987471 91
983 3300020069 Ga0197907_10447489 Ga0197907_104474892 91
984 3300020069 Ga0197907_11459507 Ga0197907_114595072 91
985 3300020070 Ga0206356_10263124 Ga0206356_102631242 91
986 3300020070 Ga0206356_10692343 Ga0206356_106923432 91
987 3300020078 Ga0206352_11075035 Ga0206352_110750352 91
988 3300020080 Ga0206350_11381714 Ga0206350_113817142 91
989 3300020081 Ga0206354_10271309 Ga0206354_102713092 91
990 3300020082 Ga0206353_10202888 Ga0206353_102028882 91
991 3300020082 Ga0206353_11680112 Ga0206353_116801122 91
992 3300021358 Ga0213873_10107793 Ga0213873_101077932 91
993 3300022467 Ga0224712_10645480 Ga0224712_106454802 91
994 3300025901 Ga0207688_10500477 Ga0207688_105004772 91
995 3300025909 Ga0207705_10092413 Ga0207705_100924132 91
996 3300025912 Ga0207707_10082264 Ga0207707_100822643 91
997 3300025912 Ga0207707_10252943 Ga0207707_102529431 91
998 3300025913 Ga0207695_10656539 Ga0207695_106565392 91
999 3300025914 Ga0207671_10073401 Ga0207671_100734014 91
1000 3300025917 Ga0207660_10013331 Ga0207660_100133315 91
1001 3300025919 Ga0207657_10032447 Ga0207657_100324472 91
1002 3300025919 Ga0207657_11423809 Ga0207657_114238091 91
1003 3300025920 Ga0207649_10605926 Ga0207649_106059262 91
1004 3300025921 Ga0207652_10210612 Ga0207652_102106122 91
1005 3300025921 Ga0207652_10537574 Ga0207652_105375741 91
1006 3300025921 Ga0207652_11222040 Ga0207652_112220401 91
1007 3300025924 Ga0207694_10052034 Ga0207694_100520343 91
1008 3300025926 Ga0207659_10563877 Ga0207659_105638772 91
1009 3300025932 Ga0207690_10033640 Ga0207690_100336402 91
1010 3300025933 Ga0207706_10029017 Ga0207706_100290176 91
1011 3300025933 Ga0207706_10765319 Ga0207706_107653192 91
1012 3300025937 Ga0207669_10541818 Ga0207669_105418181 91
1013 3300025937 Ga0207669_11412101 Ga0207669_114121011 91
1014 3300025937 Ga0207669_11441183 Ga0207669_114411831 91
1015 3300025944 Ga0207661_10022742 Ga0207661_100227423 91
1016 3300025944 Ga0207661_10039531 Ga0207661_100395313 91
1017 3300025944 Ga0207661_10582912 Ga0207661_105829122 91
1018 3300025945 Ga0207679_10115413 Ga0207679_101154131 91
1019 3300025945 Ga0207679_10568413 Ga0207679_105684132 91
1020 3300025949 Ga0207667_11012643 Ga0207667_110126431 91
1021 3300025961 Ga0207712_11067052 Ga0207712_110670521 91
1022 3300025972 Ga0207668_10022893 Ga0207668_100228934 91
1023 3300025972 Ga0207668_10482316 Ga0207668_104823162 91
1024 3300025972 Ga0207668_11447689 Ga0207668_114476892 91
1025 3300025981 Ga0207640_10021426 Ga0207640_100214266 91
1026 3300025981 Ga0207640_10160319 Ga0207640_101603192 91
1027 3300026023 Ga0207677_11043414 Ga0207677_110434141 91
1028 3300026023 Ga0207677_12068366 Ga0207677_120683662 91
1029 3300026035 Ga0207703_11781195 Ga0207703_117811952 91
1030 3300026041 Ga0207639_10418044 Ga0207639_104180442 91
1031 3300026075 Ga0207708_10015960 Ga0207708_100159603 91
1032 3300026075 Ga0207708_10196641 Ga0207708_101966412 91
1033 3300026075 Ga0207708_10664741 Ga0207708_106647412 91
1034 3300026075 Ga0207708_11062449 Ga0207708_110624492 91
1035 3300026075 Ga0207708_11123585 Ga0207708_111235852 91
1036 3300026075 Ga0207708_11907667 Ga0207708_119076672 91
1037 3300026078 Ga0207702_10069999 Ga0207702_100699992 91
1038 3300026078 Ga0207702_11458584 Ga0207702_114585842 91
1039 3300026118 Ga0207675_100006700 Ga0207675_1000067007 91
1040 3300026118 Ga0207675_101353004 Ga0207675_1013530041 91
1041 3300026142 Ga0207698_10221625 Ga0207698_102216252 91
1042 3300027665 Ga0209983_1069531 Ga0209983_10695312 91
1043 3300027907 Ga0207428_10065295 Ga0207428_100652953 91
1044 3300027907 Ga0207428_10125159 Ga0207428_101251592 91
1045 3300027907 Ga0207428_10450700 Ga0207428_104507002 91
1046 3300028380 Ga0268265_11341997 Ga0268265_113419972 91
1047 3300031548 Ga0307408_100176899 Ga0307408_1001768992 91
1048 3300031548 Ga0307408_100739547 Ga0307408_1007395472 91
1049 3300031548 Ga0307408_102015716 Ga0307408_1020157161 91
1050 3300031731 Ga0307405_10119287 Ga0307405_101192872 91
1051 3300031731 Ga0307405_10182437 Ga0307405_101824372 91
1052 3300031731 Ga0307405_10374451 Ga0307405_103744512 91
1053 3300031731 Ga0307405_10747377 Ga0307405_107473772 91
1054 3300031824 Ga0307413_10032546 Ga0307413_100325462 91
1055 3300031824 Ga0307413_10100962 Ga0307413_101009622 91
1056 3300031824 Ga0307413_10169885 Ga0307413_101698852 91
1057 3300031824 Ga0307413_12188061 Ga0307413_121880612 91
1058 3300031852 Ga0307410_10023114 Ga0307410_100231143 91
1059 3300031852 Ga0307410_10053498 Ga0307410_100534982 91
1060 3300031852 Ga0307410_10116216 Ga0307410_101162162 91
1061 3300031852 Ga0307410_10166136 Ga0307410_101661362 91
1062 3300031852 Ga0307410_10718033 Ga0307410_107180331 91
1063 3300031852 Ga0307410_11377785 Ga0307410_113777852 91
1064 3300031901 Ga0307406_10014323 Ga0307406_100143234 91
1065 3300031901 Ga0307406_10035805 Ga0307406_100358052 91
1066 3300031901 Ga0307406_10142795 Ga0307406_101427952 91
1067 3300031901 Ga0307406_10176132 Ga0307406_101761322 91
1068 3300031903 Ga0307407_10010943 Ga0307407_100109432 91
1069 3300031903 Ga0307407_10029964 Ga0307407_100299643 91
1070 3300031903 Ga0307407_10136379 Ga0307407_101363792 91
1071 3300031903 Ga0307407_10270629 Ga0307407_102706292 91
1072 3300031903 Ga0307407_10727500 Ga0307407_107275002 91
1073 3300031903 Ga0307407_11304683 Ga0307407_113046832 91
1074 3300031911 Ga0307412_10142268 Ga0307412_101422682 91
1075 3300031911 Ga0307412_10348578 Ga0307412_103485782 91
1076 3300031911 Ga0307412_10639520 Ga0307412_106395202 91
1077 3300031995 Ga0307409_100067446 Ga0307409_1000674462 91
1078 3300031995 Ga0307409_100137973 Ga0307409_1001379732 91
1079 3300031995 Ga0307409_100239582 Ga0307409_1002395821 91
1080 3300031995 Ga0307409_100424827 Ga0307409_1004248272 91
1081 3300031995 Ga0307409_100487396 Ga0307409_1004873962 91
1082 3300031995 Ga0307409_101652512 Ga0307409_1016525121 91
1083 3300031995 Ga0307409_102953779 Ga0307409_1029537792 91
1084 3300032002 Ga0307416_100040585 Ga0307416_1000405852 91
1085 3300032002 Ga0307416_100044688 Ga0307416_1000446884 91
1086 3300032002 Ga0307416_100117348 Ga0307416_1001173482 91
1087 3300032002 Ga0307416_101000922 Ga0307416_1010009222 91
1088 3300032002 Ga0307416_101198300 Ga0307416_1011983002 91
1089 3300032002 Ga0307416_101311271 Ga0307416_1013112711 91
1090 3300032002 Ga0307416_101494886 Ga0307416_1014948862 91
1091 3300032002 Ga0307416_101920349 Ga0307416_1019203492 91
1092 3300032002 Ga0307416_102696664 Ga0307416_1026966641 91
1093 3300032002 Ga0307416_103331950 Ga0307416_1033319502 91
1094 3300032004 Ga0307414_10041832 Ga0307414_100418321 91
1095 3300032004 Ga0307414_10086068 Ga0307414_100860682 91
1096 3300032005 Ga0307411_10011464 Ga0307411_100114643 91
1097 3300032005 Ga0307411_10123147 Ga0307411_101231472 91
1098 3300032005 Ga0307411_10795011 Ga0307411_107950112 91
1099 3300032005 Ga0307411_12247098 Ga0307411_122470982 91
1100 3300032126 Ga0307415_100004435 Ga0307415_1000044356 91
1101 3300032126 Ga0307415_100019353 Ga0307415_1000193532 91
1102 3300032126 Ga0307415_100131046 Ga0307415_1001310462 91
1103 3300032126 Ga0307415_100176455 Ga0307415_1001764552 91
1104 3300032126 Ga0307415_100931861 Ga0307415_1009318612 91
1105 3300035085 Ga0373929_0051240 Ga0373929_0051240_455_733 91
1106 3300035090 Ga0373949_0186905 Ga0373949_0186905_328_606 91
1107 3300035114 Ga0373939_0217159 Ga0373939_0217159_18_296 91
1108 3300035115 Ga0373941_0031493 Ga0373941_0031493_1025_1303 91
1109 3300035170 Ga0373943_0781343 Ga0373943_0781343_259_552 91
1110 3300035241 Ga0373961_0020105 Ga0373961_0020105_1158_1436 91
1111 3300035725 Ga0373947_0438878 Ga0373947_0438878_186_464 91
1112 3300037068 Ga0373925_0453028 Ga0373925_0453028_87_380 91
1113 3300037068 Ga0373925_1381972 Ga0373925_1381972_77_355 91
1114 3300037312 Ga0395899_0145523 Ga0395899_0145523_177_452 91
1115 3300037312 Ga0395899_0861317 Ga0395899_0861317_267_542 91
1116 3300037418 Ga0395900_0686340 Ga0395900_0686340_132_407 91
1117 3300037418 Ga0395900_0918122 Ga0395900_0918122_134_412 91
1118 3300037418 Ga0395900_0998396 Ga0395900_0998396_249_527 91
1119 3300037466 Ga0395898_0010899 Ga0395898_0010899_2528_2803 91
1120 3300037466 Ga0395898_0092869 Ga0395898_0092869_2548_2823 91
1121 3300037466 Ga0395898_0179814 Ga0395898_0179814_1312_1590 91
1122 3300037466 Ga0395898_0270008 Ga0395898_0270008_248_523 91
1123 3300037471 Ga0395905_0022103 Ga0395905_0022103_1264_1539 91
1124 3300038443 Ga0395901_0003277 Ga0395901_0003277_15608_15883 91
1125 3300038443 Ga0395901_0004095 Ga0395901_0004095_917_1192 91
1126 3300038443 Ga0395901_0542179 Ga0395901_0542179_343_618 91
1127 3300038443 Ga0395901_0728090 Ga0395901_0728090_265_540 91
1128 3300038443 Ga0395901_1009683 Ga0395901_1009683_65_343 91
1129 3300038443 Ga0395901_1262649 Ga0395901_1262649_194_469 91
1130 3300039437 Ga0436365_0810329 Ga0436365_0810329_1164_1439 91
1131 3300039453 Ga0436362_0190713 Ga0436362_0190713_824_1099 91
1132 3300041486 Ga0451807_2747498 Ga0451807_2747498_296_571 91
1133 3300041505 Ga0451849_1485368 Ga0451849_1485368_129_404 91
1134 3300041512 Ga0451853_1695930 Ga0451853_1695930_120_398 91
1135 3300041512 Ga0451853_2911824 Ga0451853_2911824_204_479 91
1136 3300042008 Ga0439450_089173 Ga0439450_089173_140_418 91
1137 3300042011 Ga0439454_088417 Ga0439454_088417_71_346 91
1138 3300042016 Ga0439463_163450 Ga0439463_163450_82_360 91
1139 3300042993 Ga0439440_0112817 Ga0439440_0112817_202_480 91
1140 3300045836 Ga0466958_0561216 Ga0466958_0561216_159_437 91
1141 3300045976 Ga0466967_0031652 Ga0466967_0031652_1909_2196 91
1142 3300045976 Ga0466967_0983702 Ga0466967_0983702_25_300 91
1143 3300045976 Ga0466967_1325246 Ga0466967_1325246_393_668 91
1144 3300046457 Ga0495590_0092263 Ga0495590_0092263_218_493 91
1145 3300046474 Ga0495605_0248353 Ga0495605_0248353_386_664 91
1146 3300046492 Ga0495585_0044918 Ga0495585_0044918_1231_1506 91
1147 3300046500 Ga0495596_0042225 Ga0495596_0042225_363_638 91
1148 3300046500 Ga0495596_0094145 Ga0495596_0094145_163_441 91
1149 3300046513 Ga0495616_0335532 Ga0495616_0335532_78_353 91
1150 3300046515 Ga0495620_0354263 Ga0495620_0354263_251_529 91
1151 3300046520 Ga0495637_0144297 Ga0495637_0144297_316_591 91
1152 3300046523 Ga0495644_0118963 Ga0495644_0118963_165_440 91
1153 3300046523 Ga0495644_0275555 Ga0495644_0275555_129_407 91
1154 3300046528 Ga0495642_0055414 Ga0495642_0055414_830_1105 91
1155 3300046539 Ga0495621_0265268 Ga0495621_0265268_221_499 91
1156 3300046616 Ga0495668_0166265 Ga0495668_0166265_457_732 91
1157 3300046689 Ga0495613_0906065 Ga0495613_0906065_233_511 91
1158 3300046691 Ga0495670_0299768 Ga0495670_0299768_298_573 91
1159 3300046691 Ga0495670_0365798 Ga0495670_0365798_115_393 91
1160 3300046794 Ga0495589_0094904 Ga0495589_0094904_563_838 91
1161 3300046794 Ga0495589_0437455 Ga0495589_0437455_154_432 91
1162 3300047320 Ga0495672_0118269 Ga0495672_0118269_40_315 91
1163 3300047320 Ga0495672_0176430 Ga0495672_0176430_584_859 91
1164 3300047321 Ga0495676_0276604 Ga0495676_0276604_441_734 91
1165 3300047445 Ga0495677_0076956 Ga0495677_0076956_468_746 91
1166 3300048090 Ga0495615_0203319 Ga0495615_0203319_110_385 91
1167 3300048905 Ga0496102_0641245 Ga0496102_0641245_307_582 91
1168 3300048905 Ga0496102_0962908 Ga0496102_0962908_171_449 91
1169 3300048906 Ga0496103_0893648 Ga0496103_0893648_121_399 91
1170 3300048908 Ga0496105_1095164 Ga0496105_1095164_76_351 91
1171 3300048911 Ga0496108_0121040 Ga0496108_0121040_1381_1656 91
1172 3300048911 Ga0496108_0319490 Ga0496108_0319490_382_657 91
1173 3300048911 Ga0496108_1388363 Ga0496108_1388363_124_399 91
1174 3300048912 Ga0496109_0293234 Ga0496109_0293234_124_399 91
1175 3300048912 Ga0496109_0401507 Ga0496109_0401507_451_726 91
1176 3300048912 Ga0496109_1059659 Ga0496109_1059659_167_442 91
1177 3300048913 Ga0496110_0107444 Ga0496110_0107444_704_979 91
1178 3300048914 Ga0496111_0015567 Ga0496111_0015567_2584_2859 91
1179 3300048914 Ga0496111_0161076 Ga0496111_0161076_1122_1397 91
1180 3300048915 Ga0496112_0160487 Ga0496112_0160487_378_653 91
1181 3300048916 Ga0496113_0133213 Ga0496113_0133213_1523_1798 91
1182 3300048916 Ga0496113_0777530 Ga0496113_0777530_166_441 91
1183 3300049568 Ga0501031_0223400 Ga0501031_0223400_92_370 91
1184 3300049568 Ga0501031_0620695 Ga0501031_0620695_17_292 91
1185 3300049569 Ga0501032_0782093 Ga0501032_0782093_64_342 91
1186 3300049572 Ga0501036_1041126 Ga0501036_1041126_115_393 91
1187 3300049574 Ga0501038_0280777 Ga0501038_0280777_1005_1283 91
1188 3300049575 Ga0501039_0602231 Ga0501039_0602231_201_479 91
1189 3300049575 Ga0501039_0801166 Ga0501039_0801166_154_429 91
1190 3300049575 Ga0501039_1000910 Ga0501039_1000910_192_470 91
1191 3300049576 Ga0501040_0073682 Ga0501040_0073682_1018_1296 91
1192 3300049576 Ga0501040_0390735 Ga0501040_0390735_70_348 91
1193 3300049577 Ga0501041_0023172 Ga0501041_0023172_61_339 91
1194 3300049577 Ga0501041_0565537 Ga0501041_0565537_63_338 91
1195 3300049577 Ga0501041_0844737 Ga0501041_0844737_284_562 91
1196 3300049578 Ga0501042_0183811 Ga0501042_0183811_224_502 91
1197 3300049578 Ga0501042_0417922 Ga0501042_0417922_321_596 91
1198 3300049580 Ga0501046_0324103 Ga0501046_0324103_392_670 91
1199 3300049582 Ga0501048_0313175 Ga0501048_0313175_45_323 91
1200 3300049582 Ga0501048_0346919 Ga0501048_0346919_378_656 91
1201 3300049582 Ga0501048_0852219 Ga0501048_0852219_215_493 91
1202 3300049582 Ga0501048_1259973 Ga0501048_1259973_132_419 91
1203 3300049583 Ga0501067_0363294 Ga0501067_0363294_435_710 91
1204 3300049587 Ga0501071_0872256 Ga0501071_0872256_147_425 91
1205 3300049588 Ga0501072_0823431 Ga0501072_0823431_229_504 91
1206 3300049588 Ga0501072_0949454 Ga0501072_0949454_369_647 91
1207 3300049590 Ga0501074_0741325 Ga0501074_0741325_241_519 91
1208 3300049591 Ga0501075_0610774 Ga0501075_0610774_106_384 91
1209 3300049591 Ga0501075_1514277 Ga0501075_1514277_59_334 91
1210 3300049593 Ga0501077_0319658 Ga0501077_0319658_392_667 91
1211 3300049741 Ga0501079_1621248 Ga0501079_1621248_211_486 91
1212 3300049743 Ga0501081_0056532 Ga0501081_0056532_2032_2310 91
1213 3300049743 Ga0501081_1147752 Ga0501081_1147752_118_396 91
1214 3300049822 Ga0501035_1058631 Ga0501035_1058631_55_342 91
1215 3300049824 Ga0501045_0069046 Ga0501045_0069046_1971_2249 91
1216 3300049824 Ga0501045_0131179 Ga0501045_0131179_365_643 91
1217 3300049824 Ga0501045_0741403 Ga0501045_0741403_415_690 91
1218 3300050492 nmdc:mga0yw44_116189_c1 nmdc:mga0yw44_116189_c1_875_1153 91
1219 3300050494 nmdc:mga06z11_861233_c1 nmdc:mga06z11_861233_c1_19_294 91
1220 3300050507 nmdc:mga05p37_1304567_c1 nmdc:mga05p37_1304567_c1_290_568 91
1221 3300050507 nmdc:mga05p37_219144_c1 nmdc:mga05p37_219144_c1_250_528 91
1222 3300050507 nmdc:mga05p37_354916_c1 nmdc:mga05p37_354916_c1_267_542 91
1223 3300050507 nmdc:mga05p37_380651_c1 nmdc:mga05p37_380651_c1_307_585 91
1224 3300050507 nmdc:mga05p37_569766_c1 nmdc:mga05p37_569766_c1_92_370 91
1225 3300050507 nmdc:mga05p37_663716_c1 nmdc:mga05p37_663716_c1_208_486 91
1226 3300050507 nmdc:mga05p37_99282_c1 nmdc:mga05p37_99282_c1_1815_2102 91
1227 3300050509 nmdc:mga0qj67_112351_c1 nmdc:mga0qj67_112351_c1_80_358 91
1228 3300050509 nmdc:mga0qj67_1457790_c1 nmdc:mga0qj67_1457790_c1_219_497 91
1229 3300050509 nmdc:mga0qj67_219923_c1 nmdc:mga0qj67_219923_c1_237_515 91
1230 3300050509 nmdc:mga0qj67_270501_c1 nmdc:mga0qj67_270501_c1_712_990 91
1231 3300050509 nmdc:mga0qj67_6768_c1 nmdc:mga0qj67_6768_c1_1783_2058 91
1232 3300050510 nmdc:mga06r32_1039497_c1 nmdc:mga06r32_1039497_c1_86_364 91
1233 3300050510 nmdc:mga06r32_1726856_c1 nmdc:mga06r32_1726856_c1_78_356 91
1234 3300050510 nmdc:mga06r32_191804_c1 nmdc:mga06r32_191804_c1_1469_1744 91
1235 3300050510 nmdc:mga06r32_249219_c1 nmdc:mga06r32_249219_c1_47_322 91
1236 3300050510 nmdc:mga06r32_448567_c1 nmdc:mga06r32_448567_c1_652_930 91
1237 3300050511 nmdc:mga08y16_12932_c2 nmdc:mga08y16_12932_c2_1729_2016 91
1238 3300050511 nmdc:mga08y16_1953964_c1 nmdc:mga08y16_1953964_c1_128_406 91
1239 3300050511 nmdc:mga08y16_88912_c1 nmdc:mga08y16_88912_c1_1035_1313 91
1240 3300050515 nmdc:mga0a205_1365641_c1 nmdc:mga0a205_1365641_c1_191_469 91
1241 3300054114 Ga0501084_0037523 Ga0501084_0037523_1195_1473 91
1242 3300054114 Ga0501084_0246289 Ga0501084_0246289_1178_1456 91
1243 3300054114 Ga0501084_1376083 Ga0501084_1376083_130_405 91
1244 3300060353 Ga0501082_0467067 Ga0501082_0467067_799_1074 91
1245 3300061719 Ga0466962_0209005 Ga0466962_0209005_184_459 91
1246 3300061734 Ga0530510_0057001 Ga0530510_0057001_1149_1427 91
1247 3300061734 Ga0530510_0330342 Ga0530510_0330342_769_1047 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

19

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9309 3 91
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9275 4 91
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9114 3 91
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.894 2 88
2l52-assembly1.cif.gz_A solution structure of the small archaeal modifier protein 1 (samp1) from methanosarcina acetivorans 0.8889 2 91
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9309 3 91 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9114 3 91 3.10.20.30
2l52A00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8889 2 91 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8719 2 88 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8715 1 91 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A838PUQ2-F1-model_v4 MoaD/ThiS family protein 1.007 1 83
AF-A0A838PUQ2-F1-model_v4 MoaD/ThiS family protein 0.9952 1 83
AF-A0A7V9EBR7-F1-model_v4 MoaD/ThiS family protein 0.9925 1 80
AF-A0A538C6W4-F1-model_v4 MoaD/ThiS family protein 0.9743 1 91
AF-A0A7V9EBR7-F1-model_v4 MoaD/ThiS family protein 0.9681 1 80

Feature Viewer

pLDDT pTM Quality
93.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map