metagRoot

F492070

General Info

Members	Datasets	Scaffolds	Average Seq Length
1239	634	1083	308

Family's Representative Sequence

Representative Sequence	3300009092\|Ga0105250_10044743\|Ga0105250_100447432
Length	334
Sequence	MHLLHRRPGRHFSRYQPRRREVIRSKVLNAIVGLTFAVGVTAGAQAQEAYIPLISKGFQHQFWQAVKAGAMQAAKDYKVKVTFEGPETEAMVDKQIDMLSAAIAKKPAALGFAALDSKAALPLLKKAQAEKIPVIAFDSGVDSDIPVTTAATNNKAAASLAADKLAALIGDEGEVAVVAHDQTSRTGIDRRDGFLERMKSAHPKVRVVTVQYGEGDQLKSTEVTKSILQAYPKLKGLFGTNEGSAIGVVNGVREMKRKVVIVGYDSGKQQKDAIRSGLMAGAITQNPIGIGYKTVEAAVKAIKGEKLPKVIDTGFYWYDKTNIDDPKISAVLYD

Samples

	Sample ID	Description	Type	Environment
1	2501025501	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
2	2501025504	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
3	2508501050	Microvirga lupini Lut6	Isolate	Nodule
4	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
5	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
6	2510917014	Paraburkholderia silvatlantica SRMrh-20	Isolate	Unclassified
7	2510917015	Paraburkholderia silvatlantica PVA5	Isolate	Unclassified
8	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
9	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
10	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
11	2512047030	Paraburkholderia tuberum STM678	Isolate	Nodule
12	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
13	2513237082	Paraburkholderia mimosarum STM3621	Isolate	Nodule
14	2513237083	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
15	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
16	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
17	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
18	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
19	2519103095	Burkholderia sp. KJ006	Isolate	Nodule
20	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
21	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
22	2547132374	Acidovorax radicis N35	Isolate	Unclassified
23	2548876994	Herbaspirillum lusitanum P6-12	Isolate	Nodule
24	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
25	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
26	2582581311	Burkholderia sp. WP42	Isolate	Rhizosphere
27	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
28	2585428059	Paenibacillus chondroitinus OK414	Isolate	Rhizosphere
29	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
30	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
31	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
32	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
33	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
34	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
35	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
36	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
37	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
38	2643221658	Variovorax sp. Root411	Isolate	Unclassified
39	2643221672	Variovorax sp. Root434	Isolate	Unclassified
40	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
41	2643221724	Microbacterium sp. Root280D1	Isolate	Unclassified
42	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
43	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
44	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
45	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
46	2728369380	Microbacterium sp. 1.5R	Isolate	Rhizosphere
47	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
48	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
49	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
50	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
51	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
52	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
53	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
54	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
55	2747842429	Microbacterium sp. WCS2014-259	Isolate	Unclassified
56	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
57	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
58	2767802112	Streptomyces avicenniae NRRL B-24776	Isolate	Rhizosphere
59	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
60	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
61	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
62	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
63	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
64	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
65	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
66	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
67	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
68	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
69	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
70	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
71	2816332253	Burkholderia vietnamiensis HI2297	Isolate	Unclassified
72	2816332256	Burkholderia vietnamiensis MSMB608WGS	Isolate	Unclassified
73	2816332286	Burkholderia vietnamiensis HI2221	Isolate	Rhizosphere
74	2818991436	Collimonas arenae 515	Isolate	Unclassified
75	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
76	2818991446	Variovorax sp. 1180	Isolate	Unclassified
77	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
78	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
79	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
80	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
81	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
82	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
83	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
84	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
85	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
86	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
87	2868088558	Phytoactinopolyspora endophytica EGI 60009	Isolate	Unclassified
88	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
89	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
90	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
91	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
92	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
93	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
94	2885198086	Variovorax sp. 679	Isolate	Unclassified
95	2885211737	Variovorax sp. 553	Isolate	Unclassified
96	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
97	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
98	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
99	2899924645	Variovorax sp. 369	Isolate	Unclassified
100	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
101	2902682994	Paraburkholderia atlantica CNPSo 3155	Isolate	Unclassified
102	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
103	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
104	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
105	2904564687	Burkholderia sp. 571	Isolate	Unclassified
106	2904571731	Burkholderia cenocepacia 574	Isolate	Unclassified
107	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
108	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
109	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
110	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
111	2907202186	Paenibacillus sp. HJL G12	Isolate	Unclassified
112	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
113	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
114	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
115	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
116	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
117	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
118	2928037797	Variovorax sp. 1126	Isolate	Unclassified
119	2928044640	Variovorax sp. 1128	Isolate	Unclassified
120	2928051484	Variovorax sp. 1133	Isolate	Unclassified
121	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
122	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
123	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
124	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
125	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
126	2928163908	Burkholderia sp. 567	Isolate	Unclassified
127	2928170801	Burkholderia sp. 572	Isolate	Unclassified
128	2928536128	Burkholderia sola 565	Isolate	Unclassified
129	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
130	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
131	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
132	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
133	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
134	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
135	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
136	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
137	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
138	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
139	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
140	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
141	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
142	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
143	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
144	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
145	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
146	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
147	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
148	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
149	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
150	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
151	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
152	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
153	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
154	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
155	3300003479	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
156	3300003567	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
157	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
158	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
159	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
160	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
161	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
162	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
163	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
164	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
165	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
166	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
167	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
168	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
169	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
170	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
171	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
172	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
173	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
174	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
175	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
176	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
177	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
178	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
179	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
180	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
181	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
182	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
183	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
184	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
185	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
186	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
187	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
188	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
189	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
190	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
191	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
192	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
193	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
194	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
195	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
196	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
197	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
198	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
199	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
200	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
201	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
202	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
203	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
204	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
205	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
206	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
207	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
208	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
209	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
210	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
211	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
212	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
213	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
214	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
215	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
216	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
217	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
218	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
219	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
220	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
221	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
222	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
223	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
224	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
225	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
226	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
227	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
228	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
229	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
230	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
231	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
232	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
233	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
234	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
235	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
236	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
237	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
238	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
239	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
240	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
241	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
242	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
243	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
244	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
245	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
246	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
247	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
248	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
249	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
250	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
251	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
252	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
253	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
254	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
255	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
256	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
257	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
258	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
259	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
260	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
261	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
262	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
263	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
264	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
265	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
266	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
267	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
268	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
269	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
270	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
271	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
272	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
273	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
274	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
275	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
276	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
277	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
278	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
279	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
280	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
281	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
282	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
283	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
284	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
285	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
286	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
287	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
288	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
289	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
290	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
291	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
292	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
293	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
294	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
295	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
296	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
297	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
298	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
299	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
300	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
301	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
302	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
304	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
306	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
307	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
309	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
310	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
311	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
312	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
313	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
314	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
315	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
316	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
317	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
318	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
319	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
321	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
322	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
323	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
324	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
325	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
326	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
327	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
328	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
330	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
331	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
332	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
333	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
334	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
394	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
399	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
400	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
401	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
402	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
403	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
404	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
405	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
406	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
407	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
408	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
409	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
410	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
411	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
412	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
413	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
414	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
415	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
416	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
417	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
418	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
419	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
420	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
421	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
422	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
423	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
424	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
425	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
426	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
427	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
428	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
429	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
430	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
431	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
432	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
433	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
434	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
435	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
436	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
437	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
438	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
439	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
440	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
441	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
442	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
443	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
444	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
445	3300042120	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192	Metagenome	Rhizosphere
446	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
447	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
448	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
449	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
450	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
451	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
452	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
453	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
454	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
455	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
456	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
457	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
458	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
459	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
460	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
461	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
462	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
463	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
464	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
465	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
466	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
467	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
468	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
469	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
470	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
471	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
472	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
473	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
474	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
475	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
476	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
477	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
478	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
479	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
480	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
481	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
482	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
483	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
484	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
485	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
486	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
487	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
488	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
489	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
490	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
491	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
492	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
493	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
494	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
495	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
496	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
497	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
498	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
499	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
500	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
501	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
502	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
503	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
504	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
505	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
506	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
507	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
508	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
509	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
510	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
511	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
512	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
513	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
514	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
515	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
516	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
517	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
518	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
519	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
520	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
521	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
522	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
523	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
524	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
525	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
526	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
527	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
528	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
529	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
530	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
531	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
532	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
533	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
534	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
535	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
536	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
537	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
538	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
539	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
540	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
541	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
542	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
543	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
544	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
545	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
546	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
547	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
548	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
549	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
550	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
551	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
552	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
553	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
554	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
555	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
556	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
557	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
558	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
559	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
560	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
561	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
562	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
563	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
564	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
565	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
566	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
567	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
568	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
569	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
570	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
571	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
572	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
573	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
574	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
575	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
576	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
577	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
578	3300049769	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought	Metagenome	Rhizosphere
579	3300049771	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control	Metagenome	Rhizosphere
580	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
581	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
582	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
583	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
584	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
585	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
586	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
587	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
588	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
589	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
590	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
591	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
592	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
593	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
594	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
595	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
596	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
597	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
598	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
599	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
600	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
601	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
602	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
603	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
604	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
605	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
606	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
607	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
608	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
609	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
610	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
611	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
612	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
613	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
614	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
615	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
616	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
617	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
618	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
619	8002285264	Aminobacter anthyllidis LMG 26462	Isolate	Nodule
620	8003955200	Paraburkholderia mimosarum LMG 23256	Isolate	Nodule
621	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
622	8004182704	Microbacterium paraoxydans ku-mp	Isolate	Unclassified
623	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
624	8020807995	Burkholderia sp. B10	Isolate	Rhizosphere
625	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
626	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
627	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
628	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
629	8039098773	Burkholderia multivorans MSMB612WGS	Isolate	Unclassified
630	8040167225	Burkholderia vietnamiensis RS1	Isolate	Unclassified
631	8040173305	Burkholderia vietnamiensis BE10	Isolate	Rhizosphere
632	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
633	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
634	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	86.84
Metatranscriptomes	0.56
Isolates	12.59

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	21.07
Nodule	2.42
Rhizoplane	2.1
Rhizosphere	58.51
Stem	0
Stem Tuber	0
Unclassified	15.9

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10001576	3300001979	Bacteria	10471
2	JGI24740J21852_10014554	3300001979	Bacteria	2896
3	JGI24739J22299_10005313	3300001989	Bacteria	4906
4	JGI24739J22299_10023416	3300001989	Bacteria	2183
5	JGI24739J22299_10023657	3300001989	Bacteria	2169
6	JGI24739J22299_10065479	3300001989	Bacteria	1139
7	JGI24735J21928_10000087	3300002067	Bacteria	35083
8	JGI24735J21928_10002281	3300002067	Bacteria	6695
9	JGI24738J21930_10004412	3300002075	Bacteria	3449
10	JGI25155J39150_1000033	3300002704	Bacteria	105391
11	JGI25155J39150_1000192	3300002704	Bacteria	25932
12	JGI25155J39150_1001145	3300002704	Bacteria	2489
13	JGI25156J39149_1000043	3300002705	Bacteria	105452
14	JGI25156J39149_1000077	3300002705	Bacteria	74919
15	JGI25156J39149_1000098	3300002705	Bacteria	64288
16	JGI25156J39149_1000218	3300002705	Bacteria	39862
17	JGI25156J39149_1000325	3300002705	Bacteria	31382
18	JGI25156J39149_1000429	3300002705	Bacteria	26030
19	JGI25156J39149_1004719	3300002705	Bacteria	4086
20	JGI25156J39149_1012226	3300002705	Bacteria	1900
21	JGI25162J39368_1000021	3300002737	Bacteria	248155
22	JGI25162J39368_1006740	3300002737	Bacteria	1916
23	JGI25154J39366_1000062	3300002738	Bacteria	105525
24	JGI25154J39366_1000103	3300002738	Bacteria	74908
25	JGI25154J39366_1000512	3300002738	Bacteria	19763
26	JGI25154J39366_1001998	3300002738	Bacteria	5963
27	JGI25154J39366_1004497	3300002738	Bacteria	2485
28	JGI25158J39367_1002712	3300002739	Bacteria	2826
29	JGI25157J39369_1000018	3300002741	Bacteria	177410
30	JGI25157J39369_1000060	3300002741	Bacteria	105525
31	JGI25157J39369_1000668	3300002741	Bacteria	18866
32	JGI25164J39214_1002619	3300002772	Bacteria	2641
33	JGI25152J39213_1009120	3300002773	Bacteria	2387
34	JGI25152J39213_1009200	3300002773	Bacteria	2365
35	JGI25150J39212_1001226	3300002774	Bacteria	7543
36	JGI25150J39212_1002736	3300002774	Bacteria	4291
37	JGI25150J39212_1012775	3300002774	Bacteria	1474
38	JGI25159J45721_1000163	3300002987	Bacteria	31237
39	JGI25159J45721_1012271	3300002987	Bacteria	2051
40	JGI25159J45721_1013591	3300002987	Bacteria	1876
41	JGI25151J46595_10001083	3300003187	Bacteria	20209
42	JGI25151J46595_10010190	3300003187	Bacteria	4386
43	JGI25151J46595_10019156	3300003187	Bacteria	2915
44	JGI25151J46595_10025749	3300003187	Bacteria	2387
45	JGI25151J46595_10026071	3300003187	Bacteria	2365
46	JGI25165J46597_1000049	3300003214	Bacteria	248154
47	JGI25165J46597_1000797	3300003214	Bacteria	23919
48	JGI25153J46596_10021699	3300003215	Bacteria	2387
49	JGI25153J46596_10021981	3300003215	Bacteria	2365
50	JGI25160J50197_1000099	3300003354	Bacteria	86777
51	JGI25160J50197_1000174	3300003354	Bacteria	54817
52	JGI25160J50197_1000197	3300003354	Bacteria	50744
53	JGI25160J50197_1016609	3300003354	Bacteria	2365
54	JGI25161J50226_1000057	3300003374	Bacteria	102462
55	JGI25161J50226_1001645	3300003374	Bacteria	6440
56	JGI25161J50226_1006842	3300003374	Bacteria	2000
57	Ga0006556J51387_1026066	3300003479	Bacteria	2590
58	Ga0006554J51385_1026721	3300003567	Bacteria	2761
59	Ga0006562J51391_1086990	3300003578	Bacteria	2000
60	Ga0055538_1000008	3300003751	Bacteria	398547
61	Ga0055538_1000023	3300003751	Bacteria	248154
62	Ga0055539_1000012	3300003752	Bacteria	398547
63	Ga0055539_1000030	3300003752	Bacteria	248154
64	Ga0055539_1000797	3300003752	Bacteria	7490
65	Ga0055533_1000015	3300003756	Bacteria	398547
66	Ga0055533_1000039	3300003756	Bacteria	248154
67	Ga0055533_1000253	3300003756	Bacteria	32721
68	Ga0055533_1001638	3300003756	Bacteria	5763
69	Ga0055532_1000001	3300003758	Bacteria	1119836
70	Ga0055532_1000034	3300003758	Bacteria	210984
71	Ga0055532_1000991	3300003758	Bacteria	8928
72	Ga0055525_1000017	3300003759	Bacteria	398547
73	Ga0055525_1000048	3300003759	Bacteria	248154
74	Ga0055527_1000002	3300003760	Bacteria	830488
75	Ga0055527_1000349	3300003760	Bacteria	22926
76	Ga0055527_1000762	3300003760	Bacteria	8949
77	Ga0055527_1004591	3300003760	Bacteria	1879
78	Ga0055535_1000001	3300003761	Bacteria	1119836
79	Ga0055535_1000039	3300003761	Bacteria	159377
80	Ga0055535_1000786	3300003761	Bacteria	23172
81	Ga0055535_1000792	3300003761	Bacteria	23026
82	Ga0055535_1001868	3300003761	Bacteria	8949
83	Ga0055535_1010329	3300003761	Bacteria	1541
84	Ga0055535_1011492	3300003761	Bacteria	1396
85	Ga0055542_1000001	3300003762	Bacteria	1119836
86	Ga0055542_1000022	3300003762	Bacteria	302315
87	Ga0055542_1000747	3300003762	Bacteria	25043
88	Ga0055529_1000001	3300003763	Bacteria	826680
89	Ga0055529_1000690	3300003763	Bacteria	23026
90	Ga0055529_1000901	3300003763	Bacteria	16570
91	Ga0055526_1020182	3300003771	Bacteria	2387
92	Ga0055526_1020352	3300003771	Bacteria	2365
93	Ga0055526_1032454	3300003771	Bacteria	1473
94	Ga0055537_1006317	3300003773	Bacteria	3030
95	Ga0055537_1006961	3300003773	Bacteria	2792
96	Ga0055537_1008491	3300003773	Bacteria	2365
97	Ga0055524_1018801	3300003775	Bacteria	2387
98	Ga0055524_1018995	3300003775	Bacteria	2365
99	Ga0055534_1010894	3300003784	Bacteria	1876
100	Ga0055528_1001609	3300003790	Bacteria	13350
101	Ga0055528_1015211	3300003790	Bacteria	2792
102	Ga0055528_1018443	3300003790	Bacteria	2365
103	Ga0055530_10004448	3300003791	Bacteria	7200
104	Ga0055530_10027916	3300003791	Bacteria	1533
105	Ga0055540_1012967	3300003792	Bacteria	2579
106	Ga0055531_10000570	3300003794	Bacteria	32274
107	Ga0055541_1000009	3300003841	Bacteria	398547
108	Ga0055541_1000021	3300003841	Bacteria	248154
109	Ga0055543_1000213	3300004625	Bacteria	46762
110	Ga0055543_1006235	3300004625	Bacteria	2913
111	Ga0065165_1000119	3300005262	Bacteria	134464
112	Ga0065165_1006827	3300005262	Bacteria	5822
113	Ga0065165_1019640	3300005262	Bacteria	2403
114	Ga0065165_1027925	3300005262	Bacteria	1830
115	Ga0065714_10065020	3300005288	Bacteria	13888
116	Ga0070658_10005228	3300005327	Bacteria	10553
117	Ga0070658_10202993	3300005327	Bacteria	1673
118	Ga0070676_10000378	3300005328	Bacteria	20674
119	Ga0070690_100000481	3300005330	Bacteria	20092
120	Ga0070690_100005034	3300005330	Bacteria	7405
121	Ga0070670_100068726	3300005331	Bacteria	3041
122	Ga0070670_100092668	3300005331	Bacteria	2598
123	Ga0070677_10083557	3300005333	Bacteria	1372
124	Ga0068869_100003543	3300005334	Bacteria	9586
125	Ga0068869_100031797	3300005334	Bacteria	3715
126	Ga0068869_100037209	3300005334	Bacteria	3460
127	Ga0068869_100129845	3300005334	Bacteria	1936
128	Ga0068869_100467717	3300005334	Bacteria	1048
129	Ga0070680_100015442	3300005336	Bacteria	5986
130	Ga0068868_100015313	3300005338	Bacteria	5669
131	Ga0068868_100073576	3300005338	Bacteria	2729
132	Ga0068868_100085350	3300005338	Bacteria	2537
133	Ga0068868_100485341	3300005338	Bacteria	1080
134	Ga0070660_100000006	3300005339	Bacteria	166714
135	Ga0070660_100000824	3300005339	Bacteria	20581
136	Ga0070689_100009103	3300005340	Bacteria	7030
137	Ga0070689_100034227	3300005340	Bacteria	3876
138	Ga0070691_10010839	3300005341	Bacteria	4160
139	Ga0070661_100140616	3300005344	Bacteria	1819
140	Ga0070675_100239810	3300005354	Bacteria	1584
141	Ga0070671_100012644	3300005355	Bacteria	6802
142	Ga0070674_100366791	3300005356	Bacteria	1167
143	Ga0070673_100002446	3300005364	Bacteria	11313
144	Ga0070673_100004503	3300005364	Bacteria	8818
145	Ga0070673_100070079	3300005364	Bacteria	2812
146	Ga0070673_100287109	3300005364	Bacteria	1445
147	Ga0070659_100000078	3300005366	Bacteria	74646
148	Ga0070659_100140537	3300005366	Bacteria	1966
149	Ga0070667_100224531	3300005367	Bacteria	1673
150	Ga0070709_10342344	3300005434	Bacteria	1103
151	Ga0070714_100004877	3300005435	Bacteria	10183
152	Ga0070714_100130827	3300005435	Bacteria	2243
153	Ga0070710_10004571	3300005437	Bacteria	6539
154	Ga0070710_10210590	3300005437	Bacteria	1232
155	Ga0070710_10227432	3300005437	Bacteria	1190
156	Ga0070701_10001168	3300005438	Bacteria	9615
157	Ga0070711_100035515	3300005439	Bacteria	3334
158	Ga0070705_100018183	3300005440	Bacteria	3680
159	Ga0070700_100000628	3300005441	Bacteria	17527
160	Ga0070694_100038557	3300005444	Bacteria	3176
161	Ga0070708_100208711	3300005445	Bacteria	1830
162	Ga0070708_100273464	3300005445	Bacteria	1589
163	Ga0070663_100000371	3300005455	Bacteria	23590
164	Ga0070663_100039110	3300005455	Bacteria	3313
165	Ga0070663_100156765	3300005455	Bacteria	1750
166	Ga0070663_100221717	3300005455	Bacteria	1485
167	Ga0070663_100339518	3300005455	Bacteria	1213
168	Ga0070678_100072114	3300005456	Bacteria	2588
169	Ga0070678_100103808	3300005456	Bacteria	2209
170	Ga0070662_100023588	3300005457	Bacteria	4228
171	Ga0070662_100077168	3300005457	Bacteria	2472
172	Ga0068867_100000091	3300005459	Bacteria	57689
173	Ga0068867_100001785	3300005459	Bacteria	14965
174	Ga0068867_100050539	3300005459	Bacteria	3065
175	Ga0068867_100054836	3300005459	Bacteria	2945
176	Ga0070706_100005642	3300005467	Bacteria	11907
177	Ga0070698_100108240	3300005471	Bacteria	2747
178	Ga0070699_100408627	3300005518	Bacteria	1228
179	Ga0070684_100114508	3300005535	Bacteria	2421
180	Ga0070684_100215528	3300005535	Bacteria	1751
181	Ga0070684_100222454	3300005535	Bacteria	1722
182	Ga0070672_100013235	3300005543	Bacteria	5818
183	Ga0070695_100172594	3300005545	Bacteria	1526
184	Ga0070696_100015190	3300005546	Bacteria	5169
185	Ga0070696_100328950	3300005546	Bacteria	1178
186	Ga0070693_100204106	3300005547	Bacteria	1285
187	Ga0070665_100001916	3300005548	Bacteria	23511
188	Ga0070665_100078494	3300005548	Bacteria	3308
189	Ga0070704_100006762	3300005549	Bacteria	6787
190	Ga0068855_100000175	3300005563	Bacteria	82401
191	Ga0068855_100002067	3300005563	Bacteria	24867
192	Ga0068855_100016635	3300005563	Bacteria	8842
193	Ga0068855_100135521	3300005563	Bacteria	2810
194	Ga0068855_100311656	3300005563	Bacteria	1741
195	Ga0068855_100431010	3300005563	Bacteria	1441
196	Ga0070664_100203341	3300005564	Bacteria	1768
197	Ga0068857_100054098	3300005577	Bacteria	3561
198	Ga0068857_100347509	3300005577	Bacteria	1373
199	Ga0068857_100425424	3300005577	Bacteria	1239
200	Ga0068857_100441941	3300005577	Bacteria	1215
201	Ga0068854_100034373	3300005578	Bacteria	3540
202	Ga0068854_100056145	3300005578	Bacteria	2837
203	Ga0068854_100108004	3300005578	Bacteria	2095
204	Ga0068856_100000953	3300005614	Bacteria	30963
205	Ga0070702_100001192	3300005615	Bacteria	10482
206	Ga0068852_100002439	3300005616	Bacteria	12803
207	Ga0068852_100005949	3300005616	Bacteria	8779
208	Ga0068859_100030507	3300005617	Bacteria	5411
209	Ga0068859_100041591	3300005617	Bacteria	4616
210	Ga0068859_100208811	3300005617	Bacteria	2039
211	Ga0068864_100369626	3300005618	Bacteria	1357
212	Ga0068866_10002792	3300005718	Bacteria	7203
213	Ga0068861_100006778	3300005719	Bacteria	7824
214	Ga0068863_100059471	3300005841	Bacteria	3615
215	Ga0068858_100008134	3300005842	Bacteria	10085
216	Ga0068858_100385768	3300005842	Bacteria	1345
217	Ga0068860_100000179	3300005843	Bacteria	102844
218	Ga0068860_100260874	3300005843	Bacteria	1689
219	Ga0068860_100506398	3300005843	Bacteria	1206
220	Ga0068862_100037008	3300005844	Bacteria	4136
221	Ga0068862_100070091	3300005844	Bacteria	3026
222	Ga0068862_100073318	3300005844	Bacteria	2959
223	Ga0081455_10219144	3300005937	Bacteria	1412
224	Ga0081540_1004724	3300005983	Bacteria	10305
225	Ga0081540_1040098	3300005983	Bacteria	2445
226	Ga0070717_10040289	3300006028	Bacteria	3805
227	Ga0070717_10103222	3300006028	Bacteria	2423
228	Ga0075365_10026960	3300006038	Bacteria	3651
229	Ga0075368_10072670	3300006042	Bacteria	1391
230	Ga0075363_100020657	3300006048	Bacteria	3305
231	Ga0075363_100020664	3300006048	Bacteria	3305
232	Ga0075363_100088518	3300006048	Bacteria	1702
233	Ga0075432_10009562	3300006058	Bacteria	3302
234	Ga0075432_10032303	3300006058	Bacteria	1814
235	Ga0070716_100014645	3300006173	Bacteria	4021
236	Ga0075362_10000282	3300006177	Bacteria	14289
237	Ga0075362_10007696	3300006177	Bacteria	4093
238	Ga0075362_10014270	3300006177	Bacteria	3201
239	Ga0075362_10061341	3300006177	Bacteria	1701
240	Ga0075367_10006540	3300006178	Bacteria	5897
241	Ga0075367_10026180	3300006178	Bacteria	3305
242	Ga0075367_10075527	3300006178	Bacteria	2033
243	Ga0075369_10002536	3300006186	Bacteria	6538
244	Ga0075369_10106310	3300006186	Bacteria	1262
245	Ga0075366_10003173	3300006195	Bacteria	8609
246	Ga0075366_10031692	3300006195	Bacteria	3112
247	Ga0075366_10103689	3300006195	Bacteria	1708
248	Ga0097621_100007649	3300006237	Bacteria	7746
249	Ga0097621_100031666	3300006237	Bacteria	4198
250	Ga0097621_100327102	3300006237	Bacteria	1359
251	Ga0075370_10006256	3300006353	Bacteria	5977
252	Ga0075370_10010253	3300006353	Bacteria	4892
253	Ga0075370_10013658	3300006353	Bacteria	4322
254	Ga0075370_10028203	3300006353	Bacteria	3119
255	Ga0075370_10034053	3300006353	Bacteria	2855
256	Ga0068871_100006608	3300006358	Bacteria	8222
257	Ga0068871_100009421	3300006358	Bacteria	7075
258	Ga0068871_100046910	3300006358	Bacteria	3482
259	Ga0075433_10049200	3300006852	Bacteria	3667
260	Ga0068865_100003142	3300006881	Bacteria	9886
261	Ga0068865_100216862	3300006881	Bacteria	1494
262	Ga0097620_100030508	3300006931	Bacteria	5411
263	Ga0097620_100041591	3300006931	Bacteria	4616
264	Ga0097620_100208817	3300006931	Bacteria	2039
265	Ga0079104_1008948	3300006946	Bacteria	3437
266	Ga0075435_100107407	3300007076	Bacteria	2318
267	Ga0099794_10024789	3300007265	Bacteria	2757
268	Ga0105250_10044743	3300009092	Bacteria	1775
269	Ga0105240_10000799	3300009093	Bacteria	56992
270	Ga0105240_10001916	3300009093	Bacteria	34556
271	Ga0105240_10002451	3300009093	Bacteria	29846
272	Ga0105240_10022396	3300009093	Bacteria	8375
273	Ga0105240_10107117	3300009093	Bacteria	3389
274	Ga0105240_10122159	3300009093	Bacteria	3135
275	Ga0105240_10304356	3300009093	Bacteria	1823
276	Ga0105240_10464797	3300009093	Bacteria	1413
277	Ga0111539_10290920	3300009094	Bacteria	1901
278	Ga0105245_10007509	3300009098	Bacteria	9554
279	Ga0105245_10064942	3300009098	Bacteria	3299
280	Ga0105245_10350660	3300009098	Bacteria	1462
281	Ga0105247_10006954	3300009101	Bacteria	6966
282	Ga0114129_10499244	3300009147	Bacteria	1589
283	Ga0114129_10744032	3300009147	Bacteria	1256
284	Ga0105243_10004749	3300009148	Bacteria	10683
285	Ga0105243_10004977	3300009148	Bacteria	10415
286	Ga0105243_10025177	3300009148	Bacteria	4545
287	Ga0105243_10066660	3300009148	Bacteria	2896
288	Ga0105243_10332331	3300009148	Bacteria	1389
289	Ga0105241_10042124	3300009174	Bacteria	3452
290	Ga0105242_10019172	3300009176	Bacteria	5359
291	Ga0105242_10052872	3300009176	Bacteria	3316
292	Ga0105242_10133020	3300009176	Bacteria	2149
293	Ga0105248_10023294	3300009177	Bacteria	6877
294	Ga0105248_10024051	3300009177	Bacteria	6770
295	Ga0105248_10046936	3300009177	Bacteria	4842
296	Ga0105248_10073191	3300009177	Bacteria	3851
297	Ga0105248_10255528	3300009177	Bacteria	1972
298	Ga0105237_10007408	3300009545	Bacteria	12016
299	Ga0105237_10022179	3300009545	Bacteria	6516
300	Ga0105237_10037804	3300009545	Bacteria	4877
301	Ga0105237_10070180	3300009545	Bacteria	3499
302	Ga0105237_10100744	3300009545	Bacteria	2880
303	Ga0105237_10328766	3300009545	Bacteria	1533
304	Ga0105238_10000062	3300009551	Bacteria	126356
305	Ga0105238_10130095	3300009551	Bacteria	2495
306	Ga0105238_10405740	3300009551	Bacteria	1356
307	Ga0105238_10466826	3300009551	Bacteria	1260
308	Ga0105238_10477127	3300009551	Bacteria	1246
309	Ga0105249_10367172	3300009553	Bacteria	1462
310	Ga0105239_10022712	3300010375	Bacteria	6915
311	Ga0105239_10056421	3300010375	Bacteria	4308
312	Ga0105239_10056576	3300010375	Bacteria	4302
313	Ga0105239_10095021	3300010375	Bacteria	3293
314	Ga0105239_10129004	3300010375	Bacteria	2811
315	Ga0105239_10217517	3300010375	Bacteria	2142
316	Ga0105239_10323961	3300010375	Bacteria	1738
317	Ga0105246_10004731	3300011119	Bacteria	8291
318	Ga0105246_10027836	3300011119	Bacteria	3708
319	Ga0157347_1002126	3300012502	Bacteria	1657
320	Ga0157373_10016431	3300013100	Bacteria	5399
321	Ga0157371_10002771	3300013102	Bacteria	16461
322	Ga0157370_10001540	3300013104	Bacteria	28519
323	Ga0157370_10002288	3300013104	Bacteria	23212
324	Ga0157370_10182887	3300013104	Bacteria	1947
325	Ga0157369_10000602	3300013105	Bacteria	46869
326	Ga0157369_10001266	3300013105	Bacteria	31371
327	Ga0157369_10045257	3300013105	Bacteria	4787
328	Ga0157369_10065510	3300013105	Bacteria	3910
329	Ga0157369_10154553	3300013105	Bacteria	2424
330	Ga0157374_10000032	3300013296	Bacteria	202485
331	Ga0157378_10015230	3300013297	Bacteria	6735
332	Ga0157378_10502590	3300013297	Bacteria	1211
333	Ga0157378_10574175	3300013297	Bacteria	1136
334	Ga0163162_10212651	3300013306	Bacteria	2064
335	Ga0163162_10341852	3300013306	Bacteria	1629
336	Ga0157372_10010032	3300013307	Bacteria	10072
337	Ga0157372_10162917	3300013307	Bacteria	2578
338	Ga0157372_10492140	3300013307	Bacteria	1430
339	Ga0157375_10036029	3300013308	Bacteria	4729
340	Ga0157375_10181890	3300013308	Bacteria	2254
341	Ga0157375_10236038	3300013308	Bacteria	1988
342	Ga0157375_10444992	3300013308	Bacteria	1461
343	Ga0163163_10595712	3300014325	Bacteria	1168
344	Ga0157380_10016339	3300014326	Bacteria	5471
345	Ga0182008_10003216	3300014497	Bacteria	9984
346	Ga0182008_10014502	3300014497	Bacteria	4126
347	Ga0182008_10062250	3300014497	Bacteria	1839
348	Ga0157377_10000107	3300014745	Bacteria	57351
349	Ga0157379_10025728	3300014968	Bacteria	5231
350	Ga0157379_10212686	3300014968	Bacteria	1751
351	Ga0157376_10008622	3300014969	Bacteria	7370
352	Ga0182006_1010913	3300015261	Bacteria	4019
353	Ga0182006_1018572	3300015261	Bacteria	2936
354	Ga0182006_1073593	3300015261	Bacteria	1261
355	Ga0182006_1095554	3300015261	Bacteria	1062
356	Ga0182007_10019962	3300015262	Bacteria	2401
357	Ga0182007_10058289	3300015262	Bacteria	1267
358	Ga0182005_1002627	3300015265	Bacteria	6337
359	Ga0183361_10020	3300016635	Bacteria	128627
360	Ga0163161_10000105	3300017792	Bacteria	80620
361	Ga0206356_10395318	3300020070	Bacteria	1602
362	Ga0206354_10403482	3300020081	Bacteria	1177
363	Ga0206353_11438612	3300020082	Bacteria	1376
364	Ga0213872_10003902	3300021361	Bacteria	8093
365	Ga0213872_10073089	3300021361	Bacteria	1545
366	Ga0213876_10002123	3300021384	Bacteria	11724
367	Ga0213876_10003157	3300021384	Bacteria	9485
368	Ga0213876_10004490	3300021384	Bacteria	7798
369	Ga0213875_10010543	3300021388	Bacteria	4622
370	Ga0224712_10000303	3300022467	Bacteria	9194
371	Ga0228598_1001714	3300024227	Bacteria	4793
372	Ga0209435_100007	3300025206	Bacteria	516857
373	Ga0209435_100041	3300025206	Bacteria	105577
374	Ga0209435_100124	3300025206	Bacteria	27904
375	Ga0209760_101691	3300025207	Bacteria	2244
376	Ga0209436_104081	3300025208	Bacteria	3682
377	Ga0209436_104924	3300025208	Bacteria	3198
378	Ga0209784_100004	3300025224	Bacteria	1378156
379	Ga0209784_100005	3300025224	Bacteria	1040422
380	Ga0209566_100004	3300025225	Bacteria	1531866
381	Ga0209566_100005	3300025225	Bacteria	1040422
382	Ga0209566_100436	3300025225	Bacteria	31141
383	Ga0209566_100493	3300025225	Bacteria	27632
384	Ga0209674_100005	3300025226	Bacteria	1708125
385	Ga0209674_100006	3300025226	Bacteria	1531866
386	Ga0209674_100009	3300025226	Bacteria	1040422
387	Ga0209674_100146	3300025226	Bacteria	98804
388	Ga0209674_100928	3300025226	Bacteria	9359
389	Ga0209672_100001	3300025228	Bacteria	2828210
390	Ga0209672_100020	3300025228	Bacteria	429003
391	Ga0209672_100066	3300025228	Bacteria	189828
392	Ga0209672_100391	3300025228	Bacteria	26387
393	Ga0209672_100609	3300025228	Bacteria	18619
394	Ga0209147_100001	3300025229	Bacteria	2384371
395	Ga0209147_100017	3300025229	Bacteria	516857
396	Ga0209147_100024	3300025229	Bacteria	429003
397	Ga0209147_100063	3300025229	Bacteria	241980
398	Ga0209147_100084	3300025229	Bacteria	189828
399	Ga0209147_102395	3300025229	Bacteria	4708
400	Ga0209563_100009	3300025230	Bacteria	1378156
401	Ga0209563_100012	3300025230	Bacteria	1040422
402	Ga0207427_100321	3300025231	Bacteria	32350
403	Ga0207427_100998	3300025231	Bacteria	11884
404	Ga0209437_100004	3300025233	Bacteria	1378156
405	Ga0209437_100215	3300025233	Bacteria	106873
406	Ga0209258_100001	3300025242	Bacteria	2384269
407	Ga0209258_100009	3300025242	Bacteria	996276
408	Ga0209258_100025	3300025242	Bacteria	534777
409	Ga0209258_100084	3300025242	Bacteria	244783
410	Ga0209258_100115	3300025242	Bacteria	190367
411	Ga0209258_100117	3300025242	Bacteria	189828
412	Ga0209258_100531	3300025242	Bacteria	36288
413	Ga0207425_1001486	3300025245	Bacteria	9746
414	Ga0207425_1002008	3300025245	Bacteria	7592
415	Ga0209646_1000014	3300025246	Bacteria	550484
416	Ga0209646_1000044	3300025246	Bacteria	334596
417	Ga0209646_1000067	3300025246	Bacteria	241595
418	Ga0209646_1000144	3300025246	Bacteria	105691
419	Ga0209646_1000238	3300025246	Bacteria	57384
420	Ga0209026_1000033	3300025250	Bacteria	318512
421	Ga0209026_1000063	3300025250	Bacteria	211324
422	Ga0209026_1000159	3300025250	Bacteria	105691
423	Ga0209026_1006998	3300025250	Bacteria	2633
424	Ga0209677_100005	3300025253	Bacteria	1378156
425	Ga0209677_100006	3300025253	Bacteria	1040422
426	Ga0209677_100546	3300025253	Bacteria	20890
427	Ga0209148_1000003	3300025254	Bacteria	2384288
428	Ga0209148_1000007	3300025254	Bacteria	1592273
429	Ga0209148_1000148	3300025254	Bacteria	159642
430	Ga0209148_1001093	3300025254	Bacteria	16389
431	Ga0209759_1000001	3300025256	Bacteria	2799452
432	Ga0209759_1000024	3300025256	Bacteria	318512
433	Ga0209759_1000048	3300025256	Bacteria	224817
434	Ga0209759_1000079	3300025256	Bacteria	174354
435	Ga0209759_1000097	3300025256	Bacteria	157627
436	Ga0209759_1000152	3300025256	Bacteria	119866
437	Ga0209759_1000628	3300025256	Bacteria	33562
438	Ga0209759_1001194	3300025256	Bacteria	16211
439	Ga0209759_1014177	3300025256	Bacteria	2121
440	Ga0209759_1023859	3300025256	Bacteria	1337
441	Ga0209129_1000024	3300025258	Bacteria	417268
442	Ga0209129_1000085	3300025258	Bacteria	181765
443	Ga0209129_1001412	3300025258	Bacteria	13452
444	Ga0209129_1001966	3300025258	Bacteria	10711
445	Ga0209129_1008882	3300025258	Bacteria	2727
446	Ga0209233_1000005	3300025261	Bacteria	1531866
447	Ga0209233_1000016	3300025261	Bacteria	907830
448	Ga0209565_1000546	3300025263	Bacteria	26226
449	Ga0209565_1001120	3300025263	Bacteria	13007
450	Ga0209565_1002546	3300025263	Bacteria	6479
451	Ga0209455_1000001	3300025272	Bacteria	2384278
452	Ga0209455_1000089	3300025272	Bacteria	235612
453	Ga0209455_1000110	3300025272	Bacteria	189828
454	Ga0209455_1000298	3300025272	Bacteria	51486
455	Ga0209455_1010309	3300025272	Bacteria	2384
456	Ga0209673_1000056	3300025273	Bacteria	271069
457	Ga0209673_1000571	3300025273	Bacteria	58695
458	Ga0209673_1000585	3300025273	Bacteria	57304
459	Ga0209130_1000146	3300025284	Bacteria	111777
460	Ga0209130_1000505	3300025284	Bacteria	39706
461	Ga0209130_1000923	3300025284	Bacteria	23600
462	Ga0209130_1006080	3300025284	Bacteria	4004
463	Ga0209675_1002535	3300025291	Bacteria	9279
464	Ga0209675_1002997	3300025291	Bacteria	8314
465	Ga0209675_1003894	3300025291	Bacteria	6868
466	Ga0209675_1010462	3300025291	Bacteria	3164
467	Ga0209676_1000028	3300025292	Bacteria	559745
468	Ga0209676_1000194	3300025292	Bacteria	136666
469	Ga0209676_1005116	3300025292	Bacteria	6990
470	Ga0209025_1000122	3300025294	Bacteria	206064
471	Ga0209025_1000267	3300025294	Bacteria	121798
472	Ga0209025_1004112	3300025294	Bacteria	12943
473	Ga0209025_1004647	3300025294	Bacteria	11739
474	Ga0209025_1005790	3300025294	Bacteria	9912
475	Ga0209025_1012551	3300025294	Bacteria	5418
476	Ga0209025_1016614	3300025294	Bacteria	4323
477	Ga0209025_1056324	3300025294	Bacteria	1513
478	Ga0209564_1000183	3300025295	Bacteria	150409
479	Ga0209564_1000198	3300025295	Bacteria	138511
480	Ga0209564_1001449	3300025295	Bacteria	24206
481	Ga0209564_1005932	3300025295	Bacteria	6765
482	Ga0209564_1006309	3300025295	Bacteria	6447
483	Ga0209564_1018584	3300025295	Bacteria	2641
484	Ga0209758_1000049	3300025297	Bacteria	345104
485	Ga0209758_1004192	3300025297	Bacteria	12242
486	Ga0209758_1024593	3300025297	Bacteria	2679
487	Ga0209050_1000002	3300025298	Bacteria	1792849
488	Ga0209050_1000122	3300025298	Bacteria	195305
489	Ga0209050_1000554	3300025298	Bacteria	61514
490	Ga0209050_1019032	3300025298	Bacteria	2633
491	Ga0209050_1047294	3300025298	Bacteria	1122
492	Ga0209256_1000098	3300025299	Bacteria	204152
493	Ga0209256_1000140	3300025299	Bacteria	152770
494	Ga0207426_1000038	3300025302	Bacteria	441522
495	Ga0207426_1000053	3300025302	Bacteria	384818
496	Ga0207426_1000215	3300025302	Bacteria	136757
497	Ga0207426_1000291	3300025302	Bacteria	99437
498	Ga0209051_1000055	3300025303	Bacteria	277194
499	Ga0209051_1000194	3300025303	Bacteria	107213
500	Ga0209051_1002395	3300025303	Bacteria	13518
501	Ga0209051_1048026	3300025303	Bacteria	1451
502	Ga0209257_1000002	3300025304	Bacteria	1767052
503	Ga0209257_1000101	3300025304	Bacteria	251553
504	Ga0209257_1000475	3300025304	Bacteria	73111
505	Ga0209257_1005155	3300025304	Bacteria	9429
506	Ga0209257_1006972	3300025304	Bacteria	7037
507	Ga0207656_10002227	3300025321	Bacteria	6492
508	Ga0207696_1025092	3300025711	Bacteria	1862
509	Ga0207655_1003555	3300025728	Bacteria	11543
510	Ga0207682_10026744	3300025893	Bacteria	2296
511	Ga0207692_10001657	3300025898	Bacteria	8417
512	Ga0207710_10017446	3300025900	Bacteria	3045
513	Ga0207688_10088648	3300025901	Bacteria	1774
514	Ga0207680_10169703	3300025903	Bacteria	1469
515	Ga0207647_10000667	3300025904	Bacteria	26815
516	Ga0207647_10002918	3300025904	Bacteria	12875
517	Ga0207647_10070073	3300025904	Bacteria	2119
518	Ga0207699_10016633	3300025906	Bacteria	3852
519	Ga0207645_10001967	3300025907	Bacteria	16511
520	Ga0207705_10012017	3300025909	Bacteria	6255
521	Ga0207705_10122656	3300025909	Bacteria	1929
522	Ga0207705_10237945	3300025909	Bacteria	1386
523	Ga0207684_10002633	3300025910	Bacteria	17956
524	Ga0207654_10056416	3300025911	Bacteria	2278
525	Ga0207695_10000328	3300025913	Bacteria	113378
526	Ga0207695_10001014	3300025913	Bacteria	49482
527	Ga0207695_10002743	3300025913	Bacteria	25683
528	Ga0207695_10004788	3300025913	Bacteria	18313
529	Ga0207695_10005541	3300025913	Bacteria	16696
530	Ga0207695_10011015	3300025913	Bacteria	10986
531	Ga0207695_10111091	3300025913	Bacteria	2720
532	Ga0207695_10158877	3300025913	Bacteria	2193
533	Ga0207695_10329036	3300025913	Bacteria	1417
534	Ga0207695_10489370	3300025913	Bacteria	1112
535	Ga0207671_10004320	3300025914	Bacteria	13655
536	Ga0207671_10014732	3300025914	Bacteria	6165
537	Ga0207671_10031648	3300025914	Bacteria	3942
538	Ga0207671_10038925	3300025914	Bacteria	3523
539	Ga0207693_10132638	3300025915	Bacteria	1958
540	Ga0207663_10037677	3300025916	Bacteria	2916
541	Ga0207660_10021671	3300025917	Bacteria	4323
542	Ga0207662_10088133	3300025918	Bacteria	1905
543	Ga0207657_10000003	3300025919	Bacteria	263148
544	Ga0207657_10002598	3300025919	Bacteria	19544
545	Ga0207646_10066508	3300025922	Bacteria	3218
546	Ga0207694_10000114	3300025924	Bacteria	84485
547	Ga0207694_10019868	3300025924	Bacteria	5082
548	Ga0207694_10040439	3300025924	Bacteria	3589
549	Ga0207694_10210695	3300025924	Bacteria	1583
550	Ga0207650_10023294	3300025925	Bacteria	4390
551	Ga0207650_10116948	3300025925	Bacteria	2071
552	Ga0207650_10158675	3300025925	Bacteria	1790
553	Ga0207659_10216793	3300025926	Bacteria	1537
554	Ga0207687_10003593	3300025927	Bacteria	10444
555	Ga0207687_10298950	3300025927	Bacteria	1296
556	Ga0207664_10188840	3300025929	Bacteria	1772
557	Ga0207664_10210549	3300025929	Bacteria	1682
558	Ga0207644_10006953	3300025931	Bacteria	7368
559	Ga0207690_10000007	3300025932	Bacteria	388533
560	Ga0207690_10105006	3300025932	Bacteria	2025
561	Ga0207690_10142786	3300025932	Bacteria	1766
562	Ga0207706_10001911	3300025933	Bacteria	20450
563	Ga0207706_10002765	3300025933	Bacteria	17065
564	Ga0207706_10043757	3300025933	Bacteria	3968
565	Ga0207686_10001924	3300025934	Bacteria	11468
566	Ga0207686_10027663	3300025934	Bacteria	3322
567	Ga0207686_10095425	3300025934	Bacteria	1973
568	Ga0207709_10001197	3300025935	Bacteria	18718
569	Ga0207709_10002921	3300025935	Bacteria	10435
570	Ga0207709_10003509	3300025935	Bacteria	9284
571	Ga0207709_10031617	3300025935	Bacteria	3093
572	Ga0207670_10028574	3300025936	Bacteria	3543
573	Ga0207704_10252755	3300025938	Bacteria	1324
574	Ga0207665_10003989	3300025939	Bacteria	9862
575	Ga0207691_10111800	3300025940	Bacteria	2428
576	Ga0207691_10129027	3300025940	Bacteria	2235
577	Ga0207711_10008554	3300025941	Bacteria	8561
578	Ga0207711_10033107	3300025941	Bacteria	4372
579	Ga0207711_10077378	3300025941	Bacteria	2900
580	Ga0207689_10006569	3300025942	Bacteria	10254
581	Ga0207689_10026488	3300025942	Bacteria	4855
582	Ga0207689_10045601	3300025942	Bacteria	3624
583	Ga0207679_10213568	3300025945	Bacteria	1619
584	Ga0207667_10000028	3300025949	Bacteria	334510
585	Ga0207667_10012674	3300025949	Bacteria	9688
586	Ga0207667_10030561	3300025949	Bacteria	5827
587	Ga0207667_10037902	3300025949	Bacteria	5151
588	Ga0207667_10041707	3300025949	Bacteria	4880
589	Ga0207667_10047275	3300025949	Bacteria	4555
590	Ga0207667_10286571	3300025949	Bacteria	1683
591	Ga0207651_10003772	3300025960	Bacteria	7507
592	Ga0207651_10019974	3300025960	Bacteria	4030
593	Ga0207651_10050635	3300025960	Bacteria	2821
594	Ga0207651_10503227	3300025960	Bacteria	1048
595	Ga0207712_10225293	3300025961	Bacteria	1501
596	Ga0207668_10448070	3300025972	Bacteria	1101
597	Ga0207640_10009873	3300025981	Bacteria	5358
598	Ga0207658_10091250	3300025986	Bacteria	2363
599	Ga0207677_10085400	3300026023	Bacteria	2278
600	Ga0207677_10166164	3300026023	Bacteria	1720
601	Ga0207677_10166833	3300026023	Bacteria	1717
602	Ga0207703_10036560	3300026035	Bacteria	3910
603	Ga0207639_10288788	3300026041	Bacteria	1445
604	Ga0207678_10000064	3300026067	Bacteria	83470
605	Ga0207678_10023965	3300026067	Bacteria	5335
606	Ga0207678_10098361	3300026067	Bacteria	2500
607	Ga0207678_10175179	3300026067	Bacteria	1831
608	Ga0207678_10198030	3300026067	Bacteria	1717
609	Ga0207708_10003877	3300026075	Bacteria	11008
610	Ga0207702_10002489	3300026078	Bacteria	17397
611	Ga0207648_10000227	3300026089	Bacteria	60175
612	Ga0207648_10003813	3300026089	Bacteria	15762
613	Ga0207648_10007927	3300026089	Bacteria	10355
614	Ga0207648_10010087	3300026089	Bacteria	8981
615	Ga0207648_10111641	3300026089	Bacteria	2400
616	Ga0207648_10259374	3300026089	Bacteria	1551
617	Ga0207676_10177856	3300026095	Bacteria	1860
618	Ga0207674_10007534	3300026116	Bacteria	12684
619	Ga0207674_10081983	3300026116	Bacteria	3227
620	Ga0207674_10144190	3300026116	Bacteria	2341
621	Ga0207674_10188396	3300026116	Bacteria	2013
622	Ga0207674_10303386	3300026116	Bacteria	1546
623	Ga0207674_10307601	3300026116	Bacteria	1534
624	Ga0207675_100005712	3300026118	Bacteria	11906
625	Ga0207675_100031261	3300026118	Bacteria	4959
626	Ga0207675_100173940	3300026118	Bacteria	2059
627	Ga0207683_10053980	3300026121	Bacteria	3524
628	Ga0207683_10109918	3300026121	Bacteria	2468
629	Ga0207683_10147976	3300026121	Bacteria	2119
630	Ga0207698_10008214	3300026142	Bacteria	6585
631	Ga0207698_10044735	3300026142	Bacteria	3330
632	Ga0209371_1000076	3300027312	Bacteria	195166
633	Ga0209998_10015337	3300027717	Bacteria	1604
634	Ga0209813_10002707	3300027866	Bacteria	4081
635	Ga0209974_10003819	3300027876	Bacteria	5402
636	Ga0209974_10003999	3300027876	Bacteria	5273
637	Ga0268266_10054810	3300028379	Bacteria	3427
638	Ga0268266_10224872	3300028379	Bacteria	1726
639	Ga0268265_10030857	3300028380	Bacteria	3865
640	Ga0268265_10051042	3300028380	Bacteria	3120
641	Ga0268264_10000153	3300028381	Bacteria	157298
642	Ga0268264_10137877	3300028381	Bacteria	2171
643	Ga0268264_10365151	3300028381	Bacteria	1378
644	Ga0307517_10000122	3300028786	Bacteria	116429
645	Ga0307517_10015711	3300028786	Bacteria	10030
646	Ga0307515_10000030	3300028794	Bacteria	364482
647	Ga0307515_10003694	3300028794	Bacteria	32127
648	Ga0307515_10018203	3300028794	Bacteria	12740
649	Ga0307515_10035466	3300028794	Bacteria	8112
650	Ga0307515_10086362	3300028794	Bacteria	4000
651	Ga0307515_10177504	3300028794	Bacteria	2094
652	Ga0265338_10000037	3300028800	Bacteria	237244
653	Ga0268256_1000087	3300030500	Bacteria	157659
654	Ga0307511_10079461	3300030521	Bacteria	2318
655	Ga0307512_10046658	3300030522	Bacteria	3530
656	Ga0307512_10086069	3300030522	Bacteria	2223
657	Ga0265316_10277438	3300031344	Bacteria	1225
658	Ga0307513_10012493	3300031456	Bacteria	10474
659	Ga0307513_10090996	3300031456	Bacteria	3110
660	Ga0307513_10114027	3300031456	Bacteria	2689
661	Ga0307509_10019814	3300031507	Bacteria	7653
662	Ga0307509_10094195	3300031507	Bacteria	3054
663	Ga0307408_100004032	3300031548	Bacteria	10014
664	Ga0307408_100172700	3300031548	Bacteria	1727
665	Ga0265313_10006112	3300031595	Bacteria	8658
666	Ga0307508_10000013	3300031616	Bacteria	242867
667	Ga0307508_10001048	3300031616	Bacteria	32001
668	Ga0307508_10008457	3300031616	Bacteria	9508
669	Ga0307508_10109356	3300031616	Bacteria	2363
670	Ga0307514_10001002	3300031649	Bacteria	41404
671	Ga0307514_10031572	3300031649	Bacteria	4247
672	Ga0307514_10067244	3300031649	Bacteria	2705
673	Ga0307516_10001109	3300031730	Bacteria	37546
674	Ga0307516_10006446	3300031730	Bacteria	13742
675	Ga0307516_10027303	3300031730	Bacteria	5788
676	Ga0307413_10022928	3300031824	Bacteria	3375
677	Ga0307413_10234068	3300031824	Bacteria	1351
678	Ga0307406_10052309	3300031901	Bacteria	2597
679	Ga0307407_10044730	3300031903	Bacteria	2498
680	Ga0307412_10000008	3300031911	Bacteria	461034
681	Ga0307412_10248699	3300031911	Bacteria	1379
682	Ga0307412_10443535	3300031911	Bacteria	1067
683	Ga0307416_100006069	3300032002	Bacteria	7524
684	Ga0307416_100272365	3300032002	Bacteria	1663
685	Ga0307416_100447575	3300032002	Bacteria	1343
686	Ga0307414_10007388	3300032004	Bacteria	6175
687	Ga0307414_10105433	3300032004	Bacteria	2131
688	Ga0307414_10360084	3300032004	Bacteria	1251
689	Ga0307411_10015734	3300032005	Bacteria	4260
690	Ga0307415_100040215	3300032126	Bacteria	3096
691	Ga0307415_100162100	3300032126	Bacteria	1734
692	Ga0307415_100328280	3300032126	Bacteria	1279
693	Ga0307507_10081359	3300033179	Bacteria	2849
694	Ga0307507_10113924	3300033179	Bacteria	2195
695	Ga0307507_10171637	3300033179	Bacteria	1574
696	Ga0373931_0000563	3300035691	Bacteria	15293
697	Ga0373935_0025489	3300035692	Bacteria	3644
698	Ga0373927_0193562	3300035695	Bacteria	1334
699	Ga0373947_0239566	3300035725	Bacteria	1197
700	Ga0373937_0078412	3300036401	Bacteria	3053
701	Ga0373937_0462570	3300036401	Bacteria	1205
702	Ga0373925_0007887	3300037068	Bacteria	7752
703	Ga0395899_0017684	3300037312	Bacteria	5430
704	Ga0395900_0011347	3300037418	Bacteria	9116
705	Ga0395900_0029670	3300037418	Bacteria	5612
706	Ga0395900_0470260	3300037418	Bacteria	1211
707	Ga0395898_0005818	3300037466	Bacteria	13263
708	Ga0395898_0007951	3300037466	Bacteria	11245
709	Ga0395905_0000020	3300037471	Bacteria	337672
710	Ga0395905_0001317	3300037471	Bacteria	30505
711	Ga0395905_0004520	3300037471	Bacteria	14409
712	Ga0395905_0007987	3300037471	Bacteria	10455
713	Ga0395905_0025846	3300037471	Bacteria	5534
714	Ga0395905_0081527	3300037471	Bacteria	3032
715	Ga0395905_0095335	3300037471	Bacteria	2792
716	Ga0395905_0135492	3300037471	Bacteria	2316
717	Ga0395905_0375999	3300037471	Bacteria	1314
718	Ga0436364_0791886	3300037853	Bacteria	9156
719	Ga0395901_0000012	3300038443	Bacteria	381361
720	Ga0395901_0219116	3300038443	Bacteria	1990
721	Ga0436365_0160289	3300039437	Bacteria	39593
722	Ga0436365_0260170	3300039437	Bacteria	52235
723	Ga0436365_0434446	3300039437	Bacteria	15302
724	Ga0436365_0648854	3300039437	Bacteria	6735
725	Ga0436361_0207643	3300039447	Bacteria	6280
726	Ga0436361_0293418	3300039447	Bacteria	2042
727	Ga0436361_0327111	3300039447	Bacteria	1604
728	Ga0436361_0689999	3300039447	Bacteria	10015
729	Ga0436361_1000836	3300039447	Bacteria	1131
730	Ga0436361_1060943	3300039447	Bacteria	2982
731	Ga0436363_0115488	3300039450	Bacteria	1857
732	Ga0436363_0145142	3300039450	Bacteria	7486
733	Ga0436363_0470120	3300039450	Bacteria	1690
734	Ga0436362_0900003	3300039453	Bacteria	7565
735	Ga0439439_0001787	3300041406	Bacteria	4393
736	Ga0439465_0074594	3300041413	Bacteria	1141
737	Ga0451791_0722199	3300041451	Bacteria	1782
738	Ga0451807_1199766	3300041486	Bacteria	1420
739	Ga0451853_2548354	3300041512	Bacteria	1831
740	Ga0439448_0009008	3300042005	Bacteria	2934
741	Ga0439449_0000195	3300042007	Bacteria	21171
742	Ga0439462_0000273	3300042015	Bacteria	9440
743	Ga0450917_000097	3300042120	Bacteria	5274
744	Ga0450888_000870	3300042126	Bacteria	2872
745	Ga0450890_000121	3300042127	Bacteria	12286
746	Ga0450891_000018	3300042129	Bacteria	12014
747	Ga0450918_000018	3300042531	Bacteria	32477
748	Ga0450893_0000080	3300042532	Bacteria	10276
749	Ga0451577_0004106	3300042876	Bacteria	15614
750	Ga0451577_0180758	3300042876	Bacteria	1902
751	Ga0466969_0011354	3300044656	Bacteria	4716
752	Ga0466969_0020838	3300044656	Bacteria	3391
753	Ga0466972_0069181	3300044658	Bacteria	1686
754	Ga0453683_0011247	3300044673	Bacteria	5909
755	Ga0466965_0002105	3300044683	Bacteria	8356
756	Ga0466965_0082913	3300044683	Bacteria	1622
757	Ga0466966_0001819	3300044684	Bacteria	13833
758	Ga0466966_0015353	3300044684	Bacteria	5064
759	Ga0466966_0059867	3300044684	Bacteria	2404
760	Ga0466961_0002311	3300044693	Bacteria	11851
761	Ga0466961_0008581	3300044693	Bacteria	6510
762	Ga0466961_0009180	3300044693	Bacteria	6297
763	Ga0466964_0003573	3300044706	Bacteria	5682
764	Ga0453684_0003196	3300044712	Bacteria	37544
765	Ga0453684_0010684	3300044712	Bacteria	15614
766	Ga0453684_0221584	3300044712	Bacteria	2191
767	Ga0466971_0007456	3300044719	Bacteria	4765
768	Ga0466971_0015555	3300044719	Bacteria	3351
769	Ga0466970_0000393	3300044765	Bacteria	21236
770	Ga0466957_0156098	3300044842	Bacteria	1479
771	Ga0466960_0108655	3300044901	Bacteria	1438
772	Ga0466959_0072565	3300045049	Bacteria	2491
773	Ga0466959_0090293	3300045049	Bacteria	2200
774	Ga0466959_0237196	3300045049	Bacteria	1261
775	Ga0451576_0004858	3300045051	Bacteria	17221
776	Ga0451576_0023787	3300045051	Bacteria	6628
777	Ga0466958_0075195	3300045836	Bacteria	2071
778	Ga0466967_0000594	3300045976	Bacteria	17970
779	Ga0466967_0124849	3300045976	Bacteria	2383
780	Ga0466967_0205211	3300045976	Bacteria	1868
781	Ga0495627_020153	3300046453	Bacteria	2226
782	Ga0495592_0006952	3300046454	Bacteria	8455
783	Ga0495592_0007445	3300046454	Bacteria	8202
784	Ga0495592_0100271	3300046454	Bacteria	2065
785	Ga0495603_0014592	3300046455	Bacteria	4750
786	Ga0495590_0006433	3300046457	Bacteria	4583
787	Ga0495591_001133	3300046458	Bacteria	17588
788	Ga0495629_0000037	3300046459	Bacteria	117099
789	Ga0495629_0009749	3300046459	Bacteria	7008
790	Ga0495629_0011345	3300046459	Bacteria	6474
791	Ga0495629_0015247	3300046459	Bacteria	5521
792	Ga0495629_0119013	3300046459	Bacteria	1840
793	Ga0495638_0010800	3300046460	Bacteria	6316
794	Ga0495638_0222334	3300046460	Bacteria	1055
795	Ga0495641_0006884	3300046461	Bacteria	7260
796	Ga0495651_0008500	3300046462	Bacteria	7866
797	Ga0495651_0014755	3300046462	Bacteria	6042
798	Ga0495651_0089718	3300046462	Bacteria	2307
799	Ga0495651_0239605	3300046462	Bacteria	1245
800	Ga0495653_0000048	3300046463	Bacteria	109560
801	Ga0495653_0007836	3300046463	Bacteria	8748
802	Ga0495653_0026867	3300046463	Bacteria	4611
803	Ga0495653_0054787	3300046463	Bacteria	3045
804	Ga0495650_0001359	3300046471	Bacteria	24265
805	Ga0495650_0011145	3300046471	Bacteria	4952
806	Ga0495650_0012273	3300046471	Bacteria	4619
807	Ga0495580_0001868	3300046472	Bacteria	18519
808	Ga0495580_0001912	3300046472	Bacteria	18310
809	Ga0495580_0007736	3300046472	Bacteria	8614
810	Ga0495580_0010047	3300046472	Bacteria	7397
811	Ga0495580_0098164	3300046472	Bacteria	2037
812	Ga0495582_0006210	3300046473	Bacteria	6653
813	Ga0495582_0009230	3300046473	Bacteria	5440
814	Ga0495605_0006858	3300046474	Bacteria	6503
815	Ga0495639_0003163	3300046475	Bacteria	7154
816	Ga0495662_0020289	3300046476	Bacteria	3214
817	Ga0495662_0152682	3300046476	Bacteria	1137
818	Ga0495664_0003489	3300046477	Bacteria	8561
819	Ga0495664_0006583	3300046477	Bacteria	6422
820	Ga0495596_0008931	3300046500	Bacteria	4429
821	Ga0495596_0014284	3300046500	Bacteria	3346
822	Ga0495583_0000777	3300046506	Bacteria	39942
823	Ga0495583_0001998	3300046506	Bacteria	18690
824	Ga0495606_0000329	3300046507	Bacteria	81972
825	Ga0495606_0001836	3300046507	Bacteria	26858
826	Ga0495606_0115549	3300046507	Bacteria	1613
827	Ga0495608_0001107	3300046511	Bacteria	19096
828	Ga0495608_0018698	3300046511	Bacteria	4775
829	Ga0495608_0058334	3300046511	Bacteria	2545
830	Ga0495610_0080244	3300046512	Bacteria	1500
831	Ga0495616_0020020	3300046513	Bacteria	3647
832	Ga0495618_0006047	3300046514	Bacteria	7348
833	Ga0495618_0011338	3300046514	Bacteria	5403
834	Ga0495628_0000750	3300046516	Bacteria	29958
835	Ga0495628_0001146	3300046516	Bacteria	24161
836	Ga0495628_0019624	3300046516	Bacteria	5584
837	Ga0495628_0022827	3300046516	Bacteria	5137
838	Ga0495628_0038395	3300046516	Bacteria	3833
839	Ga0495630_0001216	3300046517	Bacteria	17784
840	Ga0495630_0006401	3300046517	Bacteria	8377
841	Ga0495630_0032358	3300046517	Bacteria	3896
842	Ga0495631_0000764	3300046518	Bacteria	20676
843	Ga0495637_0004753	3300046520	Bacteria	7005
844	Ga0495643_0053499	3300046522	Bacteria	2164
845	Ga0495648_0013915	3300046524	Bacteria	5922
846	Ga0495648_0025623	3300046524	Bacteria	3988
847	Ga0495648_0026206	3300046524	Bacteria	3928
848	Ga0495666_0005317	3300046526	Bacteria	6490
849	Ga0495666_0007716	3300046526	Bacteria	5384
850	Ga0495666_0010065	3300046526	Bacteria	4718
851	Ga0495666_0054701	3300046526	Bacteria	1914
852	Ga0495642_0023111	3300046528	Bacteria	2453
853	Ga0495642_0122519	3300046528	Bacteria	1116
854	Ga0495652_0015088	3300046529	Bacteria	6921
855	Ga0495652_0158588	3300046529	Bacteria	1759
856	Ga0495654_0001454	3300046530	Bacteria	16232
857	Ga0495665_0005545	3300046531	Bacteria	6800
858	Ga0495665_0015436	3300046531	Bacteria	4112
859	Ga0495665_0017313	3300046531	Bacteria	3876
860	Ga0495640_0010836	3300046533	Bacteria	7033
861	Ga0495640_0011199	3300046533	Bacteria	6905
862	Ga0495586_0011616	3300046535	Bacteria	4685
863	Ga0495587_0004013	3300046536	Bacteria	9753
864	Ga0495609_0072515	3300046538	Bacteria	1512
865	Ga0495597_0038434	3300046542	Bacteria	2145
866	Ga0495597_0039031	3300046542	Bacteria	2127
867	Ga0495645_0135490	3300046543	Bacteria	1723
868	Ga0495622_0000020	3300046557	Bacteria	166839
869	Ga0495667_0020427	3300046559	Bacteria	4469
870	Ga0495667_0140545	3300046559	Bacteria	1556
871	Ga0495656_0053917	3300046615	Bacteria	1729
872	Ga0495634_0003986	3300046642	Bacteria	11717
873	Ga0495634_0023676	3300046642	Bacteria	4314
874	Ga0495611_0033129	3300046648	Bacteria	2280
875	Ga0495625_0000224	3300046660	Bacteria	89521
876	Ga0495625_0000428	3300046660	Bacteria	63353
877	Ga0495625_0006755	3300046660	Bacteria	10161
878	Ga0495625_0068949	3300046660	Bacteria	2485
879	Ga0495625_0166290	3300046660	Bacteria	1474
880	Ga0495625_0344944	3300046660	Bacteria	943
881	Ga0495635_0006790	3300046663	Bacteria	7999
882	Ga0495635_0019213	3300046663	Bacteria	4767
883	Ga0495635_0039920	3300046663	Bacteria	3245
884	Ga0495661_0011452	3300046665	Bacteria	6018
885	Ga0495599_0000743	3300046678	Bacteria	18395
886	Ga0495599_0018380	3300046678	Bacteria	4355
887	Ga0495599_0051297	3300046678	Bacteria	2585
888	Ga0495599_0066014	3300046678	Bacteria	2260
889	Ga0495599_0071584	3300046678	Bacteria	2164
890	Ga0495623_0003396	3300046679	Bacteria	10528
891	Ga0495623_0014104	3300046679	Bacteria	5176
892	Ga0495623_0022491	3300046679	Bacteria	4072
893	Ga0495646_0001003	3300046680	Bacteria	16281
894	Ga0495646_0005012	3300046680	Bacteria	8349
895	Ga0495646_0006860	3300046680	Bacteria	7226
896	Ga0495646_0020713	3300046680	Bacteria	4159
897	Ga0495646_0057350	3300046680	Bacteria	2331
898	Ga0495613_0007400	3300046689	Bacteria	8183
899	Ga0495624_0000704	3300046690	Bacteria	26244
900	Ga0495624_0001825	3300046690	Bacteria	16258
901	Ga0495624_0021543	3300046690	Bacteria	4272
902	Ga0495624_0168238	3300046690	Bacteria	1337
903	Ga0495671_0013248	3300046692	Bacteria	4475
904	Ga0495671_0066807	3300046692	Bacteria	1769
905	Ga0495671_0090250	3300046692	Bacteria	1500
906	Ga0495649_0000336	3300046694	Bacteria	40372
907	Ga0495649_0000722	3300046694	Bacteria	26827
908	Ga0495649_0073408	3300046694	Bacteria	1833
909	Ga0495589_0011674	3300046794	Bacteria	4559
910	Ga0495589_0034655	3300046794	Bacteria	2533
911	Ga0495600_0002091	3300046809	Bacteria	11277
912	Ga0495600_0002266	3300046809	Bacteria	10962
913	Ga0495660_0012196	3300046810	Bacteria	4987
914	Ga0495581_0001651	3300047315	Bacteria	12435
915	Ga0495581_0024461	3300047315	Bacteria	3500
916	Ga0495581_0034191	3300047315	Bacteria	2941
917	Ga0495604_0000220	3300047317	Bacteria	52204
918	Ga0495604_0006275	3300047317	Bacteria	9434
919	Ga0495604_0020636	3300047317	Bacteria	5261
920	Ga0495604_0022023	3300047317	Bacteria	5087
921	Ga0495604_0051947	3300047317	Bacteria	3175
922	Ga0495674_0001016	3300047319	Bacteria	26930
923	Ga0495674_0002056	3300047319	Bacteria	19727
924	Ga0495674_0028224	3300047319	Bacteria	5121
925	Ga0495674_0048143	3300047319	Bacteria	3774
926	Ga0495674_0057087	3300047319	Bacteria	3417
927	Ga0495672_0122577	3300047320	Bacteria	1379
928	Ga0495676_0021699	3300047321	Bacteria	5602
929	Ga0495676_0043274	3300047321	Bacteria	3688
930	Ga0495680_0070997	3300047322	Bacteria	2652
931	Ga0495680_0082608	3300047322	Bacteria	2424
932	Ga0495683_0001015	3300047323	Bacteria	19569
933	Ga0495683_0008795	3300047323	Bacteria	5388
934	Ga0495683_0017969	3300047323	Bacteria	3660
935	Ga0495687_000005	3300047443	Bacteria	610401
936	Ga0495687_021705	3300047443	Bacteria	3099
937	Ga0495687_054565	3300047443	Bacteria	1676
938	Ga0495687_116519	3300047443	Bacteria	971
939	Ga0495675_0001697	3300047444	Bacteria	13199
940	Ga0495675_0008499	3300047444	Bacteria	6361
941	Ga0495675_0020786	3300047444	Bacteria	4177
942	Ga0495675_0041473	3300047444	Bacteria	2933
943	Ga0495677_0084476	3300047445	Bacteria	1192
944	Ga0495679_000038	3300047446	Bacteria	157311
945	Ga0495679_004552	3300047446	Bacteria	6342
946	Ga0495673_0001492	3300047469	Bacteria	18506
947	Ga0495673_0040578	3300047469	Bacteria	2101
948	Ga0495681_0040812	3300047470	Bacteria	2257
949	Ga0495684_0014824	3300047471	Bacteria	6002
950	Ga0495686_0111768	3300047472	Bacteria	1637
951	Ga0495593_0001431	3300047673	Bacteria	14002
952	Ga0495593_0007461	3300047673	Bacteria	6397
953	Ga0495593_0158142	3300047673	Bacteria	1144
954	Ga0495602_0014424	3300048088	Bacteria	8020
955	Ga0495602_0029608	3300048088	Bacteria	5209
956	Ga0495602_0068914	3300048088	Bacteria	3036
957	Ga0495602_0249497	3300048088	Bacteria	1323
958	Ga0495602_0344202	3300048088	Bacteria	1077
959	Ga0495614_0001292	3300048089	Bacteria	10793
960	Ga0495614_0009157	3300048089	Bacteria	4389
961	Ga0495614_0018692	3300048089	Bacteria	3001
962	Ga0495614_0043294	3300048089	Bacteria	1930
963	Ga0495626_0036178	3300048091	Bacteria	2353
964	Ga0495626_0054876	3300048091	Bacteria	1829
965	Ga0496100_0003462	3300048903	Bacteria	8233
966	Ga0496101_0000205	3300048904	Bacteria	45101
967	Ga0496101_0225498	3300048904	Bacteria	1455
968	Ga0496102_0000165	3300048905	Bacteria	89141
969	Ga0496103_0000728	3300048906	Bacteria	24278
970	Ga0496103_0002046	3300048906	Bacteria	12943
971	Ga0496104_0081882	3300048907	Bacteria	3078
972	Ga0496104_0321366	3300048907	Bacteria	1460
973	Ga0496105_0144173	3300048908	Bacteria	1959
974	Ga0496106_0000032	3300048909	Bacteria	134707
975	Ga0496106_0001072	3300048909	Bacteria	20176
976	Ga0496106_0092488	3300048909	Bacteria	2336
977	Ga0496107_0293434	3300048910	Bacteria	1210
978	Ga0496108_0260226	3300048911	Bacteria	1510
979	Ga0496111_0111219	3300048914	Bacteria	2018
980	Ga0496114_0167030	3300048917	Bacteria	1916
981	Ga0496116_0005552	3300048919	Bacteria	11636
982	Ga0496116_0022924	3300048919	Bacteria	4661
983	Ga0496116_0035815	3300048919	Bacteria	3482
984	Ga0496117_0001246	3300048920	Bacteria	38001
985	Ga0496117_0002829	3300048920	Bacteria	21119
986	Ga0496117_0009590	3300048920	Bacteria	8970
987	Ga0496117_0015086	3300048920	Bacteria	6616
988	Ga0496117_0034461	3300048920	Bacteria	3813
989	Ga0496118_0000179	3300048921	Bacteria	113850
990	Ga0496118_0000283	3300048921	Bacteria	89206
991	Ga0496118_0011133	3300048921	Bacteria	8817
992	Ga0496118_0031784	3300048921	Bacteria	4366
993	Ga0496118_0041296	3300048921	Bacteria	3654
994	Ga0496118_0050515	3300048921	Bacteria	3190
995	Ga0496118_0086375	3300048921	Bacteria	2180
996	Ga0496118_0164887	3300048921	Bacteria	1363
997	Ga0496121_0000207	3300048924	Bacteria	129797
998	Ga0496121_0001382	3300048924	Bacteria	41101
999	Ga0496121_0001776	3300048924	Bacteria	34991
1000	Ga0496121_0002189	3300048924	Bacteria	30586
1001	Ga0496121_0006696	3300048924	Bacteria	14164
1002	Ga0496121_0010160	3300048924	Bacteria	10660
1003	Ga0496121_0014702	3300048924	Bacteria	8274
1004	Ga0496121_0136840	3300048924	Bacteria	1823
1005	Ga0496121_0139688	3300048924	Bacteria	1799
1006	Ga0496121_0192306	3300048924	Bacteria	1462
1007	Ga0496122_0000570	3300048925	Bacteria	75506
1008	Ga0496124_0000916	3300048927	Bacteria	47613
1009	Ga0496124_0182983	3300048927	Bacteria	1611
1010	Ga0496124_0224659	3300048927	Bacteria	1409
1011	Ga0496125_0000701	3300048928	Bacteria	55423
1012	Ga0496125_0017107	3300048928	Bacteria	6928
1013	Ga0496126_0000083	3300048929	Bacteria	217567
1014	Ga0496126_0002091	3300048929	Bacteria	27956
1015	Ga0496126_0019733	3300048929	Bacteria	6633
1016	Ga0496126_0051630	3300048929	Bacteria	3742
1017	Ga0496126_0094648	3300048929	Bacteria	2621
1018	Ga0496126_0209496	3300048929	Bacteria	1642
1019	Ga0495682_0014647	3300049460	Bacteria	2973
1020	Ga0501034_0000193	3300049571	Bacteria	115072
1021	Ga0501034_0193312	3300049571	Bacteria	1996
1022	Ga0501038_0254632	3300049574	Bacteria	1389
1023	Ga0501199_009098	3300049650	Bacteria	1048
1024	Ga0501202_004388	3300049652	Bacteria	2468
1025	Ga0501207_003139	3300049654	Bacteria	2178
1026	Ga0501222_002221	3300049662	Bacteria	2697
1027	Ga0501235_007531	3300049669	Bacteria	2369
1028	Ga0501229_000421	3300049706	Bacteria	4777
1029	Ga0501262_000780	3300049759	Bacteria	3684
1030	Ga0501265_003487	3300049762	Bacteria	1785
1031	Ga0501266_000280	3300049763	Bacteria	6719
1032	Ga0501267_000182	3300049764	Bacteria	4366
1033	Ga0501272_001713	3300049769	Bacteria	2111
1034	Ga0501274_005288	3300049771	Bacteria	1089
1035	Ga0501212_005436	3300049851	Bacteria	1682
1036	nmdc:mga03683_134_c1	3300050489	Bacteria	14287
1037	nmdc:mga03n38_52597_c1	3300050490	Bacteria	1823
1038	nmdc:mga0yw44_56522_c1	3300050492	Bacteria	2391
1039	nmdc:mga0k408_16769_c1	3300050493	Bacteria	4071
1040	nmdc:mga0k408_22357_c1	3300050493	Bacteria	3561
1041	nmdc:mga0k408_77297_c1	3300050493	Bacteria	1946
1042	nmdc:mga0k408_9720_c1	3300050493	Bacteria	5193
1043	nmdc:mga06z11_135263_c1	3300050494	Bacteria	1388
1044	nmdc:mga06z11_173345_c1	3300050494	Bacteria	1240
1045	nmdc:mga07m45_1522_c2	3300050496	Bacteria	8819
1046	nmdc:mga07m45_31751_c1	3300050496	Bacteria	2927
1047	nmdc:mga07m45_45559_c1	3300050496	Bacteria	2463
1048	nmdc:mga07m45_46534_c1	3300050496	Bacteria	2438
1049	nmdc:mga07m45_62368_c1	3300050496	Bacteria	2113
1050	nmdc:mga0n895_148273_c1	3300050512	Bacteria	2375
1051	nmdc:mga0rr50_95382_c1	3300050513	Bacteria	2325
1052	nmdc:mga0sz30_7289_c1	3300050516	Bacteria	4143
1053	Ga0495601_0120108	3300053077	Bacteria	1706
1054	Ga0500610_0008964	3300053079	Bacteria	4395
1055	Ga0500610_0102714	3300053079	Bacteria	1477
1056	Ga0495655_0002052	3300053083	Bacteria	3153
1057	Ga0500643_003427	3300053087	Bacteria	7643
1058	Ga0500644_0069104	3300053088	Bacteria	1268
1059	Ga0500651_0000167	3300053093	Bacteria	42663
1060	Ga0500651_0003137	3300053093	Bacteria	8961
1061	Ga0500571_000040	3300053110	Bacteria	40510
1062	Ga0500594_0012847	3300053118	Bacteria	1981
1063	Ga0500595_002689	3300053119	Bacteria	8626
1064	Ga0500608_003419	3300053122	Bacteria	5949
1065	Ga0500608_099718	3300053122	Bacteria	1347
1066	Ga0500642_0011888	3300053130	Bacteria	3135
1067	Ga0500655_000054	3300053133	Bacteria	31184
1068	Ga0500658_0000325	3300053134	Bacteria	21071
1069	Ga0500658_0000674	3300053134	Bacteria	14085
1070	Ga0500568_0003642	3300053139	Bacteria	8482
1071	Ga0500573_0124709	3300053140	Bacteria	1430
1072	Ga0500574_001089	3300053141	Bacteria	3852
1073	Ga0500603_037797	3300053150	Bacteria	1275
1074	Ga0500616_0005902	3300053153	Bacteria	8188
1075	Ga0500619_047857	3300053154	Bacteria	1375
1076	Ga0500627_0004483	3300053158	Bacteria	4495
1077	Ga0500634_0042790	3300053161	Bacteria	2457
1078	Ga0500638_000197	3300053162	Bacteria	12463
1079	Ga0500637_0150828	3300053178	Bacteria	1342
1080	Ga0500596_005083	3300053735	Bacteria	2350
1081	Ga0466962_0004919	3300061719	Bacteria	6423
1082	Ga0466962_0005954	3300061719	Bacteria	5859
1083	Ga0466962_0024620	3300061719	Bacteria	2890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053161	Ga0500634_0042790	Ga0500634_0042790_1279_2136	264
2	3300025208	Ga0209436_104081	Ga0209436_1040811	267
3	3300049654	Ga0501207_003139	Ga0501207_003139_11_820	269
4	3300053087	Ga0500643_003427	Ga0500643_003427_1708_2604	277
5	3300002704	JGI25155J39150_1000033	JGI25155J39150_100003324	284
6	3300002705	JGI25156J39149_1000043	JGI25156J39149_100004324	284
7	3300002738	JGI25154J39366_1000062	JGI25154J39366_100006271	284
8	3300002741	JGI25157J39369_1000060	JGI25157J39369_100006024	284
9	3300013104	Ga0157370_10001540	Ga0157370_1000154019	284
10	3300025206	Ga0209435_100041	Ga0209435_10004124	284
11	3300025246	Ga0209646_1000144	Ga0209646_100014424	284
12	3300025250	Ga0209026_1000159	Ga0209026_100015924	284
13	3300025256	Ga0209759_1000001	Ga0209759_10000012553	284
14	3300046694	Ga0495649_0073408	Ga0495649_0073408_965_1819	284
15	3300002773	JGI25152J39213_1009200	JGI25152J39213_10092002	287
16	3300002774	JGI25150J39212_1001226	JGI25150J39212_10012267	287
17	3300002987	JGI25159J45721_1013591	JGI25159J45721_10135912	287
18	3300003187	JGI25151J46595_10026071	JGI25151J46595_100260712	287
19	3300003215	JGI25153J46596_10021981	JGI25153J46596_100219812	287
20	3300003354	JGI25160J50197_1016609	JGI25160J50197_10166092	287
21	3300003374	JGI25161J50226_1001645	JGI25161J50226_10016458	287
22	3300003761	Ga0055535_1000039	Ga0055535_100003938	287
23	3300003763	Ga0055529_1000901	Ga0055529_10009013	287
24	3300003771	Ga0055526_1020352	Ga0055526_10203522	287
25	3300003773	Ga0055537_1008491	Ga0055537_10084912	287
26	3300003775	Ga0055524_1018995	Ga0055524_10189952	287
27	3300003784	Ga0055534_1010894	Ga0055534_10108942	287
28	3300003790	Ga0055528_1018443	Ga0055528_10184432	287
29	3300004625	Ga0055543_1006235	Ga0055543_10062352	287
30	3300005262	Ga0065165_1019640	Ga0065165_10196402	287
31	3300015261	Ga0182006_1095554	Ga0182006_10955541	287
32	3300025242	Ga0209258_100025	Ga0209258_100025216	287
33	3300025245	Ga0207425_1002008	Ga0207425_10020082	287
34	3300025256	Ga0209759_1000628	Ga0209759_10006282	287
35	3300025258	Ga0209129_1000024	Ga0209129_1000024287	287
36	3300025258	Ga0209129_1000085	Ga0209129_100008567	287
37	3300025263	Ga0209565_1000546	Ga0209565_100054612	287
38	3300025272	Ga0209455_1000089	Ga0209455_1000089119	287
39	3300025273	Ga0209673_1000571	Ga0209673_100057142	287
40	3300025284	Ga0209130_1000505	Ga0209130_100050524	287
41	3300025291	Ga0209675_1002997	Ga0209675_10029972	287
42	3300025294	Ga0209025_1000267	Ga0209025_100026778	287
43	3300025295	Ga0209564_1000183	Ga0209564_100018351	287
44	3300025297	Ga0209758_1000049	Ga0209758_1000049206	287
45	3300025299	Ga0209256_1000140	Ga0209256_100014051	287
46	3300025302	Ga0207426_1000053	Ga0207426_1000053242	287
47	3300025304	Ga0209257_1006972	Ga0209257_10069722	287
48	3300028794	Ga0307515_10086362	Ga0307515_100863623	288
49	3300042120	Ga0450917_000097	Ga0450917_000097_1881_2813	288
50	3300042126	Ga0450888_000870	Ga0450888_000870_1737_2669	288
51	3300042127	Ga0450890_000121	Ga0450890_000121_1731_2663	288
52	3300042129	Ga0450891_000018	Ga0450891_000018_76_1008	288
53	3300042532	Ga0450893_0000080	Ga0450893_0000080_1224_2156	288
54	3300044901	Ga0466960_0108655	Ga0466960_0108655_66_1049	288
55	3300047673	Ga0495593_0001431	Ga0495593_0001431_2124_3053	288
56	3300049650	Ga0501199_009098	Ga0501199_009098_65_994	288
57	3300049669	Ga0501235_007531	Ga0501235_007531_95_1024	288
58	3300049706	Ga0501229_000421	Ga0501229_000421_1601_2530	288
59	3300049762	Ga0501265_003487	Ga0501265_003487_396_1325	288
60	3300049769	Ga0501272_001713	Ga0501272_001713_644_1573	288
61	3300049771	Ga0501274_005288	Ga0501274_005288_49_978	288
62	3300005535	Ga0070684_100215528	Ga0070684_1002155281	289
63	3300013307	Ga0157372_10492140	Ga0157372_104921402	289
64	3300048914	Ga0496111_0111219	Ga0496111_0111219_17_1000	289
65	3300049764	Ga0501267_000182	Ga0501267_000182_175_1104	289
66	3300044719	Ga0466971_0007456	Ga0466971_0007456_1356_2300	290
67	3300046660	Ga0495625_0344944	Ga0495625_0344944_17_892	290
68	3300061719	Ga0466962_0004919	Ga0466962_0004919_3320_4264	290
69	3300003187	JGI25151J46595_10010190	JGI25151J46595_100101903	291
70	3300003771	Ga0055526_1032454	Ga0055526_10324542	291
71	3300005262	Ga0065165_1006827	Ga0065165_10068272	291
72	3300025258	Ga0209129_1008882	Ga0209129_10088822	291
73	3300025291	Ga0209675_1010462	Ga0209675_10104623	291
74	3300025292	Ga0209676_1005116	Ga0209676_10051166	291
75	3300025294	Ga0209025_1004647	Ga0209025_10046473	291
76	3300025295	Ga0209564_1006309	Ga0209564_10063095	291
77	3300025298	Ga0209050_1047294	Ga0209050_10472941	291
78	3300025303	Ga0209051_1048026	Ga0209051_10480261	291
79	3300025304	Ga0209257_1005155	Ga0209257_10051555	291
80	3300026041	Ga0207639_10288788	Ga0207639_102887881	291
81	3300028794	Ga0307515_10000030	Ga0307515_1000003018	291
82	3300038443	Ga0395901_0219116	Ga0395901_0219116_348_1313	291
83	3300047443	Ga0495687_116519	Ga0495687_116519_48_923	291
84	3300025225	Ga0209566_100436	Ga0209566_10043611	292
85	3300025294	Ga0209025_1016614	Ga0209025_10166144	292
86	3300041512	Ga0451853_2548354	Ga0451853_2548354_367_1299	292
87	3300044658	Ga0466972_0069181	Ga0466972_0069181_92_1012	292
88	3300048927	Ga0496124_0182983	Ga0496124_0182983_195_1157	292
89	3300005983	Ga0081540_1004724	Ga0081540_10047242	293
90	3300028800	Ga0265338_10000037	Ga0265338_1000003715	293
91	3300032004	Ga0307414_10007388	Ga0307414_100073882	294
92	3300032005	Ga0307411_10015734	Ga0307411_100157344	294
93	3300032126	Ga0307415_100162100	Ga0307415_1001621002	294
94	3300041406	Ga0439439_0001787	Ga0439439_0001787_461_1441	294
95	3300042007	Ga0439449_0000195	Ga0439449_0000195_17469_18449	294
96	3300042015	Ga0439462_0000273	Ga0439462_0000273_7453_8433	294
97	3300044684	Ga0466966_0015353	Ga0466966_0015353_2719_3645	294
98	3300047445	Ga0495677_0084476	Ga0495677_0084476_25_1014	294
99	3300003187	JGI25151J46595_10001083	JGI25151J46595_1000108312	295
100	3300003578	Ga0006562J51391_1086990	Ga0006562J51391_10869901	295
101	3300005844	Ga0068862_100037008	Ga0068862_1000370082	295
102	3300006353	Ga0075370_10010253	Ga0075370_100102536	295
103	3300025258	Ga0209129_1001966	Ga0209129_10019663	295
104	3300025294	Ga0209025_1000122	Ga0209025_100012255	295
105	3300025935	Ga0207709_10031617	Ga0207709_100316173	295
106	3300026089	Ga0207648_10111641	Ga0207648_101116413	295
107	3300028380	Ga0268265_10051042	Ga0268265_100510422	295
108	3300046462	Ga0495651_0239605	Ga0495651_0239605_243_1196	295
109	3300046518	Ga0495631_0000764	Ga0495631_0000764_309_1262	295
110	3300046538	Ga0495609_0072515	Ga0495609_0072515_246_1196	295
111	3300046660	Ga0495625_0068949	Ga0495625_0068949_67_1020	295
112	3300047321	Ga0495676_0043274	Ga0495676_0043274_554_1507	295
113	3300048089	Ga0495614_0009157	Ga0495614_0009157_1696_2649	295
114	3300048924	Ga0496121_0136840	Ga0496121_0136840_88_1041	295
115	3300053079	Ga0500610_0102714	Ga0500610_0102714_327_1277	295
116	3300053093	Ga0500651_0000167	Ga0500651_0000167_34045_34998	295
117	3300053110	Ga0500571_000040	Ga0500571_000040_34848_35801	295
118	3300053118	Ga0500594_0012847	Ga0500594_0012847_924_1877	295
119	3300053133	Ga0500655_000054	Ga0500655_000054_3182_4135	295
120	3300053134	Ga0500658_0000325	Ga0500658_0000325_7468_8421	295
121	3300053134	Ga0500658_0000674	Ga0500658_0000674_4859_5812	295
122	3300053139	Ga0500568_0003642	Ga0500568_0003642_6681_7634	295
123	3300053141	Ga0500574_001089	Ga0500574_001089_2617_3570	295
124	3300053153	Ga0500616_0005902	Ga0500616_0005902_2333_3286	295
125	3300053158	Ga0500627_0004483	Ga0500627_0004483_3371_4324	295
126	3300053162	Ga0500638_000197	Ga0500638_000197_8077_9030	295
127	3300001979	JGI24740J21852_10014554	JGI24740J21852_100145542	296
128	3300001989	JGI24739J22299_10023657	JGI24739J22299_100236572	296
129	3300002739	JGI25158J39367_1002712	JGI25158J39367_10027122	296
130	3300002773	JGI25152J39213_1009120	JGI25152J39213_10091202	296
131	3300002774	JGI25150J39212_1002736	JGI25150J39212_10027363	296
132	3300002774	JGI25150J39212_1012775	JGI25150J39212_10127752	296
133	3300002987	JGI25159J45721_1000163	JGI25159J45721_100016322	296
134	3300002987	JGI25159J45721_1012271	JGI25159J45721_10122712	296
135	3300003187	JGI25151J46595_10019156	JGI25151J46595_100191562	296
136	3300003187	JGI25151J46595_10025749	JGI25151J46595_100257492	296
137	3300003215	JGI25153J46596_10021699	JGI25153J46596_100216992	296
138	3300003354	JGI25160J50197_1000174	JGI25160J50197_100017449	296
139	3300003354	JGI25160J50197_1000197	JGI25160J50197_100019710	296
140	3300003374	JGI25161J50226_1000057	JGI25161J50226_100005746	296
141	3300003374	JGI25161J50226_1006842	JGI25161J50226_10068422	296
142	3300003761	Ga0055535_1000786	Ga0055535_100078611	296
143	3300003762	Ga0055542_1000022	Ga0055542_1000022125	296
144	3300003771	Ga0055526_1020182	Ga0055526_10201822	296
145	3300003773	Ga0055537_1006317	Ga0055537_10063172	296
146	3300003773	Ga0055537_1006961	Ga0055537_10069613	296
147	3300003775	Ga0055524_1018801	Ga0055524_10188012	296
148	3300003790	Ga0055528_1015211	Ga0055528_10152111	296
149	3300003791	Ga0055530_10004448	Ga0055530_100044482	296
150	3300003791	Ga0055530_10027916	Ga0055530_100279161	296
151	3300004625	Ga0055543_1000213	Ga0055543_100021345	296
152	3300005262	Ga0065165_1027925	Ga0065165_10279251	296
153	3300005288	Ga0065714_10065020	Ga0065714_100650206	296
154	3300005334	Ga0068869_100467717	Ga0068869_1004677171	296
155	3300005366	Ga0070659_100140537	Ga0070659_1001405371	296
156	3300006048	Ga0075363_100020657	Ga0075363_1000206572	296
157	3300006177	Ga0075362_10014270	Ga0075362_100142703	296
158	3300006178	Ga0075367_10075527	Ga0075367_100755272	296
159	3300006353	Ga0075370_10013658	Ga0075370_100136584	296
160	3300006353	Ga0075370_10034053	Ga0075370_100340532	296
161	3300009148	Ga0105243_10025177	Ga0105243_100251775	296
162	3300009551	Ga0105238_10130095	Ga0105238_101300951	296
163	3300012502	Ga0157347_1002126	Ga0157347_10021262	296
164	3300014497	Ga0182008_10003216	Ga0182008_100032166	296
165	3300014497	Ga0182008_10014502	Ga0182008_100145022	296
166	3300014497	Ga0182008_10062250	Ga0182008_100622502	296
167	3300015261	Ga0182006_1073593	Ga0182006_10735932	296
168	3300015262	Ga0182007_10058289	Ga0182007_100582892	296
169	3300017792	Ga0163161_10000105	Ga0163161_1000010560	296
170	3300025208	Ga0209436_104924	Ga0209436_1049242	296
171	3300025228	Ga0209672_100391	Ga0209672_1003916	296
172	3300025229	Ga0209147_102395	Ga0209147_1023952	296
173	3300025242	Ga0209258_100009	Ga0209258_100009788	296
174	3300025245	Ga0207425_1001486	Ga0207425_10014864	296
175	3300025254	Ga0209148_1000007	Ga0209148_1000007788	296
176	3300025258	Ga0209129_1001412	Ga0209129_10014126	296
177	3300025263	Ga0209565_1001120	Ga0209565_10011206	296
178	3300025263	Ga0209565_1002546	Ga0209565_10025462	296
179	3300025273	Ga0209673_1000585	Ga0209673_100058513	296
180	3300025284	Ga0209130_1000146	Ga0209130_100014658	296
181	3300025284	Ga0209130_1000923	Ga0209130_100092315	296
182	3300025291	Ga0209675_1002535	Ga0209675_10025354	296
183	3300025291	Ga0209675_1003894	Ga0209675_10038947	296
184	3300025292	Ga0209676_1000028	Ga0209676_100002854	296
185	3300025292	Ga0209676_1000194	Ga0209676_100019479	296
186	3300025294	Ga0209025_1004112	Ga0209025_10041125	296
187	3300025294	Ga0209025_1005790	Ga0209025_10057904	296
188	3300025294	Ga0209025_1012551	Ga0209025_10125512	296
189	3300025294	Ga0209025_1056324	Ga0209025_10563241	296
190	3300025295	Ga0209564_1000198	Ga0209564_100019844	296
191	3300025295	Ga0209564_1001449	Ga0209564_10014496	296
192	3300025297	Ga0209758_1004192	Ga0209758_10041927	296
193	3300025297	Ga0209758_1024593	Ga0209758_10245932	296
194	3300025298	Ga0209050_1000002	Ga0209050_1000002189	296
195	3300025298	Ga0209050_1000122	Ga0209050_1000122177	296
196	3300025298	Ga0209050_1000554	Ga0209050_100055421	296
197	3300025298	Ga0209050_1019032	Ga0209050_10190322	296
198	3300025299	Ga0209256_1000098	Ga0209256_1000098119	296
199	3300025302	Ga0207426_1000038	Ga0207426_1000038119	296
200	3300025302	Ga0207426_1000291	Ga0207426_100029146	296
201	3300025303	Ga0209051_1000194	Ga0209051_100019463	296
202	3300025304	Ga0209257_1000002	Ga0209257_100000298	296
203	3300025304	Ga0209257_1000475	Ga0209257_100047533	296
204	3300025321	Ga0207656_10002227	Ga0207656_100022276	296
205	3300025728	Ga0207655_1003555	Ga0207655_100355510	296
206	3300025911	Ga0207654_10056416	Ga0207654_100564162	296
207	3300025927	Ga0207687_10298950	Ga0207687_102989501	296
208	3300025932	Ga0207690_10105006	Ga0207690_101050062	296
209	3300025933	Ga0207706_10001911	Ga0207706_1000191115	296
210	3300025935	Ga0207709_10001197	Ga0207709_1000119710	296
211	3300025960	Ga0207651_10503227	Ga0207651_105032272	296
212	3300026067	Ga0207678_10198030	Ga0207678_101980302	296
213	3300026116	Ga0207674_10081983	Ga0207674_100819832	296
214	3300031548	Ga0307408_100004032	Ga0307408_1000040322	296
215	3300031649	Ga0307514_10067244	Ga0307514_100672442	296
216	3300032004	Ga0307414_10360084	Ga0307414_103600841	296
217	3300044712	Ga0453684_0221584	Ga0453684_0221584_1055_1996	296
218	3300046453	Ga0495627_020153	Ga0495627_020153_946_1899	296
219	3300046520	Ga0495637_0004753	Ga0495637_0004753_2900_3853	296
220	3300046660	Ga0495625_0000224	Ga0495625_0000224_42409_43362	296
221	3300046692	Ga0495671_0013248	Ga0495671_0013248_960_1913	296
222	3300048920	Ga0496117_0034461	Ga0496117_0034461_1061_2014	296
223	3300048921	Ga0496118_0011133	Ga0496118_0011133_5891_6844	296
224	3300048921	Ga0496118_0041296	Ga0496118_0041296_983_1939	296
225	3300048928	Ga0496125_0017107	Ga0496125_0017107_910_1866	296
226	3300050496	nmdc:mga07m45_1522_c2	nmdc:mga07m45_1522_c2_7665_8618	296
227	3300050496	nmdc:mga07m45_31751_c1	nmdc:mga07m45_31751_c1_1573_2526	296
228	3300053079	Ga0500610_0008964	Ga0500610_0008964_2841_3794	296
229	3300053122	Ga0500608_003419	Ga0500608_003419_680_1633	296
230	3300005563	Ga0068855_100135521	Ga0068855_1001355212	297
231	3300006038	Ga0075365_10026960	Ga0075365_100269602	297
232	3300006048	Ga0075363_100020664	Ga0075363_1000206643	297
233	3300006058	Ga0075432_10009562	Ga0075432_100095622	297
234	3300006177	Ga0075362_10061341	Ga0075362_100613412	297
235	3300009545	Ga0105237_10100744	Ga0105237_101007442	297
236	3300013104	Ga0157370_10182887	Ga0157370_101828871	297
237	3300013105	Ga0157369_10065510	Ga0157369_100655104	297
238	3300025949	Ga0207667_10030561	Ga0207667_100305612	297
239	3300031911	Ga0307412_10248699	Ga0307412_102486992	297
240	3300037471	Ga0395905_0004520	Ga0395905_0004520_4251_5192	297
241	3300044765	Ga0466970_0000393	Ga0466970_0000393_11497_12486	297
242	3300044842	Ga0466957_0156098	Ga0466957_0156098_23_1012	297
243	3300046500	Ga0495596_0014284	Ga0495596_0014284_14_907	297
244	3300049662	Ga0501222_002221	Ga0501222_002221_1466_2380	297
245	3300050492	nmdc:mga0yw44_56522_c1	nmdc:mga0yw44_56522_c1_207_1160	297
246	3300003792	Ga0055540_1012967	Ga0055540_10129673	298
247	3300003794	Ga0055531_10000570	Ga0055531_100005703	298
248	3300005328	Ga0070676_10000378	Ga0070676_1000037818	298
249	3300005331	Ga0070670_100068726	Ga0070670_1000687262	298
250	3300005333	Ga0070677_10083557	Ga0070677_100835572	298
251	3300005334	Ga0068869_100129845	Ga0068869_1001298452	298
252	3300005338	Ga0068868_100073576	Ga0068868_1000735762	298
253	3300005354	Ga0070675_100239810	Ga0070675_1002398102	298
254	3300005364	Ga0070673_100004503	Ga0070673_1000045032	298
255	3300005367	Ga0070667_100224531	Ga0070667_1002245312	298
256	3300005457	Ga0070662_100077168	Ga0070662_1000771682	298
257	3300005459	Ga0068867_100054836	Ga0068867_1000548362	298
258	3300005543	Ga0070672_100013235	Ga0070672_1000132352	298
259	3300005564	Ga0070664_100203341	Ga0070664_1002033412	298
260	3300005577	Ga0068857_100054098	Ga0068857_1000540982	298
261	3300006042	Ga0075368_10072670	Ga0075368_100726702	298
262	3300009098	Ga0105245_10064942	Ga0105245_100649422	298
263	3300009148	Ga0105243_10066660	Ga0105243_100666603	298
264	3300013308	Ga0157375_10036029	Ga0157375_100360293	298
265	3300025303	Ga0209051_1000055	Ga0209051_1000055201	298
266	3300025304	Ga0209257_1000101	Ga0209257_1000101175	298
267	3300025893	Ga0207682_10026744	Ga0207682_100267442	298
268	3300025907	Ga0207645_10001967	Ga0207645_1000196711	298
269	3300025925	Ga0207650_10023294	Ga0207650_100232943	298
270	3300025926	Ga0207659_10216793	Ga0207659_102167932	298
271	3300025933	Ga0207706_10043757	Ga0207706_100437572	298
272	3300025940	Ga0207691_10129027	Ga0207691_101290272	298
273	3300025942	Ga0207689_10045601	Ga0207689_100456013	298
274	3300025960	Ga0207651_10050635	Ga0207651_100506352	298
275	3300025986	Ga0207658_10091250	Ga0207658_100912502	298
276	3300026023	Ga0207677_10085400	Ga0207677_100854002	298
277	3300026089	Ga0207648_10007927	Ga0207648_100079273	298
278	3300026116	Ga0207674_10144190	Ga0207674_101441902	298
279	3300027866	Ga0209813_10002707	Ga0209813_100027072	298
280	3300032002	Ga0307416_100006069	Ga0307416_1000060697	298
281	3300032126	Ga0307415_100040215	Ga0307415_1000402151	298
282	3300045976	Ga0466967_0000594	Ga0466967_0000594_10266_11288	298
283	3300048909	Ga0496106_0000032	Ga0496106_0000032_61362_62258	298
284	3300048924	Ga0496121_0014702	Ga0496121_0014702_6687_7583	298
285	3300049571	Ga0501034_0000193	Ga0501034_0000193_30428_31357	298
286	3300050493	nmdc:mga0k408_22357_c1	nmdc:mga0k408_22357_c1_452_1393	298
287	3300050494	nmdc:mga06z11_135263_c1	nmdc:mga06z11_135263_c1_354_1295	298
288	3300050496	nmdc:mga07m45_62368_c1	nmdc:mga07m45_62368_c1_1034_1975	298
289	3300003758	Ga0055532_1000991	Ga0055532_10009912	299
290	3300003760	Ga0055527_1000349	Ga0055527_10003492	299
291	3300003760	Ga0055527_1000762	Ga0055527_10007622	299
292	3300003761	Ga0055535_1000792	Ga0055535_10007922	299
293	3300003761	Ga0055535_1001868	Ga0055535_10018682	299
294	3300003762	Ga0055542_1000747	Ga0055542_100074717	299
295	3300003763	Ga0055529_1000690	Ga0055529_10006902	299
296	3300003790	Ga0055528_1001609	Ga0055528_100160910	299
297	3300005445	Ga0070708_100208711	Ga0070708_1002087111	299
298	3300005467	Ga0070706_100005642	Ga0070706_1000056425	299
299	3300005471	Ga0070698_100108240	Ga0070698_1001082403	299
300	3300005518	Ga0070699_100408627	Ga0070699_1004086271	299
301	3300005937	Ga0081455_10219144	Ga0081455_102191442	299
302	3300009094	Ga0111539_10290920	Ga0111539_102909202	299
303	3300025225	Ga0209566_100493	Ga0209566_10049321	299
304	3300025226	Ga0209674_100928	Ga0209674_1009282	299
305	3300025228	Ga0209672_100020	Ga0209672_100020212	299
306	3300025228	Ga0209672_100066	Ga0209672_100066150	299
307	3300025229	Ga0209147_100024	Ga0209147_100024212	299
308	3300025229	Ga0209147_100063	Ga0209147_10006348	299
309	3300025229	Ga0209147_100084	Ga0209147_10008417	299
310	3300025242	Ga0209258_100084	Ga0209258_100084212	299
311	3300025242	Ga0209258_100117	Ga0209258_10011717	299
312	3300025254	Ga0209148_1000148	Ga0209148_1000148119	299
313	3300025254	Ga0209148_1001093	Ga0209148_10010938	299
314	3300025272	Ga0209455_1000110	Ga0209455_100011017	299
315	3300025272	Ga0209455_1000298	Ga0209455_100029841	299
316	3300025273	Ga0209673_1000056	Ga0209673_100005618	299
317	3300025295	Ga0209564_1018584	Ga0209564_10185842	299
318	3300025910	Ga0207684_10002633	Ga0207684_100026337	299
319	3300025922	Ga0207646_10066508	Ga0207646_100665083	299
320	3300028786	Ga0307517_10000122	Ga0307517_1000012297	299
321	3300028786	Ga0307517_10015711	Ga0307517_1001571113	299
322	3300028794	Ga0307515_10177504	Ga0307515_101775042	299
323	3300031456	Ga0307513_10114027	Ga0307513_101140272	299
324	3300031507	Ga0307509_10019814	Ga0307509_100198143	299
325	3300031616	Ga0307508_10008457	Ga0307508_100084575	299
326	3300031616	Ga0307508_10109356	Ga0307508_101093561	299
327	3300033179	Ga0307507_10113924	Ga0307507_101139241	299
328	3300037312	Ga0395899_0017684	Ga0395899_0017684_51_1094	299
329	3300046460	Ga0495638_0222334	Ga0495638_0222334_38_979	299
330	3300046530	Ga0495654_0001454	Ga0495654_0001454_13286_14251	299
331	3300050494	nmdc:mga06z11_173345_c1	nmdc:mga06z11_173345_c1_278_1201	299
332	3300006852	Ga0075433_10049200	Ga0075433_100492002	300
333	3300027312	Ga0209371_1000076	Ga0209371_100007658	300
334	3300030500	Ga0268256_1000087	Ga0268256_100008780	300
335	3300041413	Ga0439465_0074594	Ga0439465_0074594_169_1098	300
336	3300046615	Ga0495656_0053917	Ga0495656_0053917_210_1205	300
337	3300048917	Ga0496114_0167030	Ga0496114_0167030_338_1348	300
338	iso_pu_bacteria	2585428062	2587757330	300
339	3300002067	JGI24735J21928_10002281	JGI24735J21928_100022812	301
340	3300005327	Ga0070658_10202993	Ga0070658_102029932	301
341	3300005339	Ga0070660_100000824	Ga0070660_10000082416	301
342	3300005563	Ga0068855_100002067	Ga0068855_10000206712	301
343	3300005577	Ga0068857_100347509	Ga0068857_1003475091	301
344	3300006237	Ga0097621_100327102	Ga0097621_1003271021	301
345	3300006358	Ga0068871_100046910	Ga0068871_1000469102	301
346	3300009093	Ga0105240_10001916	Ga0105240_100019167	301
347	3300009098	Ga0105245_10350660	Ga0105245_103506602	301
348	3300009174	Ga0105241_10042124	Ga0105241_100421243	301
349	3300009177	Ga0105248_10255528	Ga0105248_102555282	301
350	3300009545	Ga0105237_10022179	Ga0105237_100221795	301
351	3300010375	Ga0105239_10022712	Ga0105239_100227122	301
352	3300010375	Ga0105239_10217517	Ga0105239_102175172	301
353	3300013100	Ga0157373_10016431	Ga0157373_100164313	301
354	3300013104	Ga0157370_10002288	Ga0157370_1000228814	301
355	3300013105	Ga0157369_10001266	Ga0157369_100012664	301
356	3300013296	Ga0157374_10000032	Ga0157374_10000032152	301
357	3300013306	Ga0163162_10212651	Ga0163162_102126511	301
358	3300013307	Ga0157372_10010032	Ga0157372_100100324	301
359	3300013308	Ga0157375_10181890	Ga0157375_101818902	301
360	3300025904	Ga0207647_10000667	Ga0207647_1000066720	301
361	3300025909	Ga0207705_10012017	Ga0207705_100120172	301
362	3300025913	Ga0207695_10005541	Ga0207695_1000554110	301
363	3300025914	Ga0207671_10031648	Ga0207671_100316482	301
364	3300025919	Ga0207657_10002598	Ga0207657_1000259814	301
365	3300025945	Ga0207679_10213568	Ga0207679_102135682	301
366	3300025949	Ga0207667_10047275	Ga0207667_100472753	301
367	3300037418	Ga0395900_0011347	Ga0395900_0011347_4814_5770	301
368	3300042005	Ga0439448_0009008	Ga0439448_0009008_604_1560	301
369	3300046660	Ga0495625_0006755	Ga0495625_0006755_493_1404	301
370	3300061719	Ga0466962_0005954	Ga0466962_0005954_3129_4079	301
371	3300003760	Ga0055527_1004591	Ga0055527_10045911	302
372	3300009147	Ga0114129_10744032	Ga0114129_107440321	302
373	3300025228	Ga0209672_100609	Ga0209672_10060915	302
374	3300031824	Ga0307413_10022928	Ga0307413_100229284	302
375	3300031903	Ga0307407_10044730	Ga0307407_100447303	302
376	3300032002	Ga0307416_100272365	Ga0307416_1002723652	302
377	3300037418	Ga0395900_0029670	Ga0395900_0029670_665_1615	302
378	3300037466	Ga0395898_0005818	Ga0395898_0005818_9459_10409	302
379	3300037466	Ga0395898_0007951	Ga0395898_0007951_4898_5854	302
380	3300038443	Ga0395901_0000012	Ga0395901_0000012_107213_108163	302
381	3300045051	Ga0451576_0023787	Ga0451576_0023787_2823_3749	302
382	3300009148	Ga0105243_10332331	Ga0105243_103323312	303
383	3300049763	Ga0501266_000280	Ga0501266_000280_5672_6619	303
384	3300005455	Ga0070663_100156765	Ga0070663_1001567652	304
385	3300005459	Ga0068867_100000091	Ga0068867_10000009136	304
386	3300005577	Ga0068857_100441941	Ga0068857_1004419411	304
387	3300006058	Ga0075432_10032303	Ga0075432_100323031	304
388	3300006177	Ga0075362_10007696	Ga0075362_100076963	304
389	3300006178	Ga0075367_10026180	Ga0075367_100261803	304
390	3300006186	Ga0075369_10002536	Ga0075369_100025363	304
391	3300006195	Ga0075366_10031692	Ga0075366_100316923	304
392	3300006353	Ga0075370_10006256	Ga0075370_100062566	304
393	3300009093	Ga0105240_10122159	Ga0105240_101221593	304
394	3300009148	Ga0105243_10004977	Ga0105243_100049776	304
395	3300009545	Ga0105237_10007408	Ga0105237_100074086	304
396	3300010375	Ga0105239_10056576	Ga0105239_100565762	304
397	3300014745	Ga0157377_10000107	Ga0157377_1000010736	304
398	3300025303	Ga0209051_1002395	Ga0209051_10023955	304
399	3300025913	Ga0207695_10111091	Ga0207695_101110912	304
400	3300025914	Ga0207671_10014732	Ga0207671_100147325	304
401	3300025935	Ga0207709_10002921	Ga0207709_100029213	304
402	3300026067	Ga0207678_10175179	Ga0207678_101751792	304
403	3300026089	Ga0207648_10000227	Ga0207648_1000022738	304
404	3300026116	Ga0207674_10188396	Ga0207674_101883962	304
405	3300027717	Ga0209998_10015337	Ga0209998_100153371	304
406	3300027876	Ga0209974_10003999	Ga0209974_100039994	304
407	3300032002	Ga0307416_100447575	Ga0307416_1004475752	304
408	3300042531	Ga0450918_000018	Ga0450918_000018_1832_2794	304
409	3300044712	Ga0453684_0003196	Ga0453684_0003196_16328_17266	304
410	3300046810	Ga0495660_0012196	Ga0495660_0012196_4057_4971	304
411	3300050493	nmdc:mga0k408_16769_c1	nmdc:mga0k408_16769_c1_2980_3909	304
412	3300050496	nmdc:mga07m45_45559_c1	nmdc:mga07m45_45559_c1_529_1458	304
413	3300005435	Ga0070714_100004877	Ga0070714_1000048776	305
414	3300006195	Ga0075366_10103689	Ga0075366_101036892	305
415	3300009148	Ga0105243_10004749	Ga0105243_100047493	305
416	3300010375	Ga0105239_10323961	Ga0105239_103239612	305
417	3300013297	Ga0157378_10502590	Ga0157378_105025901	305
418	3300013297	Ga0157378_10574175	Ga0157378_105741751	305
419	iso_pu_bacteria	2582581866	2585395587	305
420	iso_pu_bacteria	2837651117	2837653817	305
421	iso_pu_bacteria	2919704043	2919707399	305
422	3300046511	Ga0495608_0018698	Ga0495608_0018698_744_1664	306
423	3300046516	Ga0495628_0038395	Ga0495628_0038395_115_1035	306
424	3300046678	Ga0495599_0071584	Ga0495599_0071584_261_1181	306
425	3300046690	Ga0495624_0000704	Ga0495624_0000704_22578_23498	306
426	3300046809	Ga0495600_0002266	Ga0495600_0002266_24_944	306
427	3300047317	Ga0495604_0022023	Ga0495604_0022023_189_1109	306
428	3300053077	Ga0495601_0120108	Ga0495601_0120108_609_1529	306
429	3300053154	Ga0500619_047857	Ga0500619_047857_228_1148	306
430	iso_pu_bacteria	2508501050	2508735978	306
431	iso_pu_bacteria	2643221623	2644130701	306
432	iso_pu_bacteria	2657244999	2657681268	306
433	iso_pu_bacteria	2738543024	2739305981	306
434	iso_pu_bacteria	2773857925	2774874017	306
435	iso_pu_bacteria	2775506901	2776259951	306
436	iso_pu_bacteria	2791355082	2792581680	306
437	iso_pu_bacteria	2791355091	2792622454	306
438	iso_pu_bacteria	2802429268	2804752465	306
439	iso_pu_bacteria	2882456835	2882458152	306
440	iso_pu_bacteria	2894232714	2894235923	306
441	iso_pu_bacteria	2928084124	2928086820	306
442	iso_pu_bacteria	2945972063	2945972103	306
443	iso_pu_bacteria	8002285264	8002291909	306
444	iso_pu_bacteria	8049293176	8049295038	306
445	3300005563	Ga0068855_100000175	Ga0068855_10000017516	307
446	3300006353	Ga0075370_10028203	Ga0075370_100282032	307
447	3300009147	Ga0114129_10499244	Ga0114129_104992442	307
448	3300025949	Ga0207667_10000028	Ga0207667_10000028140	307
449	3300031507	Ga0307509_10094195	Ga0307509_100941953	307
450	3300031548	Ga0307408_100172700	Ga0307408_1001727002	307
451	3300032126	Ga0307415_100328280	Ga0307415_1003282802	307
452	3300037418	Ga0395900_0470260	Ga0395900_0470260_160_1137	307
453	3300037471	Ga0395905_0001317	Ga0395905_0001317_12317_13255	307
454	3300037471	Ga0395905_0095335	Ga0395905_0095335_862_1791	307
455	3300044656	Ga0466969_0011354	Ga0466969_0011354_408_1352	307
456	3300044673	Ga0453683_0011247	Ga0453683_0011247_127_1080	307
457	3300044683	Ga0466965_0002105	Ga0466965_0002105_468_1412	307
458	3300044684	Ga0466966_0001819	Ga0466966_0001819_10948_11892	307
459	3300044693	Ga0466961_0002311	Ga0466961_0002311_3716_4660	307
460	3300044706	Ga0466964_0003573	Ga0466964_0003573_69_1013	307
461	3300045049	Ga0466959_0072565	Ga0466959_0072565_1501_2445	307
462	3300045836	Ga0466958_0075195	Ga0466958_0075195_779_1723	307
463	3300045976	Ga0466967_0124849	Ga0466967_0124849_1238_2182	307
464	3300046455	Ga0495603_0014592	Ga0495603_0014592_2254_3177	307
465	3300046459	Ga0495629_0011345	Ga0495629_0011345_5162_6085	307
466	3300046473	Ga0495582_0009230	Ga0495582_0009230_3704_4627	307
467	3300046476	Ga0495662_0020289	Ga0495662_0020289_1613_2536	307
468	3300046477	Ga0495664_0003489	Ga0495664_0003489_7249_8172	307
469	3300046516	Ga0495628_0019624	Ga0495628_0019624_942_1865	307
470	3300046517	Ga0495630_0032358	Ga0495630_0032358_2504_3427	307
471	3300046526	Ga0495666_0010065	Ga0495666_0010065_3752_4675	307
472	3300046531	Ga0495665_0015436	Ga0495665_0015436_814_1737	307
473	3300046535	Ga0495586_0011616	Ga0495586_0011616_1992_2915	307
474	3300046536	Ga0495587_0004013	Ga0495587_0004013_3692_4615	307
475	3300046642	Ga0495634_0003986	Ga0495634_0003986_3259_4182	307
476	3300046665	Ga0495661_0011452	Ga0495661_0011452_1389_2312	307
477	3300046678	Ga0495599_0018380	Ga0495599_0018380_3380_4303	307
478	3300046680	Ga0495646_0020713	Ga0495646_0020713_2126_3049	307
479	3300047315	Ga0495581_0001651	Ga0495581_0001651_3713_4636	307
480	3300047317	Ga0495604_0006275	Ga0495604_0006275_4797_5720	307
481	3300047444	Ga0495675_0008499	Ga0495675_0008499_1770_2693	307
482	3300047470	Ga0495681_0040812	Ga0495681_0040812_1286_2209	307
483	3300047471	Ga0495684_0014824	Ga0495684_0014824_941_1864	307
484	3300048088	Ga0495602_0029608	Ga0495602_0029608_3702_4625	307
485	3300048924	Ga0496121_0192306	Ga0496121_0192306_416_1411	307
486	3300049759	Ga0501262_000780	Ga0501262_000780_936_1868	307
487	3300050496	nmdc:mga07m45_46534_c1	nmdc:mga07m45_46534_c1_1013_1942	307
488	iso_pu_bacteria	2511231002	2511243049	307
489	iso_pu_bacteria	2513020051	2513227720	307
490	iso_pu_bacteria	2643221658	2644324489	307
491	iso_pu_bacteria	2643221672	2644396330	307
492	iso_pu_bacteria	2945909444	2945913763	307
493	iso_pu_bacteria	2945945610	2945947885	307
494	iso_pu_bacteria	2945984333	2945990844	307
495	iso_pu_bacteria	8004025490	8004026550	307
496	3300011119	Ga0105246_10004731	Ga0105246_100047313	308
497	3300039437	Ga0436365_0648854	Ga0436365_0648854_2086_3012	308
498	3300049571	Ga0501034_0193312	Ga0501034_0193312_156_1097	308
499	3300050493	nmdc:mga0k408_77297_c1	nmdc:mga0k408_77297_c1_721_1653	308
500	iso_pu_bacteria	2521172590	2521556926	308
501	iso_pu_bacteria	2547132374	2548500074	308
502	iso_pu_bacteria	2551306416	2553004714	308
503	iso_pu_bacteria	2599185214	2599625559	308
504	iso_pu_bacteria	2599185226	2599673572	308
505	iso_pu_bacteria	2599185227	2599683242	308
506	iso_pu_bacteria	2599185229	2599695270	308
507	iso_pu_bacteria	2643221717	2644644608	308
508	iso_pu_bacteria	2643221724	2644681579	308
509	iso_pu_bacteria	2728369380	2730231017	308
510	iso_pu_bacteria	2747842429	2747954144	308
511	iso_pu_bacteria	2765235838	2765568119	308
512	iso_pu_bacteria	2767802112	2768645060	308
513	iso_pu_bacteria	2808606386	2808983634	308
514	iso_pu_bacteria	2808606415	2809129298	308
515	iso_pu_bacteria	2808606419	2809149647	308
516	iso_pu_bacteria	2818991436	2819541751	308
517	iso_pu_bacteria	2818991446	2819599661	308
518	iso_pu_bacteria	2818991449	2819616894	308
519	iso_pu_bacteria	2838054893	2838055657	308
520	iso_pu_bacteria	2839094727	2839097588	308
521	iso_pu_bacteria	2852618963	2852619799	308
522	iso_pu_bacteria	2899924645	2899927706	308
523	iso_pu_bacteria	2900634093	2900638724	308
524	iso_pu_bacteria	2904439833	2904440374	308
525	iso_pu_bacteria	2904530477	2904530711	308
526	iso_pu_bacteria	2904584206	2904585876	308
527	iso_pu_bacteria	2904589729	2904592311	308
528	iso_pu_bacteria	2904601388	2904601553	308
529	iso_pu_bacteria	2919046199	2919049724	308
530	iso_pu_bacteria	2919079590	2919082795	308
531	iso_pu_bacteria	2923510766	2923515542	308
532	iso_pu_bacteria	2928037797	2928042016	308
533	iso_pu_bacteria	2928044640	2928049580	308
534	iso_pu_bacteria	2928051484	2928051745	308
535	iso_pu_bacteria	2928064002	2928065562	308
536	iso_pu_bacteria	2928070936	2928073021	308
537	iso_pu_bacteria	2928130867	2928134463	308
538	iso_pu_bacteria	642555113	642615272	308
539	iso_pu_bacteria	8004182704	8004184164	308
540	3300013102	Ga0157371_10002771	Ga0157371_100027715	309
541	3300026121	Ga0207683_10147976	Ga0207683_101479762	309
542	3300042876	Ga0451577_0004106	Ga0451577_0004106_4732_5673	309
543	3300044712	Ga0453684_0010684	Ga0453684_0010684_4732_5673	309
544	3300045051	Ga0451576_0004858	Ga0451576_0004858_10059_11000	309
545	iso_pu_bacteria	2501025501	2501072455	309
546	iso_pu_bacteria	2508501125	2509129776	309
547	iso_pu_bacteria	2510065045	2510248535	309
548	iso_pu_bacteria	2510917014	2511101104	309
549	iso_pu_bacteria	2510917015	2511107149	309
550	iso_pu_bacteria	2511231003	2511251599	309
551	iso_pu_bacteria	2511231026	2511385256	309
552	iso_pu_bacteria	2512047030	2512349455	309
553	iso_pu_bacteria	2513237082	2513554976	309
554	iso_pu_bacteria	2513237083	2513563091	309
555	iso_pu_bacteria	2513237151	2513960156	309
556	iso_pu_bacteria	2513237166	2514053815	309
557	iso_pu_bacteria	2515154122	2515686035	309
558	iso_pu_bacteria	2515154189	2516018959	309
559	iso_pu_bacteria	2519103095	2519460282	309
560	iso_pu_bacteria	2526164713	2527075540	309
561	iso_pu_bacteria	2548876994	2550694880	309
562	iso_pu_bacteria	2562617112	2563065131	309
563	iso_pu_bacteria	2582581311	2585292594	309
564	iso_pu_bacteria	2585428062	2587757894	309
565	iso_pu_bacteria	2599185239	2599739735	309
566	iso_pu_bacteria	2599185240	2599747326	309
567	iso_pu_bacteria	2599185355	2600209049	309
568	iso_pu_bacteria	2675903129	2676745077	309
569	iso_pu_bacteria	2711768613	2713481881	309
570	iso_pu_bacteria	2718217991	2719643038	309
571	iso_pu_bacteria	2738541296	2738818733	309
572	iso_pu_bacteria	2738541298	2738831111	309
573	iso_pu_bacteria	2738541306	2738872638	309
574	iso_pu_bacteria	2738543002	2739184268	309
575	iso_pu_bacteria	2738543008	2739219238	309
576	iso_pu_bacteria	2744054900	2746084927	309
577	iso_pu_bacteria	2744054901	2746099590	309
578	iso_pu_bacteria	2751185846	2753565735	309
579	iso_pu_bacteria	2791355137	2792836832	309
580	iso_pu_bacteria	2808606384	2808968802	309
581	iso_pu_bacteria	2808606390	2809003633	309
582	iso_pu_bacteria	2808606391	2809010910	309
583	iso_pu_bacteria	2816332253	2817257920	309
584	iso_pu_bacteria	2816332256	2817281689	309
585	iso_pu_bacteria	2816332286	2817456055	309
586	iso_pu_bacteria	2818991445	2819593969	309
587	iso_pu_bacteria	2818991452	2819635268	309
588	iso_pu_bacteria	2842324504	2842325372	309
589	iso_pu_bacteria	2842348783	2842349651	309
590	iso_pu_bacteria	2842454564	2842455111	309
591	iso_pu_bacteria	2863421361	2863424322	309
592	iso_pu_bacteria	2870068957	2870073478	309
593	iso_pu_bacteria	2883087390	2883089339	309
594	iso_pu_bacteria	2884811622	2884811799	309
595	iso_pu_bacteria	2884836552	2884839790	309
596	iso_pu_bacteria	2884852848	2884856399	309
597	iso_pu_bacteria	2885198086	2885200806	309
598	iso_pu_bacteria	2885211737	2885214411	309
599	iso_pu_bacteria	2885270888	2885278252	309
600	iso_pu_bacteria	2896154374	2896158764	309
601	iso_pu_bacteria	2902682994	2902685681	309
602	iso_pu_bacteria	2904483920	2904484509	309
603	iso_pu_bacteria	2904564687	2904567488	309
604	iso_pu_bacteria	2904571731	2904574533	309
605	iso_pu_bacteria	2904615490	2904624413	309
606	iso_pu_bacteria	2919527303	2919531526	309
607	iso_pu_bacteria	2921643360	2921645399	309
608	iso_pu_bacteria	2928157003	2928158426	309
609	iso_pu_bacteria	2928163908	2928167362	309
610	iso_pu_bacteria	2928170801	2928177089	309
611	iso_pu_bacteria	2928536128	2928540351	309
612	iso_pu_bacteria	2945934425	2945937433	309
613	iso_pu_bacteria	2981990288	2981991892	309
614	iso_pu_bacteria	2990703756	2990705871	309
615	iso_pu_bacteria	641736151	642425528	309
616	iso_pu_bacteria	641736154	642414158	309
617	iso_pu_bacteria	642555112	642597314	309
618	iso_pu_bacteria	8003955200	8003956222	309
619	iso_pu_bacteria	8018845410	8018851727	309
620	iso_pu_bacteria	8020807995	8020812182	309
621	iso_pu_bacteria	8020938398	8020942959	309
622	iso_pu_bacteria	8020945358	8020946650	309
623	iso_pu_bacteria	8020953355	8020959639	309
624	iso_pu_bacteria	8021120328	8021123951	309
625	iso_pu_bacteria	8039098773	8039100312	309
626	iso_pu_bacteria	8040167225	8040170702	309
627	iso_pu_bacteria	8040173305	8040176905	309
628	iso_pu_bacteria	8055266321	8055269019	309
629	iso_pu_bacteria	8055301274	8055301998	309
630	3300002738	JGI25154J39366_1001998	JGI25154J39366_10019981	310
631	3300006881	Ga0068865_100216862	Ga0068865_1002168622	310
632	3300014326	Ga0157380_10016339	Ga0157380_100163395	310
633	3300014968	Ga0157379_10212686	Ga0157379_102126862	310
634	3300025246	Ga0209646_1000014	Ga0209646_1000014412	310
635	3300025901	Ga0207688_10088648	Ga0207688_100886482	310
636	3300031824	Ga0307413_10234068	Ga0307413_102340682	310
637	3300031901	Ga0307406_10052309	Ga0307406_100523092	310
638	3300031911	Ga0307412_10443535	Ga0307412_104435351	310
639	3300032004	Ga0307414_10105433	Ga0307414_101054333	310
640	3300035691	Ga0373931_0000563	Ga0373931_0000563_9390_10337	310
641	3300037471	Ga0395905_0025846	Ga0395905_0025846_2015_2956	310
642	3300037471	Ga0395905_0135492	Ga0395905_0135492_540_1478	310
643	3300048911	Ga0496108_0260226	Ga0496108_0260226_136_1077	310
644	3300049652	Ga0501202_004388	Ga0501202_004388_932_1873	310
645	3300049851	Ga0501212_005436	Ga0501212_005436_522_1463	310
646	iso_pu_bacteria	2585428059	2587745261	310
647	iso_pu_bacteria	2907202186	2907203465	310
648	3300002705	JGI25156J39149_1000218	JGI25156J39149_10002183	311
649	3300002705	JGI25156J39149_1012226	JGI25156J39149_10122262	311
650	3300002738	JGI25154J39366_1000512	JGI25154J39366_10005128	311
651	3300002741	JGI25157J39369_1000018	JGI25157J39369_1000018110	311
652	3300003752	Ga0055539_1000797	Ga0055539_10007973	311
653	3300003761	Ga0055535_1011492	Ga0055535_10114921	311
654	3300005330	Ga0070690_100005034	Ga0070690_1000050344	311
655	3300005334	Ga0068869_100003543	Ga0068869_1000035435	311
656	3300005334	Ga0068869_100031797	Ga0068869_1000317973	311
657	3300005338	Ga0068868_100085350	Ga0068868_1000853501	311
658	3300005356	Ga0070674_100366791	Ga0070674_1003667911	311
659	3300005364	Ga0070673_100070079	Ga0070673_1000700792	311
660	3300005364	Ga0070673_100287109	Ga0070673_1002871091	311
661	3300005456	Ga0070678_100103808	Ga0070678_1001038082	311
662	3300005459	Ga0068867_100050539	Ga0068867_1000505392	311
663	3300005535	Ga0070684_100222454	Ga0070684_1002224541	311
664	3300005548	Ga0070665_100078494	Ga0070665_1000784943	311
665	3300005563	Ga0068855_100431010	Ga0068855_1004310102	311
666	3300005578	Ga0068854_100034373	Ga0068854_1000343732	311
667	3300005614	Ga0068856_100000953	Ga0068856_1000009539	311
668	3300005617	Ga0068859_100041591	Ga0068859_1000415913	311
669	3300005841	Ga0068863_100059471	Ga0068863_1000594713	311
670	3300005843	Ga0068860_100506398	Ga0068860_1005063981	311
671	3300005844	Ga0068862_100073318	Ga0068862_1000733183	311
672	3300006178	Ga0075367_10006540	Ga0075367_100065403	311
673	3300006237	Ga0097621_100031666	Ga0097621_1000316661	311
674	3300006358	Ga0068871_100009421	Ga0068871_1000094212	311
675	3300006931	Ga0097620_100041591	Ga0097620_1000415912	311
676	3300009093	Ga0105240_10304356	Ga0105240_103043562	311
677	3300009176	Ga0105242_10052872	Ga0105242_100528723	311
678	3300009176	Ga0105242_10133020	Ga0105242_101330202	311
679	3300009177	Ga0105248_10046936	Ga0105248_100469363	311
680	3300009553	Ga0105249_10367172	Ga0105249_103671721	311
681	3300010375	Ga0105239_10129004	Ga0105239_101290042	311
682	3300011119	Ga0105246_10027836	Ga0105246_100278363	311
683	3300013105	Ga0157369_10154553	Ga0157369_101545532	311
684	3300014969	Ga0157376_10008622	Ga0157376_100086225	311
685	3300025242	Ga0209258_100531	Ga0209258_10053118	311
686	3300025246	Ga0209646_1000067	Ga0209646_100006744	311
687	3300025250	Ga0209026_1000033	Ga0209026_1000033187	311
688	3300025253	Ga0209677_100546	Ga0209677_1005468	311
689	3300025256	Ga0209759_1000024	Ga0209759_1000024187	311
690	3300025256	Ga0209759_1001194	Ga0209759_100119414	311
691	3300025256	Ga0209759_1023859	Ga0209759_10238592	311
692	3300025909	Ga0207705_10237945	Ga0207705_102379451	311
693	3300025913	Ga0207695_10011015	Ga0207695_100110156	311
694	3300025924	Ga0207694_10040439	Ga0207694_100404392	311
695	3300025932	Ga0207690_10142786	Ga0207690_101427862	311
696	3300025934	Ga0207686_10027663	Ga0207686_100276632	311
697	3300025934	Ga0207686_10095425	Ga0207686_100954251	311
698	3300025938	Ga0207704_10252755	Ga0207704_102527551	311
699	3300025940	Ga0207691_10111800	Ga0207691_101118002	311
700	3300025941	Ga0207711_10077378	Ga0207711_100773783	311
701	3300025942	Ga0207689_10026488	Ga0207689_100264882	311
702	3300025960	Ga0207651_10019974	Ga0207651_100199742	311
703	3300025972	Ga0207668_10448070	Ga0207668_104480701	311
704	3300025981	Ga0207640_10009873	Ga0207640_100098732	311
705	3300026023	Ga0207677_10166164	Ga0207677_101661642	311
706	3300026023	Ga0207677_10166833	Ga0207677_101668331	311
707	3300026078	Ga0207702_10002489	Ga0207702_100024899	311
708	3300026089	Ga0207648_10010087	Ga0207648_100100871	311
709	3300026089	Ga0207648_10259374	Ga0207648_102593742	311
710	3300026116	Ga0207674_10007534	Ga0207674_100075343	311
711	3300026118	Ga0207675_100031261	Ga0207675_1000312614	311
712	3300026118	Ga0207675_100173940	Ga0207675_1001739402	311
713	3300026121	Ga0207683_10053980	Ga0207683_100539803	311
714	3300027876	Ga0209974_10003819	Ga0209974_100038195	311
715	3300028381	Ga0268264_10365151	Ga0268264_103651511	311
716	3300031730	Ga0307516_10027303	Ga0307516_100273035	311
717	3300036401	Ga0373937_0462570	Ga0373937_0462570_91_1038	311
718	3300037471	Ga0395905_0375999	Ga0395905_0375999_339_1283	311
719	3300044693	Ga0466961_0008581	Ga0466961_0008581_2635_3588	311
720	3300044719	Ga0466971_0015555	Ga0466971_0015555_1611_2564	311
721	3300045049	Ga0466959_0090293	Ga0466959_0090293_986_1942	311
722	3300046475	Ga0495639_0003163	Ga0495639_0003163_5655_6599	311
723	3300046506	Ga0495583_0000777	Ga0495583_0000777_25721_26665	311
724	3300046507	Ga0495606_0000329	Ga0495606_0000329_32718_33662	311
725	3300046694	Ga0495649_0000722	Ga0495649_0000722_8731_9675	311
726	3300049574	Ga0501038_0254632	Ga0501038_0254632_314_1318	311
727	3300053122	Ga0500608_099718	Ga0500608_099718_231_1175	311
728	3300061719	Ga0466962_0024620	Ga0466962_0024620_235_1188	311
729	iso_pu_bacteria	2868088558	2868095364	311
730	3300002705	JGI25156J39149_1000325	JGI25156J39149_100032526	312
731	3300002737	JGI25162J39368_1000021	JGI25162J39368_100002191	312
732	3300002772	JGI25164J39214_1002619	JGI25164J39214_10026191	312
733	3300003214	JGI25165J46597_1000049	JGI25165J46597_1000049133	312
734	3300003751	Ga0055538_1000008	Ga0055538_1000008213	312
735	3300003751	Ga0055538_1000023	Ga0055538_100002391	312
736	3300003752	Ga0055539_1000012	Ga0055539_1000012213	312
737	3300003752	Ga0055539_1000030	Ga0055539_100003091	312
738	3300003756	Ga0055533_1000015	Ga0055533_1000015213	312
739	3300003756	Ga0055533_1000039	Ga0055533_100003991	312
740	3300003759	Ga0055525_1000017	Ga0055525_1000017130	312
741	3300003759	Ga0055525_1000048	Ga0055525_1000048133	312
742	3300003841	Ga0055541_1000009	Ga0055541_1000009213	312
743	3300003841	Ga0055541_1000021	Ga0055541_1000021133	312
744	3300005455	Ga0070663_100339518	Ga0070663_1003395181	312
745	3300005457	Ga0070662_100023588	Ga0070662_1000235884	312
746	3300005578	Ga0068854_100056145	Ga0068854_1000561452	312
747	3300006195	Ga0075366_10003173	Ga0075366_100031738	312
748	3300009093	Ga0105240_10022396	Ga0105240_100223963	312
749	3300009551	Ga0105238_10000062	Ga0105238_1000006257	312
750	3300009551	Ga0105238_10466826	Ga0105238_104668261	312
751	3300010375	Ga0105239_10056421	Ga0105239_100564214	312
752	3300013105	Ga0157369_10000602	Ga0157369_100006028	312
753	3300013307	Ga0157372_10162917	Ga0157372_101629172	312
754	3300015261	Ga0182006_1010913	Ga0182006_10109131	312
755	3300015261	Ga0182006_1018572	Ga0182006_10185722	312
756	3300015262	Ga0182007_10019962	Ga0182007_100199622	312
757	3300015265	Ga0182005_1002627	Ga0182005_10026274	312
758	3300020070	Ga0206356_10395318	Ga0206356_103953182	312
759	3300020081	Ga0206354_10403482	Ga0206354_104034821	312
760	3300020082	Ga0206353_11438612	Ga0206353_114386122	312
761	3300021361	Ga0213872_10003902	Ga0213872_100039025	312
762	3300022467	Ga0224712_10000303	Ga0224712_100003039	312
763	3300025207	Ga0209760_101691	Ga0209760_1016912	312
764	3300025224	Ga0209784_100004	Ga0209784_1000041132	312
765	3300025224	Ga0209784_100005	Ga0209784_100005210	312
766	3300025225	Ga0209566_100004	Ga0209566_1000041289	312
767	3300025225	Ga0209566_100005	Ga0209566_100005210	312
768	3300025226	Ga0209674_100006	Ga0209674_1000061289	312
769	3300025226	Ga0209674_100009	Ga0209674_100009210	312
770	3300025230	Ga0209563_100009	Ga0209563_1000091132	312
771	3300025230	Ga0209563_100012	Ga0209563_100012210	312
772	3300025231	Ga0207427_100321	Ga0207427_10032113	312
773	3300025233	Ga0209437_100004	Ga0209437_1000041132	312
774	3300025253	Ga0209677_100005	Ga0209677_1000051132	312
775	3300025253	Ga0209677_100006	Ga0209677_100006210	312
776	3300025256	Ga0209759_1000097	Ga0209759_100009717	312
777	3300025261	Ga0209233_1000005	Ga0209233_10000051289	312
778	3300025913	Ga0207695_10004788	Ga0207695_100047887	312
779	3300025914	Ga0207671_10004320	Ga0207671_1000432011	312
780	3300025924	Ga0207694_10000114	Ga0207694_1000011452	312
781	3300025933	Ga0207706_10002765	Ga0207706_100027656	312
782	3300025949	Ga0207667_10041707	Ga0207667_100417072	312
783	3300026116	Ga0207674_10307601	Ga0207674_103076011	312
784	3300031649	Ga0307514_10001002	Ga0307514_100010024	312
785	3300035725	Ga0373947_0239566	Ga0373947_0239566_135_1082	312
786	3300036401	Ga0373937_0078412	Ga0373937_0078412_1370_2308	312
787	3300039447	Ga0436361_0689999	Ga0436361_0689999_6980_7918	312
788	3300046454	Ga0495592_0006952	Ga0495592_0006952_5760_6698	312
789	3300046457	Ga0495590_0006433	Ga0495590_0006433_1822_2760	312
790	3300046458	Ga0495591_001133	Ga0495591_001133_752_1690	312
791	3300046459	Ga0495629_0000037	Ga0495629_0000037_18983_19921	312
792	3300046459	Ga0495629_0009749	Ga0495629_0009749_2299_3237	312
793	3300046460	Ga0495638_0010800	Ga0495638_0010800_4138_5085	312
794	3300046462	Ga0495651_0008500	Ga0495651_0008500_3206_4144	312
795	3300046462	Ga0495651_0014755	Ga0495651_0014755_3763_4701	312
796	3300046462	Ga0495651_0089718	Ga0495651_0089718_1222_2160	312
797	3300046463	Ga0495653_0000048	Ga0495653_0000048_90348_91286	312
798	3300046471	Ga0495650_0011145	Ga0495650_0011145_3337_4275	312
799	3300046472	Ga0495580_0001912	Ga0495580_0001912_1045_1983	312
800	3300046472	Ga0495580_0098164	Ga0495580_0098164_568_1506	312
801	3300046473	Ga0495582_0006210	Ga0495582_0006210_3652_4590	312
802	3300046477	Ga0495664_0006583	Ga0495664_0006583_4862_5800	312
803	3300046506	Ga0495583_0001998	Ga0495583_0001998_17508_18446	312
804	3300046511	Ga0495608_0001107	Ga0495608_0001107_2016_2954	312
805	3300046511	Ga0495608_0058334	Ga0495608_0058334_436_1374	312
806	3300046514	Ga0495618_0006047	Ga0495618_0006047_2577_3515	312
807	3300046516	Ga0495628_0000750	Ga0495628_0000750_467_1405	312
808	3300046516	Ga0495628_0001146	Ga0495628_0001146_18787_19725	312
809	3300046516	Ga0495628_0022827	Ga0495628_0022827_1457_2395	312
810	3300046517	Ga0495630_0001216	Ga0495630_0001216_14419_15357	312
811	3300046517	Ga0495630_0006401	Ga0495630_0006401_2916_3854	312
812	3300046524	Ga0495648_0013915	Ga0495648_0013915_2686_3624	312
813	3300046524	Ga0495648_0025623	Ga0495648_0025623_315_1253	312
814	3300046526	Ga0495666_0005317	Ga0495666_0005317_1955_2893	312
815	3300046529	Ga0495652_0015088	Ga0495652_0015088_3775_4713	312
816	3300046531	Ga0495665_0005545	Ga0495665_0005545_3285_4223	312
817	3300046531	Ga0495665_0017313	Ga0495665_0017313_2878_3816	312
818	3300046533	Ga0495640_0011199	Ga0495640_0011199_2017_2955	312
819	3300046542	Ga0495597_0039031	Ga0495597_0039031_722_1660	312
820	3300046559	Ga0495667_0140545	Ga0495667_0140545_199_1137	312
821	3300046642	Ga0495634_0023676	Ga0495634_0023676_1422_2360	312
822	3300046648	Ga0495611_0033129	Ga0495611_0033129_250_1188	312
823	3300046663	Ga0495635_0019213	Ga0495635_0019213_2236_3174	312
824	3300046678	Ga0495599_0000743	Ga0495599_0000743_265_1203	312
825	3300046678	Ga0495599_0066014	Ga0495599_0066014_1063_2001	312
826	3300046679	Ga0495623_0003396	Ga0495623_0003396_7929_8867	312
827	3300046679	Ga0495623_0014104	Ga0495623_0014104_1727_2665	312
828	3300046680	Ga0495646_0001003	Ga0495646_0001003_9312_10250	312
829	3300046689	Ga0495613_0007400	Ga0495613_0007400_5524_6462	312
830	3300046690	Ga0495624_0001825	Ga0495624_0001825_8736_9674	312
831	3300046690	Ga0495624_0021543	Ga0495624_0021543_1759_2697	312
832	3300046692	Ga0495671_0066807	Ga0495671_0066807_485_1423	312
833	3300046794	Ga0495589_0011674	Ga0495589_0011674_363_1301	312
834	3300046809	Ga0495600_0002091	Ga0495600_0002091_5816_6754	312
835	3300047315	Ga0495581_0024461	Ga0495581_0024461_2121_3059	312
836	3300047317	Ga0495604_0000220	Ga0495604_0000220_18433_19371	312
837	3300047317	Ga0495604_0051947	Ga0495604_0051947_1706_2644	312
838	3300047319	Ga0495674_0001016	Ga0495674_0001016_25791_26729	312
839	3300047319	Ga0495674_0002056	Ga0495674_0002056_1943_2881	312
840	3300047319	Ga0495674_0028224	Ga0495674_0028224_3331_4269	312
841	3300047322	Ga0495680_0082608	Ga0495680_0082608_1458_2396	312
842	3300047323	Ga0495683_0001015	Ga0495683_0001015_16851_17789	312
843	3300047323	Ga0495683_0017969	Ga0495683_0017969_827_1765	312
844	3300047444	Ga0495675_0001697	Ga0495675_0001697_8490_9428	312
845	3300047444	Ga0495675_0020786	Ga0495675_0020786_2220_3158	312
846	3300047446	Ga0495679_000038	Ga0495679_000038_64047_64985	312
847	3300047469	Ga0495673_0001492	Ga0495673_0001492_4291_5229	312
848	3300048088	Ga0495602_0068914	Ga0495602_0068914_1101_2039	312
849	3300048089	Ga0495614_0001292	Ga0495614_0001292_3224_4162	312
850	3300048091	Ga0495626_0036178	Ga0495626_0036178_774_1712	312
851	3300048906	Ga0496103_0002046	Ga0496103_0002046_2172_3110	312
852	3300048920	Ga0496117_0002829	Ga0496117_0002829_16471_17409	312
853	3300048921	Ga0496118_0000179	Ga0496118_0000179_46621_47559	312
854	3300048921	Ga0496118_0050515	Ga0496118_0050515_1480_2418	312
855	3300048924	Ga0496121_0006696	Ga0496121_0006696_9641_10579	312
856	3300049460	Ga0495682_0014647	Ga0495682_0014647_1771_2709	312
857	3300050493	nmdc:mga0k408_9720_c1	nmdc:mga0k408_9720_c1_497_1435	312
858	3300053119	Ga0500595_002689	Ga0500595_002689_588_1526	312
859	3300001979	JGI24740J21852_10001576	JGI24740J21852_100015766	313
860	3300001989	JGI24739J22299_10005313	JGI24739J22299_100053132	313
861	3300001989	JGI24739J22299_10023416	JGI24739J22299_100234161	313
862	3300001989	JGI24739J22299_10065479	JGI24739J22299_100654791	313
863	3300002067	JGI24735J21928_10000087	JGI24735J21928_1000008710	313
864	3300002075	JGI24738J21930_10004412	JGI24738J21930_100044122	313
865	3300002704	JGI25155J39150_1000192	JGI25155J39150_10001922	313
866	3300002704	JGI25155J39150_1001145	JGI25155J39150_10011452	313
867	3300002705	JGI25156J39149_1000077	JGI25156J39149_100007769	313
868	3300002705	JGI25156J39149_1000098	JGI25156J39149_100009814	313
869	3300002705	JGI25156J39149_1000429	JGI25156J39149_100042910	313
870	3300002705	JGI25156J39149_1004719	JGI25156J39149_10047192	313
871	3300002737	JGI25162J39368_1006740	JGI25162J39368_10067402	313
872	3300002738	JGI25154J39366_1000103	JGI25154J39366_100010369	313
873	3300002738	JGI25154J39366_1004497	JGI25154J39366_10044972	313
874	3300002741	JGI25157J39369_1000668	JGI25157J39369_10006685	313
875	3300003214	JGI25165J46597_1000797	JGI25165J46597_100079717	313
876	3300003354	JGI25160J50197_1000099	JGI25160J50197_100009956	313
877	3300003479	Ga0006556J51387_1026066	Ga0006556J51387_10260662	313
878	3300003567	Ga0006554J51385_1026721	Ga0006554J51385_10267212	313
879	3300003756	Ga0055533_1000253	Ga0055533_100025319	313
880	3300003756	Ga0055533_1001638	Ga0055533_10016383	313
881	3300003758	Ga0055532_1000001	Ga0055532_1000001413	313
882	3300003758	Ga0055532_1000034	Ga0055532_1000034109	313
883	3300003760	Ga0055527_1000002	Ga0055527_1000002346	313
884	3300003761	Ga0055535_1000001	Ga0055535_1000001592	313
885	3300003761	Ga0055535_1010329	Ga0055535_10103292	313
886	3300003762	Ga0055542_1000001	Ga0055542_1000001412	313
887	3300003763	Ga0055529_1000001	Ga0055529_1000001592	313
888	3300005262	Ga0065165_1000119	Ga0065165_1000119103	313
889	3300005327	Ga0070658_10005228	Ga0070658_100052283	313
890	3300005330	Ga0070690_100000481	Ga0070690_1000004819	313
891	3300005331	Ga0070670_100092668	Ga0070670_1000926682	313
892	3300005334	Ga0068869_100037209	Ga0068869_1000372092	313
893	3300005336	Ga0070680_100015442	Ga0070680_1000154423	313
894	3300005338	Ga0068868_100015313	Ga0068868_10001531312	313
895	3300005338	Ga0068868_100485341	Ga0068868_1004853411	313
896	3300005339	Ga0070660_100000006	Ga0070660_100000006137	313
897	3300005340	Ga0070689_100009103	Ga0070689_1000091032	313
898	3300005340	Ga0070689_100034227	Ga0070689_1000342272	313
899	3300005341	Ga0070691_10010839	Ga0070691_100108393	313
900	3300005344	Ga0070661_100140616	Ga0070661_1001406161	313
901	3300005355	Ga0070671_100012644	Ga0070671_1000126442	313
902	3300005364	Ga0070673_100002446	Ga0070673_1000024466	313
903	3300005366	Ga0070659_100000078	Ga0070659_10000007815	313
904	3300005434	Ga0070709_10342344	Ga0070709_103423441	313
905	3300005435	Ga0070714_100130827	Ga0070714_1001308272	313
906	3300005437	Ga0070710_10004571	Ga0070710_100045714	313
907	3300005437	Ga0070710_10210590	Ga0070710_102105901	313
908	3300005437	Ga0070710_10227432	Ga0070710_102274321	313
909	3300005438	Ga0070701_10001168	Ga0070701_100011687	313
910	3300005439	Ga0070711_100035515	Ga0070711_1000355152	313
911	3300005440	Ga0070705_100018183	Ga0070705_1000181832	313
912	3300005441	Ga0070700_100000628	Ga0070700_1000006287	313
913	3300005444	Ga0070694_100038557	Ga0070694_1000385572	313
914	3300005445	Ga0070708_100273464	Ga0070708_1002734642	313
915	3300005455	Ga0070663_100000371	Ga0070663_10000037110	313
916	3300005455	Ga0070663_100039110	Ga0070663_1000391102	313
917	3300005455	Ga0070663_100221717	Ga0070663_1002217172	313
918	3300005456	Ga0070678_100072114	Ga0070678_1000721142	313
919	3300005459	Ga0068867_100001785	Ga0068867_1000017855	313
920	3300005535	Ga0070684_100114508	Ga0070684_1001145082	313
921	3300005545	Ga0070695_100172594	Ga0070695_1001725941	313
922	3300005546	Ga0070696_100015190	Ga0070696_1000151902	313
923	3300005546	Ga0070696_100328950	Ga0070696_1003289501	313
924	3300005547	Ga0070693_100204106	Ga0070693_1002041062	313
925	3300005548	Ga0070665_100001916	Ga0070665_10000191614	313
926	3300005549	Ga0070704_100006762	Ga0070704_1000067622	313
927	3300005563	Ga0068855_100016635	Ga0068855_1000166358	313
928	3300005563	Ga0068855_100311656	Ga0068855_1003116562	313
929	3300005577	Ga0068857_100425424	Ga0068857_1004254242	313
930	3300005578	Ga0068854_100108004	Ga0068854_1001080042	313
931	3300005615	Ga0070702_100001192	Ga0070702_1000011924	313
932	3300005616	Ga0068852_100002439	Ga0068852_1000024394	313
933	3300005616	Ga0068852_100005949	Ga0068852_1000059492	313
934	3300005617	Ga0068859_100030507	Ga0068859_1000305076	313
935	3300005617	Ga0068859_100208811	Ga0068859_1002088111	313
936	3300005618	Ga0068864_100369626	Ga0068864_1003696262	313
937	3300005718	Ga0068866_10002792	Ga0068866_100027922	313
938	3300005719	Ga0068861_100006778	Ga0068861_1000067783	313
939	3300005842	Ga0068858_100008134	Ga0068858_1000081347	313
940	3300005842	Ga0068858_100385768	Ga0068858_1003857681	313
941	3300005843	Ga0068860_100000179	Ga0068860_10000017960	313
942	3300005843	Ga0068860_100260874	Ga0068860_1002608742	313
943	3300005844	Ga0068862_100070091	Ga0068862_1000700912	313
944	3300005983	Ga0081540_1040098	Ga0081540_10400983	313
945	3300006028	Ga0070717_10040289	Ga0070717_100402892	313
946	3300006028	Ga0070717_10103222	Ga0070717_101032222	313
947	3300006048	Ga0075363_100088518	Ga0075363_1000885182	313
948	3300006173	Ga0070716_100014645	Ga0070716_1000146452	313
949	3300006177	Ga0075362_10000282	Ga0075362_100002823	313
950	3300006186	Ga0075369_10106310	Ga0075369_101063101	313
951	3300006237	Ga0097621_100007649	Ga0097621_1000076493	313
952	3300006358	Ga0068871_100006608	Ga0068871_1000066087	313
953	3300006881	Ga0068865_100003142	Ga0068865_1000031423	313
954	3300006931	Ga0097620_100030508	Ga0097620_1000305082	313
955	3300006931	Ga0097620_100208817	Ga0097620_1002088171	313
956	3300006946	Ga0079104_1008948	Ga0079104_10089482	313
957	3300007076	Ga0075435_100107407	Ga0075435_1001074071	313
958	3300007265	Ga0099794_10024789	Ga0099794_100247891	313
959	3300009092	Ga0105250_10044743	Ga0105250_100447432	313
960	3300009093	Ga0105240_10000799	Ga0105240_1000079953	313
961	3300009093	Ga0105240_10002451	Ga0105240_1000245127	313
962	3300009093	Ga0105240_10107117	Ga0105240_101071172	313
963	3300009093	Ga0105240_10464797	Ga0105240_104647972	313
964	3300009098	Ga0105245_10007509	Ga0105245_100075097	313
965	3300009101	Ga0105247_10006954	Ga0105247_100069542	313
966	3300009176	Ga0105242_10019172	Ga0105242_100191723	313
967	3300009177	Ga0105248_10023294	Ga0105248_100232942	313
968	3300009177	Ga0105248_10024051	Ga0105248_100240512	313
969	3300009177	Ga0105248_10073191	Ga0105248_100731913	313
970	3300009545	Ga0105237_10037804	Ga0105237_100378042	313
971	3300009545	Ga0105237_10070180	Ga0105237_100701804	313
972	3300009545	Ga0105237_10328766	Ga0105237_103287661	313
973	3300009551	Ga0105238_10405740	Ga0105238_104057402	313
974	3300009551	Ga0105238_10477127	Ga0105238_104771271	313
975	3300010375	Ga0105239_10095021	Ga0105239_100950215	313
976	3300013105	Ga0157369_10045257	Ga0157369_100452573	313
977	3300013297	Ga0157378_10015230	Ga0157378_100152302	313
978	3300013306	Ga0163162_10341852	Ga0163162_103418522	313
979	3300013308	Ga0157375_10236038	Ga0157375_102360382	313
980	3300013308	Ga0157375_10444992	Ga0157375_104449922	313
981	3300014325	Ga0163163_10595712	Ga0163163_105957121	313
982	3300014968	Ga0157379_10025728	Ga0157379_100257284	313
983	3300016635	Ga0183361_10020	Ga0183361_1002037	313
984	3300021361	Ga0213872_10073089	Ga0213872_100730891	313
985	3300021384	Ga0213876_10002123	Ga0213876_100021232	313
986	3300021384	Ga0213876_10003157	Ga0213876_100031579	313
987	3300021384	Ga0213876_10004490	Ga0213876_100044903	313
988	3300021388	Ga0213875_10010543	Ga0213875_100105433	313
989	3300024227	Ga0228598_1001714	Ga0228598_10017142	313
990	3300025206	Ga0209435_100007	Ga0209435_100007109	313
991	3300025206	Ga0209435_100124	Ga0209435_1001248	313
992	3300025226	Ga0209674_100005	Ga0209674_100005778	313
993	3300025226	Ga0209674_100146	Ga0209674_10014669	313
994	3300025228	Ga0209672_100001	Ga0209672_1000011242	313
995	3300025229	Ga0209147_100001	Ga0209147_1000011242	313
996	3300025229	Ga0209147_100017	Ga0209147_100017363	313
997	3300025231	Ga0207427_100998	Ga0207427_1009987	313
998	3300025233	Ga0209437_100215	Ga0209437_10021584	313
999	3300025242	Ga0209258_100001	Ga0209258_1000011242	313
1000	3300025242	Ga0209258_100115	Ga0209258_10011598	313
1001	3300025246	Ga0209646_1000044	Ga0209646_1000044204	313
1002	3300025246	Ga0209646_1000238	Ga0209646_100023818	313
1003	3300025250	Ga0209026_1000063	Ga0209026_1000063109	313
1004	3300025250	Ga0209026_1006998	Ga0209026_10069982	313
1005	3300025254	Ga0209148_1000003	Ga0209148_10000031242	313
1006	3300025256	Ga0209759_1000048	Ga0209759_1000048109	313
1007	3300025256	Ga0209759_1000079	Ga0209759_100007926	313
1008	3300025256	Ga0209759_1000152	Ga0209759_100015235	313
1009	3300025256	Ga0209759_1014177	Ga0209759_10141772	313
1010	3300025261	Ga0209233_1000016	Ga0209233_1000016198	313
1011	3300025272	Ga0209455_1000001	Ga0209455_10000011242	313
1012	3300025272	Ga0209455_1010309	Ga0209455_10103092	313
1013	3300025284	Ga0209130_1006080	Ga0209130_10060803	313
1014	3300025295	Ga0209564_1005932	Ga0209564_10059322	313
1015	3300025302	Ga0207426_1000215	Ga0207426_1000215103	313
1016	3300025711	Ga0207696_1025092	Ga0207696_10250922	313
1017	3300025898	Ga0207692_10001657	Ga0207692_100016575	313
1018	3300025900	Ga0207710_10017446	Ga0207710_100174463	313
1019	3300025903	Ga0207680_10169703	Ga0207680_101697031	313
1020	3300025904	Ga0207647_10002918	Ga0207647_1000291812	313
1021	3300025904	Ga0207647_10070073	Ga0207647_100700732	313
1022	3300025906	Ga0207699_10016633	Ga0207699_100166333	313
1023	3300025909	Ga0207705_10122656	Ga0207705_101226562	313
1024	3300025913	Ga0207695_10000328	Ga0207695_1000032836	313
1025	3300025913	Ga0207695_10001014	Ga0207695_1000101448	313
1026	3300025913	Ga0207695_10002743	Ga0207695_1000274318	313
1027	3300025913	Ga0207695_10158877	Ga0207695_101588772	313
1028	3300025913	Ga0207695_10329036	Ga0207695_103290361	313
1029	3300025913	Ga0207695_10489370	Ga0207695_104893702	313
1030	3300025914	Ga0207671_10038925	Ga0207671_100389252	313
1031	3300025915	Ga0207693_10132638	Ga0207693_101326382	313
1032	3300025916	Ga0207663_10037677	Ga0207663_100376772	313
1033	3300025917	Ga0207660_10021671	Ga0207660_100216713	313
1034	3300025918	Ga0207662_10088133	Ga0207662_100881331	313
1035	3300025919	Ga0207657_10000003	Ga0207657_10000003221	313
1036	3300025924	Ga0207694_10019868	Ga0207694_100198685	313
1037	3300025924	Ga0207694_10210695	Ga0207694_102106952	313
1038	3300025925	Ga0207650_10116948	Ga0207650_101169482	313
1039	3300025925	Ga0207650_10158675	Ga0207650_101586752	313
1040	3300025927	Ga0207687_10003593	Ga0207687_100035938	313
1041	3300025929	Ga0207664_10188840	Ga0207664_101888401	313
1042	3300025929	Ga0207664_10210549	Ga0207664_102105492	313
1043	3300025931	Ga0207644_10006953	Ga0207644_100069535	313
1044	3300025932	Ga0207690_10000007	Ga0207690_10000007222	313
1045	3300025934	Ga0207686_10001924	Ga0207686_100019244	313
1046	3300025935	Ga0207709_10003509	Ga0207709_100035092	313
1047	3300025936	Ga0207670_10028574	Ga0207670_100285743	313
1048	3300025939	Ga0207665_10003989	Ga0207665_100039894	313
1049	3300025941	Ga0207711_10008554	Ga0207711_100085544	313
1050	3300025941	Ga0207711_10033107	Ga0207711_100331072	313
1051	3300025942	Ga0207689_10006569	Ga0207689_100065692	313
1052	3300025949	Ga0207667_10012674	Ga0207667_100126742	313
1053	3300025949	Ga0207667_10037902	Ga0207667_100379024	313
1054	3300025949	Ga0207667_10286571	Ga0207667_102865712	313
1055	3300025960	Ga0207651_10003772	Ga0207651_100037724	313
1056	3300025961	Ga0207712_10225293	Ga0207712_102252931	313
1057	3300026035	Ga0207703_10036560	Ga0207703_100365602	313
1058	3300026067	Ga0207678_10000064	Ga0207678_1000006435	313
1059	3300026067	Ga0207678_10023965	Ga0207678_100239652	313
1060	3300026067	Ga0207678_10098361	Ga0207678_100983613	313
1061	3300026075	Ga0207708_10003877	Ga0207708_100038772	313
1062	3300026089	Ga0207648_10003813	Ga0207648_100038135	313
1063	3300026095	Ga0207676_10177856	Ga0207676_101778562	313
1064	3300026116	Ga0207674_10303386	Ga0207674_103033862	313
1065	3300026118	Ga0207675_100005712	Ga0207675_1000057125	313
1066	3300026121	Ga0207683_10109918	Ga0207683_101099182	313
1067	3300026142	Ga0207698_10008214	Ga0207698_100082142	313
1068	3300026142	Ga0207698_10044735	Ga0207698_100447352	313
1069	3300028379	Ga0268266_10054810	Ga0268266_100548102	313
1070	3300028379	Ga0268266_10224872	Ga0268266_102248722	313
1071	3300028380	Ga0268265_10030857	Ga0268265_100308572	313
1072	3300028381	Ga0268264_10000153	Ga0268264_1000015389	313
1073	3300028381	Ga0268264_10137877	Ga0268264_101378773	313
1074	3300028794	Ga0307515_10003694	Ga0307515_100036947	313
1075	3300028794	Ga0307515_10018203	Ga0307515_100182039	313
1076	3300028794	Ga0307515_10035466	Ga0307515_100354662	313
1077	3300030521	Ga0307511_10079461	Ga0307511_100794612	313
1078	3300030522	Ga0307512_10046658	Ga0307512_100466582	313
1079	3300030522	Ga0307512_10086069	Ga0307512_100860691	313
1080	3300031344	Ga0265316_10277438	Ga0265316_102774381	313
1081	3300031456	Ga0307513_10012493	Ga0307513_100124933	313
1082	3300031456	Ga0307513_10090996	Ga0307513_100909962	313
1083	3300031595	Ga0265313_10006112	Ga0265313_100061124	313
1084	3300031616	Ga0307508_10000013	Ga0307508_10000013130	313
1085	3300031616	Ga0307508_10001048	Ga0307508_1000104825	313
1086	3300031649	Ga0307514_10031572	Ga0307514_100315721	313
1087	3300031730	Ga0307516_10001109	Ga0307516_1000110926	313
1088	3300031730	Ga0307516_10006446	Ga0307516_1000644612	313
1089	3300031911	Ga0307412_10000008	Ga0307412_10000008111	313
1090	3300033179	Ga0307507_10081359	Ga0307507_100813592	313
1091	3300033179	Ga0307507_10171637	Ga0307507_101716372	313
1092	3300035692	Ga0373935_0025489	Ga0373935_0025489_2478_3419	313
1093	3300035695	Ga0373927_0193562	Ga0373927_0193562_100_1041	313
1094	3300037068	Ga0373925_0007887	Ga0373925_0007887_1436_2377	313
1095	3300037471	Ga0395905_0000020	Ga0395905_0000020_326078_327019	313
1096	3300037471	Ga0395905_0007987	Ga0395905_0007987_8952_9893	313
1097	3300037471	Ga0395905_0081527	Ga0395905_0081527_937_1878	313
1098	3300037853	Ga0436364_0791886	Ga0436364_0791886_2862_3803	313
1099	3300039437	Ga0436365_0160289	Ga0436365_0160289_4494_5435	313
1100	3300039437	Ga0436365_0260170	Ga0436365_0260170_50249_51190	313
1101	3300039437	Ga0436365_0434446	Ga0436365_0434446_13261_14202	313
1102	3300039447	Ga0436361_0207643	Ga0436361_0207643_5040_5981	313
1103	3300039447	Ga0436361_0293418	Ga0436361_0293418_898_1839	313
1104	3300039447	Ga0436361_0327111	Ga0436361_0327111_277_1218	313
1105	3300039447	Ga0436361_1000836	Ga0436361_1000836_145_1086	313
1106	3300039447	Ga0436361_1060943	Ga0436361_1060943_479_1420	313
1107	3300039450	Ga0436363_0115488	Ga0436363_0115488_784_1725	313
1108	3300039450	Ga0436363_0145142	Ga0436363_0145142_897_1838	313
1109	3300039450	Ga0436363_0470120	Ga0436363_0470120_186_1127	313
1110	3300039453	Ga0436362_0900003	Ga0436362_0900003_2460_3401	313
1111	3300041451	Ga0451791_0722199	Ga0451791_0722199_469_1410	313
1112	3300041486	Ga0451807_1199766	Ga0451807_1199766_166_1107	313
1113	3300042876	Ga0451577_0180758	Ga0451577_0180758_150_1091	313
1114	3300044656	Ga0466969_0020838	Ga0466969_0020838_1589_2548	313
1115	3300044683	Ga0466965_0082913	Ga0466965_0082913_574_1515	313
1116	3300044684	Ga0466966_0059867	Ga0466966_0059867_766_1725	313
1117	3300044693	Ga0466961_0009180	Ga0466961_0009180_2405_3364	313
1118	3300045049	Ga0466959_0237196	Ga0466959_0237196_230_1171	313
1119	3300045976	Ga0466967_0205211	Ga0466967_0205211_320_1261	313
1120	3300046454	Ga0495592_0007445	Ga0495592_0007445_5161_6102	313
1121	3300046454	Ga0495592_0100271	Ga0495592_0100271_1008_1949	313
1122	3300046459	Ga0495629_0015247	Ga0495629_0015247_4338_5279	313
1123	3300046459	Ga0495629_0119013	Ga0495629_0119013_371_1312	313
1124	3300046461	Ga0495641_0006884	Ga0495641_0006884_4460_5401	313
1125	3300046463	Ga0495653_0007836	Ga0495653_0007836_5195_6136	313
1126	3300046463	Ga0495653_0026867	Ga0495653_0026867_2236_3177	313
1127	3300046463	Ga0495653_0054787	Ga0495653_0054787_1317_2258	313
1128	3300046471	Ga0495650_0001359	Ga0495650_0001359_8966_9907	313
1129	3300046471	Ga0495650_0012273	Ga0495650_0012273_1522_2463	313
1130	3300046472	Ga0495580_0001868	Ga0495580_0001868_5223_6164	313
1131	3300046472	Ga0495580_0007736	Ga0495580_0007736_2040_2981	313
1132	3300046472	Ga0495580_0010047	Ga0495580_0010047_4349_5290	313
1133	3300046474	Ga0495605_0006858	Ga0495605_0006858_3989_4930	313
1134	3300046476	Ga0495662_0152682	Ga0495662_0152682_185_1126	313
1135	3300046500	Ga0495596_0008931	Ga0495596_0008931_59_1000	313
1136	3300046507	Ga0495606_0001836	Ga0495606_0001836_15583_16524	313
1137	3300046507	Ga0495606_0115549	Ga0495606_0115549_148_1089	313
1138	3300046512	Ga0495610_0080244	Ga0495610_0080244_131_1072	313
1139	3300046513	Ga0495616_0020020	Ga0495616_0020020_1852_2793	313
1140	3300046514	Ga0495618_0011338	Ga0495618_0011338_3649_4590	313
1141	3300046522	Ga0495643_0053499	Ga0495643_0053499_635_1576	313
1142	3300046524	Ga0495648_0026206	Ga0495648_0026206_502_1443	313
1143	3300046526	Ga0495666_0007716	Ga0495666_0007716_2500_3441	313
1144	3300046526	Ga0495666_0054701	Ga0495666_0054701_892_1833	313
1145	3300046528	Ga0495642_0023111	Ga0495642_0023111_1315_2256	313
1146	3300046528	Ga0495642_0122519	Ga0495642_0122519_107_1048	313
1147	3300046529	Ga0495652_0158588	Ga0495652_0158588_500_1441	313
1148	3300046533	Ga0495640_0010836	Ga0495640_0010836_5894_6835	313
1149	3300046542	Ga0495597_0038434	Ga0495597_0038434_781_1722	313
1150	3300046543	Ga0495645_0135490	Ga0495645_0135490_464_1405	313
1151	3300046557	Ga0495622_0000020	Ga0495622_0000020_77721_78662	313
1152	3300046559	Ga0495667_0020427	Ga0495667_0020427_82_1023	313
1153	3300046660	Ga0495625_0000428	Ga0495625_0000428_464_1405	313
1154	3300046660	Ga0495625_0166290	Ga0495625_0166290_123_1064	313
1155	3300046663	Ga0495635_0006790	Ga0495635_0006790_164_1105	313
1156	3300046663	Ga0495635_0039920	Ga0495635_0039920_1761_2702	313
1157	3300046678	Ga0495599_0051297	Ga0495599_0051297_1110_2051	313
1158	3300046679	Ga0495623_0022491	Ga0495623_0022491_1198_2139	313
1159	3300046680	Ga0495646_0005012	Ga0495646_0005012_610_1551	313
1160	3300046680	Ga0495646_0006860	Ga0495646_0006860_1521_2462	313
1161	3300046680	Ga0495646_0057350	Ga0495646_0057350_1245_2186	313
1162	3300046690	Ga0495624_0168238	Ga0495624_0168238_372_1313	313
1163	3300046692	Ga0495671_0090250	Ga0495671_0090250_241_1182	313
1164	3300046694	Ga0495649_0000336	Ga0495649_0000336_11589_12530	313
1165	3300046794	Ga0495589_0034655	Ga0495589_0034655_401_1342	313
1166	3300047315	Ga0495581_0034191	Ga0495581_0034191_1086_2027	313
1167	3300047317	Ga0495604_0020636	Ga0495604_0020636_105_1046	313
1168	3300047319	Ga0495674_0048143	Ga0495674_0048143_2451_3392	313
1169	3300047319	Ga0495674_0057087	Ga0495674_0057087_304_1245	313
1170	3300047320	Ga0495672_0122577	Ga0495672_0122577_405_1346	313
1171	3300047321	Ga0495676_0021699	Ga0495676_0021699_2618_3559	313
1172	3300047322	Ga0495680_0070997	Ga0495680_0070997_1243_2184	313
1173	3300047323	Ga0495683_0008795	Ga0495683_0008795_804_1745	313
1174	3300047443	Ga0495687_000005	Ga0495687_000005_140115_141056	313
1175	3300047443	Ga0495687_021705	Ga0495687_021705_1895_2836	313
1176	3300047443	Ga0495687_054565	Ga0495687_054565_306_1247	313
1177	3300047444	Ga0495675_0041473	Ga0495675_0041473_557_1498	313
1178	3300047446	Ga0495679_004552	Ga0495679_004552_2618_3559	313
1179	3300047469	Ga0495673_0040578	Ga0495673_0040578_96_1037	313
1180	3300047472	Ga0495686_0111768	Ga0495686_0111768_231_1172	313
1181	3300047673	Ga0495593_0007461	Ga0495593_0007461_1770_2711	313
1182	3300047673	Ga0495593_0158142	Ga0495593_0158142_22_963	313
1183	3300048088	Ga0495602_0014424	Ga0495602_0014424_3861_4802	313
1184	3300048088	Ga0495602_0249497	Ga0495602_0249497_83_1024	313
1185	3300048088	Ga0495602_0344202	Ga0495602_0344202_83_1024	313
1186	3300048089	Ga0495614_0018692	Ga0495614_0018692_1476_2417	313
1187	3300048089	Ga0495614_0043294	Ga0495614_0043294_685_1626	313
1188	3300048091	Ga0495626_0054876	Ga0495626_0054876_500_1441	313
1189	3300048903	Ga0496100_0003462	Ga0496100_0003462_3609_4550	313
1190	3300048904	Ga0496101_0000205	Ga0496101_0000205_34884_35825	313
1191	3300048904	Ga0496101_0225498	Ga0496101_0225498_381_1322	313
1192	3300048905	Ga0496102_0000165	Ga0496102_0000165_57840_58781	313
1193	3300048906	Ga0496103_0000728	Ga0496103_0000728_17624_18565	313
1194	3300048907	Ga0496104_0081882	Ga0496104_0081882_2003_2944	313
1195	3300048907	Ga0496104_0321366	Ga0496104_0321366_158_1099	313
1196	3300048908	Ga0496105_0144173	Ga0496105_0144173_133_1074	313
1197	3300048909	Ga0496106_0001072	Ga0496106_0001072_17096_18037	313
1198	3300048909	Ga0496106_0092488	Ga0496106_0092488_418_1359	313
1199	3300048910	Ga0496107_0293434	Ga0496107_0293434_13_954	313
1200	3300048919	Ga0496116_0005552	Ga0496116_0005552_2183_3124	313
1201	3300048919	Ga0496116_0022924	Ga0496116_0022924_3693_4634	313
1202	3300048919	Ga0496116_0035815	Ga0496116_0035815_347_1288	313
1203	3300048920	Ga0496117_0001246	Ga0496117_0001246_31996_32937	313
1204	3300048920	Ga0496117_0009590	Ga0496117_0009590_1784_2725	313
1205	3300048920	Ga0496117_0015086	Ga0496117_0015086_595_1536	313
1206	3300048921	Ga0496118_0000283	Ga0496118_0000283_30439_31380	313
1207	3300048921	Ga0496118_0031784	Ga0496118_0031784_1371_2312	313
1208	3300048921	Ga0496118_0086375	Ga0496118_0086375_1182_2123	313
1209	3300048921	Ga0496118_0164887	Ga0496118_0164887_101_1042	313
1210	3300048924	Ga0496121_0000207	Ga0496121_0000207_120659_121600	313
1211	3300048924	Ga0496121_0001382	Ga0496121_0001382_9799_10740	313
1212	3300048924	Ga0496121_0001776	Ga0496121_0001776_15497_16438	313
1213	3300048924	Ga0496121_0002189	Ga0496121_0002189_22200_23141	313
1214	3300048924	Ga0496121_0010160	Ga0496121_0010160_6123_7124	313
1215	3300048924	Ga0496121_0139688	Ga0496121_0139688_190_1131	313
1216	3300048925	Ga0496122_0000570	Ga0496122_0000570_373_1314	313
1217	3300048927	Ga0496124_0000916	Ga0496124_0000916_4160_5101	313
1218	3300048927	Ga0496124_0224659	Ga0496124_0224659_21_962	313
1219	3300048928	Ga0496125_0000701	Ga0496125_0000701_42326_43267	313
1220	3300048929	Ga0496126_0000083	Ga0496126_0000083_36545_37486	313
1221	3300048929	Ga0496126_0002091	Ga0496126_0002091_18822_19763	313
1222	3300048929	Ga0496126_0019733	Ga0496126_0019733_2237_3178	313
1223	3300048929	Ga0496126_0051630	Ga0496126_0051630_459_1400	313
1224	3300048929	Ga0496126_0094648	Ga0496126_0094648_222_1178	313
1225	3300048929	Ga0496126_0209496	Ga0496126_0209496_358_1299	313
1226	3300050489	nmdc:mga03683_134_c1	nmdc:mga03683_134_c1_11041_11988	313
1227	3300050490	nmdc:mga03n38_52597_c1	nmdc:mga03n38_52597_c1_194_1141	313
1228	3300050512	nmdc:mga0n895_148273_c1	nmdc:mga0n895_148273_c1_898_1839	313
1229	3300050513	nmdc:mga0rr50_95382_c1	nmdc:mga0rr50_95382_c1_143_1084	313
1230	3300050516	nmdc:mga0sz30_7289_c1	nmdc:mga0sz30_7289_c1_982_1929	313
1231	3300053083	Ga0495655_0002052	Ga0495655_0002052_1399_2340	313
1232	3300053088	Ga0500644_0069104	Ga0500644_0069104_222_1178	313
1233	3300053093	Ga0500651_0003137	Ga0500651_0003137_1250_2206	313
1234	3300053130	Ga0500642_0011888	Ga0500642_0011888_1632_2588	313
1235	3300053140	Ga0500573_0124709	Ga0500573_0124709_183_1124	313
1236	3300053150	Ga0500603_037797	Ga0500603_037797_197_1138	313
1237	3300053178	Ga0500637_0150828	Ga0500637_0150828_205_1146	313
1238	3300053735	Ga0500596_005083	Ga0500596_005083_833_1774	313
1239	iso_pu_bacteria	2501025504	2501409151	313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

51

306

0.96 PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

49

313

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5dkv-assembly4.cif.gz_D	crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d-tagatopyranose	0.9486	27	313
6gq0-assembly1.cif.gz_A	crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus	0.9455	27	303
4zjp-assembly1.cif.gz_A	structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose	0.941	27	299
2gx6-assembly1.cif.gz_A	rational stabilization of e. coli ribose binding protein	0.9409	29	299
8wlb-assembly1.cif.gz_A	x-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose	0.9398	30	299

ID	Description	Score	Start	End	Superfamily
af_P39265_27_132_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9517	31	124	3.40.50.2300
1rpjA01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9489	30	128	3.40.50.2300
1gudA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9484	130	266	3.40.50.2300
1dbpA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.946	130	266	3.40.50.2300
3ksmB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9454	30	128	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A7C6QDI8-F1-model_v4	ABC transporter substrate-binding protein	0.9658	25	313	GO:0030246 GO:0030313
AF-A0A7W0I3D6-F1-model_v4	Substrate-binding domain-containing protein	0.9636	27	312	GO:0016020 GO:0030246 GO:0030313
AF-A0A3B9GII2-F1-model_v4	BMP family ABC transporter substrate-binding protein	0.9623	42	313	GO:0005886 GO:0030246 GO:0030313
AF-A0A7Z9Y1D1-F1-model_v4	D-ribose ABC transporter substrate-binding protein	0.9559	142	299	GO:0030246 GO:0030313
AF-A0A3B9GII2-F1-model_v4	BMP family ABC transporter substrate-binding protein	0.9487	42	313	GO:0005886 GO:0030246 GO:0030313

Feature Viewer

pLDDT	pTM	Quality
91.81	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F492070

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13407

Peripla_BP_4

Periplasmic binding protein domain

51

306

0.96

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

49

313

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map