F491983
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1230 | 361 | 2460 | 468 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10009888|Ga0157370_100098889 |
| Length | 548 |
| Sequence | MPTCRAGTSGPKRRWRLRAQPQEADGKPRDTGLCIDLTCLHARWVEWASVFGAIACAPAPCRSPSGRRHPHHLDDGEHHHMALPRSDALVFFGATGDLAYKKIFPALLAMTRDGDLDVPIIGVAHSGWGVKQLRKRAHDSVRQAAKDSGEKLDKAVFERLAERLQYVDGDYADPATFAQLKQALGKAKRPLHYLAIPPSLFGTVVEGLQQAGCAKDARVVVEKPFGHDLASAQELNGILRSVFPDDAIFRIDHFLGKEAIMNILYFRFANSFLEPIWNRNHVASVEITLAEQFGVKGRGAFYDGAGCLRDVIQNHLLQIVALLAMEPPAYQGFGAVHAEKTKVFQAMRPLAPDDLVRGQYRGYRKEPGVAKGSDVETYCALRLFIDSWRWGGVPWYLRSGKCLPETVAEIVVELKPPPQKLFDDAAISAGRANYLRFRLSPNTAVALAARVKRVGKEFVGDQRELYLMDEQSGEETPYERLLGDAMAGDGALFTREEAVEAAWMVVDPVLEKHHEAIPYTPGSWGPKQADDLIAADGGWHNPVLEPGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 220 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 221 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 236 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 348 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 349 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 356 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 357 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 358 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 359 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 360 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 361 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0.08 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 4.63 |
| Rhizosphere | 93.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10009888 | 3300013104 | Bacteria | 10107 |
| 2 | Ga0065704_10001221 | 3300005289 | Bacteria | 15987 |
| 3 | Ga0065715_10138400 | 3300005293 | Bacteria | 1892 |
| 4 | Ga0065707_10001278 | 3300005295 | Bacteria | 11071 |
| 5 | Ga0065707_10089312 | 3300005295 | Bacteria | 4405 |
| 6 | Ga0070658_10000686 | 3300005327 | Bacteria | 29296 |
| 7 | Ga0070658_10026401 | 3300005327 | Bacteria | 4658 |
| 8 | Ga0070676_10000222 | 3300005328 | Bacteria | 24230 |
| 9 | Ga0070683_100000521 | 3300005329 | Bacteria | 26974 |
| 10 | Ga0070683_100008243 | 3300005329 | Bacteria | 8855 |
| 11 | Ga0070683_100010563 | 3300005329 | Bacteria | 7938 |
| 12 | Ga0070683_100011682 | 3300005329 | Bacteria | 7604 |
| 13 | Ga0070683_100069587 | 3300005329 | Bacteria | 3281 |
| 14 | Ga0070683_100090408 | 3300005329 | Bacteria | 2874 |
| 15 | Ga0070683_100196614 | 3300005329 | Bacteria | 1915 |
| 16 | Ga0070683_100204062 | 3300005329 | Bacteria | 1877 |
| 17 | Ga0070690_100002441 | 3300005330 | Bacteria | 9993 |
| 18 | Ga0070670_100025475 | 3300005331 | Bacteria | 5089 |
| 19 | Ga0070670_100026422 | 3300005331 | Bacteria | 4996 |
| 20 | Ga0070670_100171873 | 3300005331 | Bacteria | 1880 |
| 21 | Ga0070677_10006494 | 3300005333 | Bacteria | 3886 |
| 22 | Ga0070677_10006951 | 3300005333 | Bacteria | 3762 |
| 23 | Ga0068869_100003200 | 3300005334 | Bacteria | 10003 |
| 24 | Ga0068869_100131544 | 3300005334 | Bacteria | 1924 |
| 25 | Ga0068869_100163662 | 3300005334 | Bacteria | 1733 |
| 26 | Ga0070666_10002423 | 3300005335 | Bacteria | 11276 |
| 27 | Ga0070666_10003483 | 3300005335 | Bacteria | 9541 |
| 28 | Ga0070666_10064334 | 3300005335 | Bacteria | 2487 |
| 29 | Ga0070666_10106295 | 3300005335 | Bacteria | 1939 |
| 30 | Ga0070680_100000496 | 3300005336 | Bacteria | 27081 |
| 31 | Ga0070680_100000686 | 3300005336 | Bacteria | 23486 |
| 32 | Ga0070680_100010122 | 3300005336 | Bacteria | 7270 |
| 33 | Ga0070680_100022885 | 3300005336 | Bacteria | 4979 |
| 34 | Ga0070680_100024504 | 3300005336 | Bacteria | 4821 |
| 35 | Ga0070680_100118172 | 3300005336 | Bacteria | 2211 |
| 36 | Ga0070680_100151246 | 3300005336 | Bacteria | 1949 |
| 37 | Ga0070680_100166874 | 3300005336 | Bacteria | 1851 |
| 38 | Ga0070680_100179283 | 3300005336 | Bacteria | 1784 |
| 39 | Ga0070682_100000296 | 3300005337 | Bacteria | 34820 |
| 40 | Ga0070682_100001443 | 3300005337 | Bacteria | 13371 |
| 41 | Ga0070682_100003005 | 3300005337 | Bacteria | 9361 |
| 42 | Ga0070682_100004882 | 3300005337 | Bacteria | 7443 |
| 43 | Ga0070682_100013676 | 3300005337 | Bacteria | 4676 |
| 44 | Ga0070682_100024788 | 3300005337 | Bacteria | 3573 |
| 45 | Ga0068868_100000767 | 3300005338 | Bacteria | 21693 |
| 46 | Ga0068868_100004781 | 3300005338 | Bacteria | 9510 |
| 47 | Ga0068868_100033664 | 3300005338 | Bacteria | 3951 |
| 48 | Ga0068868_100043729 | 3300005338 | Bacteria | 3499 |
| 49 | Ga0070660_100001492 | 3300005339 | Bacteria | 16013 |
| 50 | Ga0070660_100002914 | 3300005339 | Bacteria | 11784 |
| 51 | Ga0070660_100036561 | 3300005339 | Bacteria | 3720 |
| 52 | Ga0070660_100062257 | 3300005339 | Bacteria | 2898 |
| 53 | Ga0070689_100101089 | 3300005340 | Bacteria | 2281 |
| 54 | Ga0070689_100147503 | 3300005340 | Bacteria | 1896 |
| 55 | Ga0070691_10028911 | 3300005341 | Bacteria | 2592 |
| 56 | Ga0070661_100000821 | 3300005344 | Bacteria | 22334 |
| 57 | Ga0070661_100007462 | 3300005344 | Bacteria | 7541 |
| 58 | Ga0070661_100043507 | 3300005344 | Bacteria | 3280 |
| 59 | Ga0070692_10001608 | 3300005345 | Bacteria | 8309 |
| 60 | Ga0070692_10024877 | 3300005345 | Bacteria | 2947 |
| 61 | Ga0070668_100007558 | 3300005347 | Bacteria | 8066 |
| 62 | Ga0070669_100088488 | 3300005353 | Bacteria | 2318 |
| 63 | Ga0070669_100109796 | 3300005353 | Bacteria | 2092 |
| 64 | Ga0070675_100000244 | 3300005354 | Bacteria | 35244 |
| 65 | Ga0070675_100029173 | 3300005354 | Bacteria | 4447 |
| 66 | Ga0070675_100070567 | 3300005354 | Bacteria | 2895 |
| 67 | Ga0070675_100088190 | 3300005354 | Bacteria | 2595 |
| 68 | Ga0070675_100115349 | 3300005354 | Bacteria | 2277 |
| 69 | Ga0070671_100239064 | 3300005355 | Bacteria | 1542 |
| 70 | Ga0070674_100001066 | 3300005356 | Bacteria | 14355 |
| 71 | Ga0070674_100053015 | 3300005356 | Bacteria | 2799 |
| 72 | Ga0070673_100001348 | 3300005364 | Bacteria | 14331 |
| 73 | Ga0070673_100001792 | 3300005364 | Bacteria | 12806 |
| 74 | Ga0070673_100002263 | 3300005364 | Bacteria | 11667 |
| 75 | Ga0070673_100075542 | 3300005364 | Bacteria | 2718 |
| 76 | Ga0070688_100016856 | 3300005365 | Bacteria | 4183 |
| 77 | Ga0070659_100003371 | 3300005366 | Bacteria | 11375 |
| 78 | Ga0070659_100004685 | 3300005366 | Bacteria | 9759 |
| 79 | Ga0070659_100013498 | 3300005366 | Bacteria | 6081 |
| 80 | Ga0070659_100037536 | 3300005366 | Bacteria | 3777 |
| 81 | Ga0070659_100050095 | 3300005366 | Bacteria | 3285 |
| 82 | Ga0070667_100005756 | 3300005367 | Bacteria | 10355 |
| 83 | Ga0070667_100011925 | 3300005367 | Bacteria | 7192 |
| 84 | Ga0070667_100014768 | 3300005367 | Bacteria | 6451 |
| 85 | Ga0070703_10007873 | 3300005406 | Bacteria | 2998 |
| 86 | Ga0070703_10010267 | 3300005406 | Bacteria | 2640 |
| 87 | Ga0070709_10022408 | 3300005434 | Bacteria | 3694 |
| 88 | Ga0070709_10086595 | 3300005434 | Bacteria | 2057 |
| 89 | Ga0070714_100002263 | 3300005435 | Bacteria | 14160 |
| 90 | Ga0070714_100005415 | 3300005435 | Bacteria | 9736 |
| 91 | Ga0070714_100057642 | 3300005435 | Bacteria | 3325 |
| 92 | Ga0070714_100090177 | 3300005435 | Bacteria | 2684 |
| 93 | Ga0070713_100000636 | 3300005436 | Bacteria | 22415 |
| 94 | Ga0070713_100202956 | 3300005436 | Bacteria | 1791 |
| 95 | Ga0070713_100219357 | 3300005436 | Bacteria | 1725 |
| 96 | Ga0070711_100013432 | 3300005439 | Bacteria | 5144 |
| 97 | Ga0070705_100075217 | 3300005440 | Bacteria | 2056 |
| 98 | Ga0070705_100111864 | 3300005440 | Bacteria | 1746 |
| 99 | Ga0070700_100026443 | 3300005441 | Bacteria | 3427 |
| 100 | Ga0070700_100113221 | 3300005441 | Bacteria | 1807 |
| 101 | Ga0070694_100065637 | 3300005444 | Bacteria | 2487 |
| 102 | Ga0070708_100001524 | 3300005445 | Bacteria | 17691 |
| 103 | Ga0070708_100076151 | 3300005445 | Bacteria | 3030 |
| 104 | Ga0070663_100002959 | 3300005455 | Bacteria | 9677 |
| 105 | Ga0070663_100003859 | 3300005455 | Bacteria | 8733 |
| 106 | Ga0070663_100010068 | 3300005455 | Bacteria | 5880 |
| 107 | Ga0070663_100024000 | 3300005455 | Bacteria | 4097 |
| 108 | Ga0070663_100058024 | 3300005455 | Bacteria | 2778 |
| 109 | Ga0070678_100025037 | 3300005456 | Bacteria | 4007 |
| 110 | Ga0070678_100200531 | 3300005456 | Bacteria | 1646 |
| 111 | Ga0070678_100201720 | 3300005456 | Bacteria | 1642 |
| 112 | Ga0070662_100001044 | 3300005457 | Bacteria | 16919 |
| 113 | Ga0070662_100002448 | 3300005457 | Bacteria | 11431 |
| 114 | Ga0070662_100054166 | 3300005457 | Bacteria | 2907 |
| 115 | Ga0070681_10000034 | 3300005458 | Bacteria | 98600 |
| 116 | Ga0070681_10000474 | 3300005458 | Bacteria | 32760 |
| 117 | Ga0070681_10011914 | 3300005458 | Bacteria | 8622 |
| 118 | Ga0070681_10032224 | 3300005458 | Bacteria | 5259 |
| 119 | Ga0070681_10037614 | 3300005458 | Bacteria | 4855 |
| 120 | Ga0070681_10038380 | 3300005458 | Bacteria | 4802 |
| 121 | Ga0070681_10074934 | 3300005458 | Bacteria | 3344 |
| 122 | Ga0068867_100019381 | 3300005459 | Bacteria | 4848 |
| 123 | Ga0070685_10036870 | 3300005466 | Bacteria | 2766 |
| 124 | Ga0070706_100000575 | 3300005467 | Bacteria | 42747 |
| 125 | Ga0070706_100025719 | 3300005467 | Bacteria | 5417 |
| 126 | Ga0070706_100043908 | 3300005467 | Unclassified | 4129 |
| 127 | Ga0070706_100049705 | 3300005467 | Bacteria | 3869 |
| 128 | Ga0070707_100000941 | 3300005468 | Bacteria | 28909 |
| 129 | Ga0070707_100011349 | 3300005468 | Bacteria | 8305 |
| 130 | Ga0070707_100042195 | 3300005468 | Bacteria | 4367 |
| 131 | Ga0070707_100131183 | 3300005468 | Bacteria | 2437 |
| 132 | Ga0070698_100003318 | 3300005471 | Bacteria | 17704 |
| 133 | Ga0070698_100004458 | 3300005471 | Bacteria | 15388 |
| 134 | Ga0070698_100007700 | 3300005471 | Bacteria | 11649 |
| 135 | Ga0070698_100012588 | 3300005471 | Bacteria | 8958 |
| 136 | Ga0070698_100028967 | 3300005471 | Bacteria | 5748 |
| 137 | Ga0070698_100049362 | 3300005471 | Unclassified | 4295 |
| 138 | Ga0070698_100064599 | 3300005471 | Bacteria | 3687 |
| 139 | Ga0070698_100156054 | 3300005471 | Bacteria | 2228 |
| 140 | Ga0070699_100006715 | 3300005518 | Bacteria | 10006 |
| 141 | Ga0070699_100012835 | 3300005518 | Bacteria | 7223 |
| 142 | Ga0070699_100027460 | 3300005518 | Bacteria | 4908 |
| 143 | Ga0070699_100046228 | 3300005518 | Bacteria | 3768 |
| 144 | Ga0070699_100069353 | 3300005518 | Bacteria | 3063 |
| 145 | Ga0070679_100000306 | 3300005530 | Bacteria | 41768 |
| 146 | Ga0070679_100005633 | 3300005530 | Bacteria | 11604 |
| 147 | Ga0070679_100005977 | 3300005530 | Bacteria | 11313 |
| 148 | Ga0070679_100023633 | 3300005530 | Bacteria | 6019 |
| 149 | Ga0070679_100076045 | 3300005530 | Bacteria | 3347 |
| 150 | Ga0070684_100019471 | 3300005535 | Bacteria | 5614 |
| 151 | Ga0070684_100032777 | 3300005535 | Bacteria | 4432 |
| 152 | Ga0070684_100034894 | 3300005535 | Bacteria | 4303 |
| 153 | Ga0070684_100049092 | 3300005535 | Bacteria | 3662 |
| 154 | Ga0070684_100057368 | 3300005535 | Bacteria | 3400 |
| 155 | Ga0070697_100000035 | 3300005536 | Bacteria | 98818 |
| 156 | Ga0070697_100000615 | 3300005536 | Bacteria | 27079 |
| 157 | Ga0070697_100001536 | 3300005536 | Bacteria | 17584 |
| 158 | Ga0068853_100001751 | 3300005539 | Bacteria | 15924 |
| 159 | Ga0068853_100003044 | 3300005539 | Bacteria | 12805 |
| 160 | Ga0068853_100005315 | 3300005539 | Bacteria | 10081 |
| 161 | Ga0068853_100013122 | 3300005539 | Bacteria | 6761 |
| 162 | Ga0068853_100021876 | 3300005539 | Bacteria | 5334 |
| 163 | Ga0068853_100053753 | 3300005539 | Bacteria | 3469 |
| 164 | Ga0068853_100172702 | 3300005539 | Bacteria | 1956 |
| 165 | Ga0070672_100007027 | 3300005543 | Bacteria | 7612 |
| 166 | Ga0070672_100021529 | 3300005543 | Bacteria | 4720 |
| 167 | Ga0070672_100084431 | 3300005543 | Bacteria | 2550 |
| 168 | Ga0070695_100008686 | 3300005545 | Bacteria | 6038 |
| 169 | Ga0070695_100016709 | 3300005545 | Bacteria | 4444 |
| 170 | Ga0070695_100049952 | 3300005545 | Bacteria | 2679 |
| 171 | Ga0070695_100150161 | 3300005545 | Bacteria | 1625 |
| 172 | Ga0070696_100000572 | 3300005546 | Bacteria | 23515 |
| 173 | Ga0070696_100047299 | 3300005546 | Bacteria | 2985 |
| 174 | Ga0070696_100048428 | 3300005546 | Bacteria | 2950 |
| 175 | Ga0070696_100114822 | 3300005546 | Bacteria | 1942 |
| 176 | Ga0070693_100004401 | 3300005547 | Bacteria | 6659 |
| 177 | Ga0070693_100007600 | 3300005547 | Bacteria | 5306 |
| 178 | Ga0070665_100098564 | 3300005548 | Bacteria | 2927 |
| 179 | Ga0070704_100039599 | 3300005549 | Bacteria | 3237 |
| 180 | Ga0070704_100076603 | 3300005549 | Bacteria | 2447 |
| 181 | Ga0070704_100094741 | 3300005549 | Bacteria | 2234 |
| 182 | Ga0070704_100132781 | 3300005549 | Bacteria | 1932 |
| 183 | Ga0070704_100193024 | 3300005549 | Bacteria | 1638 |
| 184 | Ga0068855_100000414 | 3300005563 | Bacteria | 52978 |
| 185 | Ga0068855_100000524 | 3300005563 | Bacteria | 47035 |
| 186 | Ga0068855_100001570 | 3300005563 | Bacteria | 28673 |
| 187 | Ga0068855_100008049 | 3300005563 | Bacteria | 12738 |
| 188 | Ga0068855_100008840 | 3300005563 | Bacteria | 12174 |
| 189 | Ga0068855_100011678 | 3300005563 | Bacteria | 10614 |
| 190 | Ga0068855_100018543 | 3300005563 | Bacteria | 8367 |
| 191 | Ga0068855_100035782 | 3300005563 | Bacteria | 5914 |
| 192 | Ga0068855_100036290 | 3300005563 | Bacteria | 5868 |
| 193 | Ga0068855_100069903 | 3300005563 | Bacteria | 4085 |
| 194 | Ga0068855_100092972 | 3300005563 | Bacteria | 3478 |
| 195 | Ga0068855_100136018 | 3300005563 | Bacteria | 2804 |
| 196 | Ga0068855_100286065 | 3300005563 | Bacteria | 1829 |
| 197 | Ga0070664_100000926 | 3300005564 | Bacteria | 22932 |
| 198 | Ga0070664_100010549 | 3300005564 | Bacteria | 7489 |
| 199 | Ga0070664_100010623 | 3300005564 | Bacteria | 7460 |
| 200 | Ga0070664_100062403 | 3300005564 | Bacteria | 3177 |
| 201 | Ga0070664_100132074 | 3300005564 | Bacteria | 2194 |
| 202 | Ga0068857_100004956 | 3300005577 | Bacteria | 11310 |
| 203 | Ga0068857_100006775 | 3300005577 | Bacteria | 9858 |
| 204 | Ga0068857_100017777 | 3300005577 | Bacteria | 6233 |
| 205 | Ga0068857_100059647 | 3300005577 | Bacteria | 3390 |
| 206 | Ga0068857_100073627 | 3300005577 | Bacteria | 3044 |
| 207 | Ga0068857_100114259 | 3300005577 | Bacteria | 2428 |
| 208 | Ga0068854_100046701 | 3300005578 | Bacteria | 3084 |
| 209 | Ga0068854_100207746 | 3300005578 | Bacteria | 1543 |
| 210 | Ga0068856_100000571 | 3300005614 | Bacteria | 40367 |
| 211 | Ga0068856_100001211 | 3300005614 | Bacteria | 27074 |
| 212 | Ga0068856_100001271 | 3300005614 | Bacteria | 26542 |
| 213 | Ga0068856_100007241 | 3300005614 | Bacteria | 10824 |
| 214 | Ga0068856_100009546 | 3300005614 | Bacteria | 9425 |
| 215 | Ga0068856_100013497 | 3300005614 | Bacteria | 7909 |
| 216 | Ga0068856_100024977 | 3300005614 | Bacteria | 5824 |
| 217 | Ga0068856_100025118 | 3300005614 | Bacteria | 5806 |
| 218 | Ga0068856_100027978 | 3300005614 | Bacteria | 5500 |
| 219 | Ga0068856_100069148 | 3300005614 | Bacteria | 3492 |
| 220 | Ga0068856_100095306 | 3300005614 | Bacteria | 2964 |
| 221 | Ga0068856_100140924 | 3300005614 | Bacteria | 2418 |
| 222 | Ga0068856_100186585 | 3300005614 | Bacteria | 2088 |
| 223 | Ga0068856_100206789 | 3300005614 | Bacteria | 1977 |
| 224 | Ga0068856_100255173 | 3300005614 | Bacteria | 1768 |
| 225 | Ga0070702_100004836 | 3300005615 | Bacteria | 6195 |
| 226 | Ga0070702_100068152 | 3300005615 | Bacteria | 2093 |
| 227 | Ga0068852_100000985 | 3300005616 | Bacteria | 18756 |
| 228 | Ga0068852_100005765 | 3300005616 | Bacteria | 8890 |
| 229 | Ga0068852_100006358 | 3300005616 | Bacteria | 8530 |
| 230 | Ga0068852_100011845 | 3300005616 | Bacteria | 6591 |
| 231 | Ga0068852_100015898 | 3300005616 | Bacteria | 5853 |
| 232 | Ga0068852_100234861 | 3300005616 | Bacteria | 1750 |
| 233 | Ga0068852_100276338 | 3300005616 | Bacteria | 1618 |
| 234 | Ga0068859_100001284 | 3300005617 | Bacteria | 25635 |
| 235 | Ga0068859_100020671 | 3300005617 | Bacteria | 6606 |
| 236 | Ga0068859_100038265 | 3300005617 | Bacteria | 4812 |
| 237 | Ga0068859_100199444 | 3300005617 | Bacteria | 2086 |
| 238 | Ga0068864_100000562 | 3300005618 | Bacteria | 31752 |
| 239 | Ga0068864_100001544 | 3300005618 | Bacteria | 18972 |
| 240 | Ga0068864_100004937 | 3300005618 | Bacteria | 10929 |
| 241 | Ga0068864_100011579 | 3300005618 | Bacteria | 7283 |
| 242 | Ga0068864_100018864 | 3300005618 | Bacteria | 5767 |
| 243 | Ga0068864_100205090 | 3300005618 | Bacteria | 1813 |
| 244 | Ga0068861_100002237 | 3300005719 | Bacteria | 12553 |
| 245 | Ga0068861_100043468 | 3300005719 | Bacteria | 3373 |
| 246 | Ga0068851_10002556 | 3300005834 | Bacteria | 8006 |
| 247 | Ga0068851_10060525 | 3300005834 | Bacteria | 1939 |
| 248 | Ga0068870_10008382 | 3300005840 | Bacteria | 4649 |
| 249 | Ga0068870_10008421 | 3300005840 | Bacteria | 4638 |
| 250 | Ga0068863_100003319 | 3300005841 | Bacteria | 15889 |
| 251 | Ga0068863_100016850 | 3300005841 | Bacteria | 7008 |
| 252 | Ga0068863_100214920 | 3300005841 | Bacteria | 1852 |
| 253 | Ga0068858_100002537 | 3300005842 | Bacteria | 18405 |
| 254 | Ga0068858_100006133 | 3300005842 | Bacteria | 11726 |
| 255 | Ga0068858_100007409 | 3300005842 | Bacteria | 10615 |
| 256 | Ga0068858_100008448 | 3300005842 | Bacteria | 9900 |
| 257 | Ga0068858_100008547 | 3300005842 | Bacteria | 9838 |
| 258 | Ga0068858_100021186 | 3300005842 | Bacteria | 6069 |
| 259 | Ga0068858_100024779 | 3300005842 | Bacteria | 5587 |
| 260 | Ga0068858_100150868 | 3300005842 | Bacteria | 2185 |
| 261 | Ga0068860_100003123 | 3300005843 | Bacteria | 17110 |
| 262 | Ga0068860_100027132 | 3300005843 | Bacteria | 5518 |
| 263 | Ga0068860_100081559 | 3300005843 | Bacteria | 3076 |
| 264 | Ga0068862_100012089 | 3300005844 | Bacteria | 7134 |
| 265 | Ga0068862_100185322 | 3300005844 | Bacteria | 1870 |
| 266 | Ga0081455_10028093 | 3300005937 | Bacteria | 5143 |
| 267 | Ga0081538_10023149 | 3300005981 | Bacteria | 4474 |
| 268 | Ga0081538_10044307 | 3300005981 | Bacteria | 2777 |
| 269 | Ga0081538_10048901 | 3300005981 | Bacteria | 2572 |
| 270 | Ga0070712_100013761 | 3300006175 | Bacteria | 5176 |
| 271 | Ga0070712_100028518 | 3300006175 | Bacteria | 3734 |
| 272 | Ga0070712_100162508 | 3300006175 | Bacteria | 1725 |
| 273 | Ga0097621_100000014 | 3300006237 | Bacteria | 100839 |
| 274 | Ga0097621_100000229 | 3300006237 | Bacteria | 37450 |
| 275 | Ga0097621_100049235 | 3300006237 | Bacteria | 3422 |
| 276 | Ga0097621_100050317 | 3300006237 | Bacteria | 3388 |
| 277 | Ga0068871_100000071 | 3300006358 | Bacteria | 57255 |
| 278 | Ga0068871_100000166 | 3300006358 | Bacteria | 44052 |
| 279 | Ga0068871_100006021 | 3300006358 | Bacteria | 8537 |
| 280 | Ga0068871_100008001 | 3300006358 | Bacteria | 7587 |
| 281 | Ga0068871_100015338 | 3300006358 | Bacteria | 5731 |
| 282 | Ga0068871_100030342 | 3300006358 | Bacteria | 4256 |
| 283 | Ga0068871_100122260 | 3300006358 | Bacteria | 2200 |
| 284 | Ga0068871_100127503 | 3300006358 | Bacteria | 2155 |
| 285 | Ga0068871_100143145 | 3300006358 | Bacteria | 2034 |
| 286 | Ga0075428_100005703 | 3300006844 | Bacteria | 13843 |
| 287 | Ga0075428_100016232 | 3300006844 | Bacteria | 8231 |
| 288 | Ga0075428_100026272 | 3300006844 | Bacteria | 6448 |
| 289 | Ga0075428_100062098 | 3300006844 | Bacteria | 4091 |
| 290 | Ga0075430_100031785 | 3300006846 | Bacteria | 4480 |
| 291 | Ga0075430_100129312 | 3300006846 | Bacteria | 2105 |
| 292 | Ga0075431_100000972 | 3300006847 | Bacteria | 25462 |
| 293 | Ga0075431_100005121 | 3300006847 | Bacteria | 12895 |
| 294 | Ga0075431_100057536 | 3300006847 | Bacteria | 4010 |
| 295 | Ga0075431_100133637 | 3300006847 | Bacteria | 2558 |
| 296 | Ga0075431_100166202 | 3300006847 | Bacteria | 2268 |
| 297 | Ga0075433_10049220 | 3300006852 | Bacteria | 3667 |
| 298 | Ga0075433_10052747 | 3300006852 | Bacteria | 3544 |
| 299 | Ga0075433_10065601 | 3300006852 | Bacteria | 3184 |
| 300 | Ga0075433_10072842 | 3300006852 | Bacteria | 3021 |
| 301 | Ga0075434_100164763 | 3300006871 | Bacteria | 2236 |
| 302 | Ga0075434_100200892 | 3300006871 | Bacteria | 2013 |
| 303 | Ga0075434_100328772 | 3300006871 | Bacteria | 1549 |
| 304 | Ga0075429_100000064 | 3300006880 | Bacteria | 52724 |
| 305 | Ga0075429_100019992 | 3300006880 | Bacteria | 5806 |
| 306 | Ga0075429_100028043 | 3300006880 | Bacteria | 4886 |
| 307 | Ga0075429_100063141 | 3300006880 | Bacteria | 3227 |
| 308 | Ga0068865_100002091 | 3300006881 | Bacteria | 11788 |
| 309 | Ga0068865_100059288 | 3300006881 | Bacteria | 2676 |
| 310 | Ga0068865_100138694 | 3300006881 | Bacteria | 1831 |
| 311 | Ga0075436_100010845 | 3300006914 | Bacteria | 6251 |
| 312 | Ga0075436_100013943 | 3300006914 | Bacteria | 5501 |
| 313 | Ga0075436_100016786 | 3300006914 | Bacteria | 5011 |
| 314 | Ga0097620_100001284 | 3300006931 | Bacteria | 25635 |
| 315 | Ga0097620_100020673 | 3300006931 | Bacteria | 6606 |
| 316 | Ga0097620_100038266 | 3300006931 | Bacteria | 4812 |
| 317 | Ga0097620_100199430 | 3300006931 | Bacteria | 2086 |
| 318 | Ga0075435_100076919 | 3300007076 | Bacteria | 2736 |
| 319 | Ga0075435_100113783 | 3300007076 | Bacteria | 2252 |
| 320 | Ga0099794_10034794 | 3300007265 | Bacteria | 2375 |
| 321 | Ga0099794_10049251 | 3300007265 | Bacteria | 2024 |
| 322 | Ga0105240_10007090 | 3300009093 | Bacteria | 16338 |
| 323 | Ga0105240_10012786 | 3300009093 | Bacteria | 11566 |
| 324 | Ga0105240_10042344 | 3300009093 | Bacteria | 5803 |
| 325 | Ga0105240_10048895 | 3300009093 | Bacteria | 5343 |
| 326 | Ga0105240_10058157 | 3300009093 | Bacteria | 4827 |
| 327 | Ga0105240_10058757 | 3300009093 | Bacteria | 4800 |
| 328 | Ga0105240_10096120 | 3300009093 | Bacteria | 3611 |
| 329 | Ga0111539_10003448 | 3300009094 | Bacteria | 20824 |
| 330 | Ga0111539_10016120 | 3300009094 | Bacteria | 9273 |
| 331 | Ga0111539_10110619 | 3300009094 | Bacteria | 3224 |
| 332 | Ga0111539_10189404 | 3300009094 | Bacteria | 2401 |
| 333 | Ga0111539_10232616 | 3300009094 | Bacteria | 2146 |
| 334 | Ga0105245_10002611 | 3300009098 | Bacteria | 16234 |
| 335 | Ga0105245_10002798 | 3300009098 | Bacteria | 15691 |
| 336 | Ga0105245_10022438 | 3300009098 | Bacteria | 5541 |
| 337 | Ga0105245_10106239 | 3300009098 | Bacteria | 2605 |
| 338 | Ga0105245_10120506 | 3300009098 | Bacteria | 2450 |
| 339 | Ga0114129_10013591 | 3300009147 | Bacteria | 11600 |
| 340 | Ga0114129_10016075 | 3300009147 | Bacteria | 10646 |
| 341 | Ga0114129_10023131 | 3300009147 | Bacteria | 8815 |
| 342 | Ga0114129_10034089 | 3300009147 | Bacteria | 7191 |
| 343 | Ga0114129_10145680 | 3300009147 | Bacteria | 3245 |
| 344 | Ga0114129_10349874 | 3300009147 | Bacteria | 1958 |
| 345 | Ga0105243_10048524 | 3300009148 | Bacteria | 3347 |
| 346 | Ga0105241_10002804 | 3300009174 | Bacteria | 13044 |
| 347 | Ga0105241_10003233 | 3300009174 | Bacteria | 12120 |
| 348 | Ga0105241_10064690 | 3300009174 | Bacteria | 2824 |
| 349 | Ga0105241_10073850 | 3300009174 | Bacteria | 2654 |
| 350 | Ga0105241_10138455 | 3300009174 | Bacteria | 1979 |
| 351 | Ga0105242_10020845 | 3300009176 | Bacteria | 5141 |
| 352 | Ga0105242_10034916 | 3300009176 | Bacteria | 4031 |
| 353 | Ga0105242_10122324 | 3300009176 | Bacteria | 2235 |
| 354 | Ga0105248_10004638 | 3300009177 | Bacteria | 15202 |
| 355 | Ga0105248_10006560 | 3300009177 | Bacteria | 12762 |
| 356 | Ga0105248_10007456 | 3300009177 | Bacteria | 12003 |
| 357 | Ga0105248_10008073 | 3300009177 | Bacteria | 11555 |
| 358 | Ga0105248_10038068 | 3300009177 | Bacteria | 5382 |
| 359 | Ga0105237_10007410 | 3300009545 | Bacteria | 12015 |
| 360 | Ga0105237_10052128 | 3300009545 | Bacteria | 4108 |
| 361 | Ga0105237_10094279 | 3300009545 | Bacteria | 2982 |
| 362 | Ga0105237_10163746 | 3300009545 | Bacteria | 2223 |
| 363 | Ga0105238_10000099 | 3300009551 | Bacteria | 97818 |
| 364 | Ga0105238_10003764 | 3300009551 | Bacteria | 15071 |
| 365 | Ga0105238_10005829 | 3300009551 | Bacteria | 12195 |
| 366 | Ga0105238_10010196 | 3300009551 | Bacteria | 9421 |
| 367 | Ga0105238_10016386 | 3300009551 | Bacteria | 7501 |
| 368 | Ga0105238_10035933 | 3300009551 | Bacteria | 5037 |
| 369 | Ga0105238_10040098 | 3300009551 | Bacteria | 4747 |
| 370 | Ga0105238_10040169 | 3300009551 | Bacteria | 4741 |
| 371 | Ga0105238_10081010 | 3300009551 | Bacteria | 3235 |
| 372 | Ga0105249_10000081 | 3300009553 | Bacteria | 137945 |
| 373 | Ga0105239_10004095 | 3300010375 | Bacteria | 17531 |
| 374 | Ga0105239_10004843 | 3300010375 | Bacteria | 15928 |
| 375 | Ga0105239_10035644 | 3300010375 | Bacteria | 5463 |
| 376 | Ga0105239_10061702 | 3300010375 | Bacteria | 4114 |
| 377 | Ga0105239_10076966 | 3300010375 | Bacteria | 3670 |
| 378 | Ga0105239_10079071 | 3300010375 | Bacteria | 3619 |
| 379 | Ga0157373_10006787 | 3300013100 | Bacteria | 8526 |
| 380 | Ga0157373_10009664 | 3300013100 | Bacteria | 7119 |
| 381 | Ga0157373_10063398 | 3300013100 | Bacteria | 2617 |
| 382 | Ga0157371_10029486 | 3300013102 | Bacteria | 3967 |
| 383 | Ga0157370_10000476 | 3300013104 | Bacteria | 50116 |
| 384 | Ga0157370_10006571 | 3300013104 | Bacteria | 12807 |
| 385 | Ga0157370_10014516 | 3300013104 | Bacteria | 8052 |
| 386 | Ga0157370_10022525 | 3300013104 | Bacteria | 6268 |
| 387 | Ga0157370_10026585 | 3300013104 | Bacteria | 5712 |
| 388 | Ga0157370_10029138 | 3300013104 | Bacteria | 5422 |
| 389 | Ga0157370_10049903 | 3300013104 | Bacteria | 4002 |
| 390 | Ga0157370_10096720 | 3300013104 | Bacteria | 2770 |
| 391 | Ga0157370_10110874 | 3300013104 | Bacteria | 2565 |
| 392 | Ga0157369_10000042 | 3300013105 | Bacteria | 181784 |
| 393 | Ga0157369_10085860 | 3300013105 | Bacteria | 3362 |
| 394 | Ga0157369_10110684 | 3300013105 | Bacteria | 2920 |
| 395 | Ga0157369_10166961 | 3300013105 | Bacteria | 2321 |
| 396 | Ga0157374_10000344 | 3300013296 | Bacteria | 42978 |
| 397 | Ga0157374_10001377 | 3300013296 | Bacteria | 20643 |
| 398 | Ga0157374_10003868 | 3300013296 | Bacteria | 12565 |
| 399 | Ga0157374_10006895 | 3300013296 | Bacteria | 9662 |
| 400 | Ga0157374_10007349 | 3300013296 | Bacteria | 9391 |
| 401 | Ga0157378_10000866 | 3300013297 | Bacteria | 27978 |
| 402 | Ga0157378_10071806 | 3300013297 | Bacteria | 3109 |
| 403 | Ga0157378_10214069 | 3300013297 | Bacteria | 1828 |
| 404 | Ga0163162_10002959 | 3300013306 | Bacteria | 16208 |
| 405 | Ga0163162_10007040 | 3300013306 | Bacteria | 10903 |
| 406 | Ga0163162_10104736 | 3300013306 | Bacteria | 2924 |
| 407 | Ga0157372_10001080 | 3300013307 | Bacteria | 29682 |
| 408 | Ga0157372_10004295 | 3300013307 | Bacteria | 15232 |
| 409 | Ga0157372_10004400 | 3300013307 | Bacteria | 15026 |
| 410 | Ga0157372_10010092 | 3300013307 | Bacteria | 10034 |
| 411 | Ga0157372_10027393 | 3300013307 | Bacteria | 6205 |
| 412 | Ga0157372_10028186 | 3300013307 | Bacteria | 6128 |
| 413 | Ga0157372_10032131 | 3300013307 | Bacteria | 5753 |
| 414 | Ga0157372_10041254 | 3300013307 | Bacteria | 5102 |
| 415 | Ga0157372_10125254 | 3300013307 | Bacteria | 2954 |
| 416 | Ga0157372_10160437 | 3300013307 | Bacteria | 2599 |
| 417 | Ga0157372_10473193 | 3300013307 | Bacteria | 1461 |
| 418 | Ga0157375_10005082 | 3300013308 | Bacteria | 11414 |
| 419 | Ga0157375_10018493 | 3300013308 | Bacteria | 6321 |
| 420 | Ga0157375_10035225 | 3300013308 | Unclassified | 4776 |
| 421 | Ga0157375_10068576 | 3300013308 | Bacteria | 3549 |
| 422 | Ga0157375_10097095 | 3300013308 | Bacteria | 3020 |
| 423 | Ga0157375_10179574 | 3300013308 | Bacteria | 2268 |
| 424 | Ga0157375_10238837 | 3300013308 | Bacteria | 1976 |
| 425 | Ga0163163_10002850 | 3300014325 | Bacteria | 14610 |
| 426 | Ga0163163_10004258 | 3300014325 | Bacteria | 12196 |
| 427 | Ga0163163_10009234 | 3300014325 | Bacteria | 8794 |
| 428 | Ga0163163_10039952 | 3300014325 | Bacteria | 4580 |
| 429 | Ga0163163_10114281 | 3300014325 | Bacteria | 2730 |
| 430 | Ga0157380_10003588 | 3300014326 | Bacteria | 10676 |
| 431 | Ga0157380_10009850 | 3300014326 | Bacteria | 6860 |
| 432 | Ga0157380_10150980 | 3300014326 | Bacteria | 2008 |
| 433 | Ga0157380_10154914 | 3300014326 | Bacteria | 1985 |
| 434 | Ga0182008_10000720 | 3300014497 | Bacteria | 23630 |
| 435 | Ga0182008_10010474 | 3300014497 | Bacteria | 4960 |
| 436 | Ga0157377_10001722 | 3300014745 | Bacteria | 9535 |
| 437 | Ga0157377_10021215 | 3300014745 | Bacteria | 3415 |
| 438 | Ga0157377_10052884 | 3300014745 | Bacteria | 2294 |
| 439 | Ga0157379_10001332 | 3300014968 | Bacteria | 20156 |
| 440 | Ga0157379_10006917 | 3300014968 | Bacteria | 9811 |
| 441 | Ga0157379_10011079 | 3300014968 | Bacteria | 7860 |
| 442 | Ga0157379_10032239 | 3300014968 | Bacteria | 4671 |
| 443 | Ga0157376_10001448 | 3300014969 | Bacteria | 15629 |
| 444 | Ga0157376_10001504 | 3300014969 | Bacteria | 15385 |
| 445 | Ga0157376_10017956 | 3300014969 | Bacteria | 5410 |
| 446 | Ga0157376_10033705 | 3300014969 | Bacteria | 4127 |
| 447 | Ga0157376_10053142 | 3300014969 | Bacteria | 3372 |
| 448 | Ga0157376_10071888 | 3300014969 | Bacteria | 2941 |
| 449 | Ga0157376_10190797 | 3300014969 | Bacteria | 1879 |
| 450 | Ga0182007_10000119 | 3300015262 | Bacteria | 54423 |
| 451 | Ga0163161_10007603 | 3300017792 | Bacteria | 7496 |
| 452 | Ga0163161_10015776 | 3300017792 | Bacteria | 5268 |
| 453 | Ga0206356_11297921 | 3300020070 | Bacteria | 1638 |
| 454 | Ga0209759_1000458 | 3300025256 | Bacteria | 46338 |
| 455 | Ga0207656_10008370 | 3300025321 | Bacteria | 3804 |
| 456 | Ga0207653_10000053 | 3300025885 | Bacteria | 87641 |
| 457 | Ga0207682_10009967 | 3300025893 | Bacteria | 3732 |
| 458 | Ga0207682_10010753 | 3300025893 | Bacteria | 3583 |
| 459 | Ga0207688_10002162 | 3300025901 | Bacteria | 10569 |
| 460 | Ga0207680_10037142 | 3300025903 | Bacteria | 2810 |
| 461 | Ga0207680_10045478 | 3300025903 | Bacteria | 2588 |
| 462 | Ga0207647_10021421 | 3300025904 | Bacteria | 4314 |
| 463 | Ga0207699_10106184 | 3300025906 | Bacteria | 1792 |
| 464 | Ga0207645_10007684 | 3300025907 | Bacteria | 7593 |
| 465 | Ga0207645_10020836 | 3300025907 | Bacteria | 4283 |
| 466 | Ga0207645_10062144 | 3300025907 | Bacteria | 2386 |
| 467 | Ga0207643_10006926 | 3300025908 | Bacteria | 6078 |
| 468 | Ga0207643_10009217 | 3300025908 | Bacteria | 5300 |
| 469 | Ga0207705_10007732 | 3300025909 | Bacteria | 7902 |
| 470 | Ga0207684_10000443 | 3300025910 | Bacteria | 54670 |
| 471 | Ga0207684_10002835 | 3300025910 | Bacteria | 17218 |
| 472 | Ga0207684_10026737 | 3300025910 | Unclassified | 4919 |
| 473 | Ga0207684_10040794 | 3300025910 | Bacteria | 3936 |
| 474 | Ga0207654_10000280 | 3300025911 | Bacteria | 31003 |
| 475 | Ga0207654_10000283 | 3300025911 | Bacteria | 30936 |
| 476 | Ga0207707_10000155 | 3300025912 | Bacteria | 71477 |
| 477 | Ga0207707_10000270 | 3300025912 | Bacteria | 55930 |
| 478 | Ga0207707_10000975 | 3300025912 | Bacteria | 27500 |
| 479 | Ga0207707_10002951 | 3300025912 | Bacteria | 15147 |
| 480 | Ga0207707_10004342 | 3300025912 | Bacteria | 12548 |
| 481 | Ga0207707_10005365 | 3300025912 | Bacteria | 11203 |
| 482 | Ga0207707_10013266 | 3300025912 | Bacteria | 7179 |
| 483 | Ga0207707_10013848 | 3300025912 | Bacteria | 7033 |
| 484 | Ga0207707_10029831 | 3300025912 | Bacteria | 4770 |
| 485 | Ga0207707_10058314 | 3300025912 | Bacteria | 3360 |
| 486 | Ga0207707_10185857 | 3300025912 | Bacteria | 1814 |
| 487 | Ga0207695_10005746 | 3300025913 | Bacteria | 16336 |
| 488 | Ga0207695_10019440 | 3300025913 | Bacteria | 7823 |
| 489 | Ga0207695_10029524 | 3300025913 | Bacteria | 6055 |
| 490 | Ga0207695_10032092 | 3300025913 | Bacteria | 5752 |
| 491 | Ga0207695_10075716 | 3300025913 | Bacteria | 3423 |
| 492 | Ga0207695_10084798 | 3300025913 | Bacteria | 3198 |
| 493 | Ga0207695_10105021 | 3300025913 | Bacteria | 2812 |
| 494 | Ga0207695_10140976 | 3300025913 | Bacteria | 2359 |
| 495 | Ga0207695_10151378 | 3300025913 | Bacteria | 2259 |
| 496 | Ga0207695_10189769 | 3300025913 | Bacteria | 1973 |
| 497 | Ga0207671_10012967 | 3300025914 | Bacteria | 6669 |
| 498 | Ga0207693_10054730 | 3300025915 | Bacteria | 3130 |
| 499 | Ga0207693_10079038 | 3300025915 | Bacteria | 2574 |
| 500 | Ga0207693_10116592 | 3300025915 | Bacteria | 2097 |
| 501 | Ga0207663_10031980 | 3300025916 | Bacteria | 3119 |
| 502 | Ga0207660_10000641 | 3300025917 | Bacteria | 23532 |
| 503 | Ga0207660_10006144 | 3300025917 | Bacteria | 7794 |
| 504 | Ga0207660_10013059 | 3300025917 | Bacteria | 5438 |
| 505 | Ga0207660_10048443 | 3300025917 | Bacteria | 3007 |
| 506 | Ga0207660_10136747 | 3300025917 | Bacteria | 1870 |
| 507 | Ga0207657_10001727 | 3300025919 | Bacteria | 23554 |
| 508 | Ga0207657_10047830 | 3300025919 | Bacteria | 3737 |
| 509 | Ga0207657_10053081 | 3300025919 | Bacteria | 3514 |
| 510 | Ga0207657_10066801 | 3300025919 | Bacteria | 3060 |
| 511 | Ga0207657_10084165 | 3300025919 | Bacteria | 2666 |
| 512 | Ga0207657_10104441 | 3300025919 | Bacteria | 2347 |
| 513 | Ga0207649_10054814 | 3300025920 | Bacteria | 2483 |
| 514 | Ga0207652_10000251 | 3300025921 | Bacteria | 55866 |
| 515 | Ga0207652_10005961 | 3300025921 | Bacteria | 9860 |
| 516 | Ga0207652_10006645 | 3300025921 | Bacteria | 9317 |
| 517 | Ga0207652_10018616 | 3300025921 | Bacteria | 5698 |
| 518 | Ga0207652_10047694 | 3300025921 | Bacteria | 3659 |
| 519 | Ga0207652_10073985 | 3300025921 | Bacteria | 2965 |
| 520 | Ga0207646_10000674 | 3300025922 | Bacteria | 44214 |
| 521 | Ga0207646_10000680 | 3300025922 | Bacteria | 44066 |
| 522 | Ga0207646_10009227 | 3300025922 | Bacteria | 9771 |
| 523 | Ga0207646_10042030 | 3300025922 | Unclassified | 4107 |
| 524 | Ga0207646_10092100 | 3300025922 | Bacteria | 2713 |
| 525 | Ga0207681_10017807 | 3300025923 | Bacteria | 4467 |
| 526 | Ga0207681_10092054 | 3300025923 | Bacteria | 2167 |
| 527 | Ga0207694_10000936 | 3300025924 | Bacteria | 25749 |
| 528 | Ga0207694_10002805 | 3300025924 | Bacteria | 14070 |
| 529 | Ga0207694_10010737 | 3300025924 | Bacteria | 6916 |
| 530 | Ga0207694_10025645 | 3300025924 | Bacteria | 4481 |
| 531 | Ga0207694_10037007 | 3300025924 | Bacteria | 3746 |
| 532 | Ga0207694_10050931 | 3300025924 | Bacteria | 3209 |
| 533 | Ga0207659_10000416 | 3300025926 | Bacteria | 25703 |
| 534 | Ga0207659_10099853 | 3300025926 | Bacteria | 2186 |
| 535 | Ga0207659_10147743 | 3300025926 | Bacteria | 1832 |
| 536 | Ga0207687_10048332 | 3300025927 | Bacteria | 2953 |
| 537 | Ga0207687_10062066 | 3300025927 | Bacteria | 2641 |
| 538 | Ga0207700_10010364 | 3300025928 | Bacteria | 5876 |
| 539 | Ga0207700_10010548 | 3300025928 | Bacteria | 5838 |
| 540 | Ga0207700_10028009 | 3300025928 | Bacteria | 3953 |
| 541 | Ga0207664_10003022 | 3300025929 | Bacteria | 11188 |
| 542 | Ga0207664_10013961 | 3300025929 | Bacteria | 5789 |
| 543 | Ga0207664_10053855 | 3300025929 | Bacteria | 3186 |
| 544 | Ga0207664_10074436 | 3300025929 | Bacteria | 2744 |
| 545 | Ga0207664_10091134 | 3300025929 | Bacteria | 2499 |
| 546 | Ga0207644_10005692 | 3300025931 | Bacteria | 8112 |
| 547 | Ga0207690_10003656 | 3300025932 | Bacteria | 9162 |
| 548 | Ga0207690_10009501 | 3300025932 | Bacteria | 5776 |
| 549 | Ga0207690_10033090 | 3300025932 | Bacteria | 3322 |
| 550 | Ga0207706_10000369 | 3300025933 | Bacteria | 48716 |
| 551 | Ga0207706_10001191 | 3300025933 | Bacteria | 26232 |
| 552 | Ga0207706_10017481 | 3300025933 | Bacteria | 6463 |
| 553 | Ga0207706_10031545 | 3300025933 | Bacteria | 4720 |
| 554 | Ga0207706_10185834 | 3300025933 | Bacteria | 1825 |
| 555 | Ga0207686_10028954 | 3300025934 | Bacteria | 3262 |
| 556 | Ga0207670_10080168 | 3300025936 | Bacteria | 2281 |
| 557 | Ga0207669_10037902 | 3300025937 | Bacteria | 2771 |
| 558 | Ga0207669_10062219 | 3300025937 | Bacteria | 2298 |
| 559 | Ga0207704_10001495 | 3300025938 | Bacteria | 10470 |
| 560 | Ga0207704_10041860 | 3300025938 | Bacteria | 2691 |
| 561 | Ga0207704_10094528 | 3300025938 | Bacteria | 1974 |
| 562 | Ga0207691_10012818 | 3300025940 | Bacteria | 8024 |
| 563 | Ga0207691_10013944 | 3300025940 | Bacteria | 7668 |
| 564 | Ga0207691_10024313 | 3300025940 | Bacteria | 5697 |
| 565 | Ga0207691_10029133 | 3300025940 | Bacteria | 5165 |
| 566 | Ga0207711_10003977 | 3300025941 | Bacteria | 12713 |
| 567 | Ga0207711_10073393 | 3300025941 | Bacteria | 2973 |
| 568 | Ga0207711_10091600 | 3300025941 | Bacteria | 2674 |
| 569 | Ga0207711_10124216 | 3300025941 | Bacteria | 2307 |
| 570 | Ga0207711_10184343 | 3300025941 | Bacteria | 1899 |
| 571 | Ga0207711_10251683 | 3300025941 | Bacteria | 1622 |
| 572 | Ga0207689_10000410 | 3300025942 | Bacteria | 40080 |
| 573 | Ga0207689_10002821 | 3300025942 | Bacteria | 16043 |
| 574 | Ga0207689_10005112 | 3300025942 | Bacteria | 11794 |
| 575 | Ga0207661_10000719 | 3300025944 | Bacteria | 21519 |
| 576 | Ga0207661_10014797 | 3300025944 | Bacteria | 5724 |
| 577 | Ga0207661_10022652 | 3300025944 | Bacteria | 4735 |
| 578 | Ga0207661_10061463 | 3300025944 | Bacteria | 3035 |
| 579 | Ga0207661_10063919 | 3300025944 | Bacteria | 2982 |
| 580 | Ga0207661_10070011 | 3300025944 | Bacteria | 2862 |
| 581 | Ga0207661_10182699 | 3300025944 | Bacteria | 1833 |
| 582 | Ga0207679_10000343 | 3300025945 | Bacteria | 33879 |
| 583 | Ga0207679_10032011 | 3300025945 | Bacteria | 3687 |
| 584 | Ga0207679_10135610 | 3300025945 | Bacteria | 1982 |
| 585 | Ga0207679_10184658 | 3300025945 | Bacteria | 1728 |
| 586 | Ga0207667_10000535 | 3300025949 | Bacteria | 50094 |
| 587 | Ga0207667_10008360 | 3300025949 | Bacteria | 12300 |
| 588 | Ga0207667_10010202 | 3300025949 | Bacteria | 11002 |
| 589 | Ga0207667_10013002 | 3300025949 | Bacteria | 9555 |
| 590 | Ga0207667_10018924 | 3300025949 | Bacteria | 7703 |
| 591 | Ga0207667_10023515 | 3300025949 | Bacteria | 6785 |
| 592 | Ga0207667_10048443 | 3300025949 | Bacteria | 4493 |
| 593 | Ga0207667_10093889 | 3300025949 | Bacteria | 3098 |
| 594 | Ga0207667_10115130 | 3300025949 | Bacteria | 2771 |
| 595 | Ga0207667_10164576 | 3300025949 | Bacteria | 2281 |
| 596 | Ga0207667_10296921 | 3300025949 | Bacteria | 1650 |
| 597 | Ga0207651_10000189 | 3300025960 | Bacteria | 26894 |
| 598 | Ga0207651_10139048 | 3300025960 | Bacteria | 1873 |
| 599 | Ga0207712_10000532 | 3300025961 | Bacteria | 31279 |
| 600 | Ga0207668_10005352 | 3300025972 | Bacteria | 7549 |
| 601 | Ga0207640_10021757 | 3300025981 | Bacteria | 3827 |
| 602 | Ga0207658_10005948 | 3300025986 | Bacteria | 8330 |
| 603 | Ga0207658_10199188 | 3300025986 | Bacteria | 1670 |
| 604 | Ga0207677_10000620 | 3300026023 | Bacteria | 21704 |
| 605 | Ga0207677_10008146 | 3300026023 | Bacteria | 5835 |
| 606 | Ga0207677_10017170 | 3300026023 | Bacteria | 4307 |
| 607 | Ga0207677_10026582 | 3300026023 | Bacteria | 3633 |
| 608 | Ga0207677_10042195 | 3300026023 | Bacteria | 3023 |
| 609 | Ga0207677_10136563 | 3300026023 | Bacteria | 1871 |
| 610 | Ga0207703_10002880 | 3300026035 | Bacteria | 14646 |
| 611 | Ga0207703_10033841 | 3300026035 | Bacteria | 4053 |
| 612 | Ga0207703_10047137 | 3300026035 | Bacteria | 3474 |
| 613 | Ga0207703_10079003 | 3300026035 | Bacteria | 2736 |
| 614 | Ga0207639_10015987 | 3300026041 | Bacteria | 5300 |
| 615 | Ga0207639_10016023 | 3300026041 | Bacteria | 5294 |
| 616 | Ga0207639_10037642 | 3300026041 | Bacteria | 3594 |
| 617 | Ga0207639_10054681 | 3300026041 | Bacteria | 3052 |
| 618 | Ga0207639_10090484 | 3300026041 | Bacteria | 2447 |
| 619 | Ga0207639_10093836 | 3300026041 | Bacteria | 2408 |
| 620 | Ga0207639_10094882 | 3300026041 | Bacteria | 2396 |
| 621 | Ga0207639_10134911 | 3300026041 | Bacteria | 2048 |
| 622 | Ga0207639_10149366 | 3300026041 | Bacteria | 1956 |
| 623 | Ga0207678_10000790 | 3300026067 | Bacteria | 28986 |
| 624 | Ga0207678_10001500 | 3300026067 | Bacteria | 21396 |
| 625 | Ga0207678_10003286 | 3300026067 | Bacteria | 14585 |
| 626 | Ga0207678_10016506 | 3300026067 | Bacteria | 6483 |
| 627 | Ga0207678_10044367 | 3300026067 | Bacteria | 3847 |
| 628 | Ga0207708_10015268 | 3300026075 | Bacteria | 5758 |
| 629 | Ga0207708_10083257 | 3300026075 | Bacteria | 2459 |
| 630 | Ga0207708_10207472 | 3300026075 | Bacteria | 1565 |
| 631 | Ga0207702_10001339 | 3300026078 | Bacteria | 24625 |
| 632 | Ga0207702_10002228 | 3300026078 | Bacteria | 18591 |
| 633 | Ga0207702_10003666 | 3300026078 | Bacteria | 13910 |
| 634 | Ga0207702_10013563 | 3300026078 | Bacteria | 6769 |
| 635 | Ga0207702_10014914 | 3300026078 | Bacteria | 6445 |
| 636 | Ga0207702_10042631 | 3300026078 | Bacteria | 3807 |
| 637 | Ga0207702_10052070 | 3300026078 | Bacteria | 3462 |
| 638 | Ga0207702_10072441 | 3300026078 | Bacteria | 2970 |
| 639 | Ga0207702_10085713 | 3300026078 | Bacteria | 2745 |
| 640 | Ga0207702_10110696 | 3300026078 | Bacteria | 2441 |
| 641 | Ga0207702_10129024 | 3300026078 | Bacteria | 2273 |
| 642 | Ga0207702_10152061 | 3300026078 | Bacteria | 2106 |
| 643 | Ga0207641_10007774 | 3300026088 | Bacteria | 8908 |
| 644 | Ga0207641_10101100 | 3300026088 | Bacteria | 2540 |
| 645 | Ga0207641_10126575 | 3300026088 | Bacteria | 2288 |
| 646 | Ga0207641_10184045 | 3300026088 | Bacteria | 1915 |
| 647 | Ga0207641_10229442 | 3300026088 | Bacteria | 1725 |
| 648 | Ga0207648_10037507 | 3300026089 | Bacteria | 4270 |
| 649 | Ga0207648_10038479 | 3300026089 | Bacteria | 4208 |
| 650 | Ga0207648_10044629 | 3300026089 | Bacteria | 3889 |
| 651 | Ga0207648_10136850 | 3300026089 | Bacteria | 2158 |
| 652 | Ga0207648_10142444 | 3300026089 | Bacteria | 2113 |
| 653 | Ga0207676_10001204 | 3300026095 | Bacteria | 19366 |
| 654 | Ga0207676_10001770 | 3300026095 | Bacteria | 15831 |
| 655 | Ga0207676_10006609 | 3300026095 | Bacteria | 8202 |
| 656 | Ga0207676_10011380 | 3300026095 | Bacteria | 6359 |
| 657 | Ga0207676_10025513 | 3300026095 | Bacteria | 4385 |
| 658 | Ga0207674_10000611 | 3300026116 | Bacteria | 46923 |
| 659 | Ga0207674_10006991 | 3300026116 | Bacteria | 13202 |
| 660 | Ga0207674_10023865 | 3300026116 | Bacteria | 6542 |
| 661 | Ga0207674_10027407 | 3300026116 | Bacteria | 6027 |
| 662 | Ga0207674_10027990 | 3300026116 | Bacteria | 5956 |
| 663 | Ga0207674_10038645 | 3300026116 | Bacteria | 4950 |
| 664 | Ga0207674_10058393 | 3300026116 | Bacteria | 3909 |
| 665 | Ga0207674_10084803 | 3300026116 | Bacteria | 3165 |
| 666 | Ga0207675_100000689 | 3300026118 | Bacteria | 33348 |
| 667 | Ga0207675_100047242 | 3300026118 | Bacteria | 4020 |
| 668 | Ga0207675_100111169 | 3300026118 | Bacteria | 2585 |
| 669 | Ga0207683_10042423 | 3300026121 | Bacteria | 3974 |
| 670 | Ga0207698_10004507 | 3300026142 | Bacteria | 8496 |
| 671 | Ga0207698_10011766 | 3300026142 | Bacteria | 5689 |
| 672 | Ga0207698_10011768 | 3300026142 | Bacteria | 5689 |
| 673 | Ga0207698_10014733 | 3300026142 | Bacteria | 5209 |
| 674 | Ga0207698_10155640 | 3300026142 | Bacteria | 1990 |
| 675 | Ga0207698_10156015 | 3300026142 | Bacteria | 1989 |
| 676 | Ga0207698_10203285 | 3300026142 | Bacteria | 1776 |
| 677 | Ga0209995_1009809 | 3300027471 | Bacteria | 1551 |
| 678 | Ga0210002_1002477 | 3300027617 | Unclassified | 2665 |
| 679 | Ga0209971_1002614 | 3300027682 | Unclassified | 4317 |
| 680 | Ga0209974_10000067 | 3300027876 | Bacteria | 27577 |
| 681 | Ga0209974_10003260 | 3300027876 | Bacteria | 5865 |
| 682 | Ga0207428_10004501 | 3300027907 | Bacteria | 13221 |
| 683 | Ga0207428_10008071 | 3300027907 | Bacteria | 9550 |
| 684 | Ga0207428_10008172 | 3300027907 | Bacteria | 9469 |
| 685 | Ga0207428_10042896 | 3300027907 | Bacteria | 3657 |
| 686 | Ga0268265_10001894 | 3300028380 | Bacteria | 16646 |
| 687 | Ga0268264_10006348 | 3300028381 | Bacteria | 9962 |
| 688 | Ga0268264_10034540 | 3300028381 | Bacteria | 4160 |
| 689 | Ga0265334_10000131 | 3300028573 | Bacteria | 47027 |
| 690 | Ga0265334_10000803 | 3300028573 | Bacteria | 15713 |
| 691 | Ga0265334_10026869 | 3300028573 | Bacteria | 2321 |
| 692 | Ga0265318_10000900 | 3300028577 | Bacteria | 19390 |
| 693 | Ga0265322_10007668 | 3300028654 | Bacteria | 3147 |
| 694 | Ga0265322_10019873 | 3300028654 | Bacteria | 1925 |
| 695 | Ga0265336_10001126 | 3300028666 | Bacteria | 12830 |
| 696 | Ga0265336_10001852 | 3300028666 | Bacteria | 9175 |
| 697 | Ga0307515_10141313 | 3300028794 | Bacteria | 2580 |
| 698 | Ga0265338_10001728 | 3300028800 | Bacteria | 34565 |
| 699 | Ga0265338_10004099 | 3300028800 | Bacteria | 19961 |
| 700 | Ga0265338_10007658 | 3300028800 | Bacteria | 13319 |
| 701 | Ga0265338_10007947 | 3300028800 | Bacteria | 12996 |
| 702 | Ga0265338_10008121 | 3300028800 | Bacteria | 12817 |
| 703 | Ga0265338_10013715 | 3300028800 | Bacteria | 9115 |
| 704 | Ga0265338_10016083 | 3300028800 | Bacteria | 8167 |
| 705 | Ga0265338_10018645 | 3300028800 | Bacteria | 7415 |
| 706 | Ga0265338_10053576 | 3300028800 | Bacteria | 3606 |
| 707 | Ga0265324_10000021 | 3300029957 | Bacteria | 170598 |
| 708 | Ga0265330_10000334 | 3300031235 | Bacteria | 33914 |
| 709 | Ga0265330_10001008 | 3300031235 | Bacteria | 17120 |
| 710 | Ga0265330_10004830 | 3300031235 | Bacteria | 6794 |
| 711 | Ga0265330_10010013 | 3300031235 | Bacteria | 4485 |
| 712 | Ga0265330_10023615 | 3300031235 | Bacteria | 2791 |
| 713 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 714 | Ga0265332_10000844 | 3300031238 | Bacteria | 18600 |
| 715 | Ga0265332_10012383 | 3300031238 | Bacteria | 3785 |
| 716 | Ga0265328_10000347 | 3300031239 | Bacteria | 21777 |
| 717 | Ga0265328_10004163 | 3300031239 | Bacteria | 6308 |
| 718 | Ga0265328_10014511 | 3300031239 | Bacteria | 3101 |
| 719 | Ga0265328_10023734 | 3300031239 | Bacteria | 2324 |
| 720 | Ga0265320_10022040 | 3300031240 | Bacteria | 3416 |
| 721 | Ga0265320_10023138 | 3300031240 | Bacteria | 3312 |
| 722 | Ga0265325_10000426 | 3300031241 | Bacteria | 30282 |
| 723 | Ga0265325_10003049 | 3300031241 | Bacteria | 11076 |
| 724 | Ga0265325_10004351 | 3300031241 | Bacteria | 8964 |
| 725 | Ga0265325_10006671 | 3300031241 | Bacteria | 6984 |
| 726 | Ga0265325_10016130 | 3300031241 | Bacteria | 4180 |
| 727 | Ga0265325_10030387 | 3300031241 | Bacteria | 2897 |
| 728 | Ga0265325_10046944 | 3300031241 | Bacteria | 2237 |
| 729 | Ga0265325_10048136 | 3300031241 | Bacteria | 2205 |
| 730 | Ga0265329_10002086 | 3300031242 | Bacteria | 9298 |
| 731 | Ga0265329_10003468 | 3300031242 | Bacteria | 6859 |
| 732 | Ga0265340_10000961 | 3300031247 | Bacteria | 16412 |
| 733 | Ga0265340_10012465 | 3300031247 | Bacteria | 4490 |
| 734 | Ga0265340_10014656 | 3300031247 | Bacteria | 4088 |
| 735 | Ga0265340_10017491 | 3300031247 | Bacteria | 3709 |
| 736 | Ga0265340_10062808 | 3300031247 | Bacteria | 1773 |
| 737 | Ga0265339_10000013 | 3300031249 | Bacteria | 197953 |
| 738 | Ga0265339_10000103 | 3300031249 | Bacteria | 68631 |
| 739 | Ga0265339_10002009 | 3300031249 | Bacteria | 14947 |
| 740 | Ga0265339_10010376 | 3300031249 | Bacteria | 5790 |
| 741 | Ga0265339_10017244 | 3300031249 | Bacteria | 4280 |
| 742 | Ga0265339_10023980 | 3300031249 | Bacteria | 3521 |
| 743 | Ga0265339_10024678 | 3300031249 | Bacteria | 3460 |
| 744 | Ga0265339_10029907 | 3300031249 | Bacteria | 3087 |
| 745 | Ga0265339_10047159 | 3300031249 | Bacteria | 2366 |
| 746 | Ga0265331_10000502 | 3300031250 | Bacteria | 36921 |
| 747 | Ga0265331_10003200 | 3300031250 | Bacteria | 10686 |
| 748 | Ga0265331_10003820 | 3300031250 | Bacteria | 9552 |
| 749 | Ga0265331_10019632 | 3300031250 | Bacteria | 3487 |
| 750 | Ga0265331_10030212 | 3300031250 | Bacteria | 2698 |
| 751 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 752 | Ga0265327_10000139 | 3300031251 | Bacteria | 159492 |
| 753 | Ga0265327_10000201 | 3300031251 | Bacteria | 124359 |
| 754 | Ga0265327_10000886 | 3300031251 | Bacteria | 44160 |
| 755 | Ga0265327_10004938 | 3300031251 | Bacteria | 11476 |
| 756 | Ga0265327_10007063 | 3300031251 | Bacteria | 8787 |
| 757 | Ga0265327_10010188 | 3300031251 | Bacteria | 6642 |
| 758 | Ga0265327_10013053 | 3300031251 | Bacteria | 5548 |
| 759 | Ga0265327_10029061 | 3300031251 | Bacteria | 3149 |
| 760 | Ga0265327_10032911 | 3300031251 | Bacteria | 2898 |
| 761 | Ga0265316_10000699 | 3300031344 | Bacteria | 37344 |
| 762 | Ga0265316_10000717 | 3300031344 | Bacteria | 36575 |
| 763 | Ga0265316_10004145 | 3300031344 | Bacteria | 14490 |
| 764 | Ga0265316_10005131 | 3300031344 | Bacteria | 12833 |
| 765 | Ga0265316_10006874 | 3300031344 | Bacteria | 10797 |
| 766 | Ga0265316_10011615 | 3300031344 | Bacteria | 7931 |
| 767 | Ga0265316_10013919 | 3300031344 | Bacteria | 7116 |
| 768 | Ga0265316_10017109 | 3300031344 | Bacteria | 6275 |
| 769 | Ga0265316_10017767 | 3300031344 | Bacteria | 6132 |
| 770 | Ga0265316_10079528 | 3300031344 | Bacteria | 2515 |
| 771 | Ga0265316_10116375 | 3300031344 | Bacteria | 2021 |
| 772 | Ga0307513_10001895 | 3300031456 | Bacteria | 29712 |
| 773 | Ga0265313_10006437 | 3300031595 | Bacteria | 8313 |
| 774 | Ga0265313_10007076 | 3300031595 | Bacteria | 7751 |
| 775 | Ga0265313_10009115 | 3300031595 | Bacteria | 6489 |
| 776 | Ga0265313_10011209 | 3300031595 | Bacteria | 5588 |
| 777 | Ga0265313_10012124 | 3300031595 | Bacteria | 5303 |
| 778 | Ga0265313_10040100 | 3300031595 | Bacteria | 2317 |
| 779 | Ga0265313_10047731 | 3300031595 | Bacteria | 2071 |
| 780 | Ga0316575_10010190 | 3300031665 | Bacteria | 3447 |
| 781 | Ga0316575_10019689 | 3300031665 | Bacteria | 2584 |
| 782 | Ga0316579_10001303 | 3300031691 | Bacteria | 9005 |
| 783 | Ga0316579_10005869 | 3300031691 | Bacteria | 4978 |
| 784 | Ga0316579_10030313 | 3300031691 | Bacteria | 2471 |
| 785 | Ga0316579_10064705 | 3300031691 | Bacteria | 1725 |
| 786 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 787 | Ga0265314_10003323 | 3300031711 | Bacteria | 15673 |
| 788 | Ga0265314_10007094 | 3300031711 | Bacteria | 9772 |
| 789 | Ga0265314_10009570 | 3300031711 | Bacteria | 8165 |
| 790 | Ga0265314_10009885 | 3300031711 | Bacteria | 8004 |
| 791 | Ga0265314_10013702 | 3300031711 | Bacteria | 6536 |
| 792 | Ga0265314_10025646 | 3300031711 | Unclassified | 4442 |
| 793 | Ga0265314_10026307 | 3300031711 | Bacteria | 4372 |
| 794 | Ga0265314_10068999 | 3300031711 | Bacteria | 2374 |
| 795 | Ga0265314_10072654 | 3300031711 | Bacteria | 2297 |
| 796 | Ga0265314_10102875 | 3300031711 | Bacteria | 1832 |
| 797 | Ga0265342_10002778 | 3300031712 | Bacteria | 14826 |
| 798 | Ga0265342_10007431 | 3300031712 | Bacteria | 8019 |
| 799 | Ga0265342_10009623 | 3300031712 | Bacteria | 6784 |
| 800 | Ga0265342_10009658 | 3300031712 | Bacteria | 6766 |
| 801 | Ga0265342_10020912 | 3300031712 | Bacteria | 4185 |
| 802 | Ga0265342_10027799 | 3300031712 | Bacteria | 3529 |
| 803 | Ga0265342_10050616 | 3300031712 | Bacteria | 2481 |
| 804 | Ga0265342_10076480 | 3300031712 | Bacteria | 1940 |
| 805 | Ga0316576_10007547 | 3300031727 | Bacteria | 6860 |
| 806 | Ga0316576_10013534 | 3300031727 | Bacteria | 5428 |
| 807 | Ga0316576_10045520 | 3300031727 | Bacteria | 3173 |
| 808 | Ga0316576_10047423 | 3300031727 | Bacteria | 3113 |
| 809 | Ga0316576_10050333 | 3300031727 | Bacteria | 3029 |
| 810 | Ga0316576_10059405 | 3300031727 | Bacteria | 2799 |
| 811 | Ga0316576_10123247 | 3300031727 | Bacteria | 1947 |
| 812 | Ga0316578_10003015 | 3300031728 | Bacteria | 7588 |
| 813 | Ga0316578_10003577 | 3300031728 | Bacteria | 7142 |
| 814 | Ga0316578_10014685 | 3300031728 | Bacteria | 4191 |
| 815 | Ga0316578_10034106 | 3300031728 | Bacteria | 2920 |
| 816 | Ga0316577_10008124 | 3300031733 | Bacteria | 5611 |
| 817 | Ga0316577_10021395 | 3300031733 | Bacteria | 3589 |
| 818 | Ga0316577_10073386 | 3300031733 | Bacteria | 1910 |
| 819 | Ga0316577_10076463 | 3300031733 | Bacteria | 1869 |
| 820 | Ga0307410_10014570 | 3300031852 | Bacteria | 4631 |
| 821 | Ga0307406_10116350 | 3300031901 | Bacteria | 1850 |
| 822 | Ga0307407_10038539 | 3300031903 | Bacteria | 2650 |
| 823 | Ga0307409_100001515 | 3300031995 | Bacteria | 11498 |
| 824 | Ga0307415_100206611 | 3300032126 | Bacteria | 1563 |
| 825 | Ga0316583_10000928 | 3300032133 | Bacteria | 9441 |
| 826 | Ga0316583_10005480 | 3300032133 | Bacteria | 4552 |
| 827 | Ga0316583_10024474 | 3300032133 | Bacteria | 2156 |
| 828 | Ga0316583_10035163 | 3300032133 | Bacteria | 1778 |
| 829 | Ga0316585_10016676 | 3300032137 | Bacteria | 2214 |
| 830 | Ga0316580_10026088 | 3300032139 | Bacteria | 1806 |
| 831 | Ga0373930_0000874 | 3300034816 | Bacteria | 4306 |
| 832 | Ga0373959_0010725 | 3300034820 | Bacteria | 1607 |
| 833 | Ga0373940_0001226 | 3300035088 | Bacteria | 4537 |
| 834 | Ga0373932_0001901 | 3300035112 | Bacteria | 5583 |
| 835 | Ga0373957_0061359 | 3300035120 | Bacteria | 1457 |
| 836 | Ga0373946_0076289 | 3300035171 | Bacteria | 1459 |
| 837 | Ga0316574_0000835 | 3300035398 | Bacteria | 13455 |
| 838 | Ga0316574_0001503 | 3300035398 | Bacteria | 11109 |
| 839 | Ga0316574_0001601 | 3300035398 | Bacteria | 10843 |
| 840 | Ga0316574_0002270 | 3300035398 | Bacteria | 9574 |
| 841 | Ga0316574_0032472 | 3300035398 | Bacteria | 3173 |
| 842 | Ga0316574_0035701 | 3300035398 | Bacteria | 3040 |
| 843 | Ga0316574_0039261 | 3300035398 | Bacteria | 2910 |
| 844 | Ga0316574_0076820 | 3300035398 | Bacteria | 2116 |
| 845 | Ga0373924_0002388 | 3300035410 | Bacteria | 6319 |
| 846 | Ga0373931_0000010 | 3300035691 | Bacteria | 334069 |
| 847 | Ga0373931_0002528 | 3300035691 | Bacteria | 8119 |
| 848 | Ga0373931_0071473 | 3300035691 | Bacteria | 1896 |
| 849 | Ga0373935_0072390 | 3300035692 | Bacteria | 2225 |
| 850 | Ga0373927_0012329 | 3300035695 | Bacteria | 5689 |
| 851 | Ga0373933_0027064 | 3300035724 | Bacteria | 3300 |
| 852 | Ga0373933_0087718 | 3300035724 | Bacteria | 1917 |
| 853 | Ga0373937_0018836 | 3300036401 | Bacteria | 6172 |
| 854 | Ga0373937_0032553 | 3300036401 | Bacteria | 4730 |
| 855 | Ga0373937_0083142 | 3300036401 | Bacteria | 2962 |
| 856 | Ga0373937_0137296 | 3300036401 | Bacteria | 2287 |
| 857 | Ga0316582_0000151 | 3300036647 | Bacteria | 20947 |
| 858 | Ga0316582_0002485 | 3300036647 | Bacteria | 8681 |
| 859 | Ga0316582_0002567 | 3300036647 | Bacteria | 8599 |
| 860 | Ga0316582_0008545 | 3300036647 | Bacteria | 5511 |
| 861 | Ga0316582_0010892 | 3300036647 | Bacteria | 5004 |
| 862 | Ga0316584_0001559 | 3300036712 | Bacteria | 13892 |
| 863 | Ga0316584_0004770 | 3300036712 | Bacteria | 8991 |
| 864 | Ga0316584_0006834 | 3300036712 | Bacteria | 7747 |
| 865 | Ga0316584_0009910 | 3300036712 | Bacteria | 6635 |
| 866 | Ga0316584_0013176 | 3300036712 | Bacteria | 5846 |
| 867 | Ga0316584_0015663 | 3300036712 | Bacteria | 5425 |
| 868 | Ga0316584_0020955 | 3300036712 | Bacteria | 4747 |
| 869 | Ga0316584_0099487 | 3300036712 | Bacteria | 2178 |
| 870 | Ga0316584_0107607 | 3300036712 | Bacteria | 2086 |
| 871 | Ga0316584_0185042 | 3300036712 | Bacteria | 1541 |
| 872 | Ga0373925_0002495 | 3300037068 | Bacteria | 14707 |
| 873 | Ga0373925_0011044 | 3300037068 | Bacteria | 6558 |
| 874 | Ga0373925_0034995 | 3300037068 | Bacteria | 3704 |
| 875 | Ga0395900_0124564 | 3300037418 | Bacteria | 2643 |
| 876 | Ga0395900_0263082 | 3300037418 | Bacteria | 1722 |
| 877 | Ga0395898_0198142 | 3300037466 | Bacteria | 1918 |
| 878 | Ga0395905_0002225 | 3300037471 | Bacteria | 21882 |
| 879 | Ga0395905_0034195 | 3300037471 | Bacteria | 4772 |
| 880 | Ga0395905_0103505 | 3300037471 | Bacteria | 2673 |
| 881 | Ga0400483_027531 | 3300039062 | Bacteria | 9448 |
| 882 | Ga0400483_062504 | 3300039062 | Bacteria | 2497 |
| 883 | Ga0400483_087189 | 3300039062 | Bacteria | 18271 |
| 884 | Ga0400483_247359 | 3300039062 | Bacteria | 1903 |
| 885 | Ga0436365_0014263 | 3300039437 | Bacteria | 7602 |
| 886 | Ga0436365_1360619 | 3300039437 | Bacteria | 6605 |
| 887 | Ga0451789_0749045 | 3300041443 | Bacteria | 1822 |
| 888 | Ga0451841_0881987 | 3300041498 | Bacteria | 3860 |
| 889 | Ga0439448_0001294 | 3300042005 | Bacteria | 6400 |
| 890 | Ga0439435_0000521 | 3300042436 | Bacteria | 6160 |
| 891 | Ga0451577_0000432 | 3300042876 | Bacteria | 74811 |
| 892 | Ga0451577_0001184 | 3300042876 | Bacteria | 36620 |
| 893 | Ga0451577_0003034 | 3300042876 | Bacteria | 19097 |
| 894 | Ga0451577_0010584 | 3300042876 | Bacteria | 8796 |
| 895 | Ga0451577_0031938 | 3300042876 | Bacteria | 4747 |
| 896 | Ga0451577_0047664 | 3300042876 | Bacteria | 3831 |
| 897 | Ga0451577_0066911 | 3300042876 | Bacteria | 3204 |
| 898 | Ga0451577_0316568 | 3300042876 | Bacteria | 1415 |
| 899 | Ga0453683_0002133 | 3300044673 | Bacteria | 15770 |
| 900 | Ga0453683_0004808 | 3300044673 | Bacteria | 9511 |
| 901 | Ga0453683_0020439 | 3300044673 | Bacteria | 4231 |
| 902 | Ga0453683_0123739 | 3300044673 | Bacteria | 1628 |
| 903 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 904 | Ga0453684_0000125 | 3300044712 | Bacteria | 336972 |
| 905 | Ga0453684_0004446 | 3300044712 | Bacteria | 29581 |
| 906 | Ga0453684_0020077 | 3300044712 | Bacteria | 10114 |
| 907 | Ga0453684_0023409 | 3300044712 | Bacteria | 9101 |
| 908 | Ga0453684_0054899 | 3300044712 | Bacteria | 5184 |
| 909 | Ga0453684_0185466 | 3300044712 | Bacteria | 2439 |
| 910 | Ga0453684_0198357 | 3300044712 | Bacteria | 2341 |
| 911 | Ga0453684_0307768 | 3300044712 | Bacteria | 1799 |
| 912 | Ga0466959_0046939 | 3300045049 | Bacteria | 3178 |
| 913 | Ga0451576_0002213 | 3300045051 | Bacteria | 29932 |
| 914 | Ga0451576_0002908 | 3300045051 | Bacteria | 24421 |
| 915 | Ga0451576_0003426 | 3300045051 | Bacteria | 21810 |
| 916 | Ga0451576_0004734 | 3300045051 | Bacteria | 17490 |
| 917 | Ga0451576_0015833 | 3300045051 | Bacteria | 8341 |
| 918 | Ga0451576_0020097 | 3300045051 | Bacteria | 7278 |
| 919 | Ga0451576_0034864 | 3300045051 | Bacteria | 5343 |
| 920 | Ga0451576_0088529 | 3300045051 | Bacteria | 3220 |
| 921 | Ga0451576_0143321 | 3300045051 | Bacteria | 2492 |
| 922 | Ga0451576_0163397 | 3300045051 | Bacteria | 2324 |
| 923 | Ga0451576_0221742 | 3300045051 | Bacteria | 1974 |
| 924 | Ga0495592_0049565 | 3300046454 | Bacteria | 3122 |
| 925 | Ga0495629_0089600 | 3300046459 | Bacteria | 2146 |
| 926 | Ga0495651_0000722 | 3300046462 | Bacteria | 25617 |
| 927 | Ga0495651_0010627 | 3300046462 | Bacteria | 7081 |
| 928 | Ga0495651_0072805 | 3300046462 | Bacteria | 2609 |
| 929 | Ga0495651_0152445 | 3300046462 | Bacteria | 1664 |
| 930 | Ga0495580_0040882 | 3300046472 | Bacteria | 3309 |
| 931 | Ga0495580_0061713 | 3300046472 | Bacteria | 2631 |
| 932 | Ga0495582_0011157 | 3300046473 | Bacteria | 4948 |
| 933 | Ga0495582_0018685 | 3300046473 | Bacteria | 3789 |
| 934 | Ga0495664_0051989 | 3300046477 | Bacteria | 2433 |
| 935 | Ga0495608_0029543 | 3300046511 | Bacteria | 3717 |
| 936 | Ga0495608_0036834 | 3300046511 | Bacteria | 3291 |
| 937 | Ga0495608_0038775 | 3300046511 | Bacteria | 3197 |
| 938 | Ga0495628_0151960 | 3300046516 | Bacteria | 1763 |
| 939 | Ga0495652_0013232 | 3300046529 | Bacteria | 7427 |
| 940 | Ga0495652_0050131 | 3300046529 | Bacteria | 3571 |
| 941 | Ga0495640_0089877 | 3300046533 | Bacteria | 2028 |
| 942 | Ga0495586_0007072 | 3300046535 | Bacteria | 5982 |
| 943 | Ga0495586_0024415 | 3300046535 | Bacteria | 3232 |
| 944 | Ga0495586_0062850 | 3300046535 | Bacteria | 2022 |
| 945 | Ga0495587_0015933 | 3300046536 | Bacteria | 4680 |
| 946 | Ga0495587_0017777 | 3300046536 | Bacteria | 4411 |
| 947 | Ga0495587_0078305 | 3300046536 | Bacteria | 1918 |
| 948 | Ga0495645_0001987 | 3300046543 | Bacteria | 13893 |
| 949 | Ga0495645_0029015 | 3300046543 | Bacteria | 4021 |
| 950 | Ga0495667_0013090 | 3300046559 | Bacteria | 5619 |
| 951 | Ga0495667_0043742 | 3300046559 | Bacteria | 2967 |
| 952 | Ga0495634_0005034 | 3300046642 | Bacteria | 10203 |
| 953 | Ga0495635_0037534 | 3300046663 | Bacteria | 3354 |
| 954 | Ga0495635_0074084 | 3300046663 | Bacteria | 2332 |
| 955 | Ga0495635_0104060 | 3300046663 | Bacteria | 1940 |
| 956 | Ga0495599_0014798 | 3300046678 | Bacteria | 4831 |
| 957 | Ga0495599_0106251 | 3300046678 | Bacteria | 1749 |
| 958 | Ga0495623_0008194 | 3300046679 | Bacteria | 6797 |
| 959 | Ga0495623_0034135 | 3300046679 | Bacteria | 3263 |
| 960 | Ga0495647_0035046 | 3300046681 | Bacteria | 1883 |
| 961 | Ga0495647_0040268 | 3300046681 | Bacteria | 1775 |
| 962 | Ga0495658_0063075 | 3300046683 | Bacteria | 2132 |
| 963 | Ga0495658_0148814 | 3300046683 | Bacteria | 1437 |
| 964 | Ga0495613_0006054 | 3300046689 | Bacteria | 9053 |
| 965 | Ga0495613_0015673 | 3300046689 | Bacteria | 5641 |
| 966 | Ga0495613_0105775 | 3300046689 | Bacteria | 2031 |
| 967 | Ga0495671_0028432 | 3300046692 | Bacteria | 2880 |
| 968 | Ga0495600_0050435 | 3300046809 | Bacteria | 2716 |
| 969 | Ga0495604_0062023 | 3300047317 | Bacteria | 2858 |
| 970 | Ga0495674_0252299 | 3300047319 | Bacteria | 1452 |
| 971 | Ga0495672_0000884 | 3300047320 | Bacteria | 31539 |
| 972 | Ga0495680_0002645 | 3300047322 | Bacteria | 18132 |
| 973 | Ga0495675_0007009 | 3300047444 | Bacteria | 6931 |
| 974 | Ga0495675_0023426 | 3300047444 | Bacteria | 3934 |
| 975 | Ga0495684_0006680 | 3300047471 | Bacteria | 8950 |
| 976 | Ga0495602_0047025 | 3300048088 | Bacteria | 3892 |
| 977 | Ga0495602_0124844 | 3300048088 | Bacteria | 2064 |
| 978 | Ga0495602_0127850 | 3300048088 | Bacteria | 2032 |
| 979 | Ga0496100_0020618 | 3300048903 | Bacteria | 3955 |
| 980 | Ga0496100_0031780 | 3300048903 | Bacteria | 3285 |
| 981 | Ga0496101_0012795 | 3300048904 | Bacteria | 5611 |
| 982 | Ga0496101_0201870 | 3300048904 | Bacteria | 1537 |
| 983 | Ga0496102_0006170 | 3300048905 | Bacteria | 10220 |
| 984 | Ga0496102_0039428 | 3300048905 | Bacteria | 4269 |
| 985 | Ga0496102_0041715 | 3300048905 | Bacteria | 4157 |
| 986 | Ga0496102_0140597 | 3300048905 | Bacteria | 2263 |
| 987 | Ga0496102_0190131 | 3300048905 | Bacteria | 1934 |
| 988 | Ga0496102_0319306 | 3300048905 | Bacteria | 1463 |
| 989 | Ga0496103_0028460 | 3300048906 | Bacteria | 3391 |
| 990 | Ga0496103_0073999 | 3300048906 | Bacteria | 2135 |
| 991 | Ga0496104_0008382 | 3300048907 | Bacteria | 9187 |
| 992 | Ga0496104_0012867 | 3300048907 | Bacteria | 7537 |
| 993 | Ga0496104_0021107 | 3300048907 | Bacteria | 5975 |
| 994 | Ga0496104_0036823 | 3300048907 | Bacteria | 4575 |
| 995 | Ga0496104_0089303 | 3300048907 | Bacteria | 2944 |
| 996 | Ga0496104_0155895 | 3300048907 | Bacteria | 2191 |
| 997 | Ga0496104_0204917 | 3300048907 | Bacteria | 1884 |
| 998 | Ga0496104_0284936 | 3300048907 | Bacteria | 1565 |
| 999 | Ga0496105_0003890 | 3300048908 | Bacteria | 11161 |
| 1000 | Ga0496105_0008678 | 3300048908 | Bacteria | 7905 |
| 1001 | Ga0496105_0057782 | 3300048908 | Bacteria | 3203 |
| 1002 | Ga0496105_0161002 | 3300048908 | Bacteria | 1842 |
| 1003 | Ga0496106_0011745 | 3300048909 | Bacteria | 6466 |
| 1004 | Ga0496106_0062862 | 3300048909 | Bacteria | 2820 |
| 1005 | Ga0496106_0079266 | 3300048909 | Bacteria | 2521 |
| 1006 | Ga0496107_0032857 | 3300048910 | Bacteria | 3710 |
| 1007 | Ga0496107_0049592 | 3300048910 | Bacteria | 3025 |
| 1008 | Ga0496108_0004718 | 3300048911 | Bacteria | 10992 |
| 1009 | Ga0496108_0009710 | 3300048911 | Bacteria | 7799 |
| 1010 | Ga0496108_0012603 | 3300048911 | Bacteria | 6887 |
| 1011 | Ga0496109_0011522 | 3300048912 | Bacteria | 7607 |
| 1012 | Ga0496109_0016429 | 3300048912 | Bacteria | 6471 |
| 1013 | Ga0496109_0124563 | 3300048912 | Bacteria | 2402 |
| 1014 | Ga0496109_0216975 | 3300048912 | Bacteria | 1799 |
| 1015 | Ga0496110_0004405 | 3300048913 | Bacteria | 10906 |
| 1016 | Ga0496110_0013314 | 3300048913 | Bacteria | 6796 |
| 1017 | Ga0496110_0020051 | 3300048913 | Bacteria | 5638 |
| 1018 | Ga0496110_0043809 | 3300048913 | Bacteria | 3907 |
| 1019 | Ga0496110_0091193 | 3300048913 | Bacteria | 2726 |
| 1020 | Ga0496111_0002300 | 3300048914 | Bacteria | 11484 |
| 1021 | Ga0496111_0044808 | 3300048914 | Bacteria | 3180 |
| 1022 | Ga0496111_0123041 | 3300048914 | Bacteria | 1917 |
| 1023 | Ga0496111_0158682 | 3300048914 | Bacteria | 1679 |
| 1024 | Ga0496111_0164530 | 3300048914 | Bacteria | 1647 |
| 1025 | Ga0496112_0006868 | 3300048915 | Bacteria | 10035 |
| 1026 | Ga0496113_0013847 | 3300048916 | Bacteria | 5481 |
| 1027 | Ga0496114_0003419 | 3300048917 | Bacteria | 12184 |
| 1028 | Ga0496114_0014551 | 3300048917 | Bacteria | 6320 |
| 1029 | Ga0496114_0049805 | 3300048917 | Bacteria | 3486 |
| 1030 | Ga0496114_0059806 | 3300048917 | Bacteria | 3183 |
| 1031 | Ga0496114_0106117 | 3300048917 | Bacteria | 2403 |
| 1032 | Ga0496114_0126518 | 3300048917 | Bacteria | 2203 |
| 1033 | Ga0496114_0134711 | 3300048917 | Bacteria | 2136 |
| 1034 | Ga0496115_0025365 | 3300048918 | Bacteria | 4615 |
| 1035 | Ga0496116_0013525 | 3300048919 | Bacteria | 6571 |
| 1036 | Ga0496117_0000135 | 3300048920 | Bacteria | 160708 |
| 1037 | Ga0496118_0000098 | 3300048921 | Bacteria | 160610 |
| 1038 | Ga0496119_0008284 | 3300048922 | Bacteria | 9172 |
| 1039 | Ga0496121_0001675 | 3300048924 | Bacteria | 36420 |
| 1040 | Ga0496126_0020593 | 3300048929 | Bacteria | 6459 |
| 1041 | Ga0501031_0001007 | 3300049568 | Bacteria | 17096 |
| 1042 | Ga0501031_0020481 | 3300049568 | Bacteria | 4312 |
| 1043 | Ga0501031_0027058 | 3300049568 | Bacteria | 3738 |
| 1044 | Ga0501031_0132974 | 3300049568 | Bacteria | 1625 |
| 1045 | Ga0501032_0000167 | 3300049569 | Bacteria | 53430 |
| 1046 | Ga0501032_0007868 | 3300049569 | Bacteria | 7767 |
| 1047 | Ga0501032_0009061 | 3300049569 | Bacteria | 7227 |
| 1048 | Ga0501032_0091514 | 3300049569 | Bacteria | 2018 |
| 1049 | Ga0501033_0000280 | 3300049570 | Bacteria | 49197 |
| 1050 | Ga0501033_0003099 | 3300049570 | Bacteria | 13806 |
| 1051 | Ga0501033_0003516 | 3300049570 | Bacteria | 12828 |
| 1052 | Ga0501033_0004862 | 3300049570 | Bacteria | 10705 |
| 1053 | Ga0501034_0013851 | 3300049571 | Bacteria | 8300 |
| 1054 | Ga0501034_0016867 | 3300049571 | Bacteria | 7489 |
| 1055 | Ga0501034_0019794 | 3300049571 | Bacteria | 6879 |
| 1056 | Ga0501034_0088872 | 3300049571 | Bacteria | 3087 |
| 1057 | Ga0501034_0214528 | 3300049571 | Bacteria | 1879 |
| 1058 | Ga0501036_0021687 | 3300049572 | Bacteria | 5400 |
| 1059 | Ga0501036_0030085 | 3300049572 | Bacteria | 4587 |
| 1060 | Ga0501036_0047473 | 3300049572 | Bacteria | 3636 |
| 1061 | Ga0501036_0055259 | 3300049572 | Bacteria | 3363 |
| 1062 | Ga0501036_0100510 | 3300049572 | Bacteria | 2446 |
| 1063 | Ga0501036_0183116 | 3300049572 | Bacteria | 1763 |
| 1064 | Ga0501037_0002482 | 3300049573 | Bacteria | 13320 |
| 1065 | Ga0501037_0011560 | 3300049573 | Bacteria | 6497 |
| 1066 | Ga0501037_0047369 | 3300049573 | Bacteria | 3150 |
| 1067 | Ga0501037_0094697 | 3300049573 | Bacteria | 2159 |
| 1068 | Ga0501037_0095100 | 3300049573 | Bacteria | 2154 |
| 1069 | Ga0501038_0000229 | 3300049574 | Bacteria | 47553 |
| 1070 | Ga0501038_0004863 | 3300049574 | Bacteria | 12478 |
| 1071 | Ga0501038_0006453 | 3300049574 | Bacteria | 10857 |
| 1072 | Ga0501038_0014688 | 3300049574 | Bacteria | 7134 |
| 1073 | Ga0501038_0018426 | 3300049574 | Bacteria | 6303 |
| 1074 | Ga0501038_0022765 | 3300049574 | Bacteria | 5609 |
| 1075 | Ga0501038_0039828 | 3300049574 | Bacteria | 4110 |
| 1076 | Ga0501038_0083590 | 3300049574 | Bacteria | 2687 |
| 1077 | Ga0501039_0000387 | 3300049575 | Bacteria | 31653 |
| 1078 | Ga0501039_0003397 | 3300049575 | Bacteria | 11900 |
| 1079 | Ga0501039_0017945 | 3300049575 | Bacteria | 5427 |
| 1080 | Ga0501039_0021496 | 3300049575 | Bacteria | 4949 |
| 1081 | Ga0501039_0031047 | 3300049575 | Bacteria | 4118 |
| 1082 | Ga0501039_0034279 | 3300049575 | Bacteria | 3918 |
| 1083 | Ga0501039_0098495 | 3300049575 | Bacteria | 2281 |
| 1084 | Ga0501039_0143569 | 3300049575 | Bacteria | 1875 |
| 1085 | Ga0501040_0002042 | 3300049576 | Bacteria | 12996 |
| 1086 | Ga0501040_0019445 | 3300049576 | Bacteria | 4517 |
| 1087 | Ga0501040_0034984 | 3300049576 | Bacteria | 3404 |
| 1088 | Ga0501041_0003026 | 3300049577 | Bacteria | 9634 |
| 1089 | Ga0501041_0018700 | 3300049577 | Bacteria | 4127 |
| 1090 | Ga0501041_0036575 | 3300049577 | Bacteria | 2974 |
| 1091 | Ga0501041_0042345 | 3300049577 | Bacteria | 2767 |
| 1092 | Ga0501042_0002284 | 3300049578 | Bacteria | 11707 |
| 1093 | Ga0501042_0007841 | 3300049578 | Bacteria | 7020 |
| 1094 | Ga0501042_0022259 | 3300049578 | Bacteria | 4428 |
| 1095 | Ga0501043_0000738 | 3300049579 | Bacteria | 28995 |
| 1096 | Ga0501043_0008870 | 3300049579 | Bacteria | 7913 |
| 1097 | Ga0501043_0022536 | 3300049579 | Bacteria | 4938 |
| 1098 | Ga0501043_0030827 | 3300049579 | Bacteria | 4216 |
| 1099 | Ga0501043_0032621 | 3300049579 | Bacteria | 4095 |
| 1100 | Ga0501043_0039334 | 3300049579 | Bacteria | 3717 |
| 1101 | Ga0501046_0000422 | 3300049580 | Bacteria | 42250 |
| 1102 | Ga0501046_0030946 | 3300049580 | Bacteria | 4343 |
| 1103 | Ga0501046_0051650 | 3300049580 | Bacteria | 3243 |
| 1104 | Ga0501047_0002404 | 3300049581 | Bacteria | 17888 |
| 1105 | Ga0501047_0031282 | 3300049581 | Bacteria | 5133 |
| 1106 | Ga0501048_0002435 | 3300049582 | Bacteria | 14205 |
| 1107 | Ga0501048_0018650 | 3300049582 | Bacteria | 5102 |
| 1108 | Ga0501048_0025182 | 3300049582 | Bacteria | 4336 |
| 1109 | Ga0501068_0000685 | 3300049584 | Bacteria | 17325 |
| 1110 | Ga0501068_0004213 | 3300049584 | Bacteria | 7802 |
| 1111 | Ga0501068_0019950 | 3300049584 | Bacteria | 3901 |
| 1112 | Ga0501068_0022839 | 3300049584 | Bacteria | 3662 |
| 1113 | Ga0501068_0052074 | 3300049584 | Bacteria | 2477 |
| 1114 | Ga0501069_0000183 | 3300049585 | Bacteria | 28405 |
| 1115 | Ga0501069_0003234 | 3300049585 | Bacteria | 8355 |
| 1116 | Ga0501070_0002006 | 3300049586 | Bacteria | 17889 |
| 1117 | Ga0501070_0003803 | 3300049586 | Bacteria | 13032 |
| 1118 | Ga0501070_0015028 | 3300049586 | Bacteria | 6513 |
| 1119 | Ga0501070_0048941 | 3300049586 | Bacteria | 3510 |
| 1120 | Ga0501071_0024392 | 3300049587 | Bacteria | 4231 |
| 1121 | Ga0501071_0025266 | 3300049587 | Bacteria | 4160 |
| 1122 | Ga0501071_0042309 | 3300049587 | Bacteria | 3263 |
| 1123 | Ga0501071_0078808 | 3300049587 | Bacteria | 2408 |
| 1124 | Ga0501071_0091180 | 3300049587 | Bacteria | 2239 |
| 1125 | Ga0501072_0000929 | 3300049588 | Bacteria | 21565 |
| 1126 | Ga0501072_0002538 | 3300049588 | Bacteria | 13679 |
| 1127 | Ga0501072_0058627 | 3300049588 | Bacteria | 3034 |
| 1128 | Ga0501073_0002721 | 3300049589 | Bacteria | 13247 |
| 1129 | Ga0501073_0007592 | 3300049589 | Bacteria | 8056 |
| 1130 | Ga0501073_0032687 | 3300049589 | Bacteria | 3709 |
| 1131 | Ga0501074_0031348 | 3300049590 | Bacteria | 3852 |
| 1132 | Ga0501075_0005663 | 3300049591 | Bacteria | 8550 |
| 1133 | Ga0501075_0047166 | 3300049591 | Bacteria | 3238 |
| 1134 | Ga0501075_0054505 | 3300049591 | Bacteria | 3008 |
| 1135 | Ga0501075_0064465 | 3300049591 | Bacteria | 2763 |
| 1136 | Ga0501075_0113840 | 3300049591 | Bacteria | 2057 |
| 1137 | Ga0501076_0011604 | 3300049592 | Bacteria | 6573 |
| 1138 | Ga0501076_0014118 | 3300049592 | Bacteria | 6006 |
| 1139 | Ga0501076_0044681 | 3300049592 | Bacteria | 3494 |
| 1140 | Ga0501076_0052624 | 3300049592 | Bacteria | 3225 |
| 1141 | Ga0501076_0057659 | 3300049592 | Bacteria | 3084 |
| 1142 | Ga0501077_0044738 | 3300049593 | Bacteria | 2811 |
| 1143 | Ga0501077_0110198 | 3300049593 | Bacteria | 1744 |
| 1144 | Ga0501079_0002260 | 3300049741 | Bacteria | 13896 |
| 1145 | Ga0501079_0038750 | 3300049741 | Bacteria | 3675 |
| 1146 | Ga0501079_0096369 | 3300049741 | Bacteria | 2293 |
| 1147 | Ga0501079_0135481 | 3300049741 | Bacteria | 1917 |
| 1148 | Ga0501080_0009843 | 3300049742 | Bacteria | 8736 |
| 1149 | Ga0501080_0023075 | 3300049742 | Bacteria | 5769 |
| 1150 | Ga0501080_0023133 | 3300049742 | Bacteria | 5762 |
| 1151 | Ga0501080_0048979 | 3300049742 | Bacteria | 3932 |
| 1152 | Ga0501080_0051833 | 3300049742 | Bacteria | 3820 |
| 1153 | Ga0501080_0059272 | 3300049742 | Bacteria | 3563 |
| 1154 | Ga0501081_0001591 | 3300049743 | Bacteria | 14001 |
| 1155 | Ga0501081_0104392 | 3300049743 | Bacteria | 2006 |
| 1156 | Ga0501083_0011631 | 3300049744 | Bacteria | 6176 |
| 1157 | Ga0501035_0002589 | 3300049822 | Bacteria | 17661 |
| 1158 | Ga0501035_0007297 | 3300049822 | Bacteria | 10341 |
| 1159 | Ga0501035_0054086 | 3300049822 | Bacteria | 3588 |
| 1160 | Ga0501035_0073114 | 3300049822 | Bacteria | 3033 |
| 1161 | Ga0501044_0000323 | 3300049823 | Bacteria | 60420 |
| 1162 | Ga0501044_0000514 | 3300049823 | Bacteria | 47072 |
| 1163 | Ga0501044_0002434 | 3300049823 | Bacteria | 21234 |
| 1164 | Ga0501044_0006808 | 3300049823 | Bacteria | 12594 |
| 1165 | Ga0501044_0007920 | 3300049823 | Bacteria | 11680 |
| 1166 | Ga0501044_0030465 | 3300049823 | Bacteria | 5686 |
| 1167 | Ga0501045_0000237 | 3300049824 | Bacteria | 32030 |
| 1168 | Ga0501045_0007689 | 3300049824 | Bacteria | 7496 |
| 1169 | Ga0501045_0010042 | 3300049824 | Bacteria | 6622 |
| 1170 | Ga0501045_0047829 | 3300049824 | Bacteria | 3116 |
| 1171 | nmdc:mga05p37_141138_c1 | 3300050507 | Bacteria | 2952 |
| 1172 | nmdc:mga05p37_15817_c1 | 3300050507 | Bacteria | 9074 |
| 1173 | nmdc:mga05p37_169669_c2 | 3300050507 | Bacteria | 1693 |
| 1174 | nmdc:mga05p37_171815_c1 | 3300050507 | Bacteria | 2643 |
| 1175 | nmdc:mga05p37_68180_c1 | 3300050507 | Bacteria | 4375 |
| 1176 | nmdc:mga05p37_94311_c1 | 3300050507 | Bacteria | 3688 |
| 1177 | nmdc:mga09592_116856_c1 | 3300050508 | Bacteria | 2289 |
| 1178 | nmdc:mga09592_49229_c1 | 3300050508 | Bacteria | 2796 |
| 1179 | nmdc:mga09592_796_c1 | 3300050508 | Bacteria | 24402 |
| 1180 | nmdc:mga0qj67_39487_c1 | 3300050509 | Bacteria | 3707 |
| 1181 | nmdc:mga0qj67_6216_c1 | 3300050509 | Bacteria | 8767 |
| 1182 | nmdc:mga06r32_104142_c1 | 3300050510 | Bacteria | 2787 |
| 1183 | nmdc:mga06r32_119442_c1 | 3300050510 | Bacteria | 2599 |
| 1184 | nmdc:mga06r32_54924_c1 | 3300050510 | Bacteria | 3820 |
| 1185 | nmdc:mga06r32_56427_c1 | 3300050510 | Bacteria | 3770 |
| 1186 | nmdc:mga06r32_66005_c1 | 3300050510 | Bacteria | 3492 |
| 1187 | nmdc:mga06r32_810_c1 | 3300050510 | Bacteria | 27781 |
| 1188 | nmdc:mga08y16_13968_c1 | 3300050511 | Bacteria | 8453 |
| 1189 | nmdc:mga08y16_160883_c1 | 3300050511 | Bacteria | 2333 |
| 1190 | nmdc:mga08y16_18798_c1 | 3300050511 | Bacteria | 7281 |
| 1191 | nmdc:mga08y16_19888_c1 | 3300050511 | Bacteria | 7082 |
| 1192 | nmdc:mga08y16_57007_c1 | 3300050511 | Bacteria | 4083 |
| 1193 | nmdc:mga0n895_68039_c1 | 3300050512 | Bacteria | 3528 |
| 1194 | nmdc:mga08x19_106227_c1 | 3300050514 | Bacteria | 1868 |
| 1195 | nmdc:mga08x19_13893_c1 | 3300050514 | Bacteria | 4876 |
| 1196 | nmdc:mga08x19_24216_c1 | 3300050514 | Bacteria | 3770 |
| 1197 | nmdc:mga0a205_107256_c1 | 3300050515 | Bacteria | 2691 |
| 1198 | nmdc:mga0a205_131124_c1 | 3300050515 | Bacteria | 2407 |
| 1199 | Ga0495601_0064162 | 3300053077 | Bacteria | 2335 |
| 1200 | Ga0495595_0008665 | 3300053084 | Bacteria | 4184 |
| 1201 | Ga0495619_0017931 | 3300053085 | Bacteria | 4488 |
| 1202 | Ga0495619_0018671 | 3300053085 | Bacteria | 4401 |
| 1203 | Ga0495619_0028954 | 3300053085 | Bacteria | 3575 |
| 1204 | Ga0495619_0033006 | 3300053085 | Bacteria | 3361 |
| 1205 | Ga0495619_0035380 | 3300053085 | Bacteria | 3248 |
| 1206 | Ga0495619_0097620 | 3300053085 | Bacteria | 1996 |
| 1207 | Ga0500566_0040501 | 3300053094 | Bacteria | 2693 |
| 1208 | Ga0500607_030326 | 3300053121 | Bacteria | 2982 |
| 1209 | Ga0500568_0000135 | 3300053139 | Bacteria | 66519 |
| 1210 | Ga0500616_0000755 | 3300053153 | Bacteria | 37233 |
| 1211 | Ga0500636_0000213 | 3300053177 | Bacteria | 31500 |
| 1212 | Ga0500637_0006937 | 3300053178 | Bacteria | 5630 |
| 1213 | Ga0501084_0009817 | 3300054114 | Bacteria | 7912 |
| 1214 | Ga0501084_0031430 | 3300054114 | Bacteria | 4438 |
| 1215 | Ga0501084_0034157 | 3300054114 | Bacteria | 4252 |
| 1216 | Ga0501082_0006386 | 3300060353 | Bacteria | 10228 |
| 1217 | Ga0501082_0026658 | 3300060353 | Bacteria | 4982 |
| 1218 | Ga0501082_0038447 | 3300060353 | Bacteria | 4129 |
| 1219 | Ga0501082_0098736 | 3300060353 | Bacteria | 2525 |
| 1220 | Ga0501082_0100821 | 3300060353 | Bacteria | 2497 |
| 1221 | Ga0530510_0009754 | 3300061734 | Bacteria | 6738 |
| 1222 | Ga0530510_0012839 | 3300061734 | Bacteria | 5888 |
| 1223 | Ga0530510_0077492 | 3300061734 | Bacteria | 2416 |
| 1224 | Ga0530510_0167361 | 3300061734 | Bacteria | 1628 |
| 1225 | 2739612495 | 2739367655 | Bacteria | 4051151 |
| 1226 | 2867308048 | 2867302475 | Bacteria | 7087181 |
| 1227 | 2867318489 | 2867312974 | Bacteria | 7058875 |
| 1228 | 2867320473 | 2867319477 | Bacteria | 7069771 |
| 1229 | 2881928623 | 2881927736 | Bacteria | 3993927 |
| 1230 | 2887378819 | 2887375801 | Bacteria | 5334027 |
| 1231 | Ga0157370_10009888 | |||
| 1232 | Ga0065704_10001221 | |||
| 1233 | Ga0065715_10138400 | |||
| 1234 | Ga0065707_10001278 | |||
| 1235 | Ga0065707_10089312 | |||
| 1236 | Ga0070658_10000686 | |||
| 1237 | Ga0070658_10026401 | |||
| 1238 | Ga0070676_10000222 | |||
| 1239 | Ga0070683_100000521 | |||
| 1240 | Ga0070683_100008243 | |||
| 1241 | Ga0070683_100010563 | |||
| 1242 | Ga0070683_100011682 | |||
| 1243 | Ga0070683_100069587 | |||
| 1244 | Ga0070683_100090408 | |||
| 1245 | Ga0070683_100196614 | |||
| 1246 | Ga0070683_100204062 | |||
| 1247 | Ga0070690_100002441 | |||
| 1248 | Ga0070670_100025475 | |||
| 1249 | Ga0070670_100026422 | |||
| 1250 | Ga0070670_100171873 | |||
| 1251 | Ga0070677_10006494 | |||
| 1252 | Ga0070677_10006951 | |||
| 1253 | Ga0068869_100003200 | |||
| 1254 | Ga0068869_100131544 | |||
| 1255 | Ga0068869_100163662 | |||
| 1256 | Ga0070666_10002423 | |||
| 1257 | Ga0070666_10003483 | |||
| 1258 | Ga0070666_10064334 | |||
| 1259 | Ga0070666_10106295 | |||
| 1260 | Ga0070680_100000496 | |||
| 1261 | Ga0070680_100000686 | |||
| 1262 | Ga0070680_100010122 | |||
| 1263 | Ga0070680_100022885 | |||
| 1264 | Ga0070680_100024504 | |||
| 1265 | Ga0070680_100118172 | |||
| 1266 | Ga0070680_100151246 | |||
| 1267 | Ga0070680_100166874 | |||
| 1268 | Ga0070680_100179283 | |||
| 1269 | Ga0070682_100000296 | |||
| 1270 | Ga0070682_100001443 | |||
| 1271 | Ga0070682_100003005 | |||
| 1272 | Ga0070682_100004882 | |||
| 1273 | Ga0070682_100013676 | |||
| 1274 | Ga0070682_100024788 | |||
| 1275 | Ga0068868_100000767 | |||
| 1276 | Ga0068868_100004781 | |||
| 1277 | Ga0068868_100033664 | |||
| 1278 | Ga0068868_100043729 | |||
| 1279 | Ga0070660_100001492 | |||
| 1280 | Ga0070660_100002914 | |||
| 1281 | Ga0070660_100036561 | |||
| 1282 | Ga0070660_100062257 | |||
| 1283 | Ga0070689_100101089 | |||
| 1284 | Ga0070689_100147503 | |||
| 1285 | Ga0070691_10028911 | |||
| 1286 | Ga0070661_100000821 | |||
| 1287 | Ga0070661_100007462 | |||
| 1288 | Ga0070661_100043507 | |||
| 1289 | Ga0070692_10001608 | |||
| 1290 | Ga0070692_10024877 | |||
| 1291 | Ga0070668_100007558 | |||
| 1292 | Ga0070669_100088488 | |||
| 1293 | Ga0070669_100109796 | |||
| 1294 | Ga0070675_100000244 | |||
| 1295 | Ga0070675_100029173 | |||
| 1296 | Ga0070675_100070567 | |||
| 1297 | Ga0070675_100088190 | |||
| 1298 | Ga0070675_100115349 | |||
| 1299 | Ga0070671_100239064 | |||
| 1300 | Ga0070674_100001066 | |||
| 1301 | Ga0070674_100053015 | |||
| 1302 | Ga0070673_100001348 | |||
| 1303 | Ga0070673_100001792 | |||
| 1304 | Ga0070673_100002263 | |||
| 1305 | Ga0070673_100075542 | |||
| 1306 | Ga0070688_100016856 | |||
| 1307 | Ga0070659_100003371 | |||
| 1308 | Ga0070659_100004685 | |||
| 1309 | Ga0070659_100013498 | |||
| 1310 | Ga0070659_100037536 | |||
| 1311 | Ga0070659_100050095 | |||
| 1312 | Ga0070667_100005756 | |||
| 1313 | Ga0070667_100011925 | |||
| 1314 | Ga0070667_100014768 | |||
| 1315 | Ga0070703_10007873 | |||
| 1316 | Ga0070703_10010267 | |||
| 1317 | Ga0070709_10022408 | |||
| 1318 | Ga0070709_10086595 | |||
| 1319 | Ga0070714_100002263 | |||
| 1320 | Ga0070714_100005415 | |||
| 1321 | Ga0070714_100057642 | |||
| 1322 | Ga0070714_100090177 | |||
| 1323 | Ga0070713_100000636 | |||
| 1324 | Ga0070713_100202956 | |||
| 1325 | Ga0070713_100219357 | |||
| 1326 | Ga0070711_100013432 | |||
| 1327 | Ga0070705_100075217 | |||
| 1328 | Ga0070705_100111864 | |||
| 1329 | Ga0070700_100026443 | |||
| 1330 | Ga0070700_100113221 | |||
| 1331 | Ga0070694_100065637 | |||
| 1332 | Ga0070708_100001524 | |||
| 1333 | Ga0070708_100076151 | |||
| 1334 | Ga0070663_100002959 | |||
| 1335 | Ga0070663_100003859 | |||
| 1336 | Ga0070663_100010068 | |||
| 1337 | Ga0070663_100024000 | |||
| 1338 | Ga0070663_100058024 | |||
| 1339 | Ga0070678_100025037 | |||
| 1340 | Ga0070678_100200531 | |||
| 1341 | Ga0070678_100201720 | |||
| 1342 | Ga0070662_100001044 | |||
| 1343 | Ga0070662_100002448 | |||
| 1344 | Ga0070662_100054166 | |||
| 1345 | Ga0070681_10000034 | |||
| 1346 | Ga0070681_10000474 | |||
| 1347 | Ga0070681_10011914 | |||
| 1348 | Ga0070681_10032224 | |||
| 1349 | Ga0070681_10037614 | |||
| 1350 | Ga0070681_10038380 | |||
| 1351 | Ga0070681_10074934 | |||
| 1352 | Ga0068867_100019381 | |||
| 1353 | Ga0070685_10036870 | |||
| 1354 | Ga0070706_100000575 | |||
| 1355 | Ga0070706_100025719 | |||
| 1356 | Ga0070706_100043908 | |||
| 1357 | Ga0070706_100049705 | |||
| 1358 | Ga0070707_100000941 | |||
| 1359 | Ga0070707_100011349 | |||
| 1360 | Ga0070707_100042195 | |||
| 1361 | Ga0070707_100131183 | |||
| 1362 | Ga0070698_100003318 | |||
| 1363 | Ga0070698_100004458 | |||
| 1364 | Ga0070698_100007700 | |||
| 1365 | Ga0070698_100012588 | |||
| 1366 | Ga0070698_100028967 | |||
| 1367 | Ga0070698_100049362 | |||
| 1368 | Ga0070698_100064599 | |||
| 1369 | Ga0070698_100156054 | |||
| 1370 | Ga0070699_100006715 | |||
| 1371 | Ga0070699_100012835 | |||
| 1372 | Ga0070699_100027460 | |||
| 1373 | Ga0070699_100046228 | |||
| 1374 | Ga0070699_100069353 | |||
| 1375 | Ga0070679_100000306 | |||
| 1376 | Ga0070679_100005633 | |||
| 1377 | Ga0070679_100005977 | |||
| 1378 | Ga0070679_100023633 | |||
| 1379 | Ga0070679_100076045 | |||
| 1380 | Ga0070684_100019471 | |||
| 1381 | Ga0070684_100032777 | |||
| 1382 | Ga0070684_100034894 | |||
| 1383 | Ga0070684_100049092 | |||
| 1384 | Ga0070684_100057368 | |||
| 1385 | Ga0070697_100000035 | |||
| 1386 | Ga0070697_100000615 | |||
| 1387 | Ga0070697_100001536 | |||
| 1388 | Ga0068853_100001751 | |||
| 1389 | Ga0068853_100003044 | |||
| 1390 | Ga0068853_100005315 | |||
| 1391 | Ga0068853_100013122 | |||
| 1392 | Ga0068853_100021876 | |||
| 1393 | Ga0068853_100053753 | |||
| 1394 | Ga0068853_100172702 | |||
| 1395 | Ga0070672_100007027 | |||
| 1396 | Ga0070672_100021529 | |||
| 1397 | Ga0070672_100084431 | |||
| 1398 | Ga0070695_100008686 | |||
| 1399 | Ga0070695_100016709 | |||
| 1400 | Ga0070695_100049952 | |||
| 1401 | Ga0070695_100150161 | |||
| 1402 | Ga0070696_100000572 | |||
| 1403 | Ga0070696_100047299 | |||
| 1404 | Ga0070696_100048428 | |||
| 1405 | Ga0070696_100114822 | |||
| 1406 | Ga0070693_100004401 | |||
| 1407 | Ga0070693_100007600 | |||
| 1408 | Ga0070665_100098564 | |||
| 1409 | Ga0070704_100039599 | |||
| 1410 | Ga0070704_100076603 | |||
| 1411 | Ga0070704_100094741 | |||
| 1412 | Ga0070704_100132781 | |||
| 1413 | Ga0070704_100193024 | |||
| 1414 | Ga0068855_100000414 | |||
| 1415 | Ga0068855_100000524 | |||
| 1416 | Ga0068855_100001570 | |||
| 1417 | Ga0068855_100008049 | |||
| 1418 | Ga0068855_100008840 | |||
| 1419 | Ga0068855_100011678 | |||
| 1420 | Ga0068855_100018543 | |||
| 1421 | Ga0068855_100035782 | |||
| 1422 | Ga0068855_100036290 | |||
| 1423 | Ga0068855_100069903 | |||
| 1424 | Ga0068855_100092972 | |||
| 1425 | Ga0068855_100136018 | |||
| 1426 | Ga0068855_100286065 | |||
| 1427 | Ga0070664_100000926 | |||
| 1428 | Ga0070664_100010549 | |||
| 1429 | Ga0070664_100010623 | |||
| 1430 | Ga0070664_100062403 | |||
| 1431 | Ga0070664_100132074 | |||
| 1432 | Ga0068857_100004956 | |||
| 1433 | Ga0068857_100006775 | |||
| 1434 | Ga0068857_100017777 | |||
| 1435 | Ga0068857_100059647 | |||
| 1436 | Ga0068857_100073627 | |||
| 1437 | Ga0068857_100114259 | |||
| 1438 | Ga0068854_100046701 | |||
| 1439 | Ga0068854_100207746 | |||
| 1440 | Ga0068856_100000571 | |||
| 1441 | Ga0068856_100001211 | |||
| 1442 | Ga0068856_100001271 | |||
| 1443 | Ga0068856_100007241 | |||
| 1444 | Ga0068856_100009546 | |||
| 1445 | Ga0068856_100013497 | |||
| 1446 | Ga0068856_100024977 | |||
| 1447 | Ga0068856_100025118 | |||
| 1448 | Ga0068856_100027978 | |||
| 1449 | Ga0068856_100069148 | |||
| 1450 | Ga0068856_100095306 | |||
| 1451 | Ga0068856_100140924 | |||
| 1452 | Ga0068856_100186585 | |||
| 1453 | Ga0068856_100206789 | |||
| 1454 | Ga0068856_100255173 | |||
| 1455 | Ga0070702_100004836 | |||
| 1456 | Ga0070702_100068152 | |||
| 1457 | Ga0068852_100000985 | |||
| 1458 | Ga0068852_100005765 | |||
| 1459 | Ga0068852_100006358 | |||
| 1460 | Ga0068852_100011845 | |||
| 1461 | Ga0068852_100015898 | |||
| 1462 | Ga0068852_100234861 | |||
| 1463 | Ga0068852_100276338 | |||
| 1464 | Ga0068859_100001284 | |||
| 1465 | Ga0068859_100020671 | |||
| 1466 | Ga0068859_100038265 | |||
| 1467 | Ga0068859_100199444 | |||
| 1468 | Ga0068864_100000562 | |||
| 1469 | Ga0068864_100001544 | |||
| 1470 | Ga0068864_100004937 | |||
| 1471 | Ga0068864_100011579 | |||
| 1472 | Ga0068864_100018864 | |||
| 1473 | Ga0068864_100205090 | |||
| 1474 | Ga0068861_100002237 | |||
| 1475 | Ga0068861_100043468 | |||
| 1476 | Ga0068851_10002556 | |||
| 1477 | Ga0068851_10060525 | |||
| 1478 | Ga0068870_10008382 | |||
| 1479 | Ga0068870_10008421 | |||
| 1480 | Ga0068863_100003319 | |||
| 1481 | Ga0068863_100016850 | |||
| 1482 | Ga0068863_100214920 | |||
| 1483 | Ga0068858_100002537 | |||
| 1484 | Ga0068858_100006133 | |||
| 1485 | Ga0068858_100007409 | |||
| 1486 | Ga0068858_100008448 | |||
| 1487 | Ga0068858_100008547 | |||
| 1488 | Ga0068858_100021186 | |||
| 1489 | Ga0068858_100024779 | |||
| 1490 | Ga0068858_100150868 | |||
| 1491 | Ga0068860_100003123 | |||
| 1492 | Ga0068860_100027132 | |||
| 1493 | Ga0068860_100081559 | |||
| 1494 | Ga0068862_100012089 | |||
| 1495 | Ga0068862_100185322 | |||
| 1496 | Ga0081455_10028093 | |||
| 1497 | Ga0081538_10023149 | |||
| 1498 | Ga0081538_10044307 | |||
| 1499 | Ga0081538_10048901 | |||
| 1500 | Ga0070712_100013761 | |||
| 1501 | Ga0070712_100028518 | |||
| 1502 | Ga0070712_100162508 | |||
| 1503 | Ga0097621_100000014 | |||
| 1504 | Ga0097621_100000229 | |||
| 1505 | Ga0097621_100049235 | |||
| 1506 | Ga0097621_100050317 | |||
| 1507 | Ga0068871_100000071 | |||
| 1508 | Ga0068871_100000166 | |||
| 1509 | Ga0068871_100006021 | |||
| 1510 | Ga0068871_100008001 | |||
| 1511 | Ga0068871_100015338 | |||
| 1512 | Ga0068871_100030342 | |||
| 1513 | Ga0068871_100122260 | |||
| 1514 | Ga0068871_100127503 | |||
| 1515 | Ga0068871_100143145 | |||
| 1516 | Ga0075428_100005703 | |||
| 1517 | Ga0075428_100016232 | |||
| 1518 | Ga0075428_100026272 | |||
| 1519 | Ga0075428_100062098 | |||
| 1520 | Ga0075430_100031785 | |||
| 1521 | Ga0075430_100129312 | |||
| 1522 | Ga0075431_100000972 | |||
| 1523 | Ga0075431_100005121 | |||
| 1524 | Ga0075431_100057536 | |||
| 1525 | Ga0075431_100133637 | |||
| 1526 | Ga0075431_100166202 | |||
| 1527 | Ga0075433_10049220 | |||
| 1528 | Ga0075433_10052747 | |||
| 1529 | Ga0075433_10065601 | |||
| 1530 | Ga0075433_10072842 | |||
| 1531 | Ga0075434_100164763 | |||
| 1532 | Ga0075434_100200892 | |||
| 1533 | Ga0075434_100328772 | |||
| 1534 | Ga0075429_100000064 | |||
| 1535 | Ga0075429_100019992 | |||
| 1536 | Ga0075429_100028043 | |||
| 1537 | Ga0075429_100063141 | |||
| 1538 | Ga0068865_100002091 | |||
| 1539 | Ga0068865_100059288 | |||
| 1540 | Ga0068865_100138694 | |||
| 1541 | Ga0075436_100010845 | |||
| 1542 | Ga0075436_100013943 | |||
| 1543 | Ga0075436_100016786 | |||
| 1544 | Ga0097620_100001284 | |||
| 1545 | Ga0097620_100020673 | |||
| 1546 | Ga0097620_100038266 | |||
| 1547 | Ga0097620_100199430 | |||
| 1548 | Ga0075435_100076919 | |||
| 1549 | Ga0075435_100113783 | |||
| 1550 | Ga0099794_10034794 | |||
| 1551 | Ga0099794_10049251 | |||
| 1552 | Ga0105240_10007090 | |||
| 1553 | Ga0105240_10012786 | |||
| 1554 | Ga0105240_10042344 | |||
| 1555 | Ga0105240_10048895 | |||
| 1556 | Ga0105240_10058157 | |||
| 1557 | Ga0105240_10058757 | |||
| 1558 | Ga0105240_10096120 | |||
| 1559 | Ga0111539_10003448 | |||
| 1560 | Ga0111539_10016120 | |||
| 1561 | Ga0111539_10110619 | |||
| 1562 | Ga0111539_10189404 | |||
| 1563 | Ga0111539_10232616 | |||
| 1564 | Ga0105245_10002611 | |||
| 1565 | Ga0105245_10002798 | |||
| 1566 | Ga0105245_10022438 | |||
| 1567 | Ga0105245_10106239 | |||
| 1568 | Ga0105245_10120506 | |||
| 1569 | Ga0114129_10013591 | |||
| 1570 | Ga0114129_10016075 | |||
| 1571 | Ga0114129_10023131 | |||
| 1572 | Ga0114129_10034089 | |||
| 1573 | Ga0114129_10145680 | |||
| 1574 | Ga0114129_10349874 | |||
| 1575 | Ga0105243_10048524 | |||
| 1576 | Ga0105241_10002804 | |||
| 1577 | Ga0105241_10003233 | |||
| 1578 | Ga0105241_10064690 | |||
| 1579 | Ga0105241_10073850 | |||
| 1580 | Ga0105241_10138455 | |||
| 1581 | Ga0105242_10020845 | |||
| 1582 | Ga0105242_10034916 | |||
| 1583 | Ga0105242_10122324 | |||
| 1584 | Ga0105248_10004638 | |||
| 1585 | Ga0105248_10006560 | |||
| 1586 | Ga0105248_10007456 | |||
| 1587 | Ga0105248_10008073 | |||
| 1588 | Ga0105248_10038068 | |||
| 1589 | Ga0105237_10007410 | |||
| 1590 | Ga0105237_10052128 | |||
| 1591 | Ga0105237_10094279 | |||
| 1592 | Ga0105237_10163746 | |||
| 1593 | Ga0105238_10000099 | |||
| 1594 | Ga0105238_10003764 | |||
| 1595 | Ga0105238_10005829 | |||
| 1596 | Ga0105238_10010196 | |||
| 1597 | Ga0105238_10016386 | |||
| 1598 | Ga0105238_10035933 | |||
| 1599 | Ga0105238_10040098 | |||
| 1600 | Ga0105238_10040169 | |||
| 1601 | Ga0105238_10081010 | |||
| 1602 | Ga0105249_10000081 | |||
| 1603 | Ga0105239_10004095 | |||
| 1604 | Ga0105239_10004843 | |||
| 1605 | Ga0105239_10035644 | |||
| 1606 | Ga0105239_10061702 | |||
| 1607 | Ga0105239_10076966 | |||
| 1608 | Ga0105239_10079071 | |||
| 1609 | Ga0157373_10006787 | |||
| 1610 | Ga0157373_10009664 | |||
| 1611 | Ga0157373_10063398 | |||
| 1612 | Ga0157371_10029486 | |||
| 1613 | Ga0157370_10000476 | |||
| 1614 | Ga0157370_10006571 | |||
| 1615 | Ga0157370_10014516 | |||
| 1616 | Ga0157370_10022525 | |||
| 1617 | Ga0157370_10026585 | |||
| 1618 | Ga0157370_10029138 | |||
| 1619 | Ga0157370_10049903 | |||
| 1620 | Ga0157370_10096720 | |||
| 1621 | Ga0157370_10110874 | |||
| 1622 | Ga0157369_10000042 | |||
| 1623 | Ga0157369_10085860 | |||
| 1624 | Ga0157369_10110684 | |||
| 1625 | Ga0157369_10166961 | |||
| 1626 | Ga0157374_10000344 | |||
| 1627 | Ga0157374_10001377 | |||
| 1628 | Ga0157374_10003868 | |||
| 1629 | Ga0157374_10006895 | |||
| 1630 | Ga0157374_10007349 | |||
| 1631 | Ga0157378_10000866 | |||
| 1632 | Ga0157378_10071806 | |||
| 1633 | Ga0157378_10214069 | |||
| 1634 | Ga0163162_10002959 | |||
| 1635 | Ga0163162_10007040 | |||
| 1636 | Ga0163162_10104736 | |||
| 1637 | Ga0157372_10001080 | |||
| 1638 | Ga0157372_10004295 | |||
| 1639 | Ga0157372_10004400 | |||
| 1640 | Ga0157372_10010092 | |||
| 1641 | Ga0157372_10027393 | |||
| 1642 | Ga0157372_10028186 | |||
| 1643 | Ga0157372_10032131 | |||
| 1644 | Ga0157372_10041254 | |||
| 1645 | Ga0157372_10125254 | |||
| 1646 | Ga0157372_10160437 | |||
| 1647 | Ga0157372_10473193 | |||
| 1648 | Ga0157375_10005082 | |||
| 1649 | Ga0157375_10018493 | |||
| 1650 | Ga0157375_10035225 | |||
| 1651 | Ga0157375_10068576 | |||
| 1652 | Ga0157375_10097095 | |||
| 1653 | Ga0157375_10179574 | |||
| 1654 | Ga0157375_10238837 | |||
| 1655 | Ga0163163_10002850 | |||
| 1656 | Ga0163163_10004258 | |||
| 1657 | Ga0163163_10009234 | |||
| 1658 | Ga0163163_10039952 | |||
| 1659 | Ga0163163_10114281 | |||
| 1660 | Ga0157380_10003588 | |||
| 1661 | Ga0157380_10009850 | |||
| 1662 | Ga0157380_10150980 | |||
| 1663 | Ga0157380_10154914 | |||
| 1664 | Ga0182008_10000720 | |||
| 1665 | Ga0182008_10010474 | |||
| 1666 | Ga0157377_10001722 | |||
| 1667 | Ga0157377_10021215 | |||
| 1668 | Ga0157377_10052884 | |||
| 1669 | Ga0157379_10001332 | |||
| 1670 | Ga0157379_10006917 | |||
| 1671 | Ga0157379_10011079 | |||
| 1672 | Ga0157379_10032239 | |||
| 1673 | Ga0157376_10001448 | |||
| 1674 | Ga0157376_10001504 | |||
| 1675 | Ga0157376_10017956 | |||
| 1676 | Ga0157376_10033705 | |||
| 1677 | Ga0157376_10053142 | |||
| 1678 | Ga0157376_10071888 | |||
| 1679 | Ga0157376_10190797 | |||
| 1680 | Ga0182007_10000119 | |||
| 1681 | Ga0163161_10007603 | |||
| 1682 | Ga0163161_10015776 | |||
| 1683 | Ga0206356_11297921 | |||
| 1684 | Ga0209759_1000458 | |||
| 1685 | Ga0207656_10008370 | |||
| 1686 | Ga0207653_10000053 | |||
| 1687 | Ga0207682_10009967 | |||
| 1688 | Ga0207682_10010753 | |||
| 1689 | Ga0207688_10002162 | |||
| 1690 | Ga0207680_10037142 | |||
| 1691 | Ga0207680_10045478 | |||
| 1692 | Ga0207647_10021421 | |||
| 1693 | Ga0207699_10106184 | |||
| 1694 | Ga0207645_10007684 | |||
| 1695 | Ga0207645_10020836 | |||
| 1696 | Ga0207645_10062144 | |||
| 1697 | Ga0207643_10006926 | |||
| 1698 | Ga0207643_10009217 | |||
| 1699 | Ga0207705_10007732 | |||
| 1700 | Ga0207684_10000443 | |||
| 1701 | Ga0207684_10002835 | |||
| 1702 | Ga0207684_10026737 | |||
| 1703 | Ga0207684_10040794 | |||
| 1704 | Ga0207654_10000280 | |||
| 1705 | Ga0207654_10000283 | |||
| 1706 | Ga0207707_10000155 | |||
| 1707 | Ga0207707_10000270 | |||
| 1708 | Ga0207707_10000975 | |||
| 1709 | Ga0207707_10002951 | |||
| 1710 | Ga0207707_10004342 | |||
| 1711 | Ga0207707_10005365 | |||
| 1712 | Ga0207707_10013266 | |||
| 1713 | Ga0207707_10013848 | |||
| 1714 | Ga0207707_10029831 | |||
| 1715 | Ga0207707_10058314 | |||
| 1716 | Ga0207707_10185857 | |||
| 1717 | Ga0207695_10005746 | |||
| 1718 | Ga0207695_10019440 | |||
| 1719 | Ga0207695_10029524 | |||
| 1720 | Ga0207695_10032092 | |||
| 1721 | Ga0207695_10075716 | |||
| 1722 | Ga0207695_10084798 | |||
| 1723 | Ga0207695_10105021 | |||
| 1724 | Ga0207695_10140976 | |||
| 1725 | Ga0207695_10151378 | |||
| 1726 | Ga0207695_10189769 | |||
| 1727 | Ga0207671_10012967 | |||
| 1728 | Ga0207693_10054730 | |||
| 1729 | Ga0207693_10079038 | |||
| 1730 | Ga0207693_10116592 | |||
| 1731 | Ga0207663_10031980 | |||
| 1732 | Ga0207660_10000641 | |||
| 1733 | Ga0207660_10006144 | |||
| 1734 | Ga0207660_10013059 | |||
| 1735 | Ga0207660_10048443 | |||
| 1736 | Ga0207660_10136747 | |||
| 1737 | Ga0207657_10001727 | |||
| 1738 | Ga0207657_10047830 | |||
| 1739 | Ga0207657_10053081 | |||
| 1740 | Ga0207657_10066801 | |||
| 1741 | Ga0207657_10084165 | |||
| 1742 | Ga0207657_10104441 | |||
| 1743 | Ga0207649_10054814 | |||
| 1744 | Ga0207652_10000251 | |||
| 1745 | Ga0207652_10005961 | |||
| 1746 | Ga0207652_10006645 | |||
| 1747 | Ga0207652_10018616 | |||
| 1748 | Ga0207652_10047694 | |||
| 1749 | Ga0207652_10073985 | |||
| 1750 | Ga0207646_10000674 | |||
| 1751 | Ga0207646_10000680 | |||
| 1752 | Ga0207646_10009227 | |||
| 1753 | Ga0207646_10042030 | |||
| 1754 | Ga0207646_10092100 | |||
| 1755 | Ga0207681_10017807 | |||
| 1756 | Ga0207681_10092054 | |||
| 1757 | Ga0207694_10000936 | |||
| 1758 | Ga0207694_10002805 | |||
| 1759 | Ga0207694_10010737 | |||
| 1760 | Ga0207694_10025645 | |||
| 1761 | Ga0207694_10037007 | |||
| 1762 | Ga0207694_10050931 | |||
| 1763 | Ga0207659_10000416 | |||
| 1764 | Ga0207659_10099853 | |||
| 1765 | Ga0207659_10147743 | |||
| 1766 | Ga0207687_10048332 | |||
| 1767 | Ga0207687_10062066 | |||
| 1768 | Ga0207700_10010364 | |||
| 1769 | Ga0207700_10010548 | |||
| 1770 | Ga0207700_10028009 | |||
| 1771 | Ga0207664_10003022 | |||
| 1772 | Ga0207664_10013961 | |||
| 1773 | Ga0207664_10053855 | |||
| 1774 | Ga0207664_10074436 | |||
| 1775 | Ga0207664_10091134 | |||
| 1776 | Ga0207644_10005692 | |||
| 1777 | Ga0207690_10003656 | |||
| 1778 | Ga0207690_10009501 | |||
| 1779 | Ga0207690_10033090 | |||
| 1780 | Ga0207706_10000369 | |||
| 1781 | Ga0207706_10001191 | |||
| 1782 | Ga0207706_10017481 | |||
| 1783 | Ga0207706_10031545 | |||
| 1784 | Ga0207706_10185834 | |||
| 1785 | Ga0207686_10028954 | |||
| 1786 | Ga0207670_10080168 | |||
| 1787 | Ga0207669_10037902 | |||
| 1788 | Ga0207669_10062219 | |||
| 1789 | Ga0207704_10001495 | |||
| 1790 | Ga0207704_10041860 | |||
| 1791 | Ga0207704_10094528 | |||
| 1792 | Ga0207691_10012818 | |||
| 1793 | Ga0207691_10013944 | |||
| 1794 | Ga0207691_10024313 | |||
| 1795 | Ga0207691_10029133 | |||
| 1796 | Ga0207711_10003977 | |||
| 1797 | Ga0207711_10073393 | |||
| 1798 | Ga0207711_10091600 | |||
| 1799 | Ga0207711_10124216 | |||
| 1800 | Ga0207711_10184343 | |||
| 1801 | Ga0207711_10251683 | |||
| 1802 | Ga0207689_10000410 | |||
| 1803 | Ga0207689_10002821 | |||
| 1804 | Ga0207689_10005112 | |||
| 1805 | Ga0207661_10000719 | |||
| 1806 | Ga0207661_10014797 | |||
| 1807 | Ga0207661_10022652 | |||
| 1808 | Ga0207661_10061463 | |||
| 1809 | Ga0207661_10063919 | |||
| 1810 | Ga0207661_10070011 | |||
| 1811 | Ga0207661_10182699 | |||
| 1812 | Ga0207679_10000343 | |||
| 1813 | Ga0207679_10032011 | |||
| 1814 | Ga0207679_10135610 | |||
| 1815 | Ga0207679_10184658 | |||
| 1816 | Ga0207667_10000535 | |||
| 1817 | Ga0207667_10008360 | |||
| 1818 | Ga0207667_10010202 | |||
| 1819 | Ga0207667_10013002 | |||
| 1820 | Ga0207667_10018924 | |||
| 1821 | Ga0207667_10023515 | |||
| 1822 | Ga0207667_10048443 | |||
| 1823 | Ga0207667_10093889 | |||
| 1824 | Ga0207667_10115130 | |||
| 1825 | Ga0207667_10164576 | |||
| 1826 | Ga0207667_10296921 | |||
| 1827 | Ga0207651_10000189 | |||
| 1828 | Ga0207651_10139048 | |||
| 1829 | Ga0207712_10000532 | |||
| 1830 | Ga0207668_10005352 | |||
| 1831 | Ga0207640_10021757 | |||
| 1832 | Ga0207658_10005948 | |||
| 1833 | Ga0207658_10199188 | |||
| 1834 | Ga0207677_10000620 | |||
| 1835 | Ga0207677_10008146 | |||
| 1836 | Ga0207677_10017170 | |||
| 1837 | Ga0207677_10026582 | |||
| 1838 | Ga0207677_10042195 | |||
| 1839 | Ga0207677_10136563 | |||
| 1840 | Ga0207703_10002880 | |||
| 1841 | Ga0207703_10033841 | |||
| 1842 | Ga0207703_10047137 | |||
| 1843 | Ga0207703_10079003 | |||
| 1844 | Ga0207639_10015987 | |||
| 1845 | Ga0207639_10016023 | |||
| 1846 | Ga0207639_10037642 | |||
| 1847 | Ga0207639_10054681 | |||
| 1848 | Ga0207639_10090484 | |||
| 1849 | Ga0207639_10093836 | |||
| 1850 | Ga0207639_10094882 | |||
| 1851 | Ga0207639_10134911 | |||
| 1852 | Ga0207639_10149366 | |||
| 1853 | Ga0207678_10000790 | |||
| 1854 | Ga0207678_10001500 | |||
| 1855 | Ga0207678_10003286 | |||
| 1856 | Ga0207678_10016506 | |||
| 1857 | Ga0207678_10044367 | |||
| 1858 | Ga0207708_10015268 | |||
| 1859 | Ga0207708_10083257 | |||
| 1860 | Ga0207708_10207472 | |||
| 1861 | Ga0207702_10001339 | |||
| 1862 | Ga0207702_10002228 | |||
| 1863 | Ga0207702_10003666 | |||
| 1864 | Ga0207702_10013563 | |||
| 1865 | Ga0207702_10014914 | |||
| 1866 | Ga0207702_10042631 | |||
| 1867 | Ga0207702_10052070 | |||
| 1868 | Ga0207702_10072441 | |||
| 1869 | Ga0207702_10085713 | |||
| 1870 | Ga0207702_10110696 | |||
| 1871 | Ga0207702_10129024 | |||
| 1872 | Ga0207702_10152061 | |||
| 1873 | Ga0207641_10007774 | |||
| 1874 | Ga0207641_10101100 | |||
| 1875 | Ga0207641_10126575 | |||
| 1876 | Ga0207641_10184045 | |||
| 1877 | Ga0207641_10229442 | |||
| 1878 | Ga0207648_10037507 | |||
| 1879 | Ga0207648_10038479 | |||
| 1880 | Ga0207648_10044629 | |||
| 1881 | Ga0207648_10136850 | |||
| 1882 | Ga0207648_10142444 | |||
| 1883 | Ga0207676_10001204 | |||
| 1884 | Ga0207676_10001770 | |||
| 1885 | Ga0207676_10006609 | |||
| 1886 | Ga0207676_10011380 | |||
| 1887 | Ga0207676_10025513 | |||
| 1888 | Ga0207674_10000611 | |||
| 1889 | Ga0207674_10006991 | |||
| 1890 | Ga0207674_10023865 | |||
| 1891 | Ga0207674_10027407 | |||
| 1892 | Ga0207674_10027990 | |||
| 1893 | Ga0207674_10038645 | |||
| 1894 | Ga0207674_10058393 | |||
| 1895 | Ga0207674_10084803 | |||
| 1896 | Ga0207675_100000689 | |||
| 1897 | Ga0207675_100047242 | |||
| 1898 | Ga0207675_100111169 | |||
| 1899 | Ga0207683_10042423 | |||
| 1900 | Ga0207698_10004507 | |||
| 1901 | Ga0207698_10011766 | |||
| 1902 | Ga0207698_10011768 | |||
| 1903 | Ga0207698_10014733 | |||
| 1904 | Ga0207698_10155640 | |||
| 1905 | Ga0207698_10156015 | |||
| 1906 | Ga0207698_10203285 | |||
| 1907 | Ga0209995_1009809 | |||
| 1908 | Ga0210002_1002477 | |||
| 1909 | Ga0209971_1002614 | |||
| 1910 | Ga0209974_10000067 | |||
| 1911 | Ga0209974_10003260 | |||
| 1912 | Ga0207428_10004501 | |||
| 1913 | Ga0207428_10008071 | |||
| 1914 | Ga0207428_10008172 | |||
| 1915 | Ga0207428_10042896 | |||
| 1916 | Ga0268265_10001894 | |||
| 1917 | Ga0268264_10006348 | |||
| 1918 | Ga0268264_10034540 | |||
| 1919 | Ga0265334_10000131 | |||
| 1920 | Ga0265334_10000803 | |||
| 1921 | Ga0265334_10026869 | |||
| 1922 | Ga0265318_10000900 | |||
| 1923 | Ga0265322_10007668 | |||
| 1924 | Ga0265322_10019873 | |||
| 1925 | Ga0265336_10001126 | |||
| 1926 | Ga0265336_10001852 | |||
| 1927 | Ga0307515_10141313 | |||
| 1928 | Ga0265338_10001728 | |||
| 1929 | Ga0265338_10004099 | |||
| 1930 | Ga0265338_10007658 | |||
| 1931 | Ga0265338_10007947 | |||
| 1932 | Ga0265338_10008121 | |||
| 1933 | Ga0265338_10013715 | |||
| 1934 | Ga0265338_10016083 | |||
| 1935 | Ga0265338_10018645 | |||
| 1936 | Ga0265338_10053576 | |||
| 1937 | Ga0265324_10000021 | |||
| 1938 | Ga0265330_10000334 | |||
| 1939 | Ga0265330_10001008 | |||
| 1940 | Ga0265330_10004830 | |||
| 1941 | Ga0265330_10010013 | |||
| 1942 | Ga0265330_10023615 | |||
| 1943 | Ga0265332_10000011 | |||
| 1944 | Ga0265332_10000844 | |||
| 1945 | Ga0265332_10012383 | |||
| 1946 | Ga0265328_10000347 | |||
| 1947 | Ga0265328_10004163 | |||
| 1948 | Ga0265328_10014511 | |||
| 1949 | Ga0265328_10023734 | |||
| 1950 | Ga0265320_10022040 | |||
| 1951 | Ga0265320_10023138 | |||
| 1952 | Ga0265325_10000426 | |||
| 1953 | Ga0265325_10003049 | |||
| 1954 | Ga0265325_10004351 | |||
| 1955 | Ga0265325_10006671 | |||
| 1956 | Ga0265325_10016130 | |||
| 1957 | Ga0265325_10030387 | |||
| 1958 | Ga0265325_10046944 | |||
| 1959 | Ga0265325_10048136 | |||
| 1960 | Ga0265329_10002086 | |||
| 1961 | Ga0265329_10003468 | |||
| 1962 | Ga0265340_10000961 | |||
| 1963 | Ga0265340_10012465 | |||
| 1964 | Ga0265340_10014656 | |||
| 1965 | Ga0265340_10017491 | |||
| 1966 | Ga0265340_10062808 | |||
| 1967 | Ga0265339_10000013 | |||
| 1968 | Ga0265339_10000103 | |||
| 1969 | Ga0265339_10002009 | |||
| 1970 | Ga0265339_10010376 | |||
| 1971 | Ga0265339_10017244 | |||
| 1972 | Ga0265339_10023980 | |||
| 1973 | Ga0265339_10024678 | |||
| 1974 | Ga0265339_10029907 | |||
| 1975 | Ga0265339_10047159 | |||
| 1976 | Ga0265331_10000502 | |||
| 1977 | Ga0265331_10003200 | |||
| 1978 | Ga0265331_10003820 | |||
| 1979 | Ga0265331_10019632 | |||
| 1980 | Ga0265331_10030212 | |||
| 1981 | Ga0265327_10000008 | |||
| 1982 | Ga0265327_10000139 | |||
| 1983 | Ga0265327_10000201 | |||
| 1984 | Ga0265327_10000886 | |||
| 1985 | Ga0265327_10004938 | |||
| 1986 | Ga0265327_10007063 | |||
| 1987 | Ga0265327_10010188 | |||
| 1988 | Ga0265327_10013053 | |||
| 1989 | Ga0265327_10029061 | |||
| 1990 | Ga0265327_10032911 | |||
| 1991 | Ga0265316_10000699 | |||
| 1992 | Ga0265316_10000717 | |||
| 1993 | Ga0265316_10004145 | |||
| 1994 | Ga0265316_10005131 | |||
| 1995 | Ga0265316_10006874 | |||
| 1996 | Ga0265316_10011615 | |||
| 1997 | Ga0265316_10013919 | |||
| 1998 | Ga0265316_10017109 | |||
| 1999 | Ga0265316_10017767 | |||
| 2000 | Ga0265316_10079528 | |||
| 2001 | Ga0265316_10116375 | |||
| 2002 | Ga0307513_10001895 | |||
| 2003 | Ga0265313_10006437 | |||
| 2004 | Ga0265313_10007076 | |||
| 2005 | Ga0265313_10009115 | |||
| 2006 | Ga0265313_10011209 | |||
| 2007 | Ga0265313_10012124 | |||
| 2008 | Ga0265313_10040100 | |||
| 2009 | Ga0265313_10047731 | |||
| 2010 | Ga0316575_10010190 | |||
| 2011 | Ga0316575_10019689 | |||
| 2012 | Ga0316579_10001303 | |||
| 2013 | Ga0316579_10005869 | |||
| 2014 | Ga0316579_10030313 | |||
| 2015 | Ga0316579_10064705 | |||
| 2016 | Ga0265314_10000026 | |||
| 2017 | Ga0265314_10003323 | |||
| 2018 | Ga0265314_10007094 | |||
| 2019 | Ga0265314_10009570 | |||
| 2020 | Ga0265314_10009885 | |||
| 2021 | Ga0265314_10013702 | |||
| 2022 | Ga0265314_10025646 | |||
| 2023 | Ga0265314_10026307 | |||
| 2024 | Ga0265314_10068999 | |||
| 2025 | Ga0265314_10072654 | |||
| 2026 | Ga0265314_10102875 | |||
| 2027 | Ga0265342_10002778 | |||
| 2028 | Ga0265342_10007431 | |||
| 2029 | Ga0265342_10009623 | |||
| 2030 | Ga0265342_10009658 | |||
| 2031 | Ga0265342_10020912 | |||
| 2032 | Ga0265342_10027799 | |||
| 2033 | Ga0265342_10050616 | |||
| 2034 | Ga0265342_10076480 | |||
| 2035 | Ga0316576_10007547 | |||
| 2036 | Ga0316576_10013534 | |||
| 2037 | Ga0316576_10045520 | |||
| 2038 | Ga0316576_10047423 | |||
| 2039 | Ga0316576_10050333 | |||
| 2040 | Ga0316576_10059405 | |||
| 2041 | Ga0316576_10123247 | |||
| 2042 | Ga0316578_10003015 | |||
| 2043 | Ga0316578_10003577 | |||
| 2044 | Ga0316578_10014685 | |||
| 2045 | Ga0316578_10034106 | |||
| 2046 | Ga0316577_10008124 | |||
| 2047 | Ga0316577_10021395 | |||
| 2048 | Ga0316577_10073386 | |||
| 2049 | Ga0316577_10076463 | |||
| 2050 | Ga0307410_10014570 | |||
| 2051 | Ga0307406_10116350 | |||
| 2052 | Ga0307407_10038539 | |||
| 2053 | Ga0307409_100001515 | |||
| 2054 | Ga0307415_100206611 | |||
| 2055 | Ga0316583_10000928 | |||
| 2056 | Ga0316583_10005480 | |||
| 2057 | Ga0316583_10024474 | |||
| 2058 | Ga0316583_10035163 | |||
| 2059 | Ga0316585_10016676 | |||
| 2060 | Ga0316580_10026088 | |||
| 2061 | Ga0373930_0000874 | |||
| 2062 | Ga0373959_0010725 | |||
| 2063 | Ga0373940_0001226 | |||
| 2064 | Ga0373932_0001901 | |||
| 2065 | Ga0373957_0061359 | |||
| 2066 | Ga0373946_0076289 | |||
| 2067 | Ga0316574_0000835 | |||
| 2068 | Ga0316574_0001503 | |||
| 2069 | Ga0316574_0001601 | |||
| 2070 | Ga0316574_0002270 | |||
| 2071 | Ga0316574_0032472 | |||
| 2072 | Ga0316574_0035701 | |||
| 2073 | Ga0316574_0039261 | |||
| 2074 | Ga0316574_0076820 | |||
| 2075 | Ga0373924_0002388 | |||
| 2076 | Ga0373931_0000010 | |||
| 2077 | Ga0373931_0002528 | |||
| 2078 | Ga0373931_0071473 | |||
| 2079 | Ga0373935_0072390 | |||
| 2080 | Ga0373927_0012329 | |||
| 2081 | Ga0373933_0027064 | |||
| 2082 | Ga0373933_0087718 | |||
| 2083 | Ga0373937_0018836 | |||
| 2084 | Ga0373937_0032553 | |||
| 2085 | Ga0373937_0083142 | |||
| 2086 | Ga0373937_0137296 | |||
| 2087 | Ga0316582_0000151 | |||
| 2088 | Ga0316582_0002485 | |||
| 2089 | Ga0316582_0002567 | |||
| 2090 | Ga0316582_0008545 | |||
| 2091 | Ga0316582_0010892 | |||
| 2092 | Ga0316584_0001559 | |||
| 2093 | Ga0316584_0004770 | |||
| 2094 | Ga0316584_0006834 | |||
| 2095 | Ga0316584_0009910 | |||
| 2096 | Ga0316584_0013176 | |||
| 2097 | Ga0316584_0015663 | |||
| 2098 | Ga0316584_0020955 | |||
| 2099 | Ga0316584_0099487 | |||
| 2100 | Ga0316584_0107607 | |||
| 2101 | Ga0316584_0185042 | |||
| 2102 | Ga0373925_0002495 | |||
| 2103 | Ga0373925_0011044 | |||
| 2104 | Ga0373925_0034995 | |||
| 2105 | Ga0395900_0124564 | |||
| 2106 | Ga0395900_0263082 | |||
| 2107 | Ga0395898_0198142 | |||
| 2108 | Ga0395905_0002225 | |||
| 2109 | Ga0395905_0034195 | |||
| 2110 | Ga0395905_0103505 | |||
| 2111 | Ga0400483_027531 | |||
| 2112 | Ga0400483_062504 | |||
| 2113 | Ga0400483_087189 | |||
| 2114 | Ga0400483_247359 | |||
| 2115 | Ga0436365_0014263 | |||
| 2116 | Ga0436365_1360619 | |||
| 2117 | Ga0451789_0749045 | |||
| 2118 | Ga0451841_0881987 | |||
| 2119 | Ga0439448_0001294 | |||
| 2120 | Ga0439435_0000521 | |||
| 2121 | Ga0451577_0000432 | |||
| 2122 | Ga0451577_0001184 | |||
| 2123 | Ga0451577_0003034 | |||
| 2124 | Ga0451577_0010584 | |||
| 2125 | Ga0451577_0031938 | |||
| 2126 | Ga0451577_0047664 | |||
| 2127 | Ga0451577_0066911 | |||
| 2128 | Ga0451577_0316568 | |||
| 2129 | Ga0453683_0002133 | |||
| 2130 | Ga0453683_0004808 | |||
| 2131 | Ga0453683_0020439 | |||
| 2132 | Ga0453683_0123739 | |||
| 2133 | Ga0453684_0000104 | |||
| 2134 | Ga0453684_0000125 | |||
| 2135 | Ga0453684_0004446 | |||
| 2136 | Ga0453684_0020077 | |||
| 2137 | Ga0453684_0023409 | |||
| 2138 | Ga0453684_0054899 | |||
| 2139 | Ga0453684_0185466 | |||
| 2140 | Ga0453684_0198357 | |||
| 2141 | Ga0453684_0307768 | |||
| 2142 | Ga0466959_0046939 | |||
| 2143 | Ga0451576_0002213 | |||
| 2144 | Ga0451576_0002908 | |||
| 2145 | Ga0451576_0003426 | |||
| 2146 | Ga0451576_0004734 | |||
| 2147 | Ga0451576_0015833 | |||
| 2148 | Ga0451576_0020097 | |||
| 2149 | Ga0451576_0034864 | |||
| 2150 | Ga0451576_0088529 | |||
| 2151 | Ga0451576_0143321 | |||
| 2152 | Ga0451576_0163397 | |||
| 2153 | Ga0451576_0221742 | |||
| 2154 | Ga0495592_0049565 | |||
| 2155 | Ga0495629_0089600 | |||
| 2156 | Ga0495651_0000722 | |||
| 2157 | Ga0495651_0010627 | |||
| 2158 | Ga0495651_0072805 | |||
| 2159 | Ga0495651_0152445 | |||
| 2160 | Ga0495580_0040882 | |||
| 2161 | Ga0495580_0061713 | |||
| 2162 | Ga0495582_0011157 | |||
| 2163 | Ga0495582_0018685 | |||
| 2164 | Ga0495664_0051989 | |||
| 2165 | Ga0495608_0029543 | |||
| 2166 | Ga0495608_0036834 | |||
| 2167 | Ga0495608_0038775 | |||
| 2168 | Ga0495628_0151960 | |||
| 2169 | Ga0495652_0013232 | |||
| 2170 | Ga0495652_0050131 | |||
| 2171 | Ga0495640_0089877 | |||
| 2172 | Ga0495586_0007072 | |||
| 2173 | Ga0495586_0024415 | |||
| 2174 | Ga0495586_0062850 | |||
| 2175 | Ga0495587_0015933 | |||
| 2176 | Ga0495587_0017777 | |||
| 2177 | Ga0495587_0078305 | |||
| 2178 | Ga0495645_0001987 | |||
| 2179 | Ga0495645_0029015 | |||
| 2180 | Ga0495667_0013090 | |||
| 2181 | Ga0495667_0043742 | |||
| 2182 | Ga0495634_0005034 | |||
| 2183 | Ga0495635_0037534 | |||
| 2184 | Ga0495635_0074084 | |||
| 2185 | Ga0495635_0104060 | |||
| 2186 | Ga0495599_0014798 | |||
| 2187 | Ga0495599_0106251 | |||
| 2188 | Ga0495623_0008194 | |||
| 2189 | Ga0495623_0034135 | |||
| 2190 | Ga0495647_0035046 | |||
| 2191 | Ga0495647_0040268 | |||
| 2192 | Ga0495658_0063075 | |||
| 2193 | Ga0495658_0148814 | |||
| 2194 | Ga0495613_0006054 | |||
| 2195 | Ga0495613_0015673 | |||
| 2196 | Ga0495613_0105775 | |||
| 2197 | Ga0495671_0028432 | |||
| 2198 | Ga0495600_0050435 | |||
| 2199 | Ga0495604_0062023 | |||
| 2200 | Ga0495674_0252299 | |||
| 2201 | Ga0495672_0000884 | |||
| 2202 | Ga0495680_0002645 | |||
| 2203 | Ga0495675_0007009 | |||
| 2204 | Ga0495675_0023426 | |||
| 2205 | Ga0495684_0006680 | |||
| 2206 | Ga0495602_0047025 | |||
| 2207 | Ga0495602_0124844 | |||
| 2208 | Ga0495602_0127850 | |||
| 2209 | Ga0496100_0020618 | |||
| 2210 | Ga0496100_0031780 | |||
| 2211 | Ga0496101_0012795 | |||
| 2212 | Ga0496101_0201870 | |||
| 2213 | Ga0496102_0006170 | |||
| 2214 | Ga0496102_0039428 | |||
| 2215 | Ga0496102_0041715 | |||
| 2216 | Ga0496102_0140597 | |||
| 2217 | Ga0496102_0190131 | |||
| 2218 | Ga0496102_0319306 | |||
| 2219 | Ga0496103_0028460 | |||
| 2220 | Ga0496103_0073999 | |||
| 2221 | Ga0496104_0008382 | |||
| 2222 | Ga0496104_0012867 | |||
| 2223 | Ga0496104_0021107 | |||
| 2224 | Ga0496104_0036823 | |||
| 2225 | Ga0496104_0089303 | |||
| 2226 | Ga0496104_0155895 | |||
| 2227 | Ga0496104_0204917 | |||
| 2228 | Ga0496104_0284936 | |||
| 2229 | Ga0496105_0003890 | |||
| 2230 | Ga0496105_0008678 | |||
| 2231 | Ga0496105_0057782 | |||
| 2232 | Ga0496105_0161002 | |||
| 2233 | Ga0496106_0011745 | |||
| 2234 | Ga0496106_0062862 | |||
| 2235 | Ga0496106_0079266 | |||
| 2236 | Ga0496107_0032857 | |||
| 2237 | Ga0496107_0049592 | |||
| 2238 | Ga0496108_0004718 | |||
| 2239 | Ga0496108_0009710 | |||
| 2240 | Ga0496108_0012603 | |||
| 2241 | Ga0496109_0011522 | |||
| 2242 | Ga0496109_0016429 | |||
| 2243 | Ga0496109_0124563 | |||
| 2244 | Ga0496109_0216975 | |||
| 2245 | Ga0496110_0004405 | |||
| 2246 | Ga0496110_0013314 | |||
| 2247 | Ga0496110_0020051 | |||
| 2248 | Ga0496110_0043809 | |||
| 2249 | Ga0496110_0091193 | |||
| 2250 | Ga0496111_0002300 | |||
| 2251 | Ga0496111_0044808 | |||
| 2252 | Ga0496111_0123041 | |||
| 2253 | Ga0496111_0158682 | |||
| 2254 | Ga0496111_0164530 | |||
| 2255 | Ga0496112_0006868 | |||
| 2256 | Ga0496113_0013847 | |||
| 2257 | Ga0496114_0003419 | |||
| 2258 | Ga0496114_0014551 | |||
| 2259 | Ga0496114_0049805 | |||
| 2260 | Ga0496114_0059806 | |||
| 2261 | Ga0496114_0106117 | |||
| 2262 | Ga0496114_0126518 | |||
| 2263 | Ga0496114_0134711 | |||
| 2264 | Ga0496115_0025365 | |||
| 2265 | Ga0496116_0013525 | |||
| 2266 | Ga0496117_0000135 | |||
| 2267 | Ga0496118_0000098 | |||
| 2268 | Ga0496119_0008284 | |||
| 2269 | Ga0496121_0001675 | |||
| 2270 | Ga0496126_0020593 | |||
| 2271 | Ga0501031_0001007 | |||
| 2272 | Ga0501031_0020481 | |||
| 2273 | Ga0501031_0027058 | |||
| 2274 | Ga0501031_0132974 | |||
| 2275 | Ga0501032_0000167 | |||
| 2276 | Ga0501032_0007868 | |||
| 2277 | Ga0501032_0009061 | |||
| 2278 | Ga0501032_0091514 | |||
| 2279 | Ga0501033_0000280 | |||
| 2280 | Ga0501033_0003099 | |||
| 2281 | Ga0501033_0003516 | |||
| 2282 | Ga0501033_0004862 | |||
| 2283 | Ga0501034_0013851 | |||
| 2284 | Ga0501034_0016867 | |||
| 2285 | Ga0501034_0019794 | |||
| 2286 | Ga0501034_0088872 | |||
| 2287 | Ga0501034_0214528 | |||
| 2288 | Ga0501036_0021687 | |||
| 2289 | Ga0501036_0030085 | |||
| 2290 | Ga0501036_0047473 | |||
| 2291 | Ga0501036_0055259 | |||
| 2292 | Ga0501036_0100510 | |||
| 2293 | Ga0501036_0183116 | |||
| 2294 | Ga0501037_0002482 | |||
| 2295 | Ga0501037_0011560 | |||
| 2296 | Ga0501037_0047369 | |||
| 2297 | Ga0501037_0094697 | |||
| 2298 | Ga0501037_0095100 | |||
| 2299 | Ga0501038_0000229 | |||
| 2300 | Ga0501038_0004863 | |||
| 2301 | Ga0501038_0006453 | |||
| 2302 | Ga0501038_0014688 | |||
| 2303 | Ga0501038_0018426 | |||
| 2304 | Ga0501038_0022765 | |||
| 2305 | Ga0501038_0039828 | |||
| 2306 | Ga0501038_0083590 | |||
| 2307 | Ga0501039_0000387 | |||
| 2308 | Ga0501039_0003397 | |||
| 2309 | Ga0501039_0017945 | |||
| 2310 | Ga0501039_0021496 | |||
| 2311 | Ga0501039_0031047 | |||
| 2312 | Ga0501039_0034279 | |||
| 2313 | Ga0501039_0098495 | |||
| 2314 | Ga0501039_0143569 | |||
| 2315 | Ga0501040_0002042 | |||
| 2316 | Ga0501040_0019445 | |||
| 2317 | Ga0501040_0034984 | |||
| 2318 | Ga0501041_0003026 | |||
| 2319 | Ga0501041_0018700 | |||
| 2320 | Ga0501041_0036575 | |||
| 2321 | Ga0501041_0042345 | |||
| 2322 | Ga0501042_0002284 | |||
| 2323 | Ga0501042_0007841 | |||
| 2324 | Ga0501042_0022259 | |||
| 2325 | Ga0501043_0000738 | |||
| 2326 | Ga0501043_0008870 | |||
| 2327 | Ga0501043_0022536 | |||
| 2328 | Ga0501043_0030827 | |||
| 2329 | Ga0501043_0032621 | |||
| 2330 | Ga0501043_0039334 | |||
| 2331 | Ga0501046_0000422 | |||
| 2332 | Ga0501046_0030946 | |||
| 2333 | Ga0501046_0051650 | |||
| 2334 | Ga0501047_0002404 | |||
| 2335 | Ga0501047_0031282 | |||
| 2336 | Ga0501048_0002435 | |||
| 2337 | Ga0501048_0018650 | |||
| 2338 | Ga0501048_0025182 | |||
| 2339 | Ga0501068_0000685 | |||
| 2340 | Ga0501068_0004213 | |||
| 2341 | Ga0501068_0019950 | |||
| 2342 | Ga0501068_0022839 | |||
| 2343 | Ga0501068_0052074 | |||
| 2344 | Ga0501069_0000183 | |||
| 2345 | Ga0501069_0003234 | |||
| 2346 | Ga0501070_0002006 | |||
| 2347 | Ga0501070_0003803 | |||
| 2348 | Ga0501070_0015028 | |||
| 2349 | Ga0501070_0048941 | |||
| 2350 | Ga0501071_0024392 | |||
| 2351 | Ga0501071_0025266 | |||
| 2352 | Ga0501071_0042309 | |||
| 2353 | Ga0501071_0078808 | |||
| 2354 | Ga0501071_0091180 | |||
| 2355 | Ga0501072_0000929 | |||
| 2356 | Ga0501072_0002538 | |||
| 2357 | Ga0501072_0058627 | |||
| 2358 | Ga0501073_0002721 | |||
| 2359 | Ga0501073_0007592 | |||
| 2360 | Ga0501073_0032687 | |||
| 2361 | Ga0501074_0031348 | |||
| 2362 | Ga0501075_0005663 | |||
| 2363 | Ga0501075_0047166 | |||
| 2364 | Ga0501075_0054505 | |||
| 2365 | Ga0501075_0064465 | |||
| 2366 | Ga0501075_0113840 | |||
| 2367 | Ga0501076_0011604 | |||
| 2368 | Ga0501076_0014118 | |||
| 2369 | Ga0501076_0044681 | |||
| 2370 | Ga0501076_0052624 | |||
| 2371 | Ga0501076_0057659 | |||
| 2372 | Ga0501077_0044738 | |||
| 2373 | Ga0501077_0110198 | |||
| 2374 | Ga0501079_0002260 | |||
| 2375 | Ga0501079_0038750 | |||
| 2376 | Ga0501079_0096369 | |||
| 2377 | Ga0501079_0135481 | |||
| 2378 | Ga0501080_0009843 | |||
| 2379 | Ga0501080_0023075 | |||
| 2380 | Ga0501080_0023133 | |||
| 2381 | Ga0501080_0048979 | |||
| 2382 | Ga0501080_0051833 | |||
| 2383 | Ga0501080_0059272 | |||
| 2384 | Ga0501081_0001591 | |||
| 2385 | Ga0501081_0104392 | |||
| 2386 | Ga0501083_0011631 | |||
| 2387 | Ga0501035_0002589 | |||
| 2388 | Ga0501035_0007297 | |||
| 2389 | Ga0501035_0054086 | |||
| 2390 | Ga0501035_0073114 | |||
| 2391 | Ga0501044_0000323 | |||
| 2392 | Ga0501044_0000514 | |||
| 2393 | Ga0501044_0002434 | |||
| 2394 | Ga0501044_0006808 | |||
| 2395 | Ga0501044_0007920 | |||
| 2396 | Ga0501044_0030465 | |||
| 2397 | Ga0501045_0000237 | |||
| 2398 | Ga0501045_0007689 | |||
| 2399 | Ga0501045_0010042 | |||
| 2400 | Ga0501045_0047829 | |||
| 2401 | nmdc:mga05p37_141138_c1 | |||
| 2402 | nmdc:mga05p37_15817_c1 | |||
| 2403 | nmdc:mga05p37_169669_c2 | |||
| 2404 | nmdc:mga05p37_171815_c1 | |||
| 2405 | nmdc:mga05p37_68180_c1 | |||
| 2406 | nmdc:mga05p37_94311_c1 | |||
| 2407 | nmdc:mga09592_116856_c1 | |||
| 2408 | nmdc:mga09592_49229_c1 | |||
| 2409 | nmdc:mga09592_796_c1 | |||
| 2410 | nmdc:mga0qj67_39487_c1 | |||
| 2411 | nmdc:mga0qj67_6216_c1 | |||
| 2412 | nmdc:mga06r32_104142_c1 | |||
| 2413 | nmdc:mga06r32_119442_c1 | |||
| 2414 | nmdc:mga06r32_54924_c1 | |||
| 2415 | nmdc:mga06r32_56427_c1 | |||
| 2416 | nmdc:mga06r32_66005_c1 | |||
| 2417 | nmdc:mga06r32_810_c1 | |||
| 2418 | nmdc:mga08y16_13968_c1 | |||
| 2419 | nmdc:mga08y16_160883_c1 | |||
| 2420 | nmdc:mga08y16_18798_c1 | |||
| 2421 | nmdc:mga08y16_19888_c1 | |||
| 2422 | nmdc:mga08y16_57007_c1 | |||
| 2423 | nmdc:mga0n895_68039_c1 | |||
| 2424 | nmdc:mga08x19_106227_c1 | |||
| 2425 | nmdc:mga08x19_13893_c1 | |||
| 2426 | nmdc:mga08x19_24216_c1 | |||
| 2427 | nmdc:mga0a205_107256_c1 | |||
| 2428 | nmdc:mga0a205_131124_c1 | |||
| 2429 | Ga0495601_0064162 | |||
| 2430 | Ga0495595_0008665 | |||
| 2431 | Ga0495619_0017931 | |||
| 2432 | Ga0495619_0018671 | |||
| 2433 | Ga0495619_0028954 | |||
| 2434 | Ga0495619_0033006 | |||
| 2435 | Ga0495619_0035380 | |||
| 2436 | Ga0495619_0097620 | |||
| 2437 | Ga0500566_0040501 | |||
| 2438 | Ga0500607_030326 | |||
| 2439 | Ga0500568_0000135 | |||
| 2440 | Ga0500616_0000755 | |||
| 2441 | Ga0500636_0000213 | |||
| 2442 | Ga0500637_0006937 | |||
| 2443 | Ga0501084_0009817 | |||
| 2444 | Ga0501084_0031430 | |||
| 2445 | Ga0501084_0034157 | |||
| 2446 | Ga0501082_0006386 | |||
| 2447 | Ga0501082_0026658 | |||
| 2448 | Ga0501082_0038447 | |||
| 2449 | Ga0501082_0098736 | |||
| 2450 | Ga0501082_0100821 | |||
| 2451 | Ga0530510_0009754 | |||
| 2452 | Ga0530510_0012839 | |||
| 2453 | Ga0530510_0077492 | |||
| 2454 | Ga0530510_0167361 | |||
| 2455 | 2739612495 | |||
| 2456 | 2867308048 | |||
| 2457 | 2867318489 | |||
| 2458 | 2867320473 | |||
| 2459 | 2881928623 | |||
| 2460 | 2887378819 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lgv-assembly1.cif.gz_D | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9515 | 11 | 465 |
| 4lgv-assembly1.cif.gz_B | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9476 | 10 | 465 |
| 4lgv-assembly1.cif.gz_D | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.9474 | 11 | 465 |
| 4lgv-assembly1.cif.gz_A | x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium | 0.942 | 9 | 465 |
| 5ukw-assembly1.cif.gz_A | crystal structure of human glucose 6-phosphate dehydrogenase mutant (a277c) complexed with g6p | 0.9397 | 10 | 461 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN71_8_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9751 | 11 | 169 | 3.40.50.720 |
| 4lgvD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9748 | 11 | 172 | 3.40.50.720 |
| af_P0AC53_13_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9515 | 16 | 170 | 3.40.50.720 |
| af_P9WN71_8_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9514 | 11 | 169 | 3.40.50.720 |
| af_O14137_172_472_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9434 | 172 | 456 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MUC2-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9983 | 209 | 302 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A659UKS1-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9946 | 197 | 309 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A6N9V909-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9944 | 211 | 326 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A528LVB6-F1-model_v4 | Glucose-6-phosphate dehydrogenase (NADP(+)) | 0.9919 | 9 | 340 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A435EGM9-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9919 | 9 | 310 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |