F491983

General Info

Members Datasets Scaffolds Average Seq Length
1230 361 2460 468

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10009888|Ga0157370_100098889
Length 548
Sequence MPTCRAGTSGPKRRWRLRAQPQEADGKPRDTGLCIDLTCLHARWVEWASVFGAIACAPAPCRSPSGRRHPHHLDDGEHHHMALPRSDALVFFGATGDLAYKKIFPALLAMTRDGDLDVPIIGVAHSGWGVKQLRKRAHDSVRQAAKDSGEKLDKAVFERLAERLQYVDGDYADPATFAQLKQALGKAKRPLHYLAIPPSLFGTVVEGLQQAGCAKDARVVVEKPFGHDLASAQELNGILRSVFPDDAIFRIDHFLGKEAIMNILYFRFANSFLEPIWNRNHVASVEITLAEQFGVKGRGAFYDGAGCLRDVIQNHLLQIVALLAMEPPAYQGFGAVHAEKTKVFQAMRPLAPDDLVRGQYRGYRKEPGVAKGSDVETYCALRLFIDSWRWGGVPWYLRSGKCLPETVAEIVVELKPPPQKLFDDAAISAGRANYLRFRLSPNTAVALAARVKRVGKEFVGDQRELYLMDEQSGEETPYERLLGDAMAGDGALFTREEAVEAAWMVVDPVLEKHHEAIPYTPGSWGPKQADDLIAADGGWHNPVLEPGA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
190 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
220 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
221 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
236 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
244 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
348 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
349 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
356 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
357 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
358 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
359 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
360 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
361 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.08
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 4.63
Rhizosphere 93.25
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10009888 3300013104 Bacteria 10107
2 Ga0065704_10001221 3300005289 Bacteria 15987
3 Ga0065715_10138400 3300005293 Bacteria 1892
4 Ga0065707_10001278 3300005295 Bacteria 11071
5 Ga0065707_10089312 3300005295 Bacteria 4405
6 Ga0070658_10000686 3300005327 Bacteria 29296
7 Ga0070658_10026401 3300005327 Bacteria 4658
8 Ga0070676_10000222 3300005328 Bacteria 24230
9 Ga0070683_100000521 3300005329 Bacteria 26974
10 Ga0070683_100008243 3300005329 Bacteria 8855
11 Ga0070683_100010563 3300005329 Bacteria 7938
12 Ga0070683_100011682 3300005329 Bacteria 7604
13 Ga0070683_100069587 3300005329 Bacteria 3281
14 Ga0070683_100090408 3300005329 Bacteria 2874
15 Ga0070683_100196614 3300005329 Bacteria 1915
16 Ga0070683_100204062 3300005329 Bacteria 1877
17 Ga0070690_100002441 3300005330 Bacteria 9993
18 Ga0070670_100025475 3300005331 Bacteria 5089
19 Ga0070670_100026422 3300005331 Bacteria 4996
20 Ga0070670_100171873 3300005331 Bacteria 1880
21 Ga0070677_10006494 3300005333 Bacteria 3886
22 Ga0070677_10006951 3300005333 Bacteria 3762
23 Ga0068869_100003200 3300005334 Bacteria 10003
24 Ga0068869_100131544 3300005334 Bacteria 1924
25 Ga0068869_100163662 3300005334 Bacteria 1733
26 Ga0070666_10002423 3300005335 Bacteria 11276
27 Ga0070666_10003483 3300005335 Bacteria 9541
28 Ga0070666_10064334 3300005335 Bacteria 2487
29 Ga0070666_10106295 3300005335 Bacteria 1939
30 Ga0070680_100000496 3300005336 Bacteria 27081
31 Ga0070680_100000686 3300005336 Bacteria 23486
32 Ga0070680_100010122 3300005336 Bacteria 7270
33 Ga0070680_100022885 3300005336 Bacteria 4979
34 Ga0070680_100024504 3300005336 Bacteria 4821
35 Ga0070680_100118172 3300005336 Bacteria 2211
36 Ga0070680_100151246 3300005336 Bacteria 1949
37 Ga0070680_100166874 3300005336 Bacteria 1851
38 Ga0070680_100179283 3300005336 Bacteria 1784
39 Ga0070682_100000296 3300005337 Bacteria 34820
40 Ga0070682_100001443 3300005337 Bacteria 13371
41 Ga0070682_100003005 3300005337 Bacteria 9361
42 Ga0070682_100004882 3300005337 Bacteria 7443
43 Ga0070682_100013676 3300005337 Bacteria 4676
44 Ga0070682_100024788 3300005337 Bacteria 3573
45 Ga0068868_100000767 3300005338 Bacteria 21693
46 Ga0068868_100004781 3300005338 Bacteria 9510
47 Ga0068868_100033664 3300005338 Bacteria 3951
48 Ga0068868_100043729 3300005338 Bacteria 3499
49 Ga0070660_100001492 3300005339 Bacteria 16013
50 Ga0070660_100002914 3300005339 Bacteria 11784
51 Ga0070660_100036561 3300005339 Bacteria 3720
52 Ga0070660_100062257 3300005339 Bacteria 2898
53 Ga0070689_100101089 3300005340 Bacteria 2281
54 Ga0070689_100147503 3300005340 Bacteria 1896
55 Ga0070691_10028911 3300005341 Bacteria 2592
56 Ga0070661_100000821 3300005344 Bacteria 22334
57 Ga0070661_100007462 3300005344 Bacteria 7541
58 Ga0070661_100043507 3300005344 Bacteria 3280
59 Ga0070692_10001608 3300005345 Bacteria 8309
60 Ga0070692_10024877 3300005345 Bacteria 2947
61 Ga0070668_100007558 3300005347 Bacteria 8066
62 Ga0070669_100088488 3300005353 Bacteria 2318
63 Ga0070669_100109796 3300005353 Bacteria 2092
64 Ga0070675_100000244 3300005354 Bacteria 35244
65 Ga0070675_100029173 3300005354 Bacteria 4447
66 Ga0070675_100070567 3300005354 Bacteria 2895
67 Ga0070675_100088190 3300005354 Bacteria 2595
68 Ga0070675_100115349 3300005354 Bacteria 2277
69 Ga0070671_100239064 3300005355 Bacteria 1542
70 Ga0070674_100001066 3300005356 Bacteria 14355
71 Ga0070674_100053015 3300005356 Bacteria 2799
72 Ga0070673_100001348 3300005364 Bacteria 14331
73 Ga0070673_100001792 3300005364 Bacteria 12806
74 Ga0070673_100002263 3300005364 Bacteria 11667
75 Ga0070673_100075542 3300005364 Bacteria 2718
76 Ga0070688_100016856 3300005365 Bacteria 4183
77 Ga0070659_100003371 3300005366 Bacteria 11375
78 Ga0070659_100004685 3300005366 Bacteria 9759
79 Ga0070659_100013498 3300005366 Bacteria 6081
80 Ga0070659_100037536 3300005366 Bacteria 3777
81 Ga0070659_100050095 3300005366 Bacteria 3285
82 Ga0070667_100005756 3300005367 Bacteria 10355
83 Ga0070667_100011925 3300005367 Bacteria 7192
84 Ga0070667_100014768 3300005367 Bacteria 6451
85 Ga0070703_10007873 3300005406 Bacteria 2998
86 Ga0070703_10010267 3300005406 Bacteria 2640
87 Ga0070709_10022408 3300005434 Bacteria 3694
88 Ga0070709_10086595 3300005434 Bacteria 2057
89 Ga0070714_100002263 3300005435 Bacteria 14160
90 Ga0070714_100005415 3300005435 Bacteria 9736
91 Ga0070714_100057642 3300005435 Bacteria 3325
92 Ga0070714_100090177 3300005435 Bacteria 2684
93 Ga0070713_100000636 3300005436 Bacteria 22415
94 Ga0070713_100202956 3300005436 Bacteria 1791
95 Ga0070713_100219357 3300005436 Bacteria 1725
96 Ga0070711_100013432 3300005439 Bacteria 5144
97 Ga0070705_100075217 3300005440 Bacteria 2056
98 Ga0070705_100111864 3300005440 Bacteria 1746
99 Ga0070700_100026443 3300005441 Bacteria 3427
100 Ga0070700_100113221 3300005441 Bacteria 1807
101 Ga0070694_100065637 3300005444 Bacteria 2487
102 Ga0070708_100001524 3300005445 Bacteria 17691
103 Ga0070708_100076151 3300005445 Bacteria 3030
104 Ga0070663_100002959 3300005455 Bacteria 9677
105 Ga0070663_100003859 3300005455 Bacteria 8733
106 Ga0070663_100010068 3300005455 Bacteria 5880
107 Ga0070663_100024000 3300005455 Bacteria 4097
108 Ga0070663_100058024 3300005455 Bacteria 2778
109 Ga0070678_100025037 3300005456 Bacteria 4007
110 Ga0070678_100200531 3300005456 Bacteria 1646
111 Ga0070678_100201720 3300005456 Bacteria 1642
112 Ga0070662_100001044 3300005457 Bacteria 16919
113 Ga0070662_100002448 3300005457 Bacteria 11431
114 Ga0070662_100054166 3300005457 Bacteria 2907
115 Ga0070681_10000034 3300005458 Bacteria 98600
116 Ga0070681_10000474 3300005458 Bacteria 32760
117 Ga0070681_10011914 3300005458 Bacteria 8622
118 Ga0070681_10032224 3300005458 Bacteria 5259
119 Ga0070681_10037614 3300005458 Bacteria 4855
120 Ga0070681_10038380 3300005458 Bacteria 4802
121 Ga0070681_10074934 3300005458 Bacteria 3344
122 Ga0068867_100019381 3300005459 Bacteria 4848
123 Ga0070685_10036870 3300005466 Bacteria 2766
124 Ga0070706_100000575 3300005467 Bacteria 42747
125 Ga0070706_100025719 3300005467 Bacteria 5417
126 Ga0070706_100043908 3300005467 Unclassified 4129
127 Ga0070706_100049705 3300005467 Bacteria 3869
128 Ga0070707_100000941 3300005468 Bacteria 28909
129 Ga0070707_100011349 3300005468 Bacteria 8305
130 Ga0070707_100042195 3300005468 Bacteria 4367
131 Ga0070707_100131183 3300005468 Bacteria 2437
132 Ga0070698_100003318 3300005471 Bacteria 17704
133 Ga0070698_100004458 3300005471 Bacteria 15388
134 Ga0070698_100007700 3300005471 Bacteria 11649
135 Ga0070698_100012588 3300005471 Bacteria 8958
136 Ga0070698_100028967 3300005471 Bacteria 5748
137 Ga0070698_100049362 3300005471 Unclassified 4295
138 Ga0070698_100064599 3300005471 Bacteria 3687
139 Ga0070698_100156054 3300005471 Bacteria 2228
140 Ga0070699_100006715 3300005518 Bacteria 10006
141 Ga0070699_100012835 3300005518 Bacteria 7223
142 Ga0070699_100027460 3300005518 Bacteria 4908
143 Ga0070699_100046228 3300005518 Bacteria 3768
144 Ga0070699_100069353 3300005518 Bacteria 3063
145 Ga0070679_100000306 3300005530 Bacteria 41768
146 Ga0070679_100005633 3300005530 Bacteria 11604
147 Ga0070679_100005977 3300005530 Bacteria 11313
148 Ga0070679_100023633 3300005530 Bacteria 6019
149 Ga0070679_100076045 3300005530 Bacteria 3347
150 Ga0070684_100019471 3300005535 Bacteria 5614
151 Ga0070684_100032777 3300005535 Bacteria 4432
152 Ga0070684_100034894 3300005535 Bacteria 4303
153 Ga0070684_100049092 3300005535 Bacteria 3662
154 Ga0070684_100057368 3300005535 Bacteria 3400
155 Ga0070697_100000035 3300005536 Bacteria 98818
156 Ga0070697_100000615 3300005536 Bacteria 27079
157 Ga0070697_100001536 3300005536 Bacteria 17584
158 Ga0068853_100001751 3300005539 Bacteria 15924
159 Ga0068853_100003044 3300005539 Bacteria 12805
160 Ga0068853_100005315 3300005539 Bacteria 10081
161 Ga0068853_100013122 3300005539 Bacteria 6761
162 Ga0068853_100021876 3300005539 Bacteria 5334
163 Ga0068853_100053753 3300005539 Bacteria 3469
164 Ga0068853_100172702 3300005539 Bacteria 1956
165 Ga0070672_100007027 3300005543 Bacteria 7612
166 Ga0070672_100021529 3300005543 Bacteria 4720
167 Ga0070672_100084431 3300005543 Bacteria 2550
168 Ga0070695_100008686 3300005545 Bacteria 6038
169 Ga0070695_100016709 3300005545 Bacteria 4444
170 Ga0070695_100049952 3300005545 Bacteria 2679
171 Ga0070695_100150161 3300005545 Bacteria 1625
172 Ga0070696_100000572 3300005546 Bacteria 23515
173 Ga0070696_100047299 3300005546 Bacteria 2985
174 Ga0070696_100048428 3300005546 Bacteria 2950
175 Ga0070696_100114822 3300005546 Bacteria 1942
176 Ga0070693_100004401 3300005547 Bacteria 6659
177 Ga0070693_100007600 3300005547 Bacteria 5306
178 Ga0070665_100098564 3300005548 Bacteria 2927
179 Ga0070704_100039599 3300005549 Bacteria 3237
180 Ga0070704_100076603 3300005549 Bacteria 2447
181 Ga0070704_100094741 3300005549 Bacteria 2234
182 Ga0070704_100132781 3300005549 Bacteria 1932
183 Ga0070704_100193024 3300005549 Bacteria 1638
184 Ga0068855_100000414 3300005563 Bacteria 52978
185 Ga0068855_100000524 3300005563 Bacteria 47035
186 Ga0068855_100001570 3300005563 Bacteria 28673
187 Ga0068855_100008049 3300005563 Bacteria 12738
188 Ga0068855_100008840 3300005563 Bacteria 12174
189 Ga0068855_100011678 3300005563 Bacteria 10614
190 Ga0068855_100018543 3300005563 Bacteria 8367
191 Ga0068855_100035782 3300005563 Bacteria 5914
192 Ga0068855_100036290 3300005563 Bacteria 5868
193 Ga0068855_100069903 3300005563 Bacteria 4085
194 Ga0068855_100092972 3300005563 Bacteria 3478
195 Ga0068855_100136018 3300005563 Bacteria 2804
196 Ga0068855_100286065 3300005563 Bacteria 1829
197 Ga0070664_100000926 3300005564 Bacteria 22932
198 Ga0070664_100010549 3300005564 Bacteria 7489
199 Ga0070664_100010623 3300005564 Bacteria 7460
200 Ga0070664_100062403 3300005564 Bacteria 3177
201 Ga0070664_100132074 3300005564 Bacteria 2194
202 Ga0068857_100004956 3300005577 Bacteria 11310
203 Ga0068857_100006775 3300005577 Bacteria 9858
204 Ga0068857_100017777 3300005577 Bacteria 6233
205 Ga0068857_100059647 3300005577 Bacteria 3390
206 Ga0068857_100073627 3300005577 Bacteria 3044
207 Ga0068857_100114259 3300005577 Bacteria 2428
208 Ga0068854_100046701 3300005578 Bacteria 3084
209 Ga0068854_100207746 3300005578 Bacteria 1543
210 Ga0068856_100000571 3300005614 Bacteria 40367
211 Ga0068856_100001211 3300005614 Bacteria 27074
212 Ga0068856_100001271 3300005614 Bacteria 26542
213 Ga0068856_100007241 3300005614 Bacteria 10824
214 Ga0068856_100009546 3300005614 Bacteria 9425
215 Ga0068856_100013497 3300005614 Bacteria 7909
216 Ga0068856_100024977 3300005614 Bacteria 5824
217 Ga0068856_100025118 3300005614 Bacteria 5806
218 Ga0068856_100027978 3300005614 Bacteria 5500
219 Ga0068856_100069148 3300005614 Bacteria 3492
220 Ga0068856_100095306 3300005614 Bacteria 2964
221 Ga0068856_100140924 3300005614 Bacteria 2418
222 Ga0068856_100186585 3300005614 Bacteria 2088
223 Ga0068856_100206789 3300005614 Bacteria 1977
224 Ga0068856_100255173 3300005614 Bacteria 1768
225 Ga0070702_100004836 3300005615 Bacteria 6195
226 Ga0070702_100068152 3300005615 Bacteria 2093
227 Ga0068852_100000985 3300005616 Bacteria 18756
228 Ga0068852_100005765 3300005616 Bacteria 8890
229 Ga0068852_100006358 3300005616 Bacteria 8530
230 Ga0068852_100011845 3300005616 Bacteria 6591
231 Ga0068852_100015898 3300005616 Bacteria 5853
232 Ga0068852_100234861 3300005616 Bacteria 1750
233 Ga0068852_100276338 3300005616 Bacteria 1618
234 Ga0068859_100001284 3300005617 Bacteria 25635
235 Ga0068859_100020671 3300005617 Bacteria 6606
236 Ga0068859_100038265 3300005617 Bacteria 4812
237 Ga0068859_100199444 3300005617 Bacteria 2086
238 Ga0068864_100000562 3300005618 Bacteria 31752
239 Ga0068864_100001544 3300005618 Bacteria 18972
240 Ga0068864_100004937 3300005618 Bacteria 10929
241 Ga0068864_100011579 3300005618 Bacteria 7283
242 Ga0068864_100018864 3300005618 Bacteria 5767
243 Ga0068864_100205090 3300005618 Bacteria 1813
244 Ga0068861_100002237 3300005719 Bacteria 12553
245 Ga0068861_100043468 3300005719 Bacteria 3373
246 Ga0068851_10002556 3300005834 Bacteria 8006
247 Ga0068851_10060525 3300005834 Bacteria 1939
248 Ga0068870_10008382 3300005840 Bacteria 4649
249 Ga0068870_10008421 3300005840 Bacteria 4638
250 Ga0068863_100003319 3300005841 Bacteria 15889
251 Ga0068863_100016850 3300005841 Bacteria 7008
252 Ga0068863_100214920 3300005841 Bacteria 1852
253 Ga0068858_100002537 3300005842 Bacteria 18405
254 Ga0068858_100006133 3300005842 Bacteria 11726
255 Ga0068858_100007409 3300005842 Bacteria 10615
256 Ga0068858_100008448 3300005842 Bacteria 9900
257 Ga0068858_100008547 3300005842 Bacteria 9838
258 Ga0068858_100021186 3300005842 Bacteria 6069
259 Ga0068858_100024779 3300005842 Bacteria 5587
260 Ga0068858_100150868 3300005842 Bacteria 2185
261 Ga0068860_100003123 3300005843 Bacteria 17110
262 Ga0068860_100027132 3300005843 Bacteria 5518
263 Ga0068860_100081559 3300005843 Bacteria 3076
264 Ga0068862_100012089 3300005844 Bacteria 7134
265 Ga0068862_100185322 3300005844 Bacteria 1870
266 Ga0081455_10028093 3300005937 Bacteria 5143
267 Ga0081538_10023149 3300005981 Bacteria 4474
268 Ga0081538_10044307 3300005981 Bacteria 2777
269 Ga0081538_10048901 3300005981 Bacteria 2572
270 Ga0070712_100013761 3300006175 Bacteria 5176
271 Ga0070712_100028518 3300006175 Bacteria 3734
272 Ga0070712_100162508 3300006175 Bacteria 1725
273 Ga0097621_100000014 3300006237 Bacteria 100839
274 Ga0097621_100000229 3300006237 Bacteria 37450
275 Ga0097621_100049235 3300006237 Bacteria 3422
276 Ga0097621_100050317 3300006237 Bacteria 3388
277 Ga0068871_100000071 3300006358 Bacteria 57255
278 Ga0068871_100000166 3300006358 Bacteria 44052
279 Ga0068871_100006021 3300006358 Bacteria 8537
280 Ga0068871_100008001 3300006358 Bacteria 7587
281 Ga0068871_100015338 3300006358 Bacteria 5731
282 Ga0068871_100030342 3300006358 Bacteria 4256
283 Ga0068871_100122260 3300006358 Bacteria 2200
284 Ga0068871_100127503 3300006358 Bacteria 2155
285 Ga0068871_100143145 3300006358 Bacteria 2034
286 Ga0075428_100005703 3300006844 Bacteria 13843
287 Ga0075428_100016232 3300006844 Bacteria 8231
288 Ga0075428_100026272 3300006844 Bacteria 6448
289 Ga0075428_100062098 3300006844 Bacteria 4091
290 Ga0075430_100031785 3300006846 Bacteria 4480
291 Ga0075430_100129312 3300006846 Bacteria 2105
292 Ga0075431_100000972 3300006847 Bacteria 25462
293 Ga0075431_100005121 3300006847 Bacteria 12895
294 Ga0075431_100057536 3300006847 Bacteria 4010
295 Ga0075431_100133637 3300006847 Bacteria 2558
296 Ga0075431_100166202 3300006847 Bacteria 2268
297 Ga0075433_10049220 3300006852 Bacteria 3667
298 Ga0075433_10052747 3300006852 Bacteria 3544
299 Ga0075433_10065601 3300006852 Bacteria 3184
300 Ga0075433_10072842 3300006852 Bacteria 3021
301 Ga0075434_100164763 3300006871 Bacteria 2236
302 Ga0075434_100200892 3300006871 Bacteria 2013
303 Ga0075434_100328772 3300006871 Bacteria 1549
304 Ga0075429_100000064 3300006880 Bacteria 52724
305 Ga0075429_100019992 3300006880 Bacteria 5806
306 Ga0075429_100028043 3300006880 Bacteria 4886
307 Ga0075429_100063141 3300006880 Bacteria 3227
308 Ga0068865_100002091 3300006881 Bacteria 11788
309 Ga0068865_100059288 3300006881 Bacteria 2676
310 Ga0068865_100138694 3300006881 Bacteria 1831
311 Ga0075436_100010845 3300006914 Bacteria 6251
312 Ga0075436_100013943 3300006914 Bacteria 5501
313 Ga0075436_100016786 3300006914 Bacteria 5011
314 Ga0097620_100001284 3300006931 Bacteria 25635
315 Ga0097620_100020673 3300006931 Bacteria 6606
316 Ga0097620_100038266 3300006931 Bacteria 4812
317 Ga0097620_100199430 3300006931 Bacteria 2086
318 Ga0075435_100076919 3300007076 Bacteria 2736
319 Ga0075435_100113783 3300007076 Bacteria 2252
320 Ga0099794_10034794 3300007265 Bacteria 2375
321 Ga0099794_10049251 3300007265 Bacteria 2024
322 Ga0105240_10007090 3300009093 Bacteria 16338
323 Ga0105240_10012786 3300009093 Bacteria 11566
324 Ga0105240_10042344 3300009093 Bacteria 5803
325 Ga0105240_10048895 3300009093 Bacteria 5343
326 Ga0105240_10058157 3300009093 Bacteria 4827
327 Ga0105240_10058757 3300009093 Bacteria 4800
328 Ga0105240_10096120 3300009093 Bacteria 3611
329 Ga0111539_10003448 3300009094 Bacteria 20824
330 Ga0111539_10016120 3300009094 Bacteria 9273
331 Ga0111539_10110619 3300009094 Bacteria 3224
332 Ga0111539_10189404 3300009094 Bacteria 2401
333 Ga0111539_10232616 3300009094 Bacteria 2146
334 Ga0105245_10002611 3300009098 Bacteria 16234
335 Ga0105245_10002798 3300009098 Bacteria 15691
336 Ga0105245_10022438 3300009098 Bacteria 5541
337 Ga0105245_10106239 3300009098 Bacteria 2605
338 Ga0105245_10120506 3300009098 Bacteria 2450
339 Ga0114129_10013591 3300009147 Bacteria 11600
340 Ga0114129_10016075 3300009147 Bacteria 10646
341 Ga0114129_10023131 3300009147 Bacteria 8815
342 Ga0114129_10034089 3300009147 Bacteria 7191
343 Ga0114129_10145680 3300009147 Bacteria 3245
344 Ga0114129_10349874 3300009147 Bacteria 1958
345 Ga0105243_10048524 3300009148 Bacteria 3347
346 Ga0105241_10002804 3300009174 Bacteria 13044
347 Ga0105241_10003233 3300009174 Bacteria 12120
348 Ga0105241_10064690 3300009174 Bacteria 2824
349 Ga0105241_10073850 3300009174 Bacteria 2654
350 Ga0105241_10138455 3300009174 Bacteria 1979
351 Ga0105242_10020845 3300009176 Bacteria 5141
352 Ga0105242_10034916 3300009176 Bacteria 4031
353 Ga0105242_10122324 3300009176 Bacteria 2235
354 Ga0105248_10004638 3300009177 Bacteria 15202
355 Ga0105248_10006560 3300009177 Bacteria 12762
356 Ga0105248_10007456 3300009177 Bacteria 12003
357 Ga0105248_10008073 3300009177 Bacteria 11555
358 Ga0105248_10038068 3300009177 Bacteria 5382
359 Ga0105237_10007410 3300009545 Bacteria 12015
360 Ga0105237_10052128 3300009545 Bacteria 4108
361 Ga0105237_10094279 3300009545 Bacteria 2982
362 Ga0105237_10163746 3300009545 Bacteria 2223
363 Ga0105238_10000099 3300009551 Bacteria 97818
364 Ga0105238_10003764 3300009551 Bacteria 15071
365 Ga0105238_10005829 3300009551 Bacteria 12195
366 Ga0105238_10010196 3300009551 Bacteria 9421
367 Ga0105238_10016386 3300009551 Bacteria 7501
368 Ga0105238_10035933 3300009551 Bacteria 5037
369 Ga0105238_10040098 3300009551 Bacteria 4747
370 Ga0105238_10040169 3300009551 Bacteria 4741
371 Ga0105238_10081010 3300009551 Bacteria 3235
372 Ga0105249_10000081 3300009553 Bacteria 137945
373 Ga0105239_10004095 3300010375 Bacteria 17531
374 Ga0105239_10004843 3300010375 Bacteria 15928
375 Ga0105239_10035644 3300010375 Bacteria 5463
376 Ga0105239_10061702 3300010375 Bacteria 4114
377 Ga0105239_10076966 3300010375 Bacteria 3670
378 Ga0105239_10079071 3300010375 Bacteria 3619
379 Ga0157373_10006787 3300013100 Bacteria 8526
380 Ga0157373_10009664 3300013100 Bacteria 7119
381 Ga0157373_10063398 3300013100 Bacteria 2617
382 Ga0157371_10029486 3300013102 Bacteria 3967
383 Ga0157370_10000476 3300013104 Bacteria 50116
384 Ga0157370_10006571 3300013104 Bacteria 12807
385 Ga0157370_10014516 3300013104 Bacteria 8052
386 Ga0157370_10022525 3300013104 Bacteria 6268
387 Ga0157370_10026585 3300013104 Bacteria 5712
388 Ga0157370_10029138 3300013104 Bacteria 5422
389 Ga0157370_10049903 3300013104 Bacteria 4002
390 Ga0157370_10096720 3300013104 Bacteria 2770
391 Ga0157370_10110874 3300013104 Bacteria 2565
392 Ga0157369_10000042 3300013105 Bacteria 181784
393 Ga0157369_10085860 3300013105 Bacteria 3362
394 Ga0157369_10110684 3300013105 Bacteria 2920
395 Ga0157369_10166961 3300013105 Bacteria 2321
396 Ga0157374_10000344 3300013296 Bacteria 42978
397 Ga0157374_10001377 3300013296 Bacteria 20643
398 Ga0157374_10003868 3300013296 Bacteria 12565
399 Ga0157374_10006895 3300013296 Bacteria 9662
400 Ga0157374_10007349 3300013296 Bacteria 9391
401 Ga0157378_10000866 3300013297 Bacteria 27978
402 Ga0157378_10071806 3300013297 Bacteria 3109
403 Ga0157378_10214069 3300013297 Bacteria 1828
404 Ga0163162_10002959 3300013306 Bacteria 16208
405 Ga0163162_10007040 3300013306 Bacteria 10903
406 Ga0163162_10104736 3300013306 Bacteria 2924
407 Ga0157372_10001080 3300013307 Bacteria 29682
408 Ga0157372_10004295 3300013307 Bacteria 15232
409 Ga0157372_10004400 3300013307 Bacteria 15026
410 Ga0157372_10010092 3300013307 Bacteria 10034
411 Ga0157372_10027393 3300013307 Bacteria 6205
412 Ga0157372_10028186 3300013307 Bacteria 6128
413 Ga0157372_10032131 3300013307 Bacteria 5753
414 Ga0157372_10041254 3300013307 Bacteria 5102
415 Ga0157372_10125254 3300013307 Bacteria 2954
416 Ga0157372_10160437 3300013307 Bacteria 2599
417 Ga0157372_10473193 3300013307 Bacteria 1461
418 Ga0157375_10005082 3300013308 Bacteria 11414
419 Ga0157375_10018493 3300013308 Bacteria 6321
420 Ga0157375_10035225 3300013308 Unclassified 4776
421 Ga0157375_10068576 3300013308 Bacteria 3549
422 Ga0157375_10097095 3300013308 Bacteria 3020
423 Ga0157375_10179574 3300013308 Bacteria 2268
424 Ga0157375_10238837 3300013308 Bacteria 1976
425 Ga0163163_10002850 3300014325 Bacteria 14610
426 Ga0163163_10004258 3300014325 Bacteria 12196
427 Ga0163163_10009234 3300014325 Bacteria 8794
428 Ga0163163_10039952 3300014325 Bacteria 4580
429 Ga0163163_10114281 3300014325 Bacteria 2730
430 Ga0157380_10003588 3300014326 Bacteria 10676
431 Ga0157380_10009850 3300014326 Bacteria 6860
432 Ga0157380_10150980 3300014326 Bacteria 2008
433 Ga0157380_10154914 3300014326 Bacteria 1985
434 Ga0182008_10000720 3300014497 Bacteria 23630
435 Ga0182008_10010474 3300014497 Bacteria 4960
436 Ga0157377_10001722 3300014745 Bacteria 9535
437 Ga0157377_10021215 3300014745 Bacteria 3415
438 Ga0157377_10052884 3300014745 Bacteria 2294
439 Ga0157379_10001332 3300014968 Bacteria 20156
440 Ga0157379_10006917 3300014968 Bacteria 9811
441 Ga0157379_10011079 3300014968 Bacteria 7860
442 Ga0157379_10032239 3300014968 Bacteria 4671
443 Ga0157376_10001448 3300014969 Bacteria 15629
444 Ga0157376_10001504 3300014969 Bacteria 15385
445 Ga0157376_10017956 3300014969 Bacteria 5410
446 Ga0157376_10033705 3300014969 Bacteria 4127
447 Ga0157376_10053142 3300014969 Bacteria 3372
448 Ga0157376_10071888 3300014969 Bacteria 2941
449 Ga0157376_10190797 3300014969 Bacteria 1879
450 Ga0182007_10000119 3300015262 Bacteria 54423
451 Ga0163161_10007603 3300017792 Bacteria 7496
452 Ga0163161_10015776 3300017792 Bacteria 5268
453 Ga0206356_11297921 3300020070 Bacteria 1638
454 Ga0209759_1000458 3300025256 Bacteria 46338
455 Ga0207656_10008370 3300025321 Bacteria 3804
456 Ga0207653_10000053 3300025885 Bacteria 87641
457 Ga0207682_10009967 3300025893 Bacteria 3732
458 Ga0207682_10010753 3300025893 Bacteria 3583
459 Ga0207688_10002162 3300025901 Bacteria 10569
460 Ga0207680_10037142 3300025903 Bacteria 2810
461 Ga0207680_10045478 3300025903 Bacteria 2588
462 Ga0207647_10021421 3300025904 Bacteria 4314
463 Ga0207699_10106184 3300025906 Bacteria 1792
464 Ga0207645_10007684 3300025907 Bacteria 7593
465 Ga0207645_10020836 3300025907 Bacteria 4283
466 Ga0207645_10062144 3300025907 Bacteria 2386
467 Ga0207643_10006926 3300025908 Bacteria 6078
468 Ga0207643_10009217 3300025908 Bacteria 5300
469 Ga0207705_10007732 3300025909 Bacteria 7902
470 Ga0207684_10000443 3300025910 Bacteria 54670
471 Ga0207684_10002835 3300025910 Bacteria 17218
472 Ga0207684_10026737 3300025910 Unclassified 4919
473 Ga0207684_10040794 3300025910 Bacteria 3936
474 Ga0207654_10000280 3300025911 Bacteria 31003
475 Ga0207654_10000283 3300025911 Bacteria 30936
476 Ga0207707_10000155 3300025912 Bacteria 71477
477 Ga0207707_10000270 3300025912 Bacteria 55930
478 Ga0207707_10000975 3300025912 Bacteria 27500
479 Ga0207707_10002951 3300025912 Bacteria 15147
480 Ga0207707_10004342 3300025912 Bacteria 12548
481 Ga0207707_10005365 3300025912 Bacteria 11203
482 Ga0207707_10013266 3300025912 Bacteria 7179
483 Ga0207707_10013848 3300025912 Bacteria 7033
484 Ga0207707_10029831 3300025912 Bacteria 4770
485 Ga0207707_10058314 3300025912 Bacteria 3360
486 Ga0207707_10185857 3300025912 Bacteria 1814
487 Ga0207695_10005746 3300025913 Bacteria 16336
488 Ga0207695_10019440 3300025913 Bacteria 7823
489 Ga0207695_10029524 3300025913 Bacteria 6055
490 Ga0207695_10032092 3300025913 Bacteria 5752
491 Ga0207695_10075716 3300025913 Bacteria 3423
492 Ga0207695_10084798 3300025913 Bacteria 3198
493 Ga0207695_10105021 3300025913 Bacteria 2812
494 Ga0207695_10140976 3300025913 Bacteria 2359
495 Ga0207695_10151378 3300025913 Bacteria 2259
496 Ga0207695_10189769 3300025913 Bacteria 1973
497 Ga0207671_10012967 3300025914 Bacteria 6669
498 Ga0207693_10054730 3300025915 Bacteria 3130
499 Ga0207693_10079038 3300025915 Bacteria 2574
500 Ga0207693_10116592 3300025915 Bacteria 2097
501 Ga0207663_10031980 3300025916 Bacteria 3119
502 Ga0207660_10000641 3300025917 Bacteria 23532
503 Ga0207660_10006144 3300025917 Bacteria 7794
504 Ga0207660_10013059 3300025917 Bacteria 5438
505 Ga0207660_10048443 3300025917 Bacteria 3007
506 Ga0207660_10136747 3300025917 Bacteria 1870
507 Ga0207657_10001727 3300025919 Bacteria 23554
508 Ga0207657_10047830 3300025919 Bacteria 3737
509 Ga0207657_10053081 3300025919 Bacteria 3514
510 Ga0207657_10066801 3300025919 Bacteria 3060
511 Ga0207657_10084165 3300025919 Bacteria 2666
512 Ga0207657_10104441 3300025919 Bacteria 2347
513 Ga0207649_10054814 3300025920 Bacteria 2483
514 Ga0207652_10000251 3300025921 Bacteria 55866
515 Ga0207652_10005961 3300025921 Bacteria 9860
516 Ga0207652_10006645 3300025921 Bacteria 9317
517 Ga0207652_10018616 3300025921 Bacteria 5698
518 Ga0207652_10047694 3300025921 Bacteria 3659
519 Ga0207652_10073985 3300025921 Bacteria 2965
520 Ga0207646_10000674 3300025922 Bacteria 44214
521 Ga0207646_10000680 3300025922 Bacteria 44066
522 Ga0207646_10009227 3300025922 Bacteria 9771
523 Ga0207646_10042030 3300025922 Unclassified 4107
524 Ga0207646_10092100 3300025922 Bacteria 2713
525 Ga0207681_10017807 3300025923 Bacteria 4467
526 Ga0207681_10092054 3300025923 Bacteria 2167
527 Ga0207694_10000936 3300025924 Bacteria 25749
528 Ga0207694_10002805 3300025924 Bacteria 14070
529 Ga0207694_10010737 3300025924 Bacteria 6916
530 Ga0207694_10025645 3300025924 Bacteria 4481
531 Ga0207694_10037007 3300025924 Bacteria 3746
532 Ga0207694_10050931 3300025924 Bacteria 3209
533 Ga0207659_10000416 3300025926 Bacteria 25703
534 Ga0207659_10099853 3300025926 Bacteria 2186
535 Ga0207659_10147743 3300025926 Bacteria 1832
536 Ga0207687_10048332 3300025927 Bacteria 2953
537 Ga0207687_10062066 3300025927 Bacteria 2641
538 Ga0207700_10010364 3300025928 Bacteria 5876
539 Ga0207700_10010548 3300025928 Bacteria 5838
540 Ga0207700_10028009 3300025928 Bacteria 3953
541 Ga0207664_10003022 3300025929 Bacteria 11188
542 Ga0207664_10013961 3300025929 Bacteria 5789
543 Ga0207664_10053855 3300025929 Bacteria 3186
544 Ga0207664_10074436 3300025929 Bacteria 2744
545 Ga0207664_10091134 3300025929 Bacteria 2499
546 Ga0207644_10005692 3300025931 Bacteria 8112
547 Ga0207690_10003656 3300025932 Bacteria 9162
548 Ga0207690_10009501 3300025932 Bacteria 5776
549 Ga0207690_10033090 3300025932 Bacteria 3322
550 Ga0207706_10000369 3300025933 Bacteria 48716
551 Ga0207706_10001191 3300025933 Bacteria 26232
552 Ga0207706_10017481 3300025933 Bacteria 6463
553 Ga0207706_10031545 3300025933 Bacteria 4720
554 Ga0207706_10185834 3300025933 Bacteria 1825
555 Ga0207686_10028954 3300025934 Bacteria 3262
556 Ga0207670_10080168 3300025936 Bacteria 2281
557 Ga0207669_10037902 3300025937 Bacteria 2771
558 Ga0207669_10062219 3300025937 Bacteria 2298
559 Ga0207704_10001495 3300025938 Bacteria 10470
560 Ga0207704_10041860 3300025938 Bacteria 2691
561 Ga0207704_10094528 3300025938 Bacteria 1974
562 Ga0207691_10012818 3300025940 Bacteria 8024
563 Ga0207691_10013944 3300025940 Bacteria 7668
564 Ga0207691_10024313 3300025940 Bacteria 5697
565 Ga0207691_10029133 3300025940 Bacteria 5165
566 Ga0207711_10003977 3300025941 Bacteria 12713
567 Ga0207711_10073393 3300025941 Bacteria 2973
568 Ga0207711_10091600 3300025941 Bacteria 2674
569 Ga0207711_10124216 3300025941 Bacteria 2307
570 Ga0207711_10184343 3300025941 Bacteria 1899
571 Ga0207711_10251683 3300025941 Bacteria 1622
572 Ga0207689_10000410 3300025942 Bacteria 40080
573 Ga0207689_10002821 3300025942 Bacteria 16043
574 Ga0207689_10005112 3300025942 Bacteria 11794
575 Ga0207661_10000719 3300025944 Bacteria 21519
576 Ga0207661_10014797 3300025944 Bacteria 5724
577 Ga0207661_10022652 3300025944 Bacteria 4735
578 Ga0207661_10061463 3300025944 Bacteria 3035
579 Ga0207661_10063919 3300025944 Bacteria 2982
580 Ga0207661_10070011 3300025944 Bacteria 2862
581 Ga0207661_10182699 3300025944 Bacteria 1833
582 Ga0207679_10000343 3300025945 Bacteria 33879
583 Ga0207679_10032011 3300025945 Bacteria 3687
584 Ga0207679_10135610 3300025945 Bacteria 1982
585 Ga0207679_10184658 3300025945 Bacteria 1728
586 Ga0207667_10000535 3300025949 Bacteria 50094
587 Ga0207667_10008360 3300025949 Bacteria 12300
588 Ga0207667_10010202 3300025949 Bacteria 11002
589 Ga0207667_10013002 3300025949 Bacteria 9555
590 Ga0207667_10018924 3300025949 Bacteria 7703
591 Ga0207667_10023515 3300025949 Bacteria 6785
592 Ga0207667_10048443 3300025949 Bacteria 4493
593 Ga0207667_10093889 3300025949 Bacteria 3098
594 Ga0207667_10115130 3300025949 Bacteria 2771
595 Ga0207667_10164576 3300025949 Bacteria 2281
596 Ga0207667_10296921 3300025949 Bacteria 1650
597 Ga0207651_10000189 3300025960 Bacteria 26894
598 Ga0207651_10139048 3300025960 Bacteria 1873
599 Ga0207712_10000532 3300025961 Bacteria 31279
600 Ga0207668_10005352 3300025972 Bacteria 7549
601 Ga0207640_10021757 3300025981 Bacteria 3827
602 Ga0207658_10005948 3300025986 Bacteria 8330
603 Ga0207658_10199188 3300025986 Bacteria 1670
604 Ga0207677_10000620 3300026023 Bacteria 21704
605 Ga0207677_10008146 3300026023 Bacteria 5835
606 Ga0207677_10017170 3300026023 Bacteria 4307
607 Ga0207677_10026582 3300026023 Bacteria 3633
608 Ga0207677_10042195 3300026023 Bacteria 3023
609 Ga0207677_10136563 3300026023 Bacteria 1871
610 Ga0207703_10002880 3300026035 Bacteria 14646
611 Ga0207703_10033841 3300026035 Bacteria 4053
612 Ga0207703_10047137 3300026035 Bacteria 3474
613 Ga0207703_10079003 3300026035 Bacteria 2736
614 Ga0207639_10015987 3300026041 Bacteria 5300
615 Ga0207639_10016023 3300026041 Bacteria 5294
616 Ga0207639_10037642 3300026041 Bacteria 3594
617 Ga0207639_10054681 3300026041 Bacteria 3052
618 Ga0207639_10090484 3300026041 Bacteria 2447
619 Ga0207639_10093836 3300026041 Bacteria 2408
620 Ga0207639_10094882 3300026041 Bacteria 2396
621 Ga0207639_10134911 3300026041 Bacteria 2048
622 Ga0207639_10149366 3300026041 Bacteria 1956
623 Ga0207678_10000790 3300026067 Bacteria 28986
624 Ga0207678_10001500 3300026067 Bacteria 21396
625 Ga0207678_10003286 3300026067 Bacteria 14585
626 Ga0207678_10016506 3300026067 Bacteria 6483
627 Ga0207678_10044367 3300026067 Bacteria 3847
628 Ga0207708_10015268 3300026075 Bacteria 5758
629 Ga0207708_10083257 3300026075 Bacteria 2459
630 Ga0207708_10207472 3300026075 Bacteria 1565
631 Ga0207702_10001339 3300026078 Bacteria 24625
632 Ga0207702_10002228 3300026078 Bacteria 18591
633 Ga0207702_10003666 3300026078 Bacteria 13910
634 Ga0207702_10013563 3300026078 Bacteria 6769
635 Ga0207702_10014914 3300026078 Bacteria 6445
636 Ga0207702_10042631 3300026078 Bacteria 3807
637 Ga0207702_10052070 3300026078 Bacteria 3462
638 Ga0207702_10072441 3300026078 Bacteria 2970
639 Ga0207702_10085713 3300026078 Bacteria 2745
640 Ga0207702_10110696 3300026078 Bacteria 2441
641 Ga0207702_10129024 3300026078 Bacteria 2273
642 Ga0207702_10152061 3300026078 Bacteria 2106
643 Ga0207641_10007774 3300026088 Bacteria 8908
644 Ga0207641_10101100 3300026088 Bacteria 2540
645 Ga0207641_10126575 3300026088 Bacteria 2288
646 Ga0207641_10184045 3300026088 Bacteria 1915
647 Ga0207641_10229442 3300026088 Bacteria 1725
648 Ga0207648_10037507 3300026089 Bacteria 4270
649 Ga0207648_10038479 3300026089 Bacteria 4208
650 Ga0207648_10044629 3300026089 Bacteria 3889
651 Ga0207648_10136850 3300026089 Bacteria 2158
652 Ga0207648_10142444 3300026089 Bacteria 2113
653 Ga0207676_10001204 3300026095 Bacteria 19366
654 Ga0207676_10001770 3300026095 Bacteria 15831
655 Ga0207676_10006609 3300026095 Bacteria 8202
656 Ga0207676_10011380 3300026095 Bacteria 6359
657 Ga0207676_10025513 3300026095 Bacteria 4385
658 Ga0207674_10000611 3300026116 Bacteria 46923
659 Ga0207674_10006991 3300026116 Bacteria 13202
660 Ga0207674_10023865 3300026116 Bacteria 6542
661 Ga0207674_10027407 3300026116 Bacteria 6027
662 Ga0207674_10027990 3300026116 Bacteria 5956
663 Ga0207674_10038645 3300026116 Bacteria 4950
664 Ga0207674_10058393 3300026116 Bacteria 3909
665 Ga0207674_10084803 3300026116 Bacteria 3165
666 Ga0207675_100000689 3300026118 Bacteria 33348
667 Ga0207675_100047242 3300026118 Bacteria 4020
668 Ga0207675_100111169 3300026118 Bacteria 2585
669 Ga0207683_10042423 3300026121 Bacteria 3974
670 Ga0207698_10004507 3300026142 Bacteria 8496
671 Ga0207698_10011766 3300026142 Bacteria 5689
672 Ga0207698_10011768 3300026142 Bacteria 5689
673 Ga0207698_10014733 3300026142 Bacteria 5209
674 Ga0207698_10155640 3300026142 Bacteria 1990
675 Ga0207698_10156015 3300026142 Bacteria 1989
676 Ga0207698_10203285 3300026142 Bacteria 1776
677 Ga0209995_1009809 3300027471 Bacteria 1551
678 Ga0210002_1002477 3300027617 Unclassified 2665
679 Ga0209971_1002614 3300027682 Unclassified 4317
680 Ga0209974_10000067 3300027876 Bacteria 27577
681 Ga0209974_10003260 3300027876 Bacteria 5865
682 Ga0207428_10004501 3300027907 Bacteria 13221
683 Ga0207428_10008071 3300027907 Bacteria 9550
684 Ga0207428_10008172 3300027907 Bacteria 9469
685 Ga0207428_10042896 3300027907 Bacteria 3657
686 Ga0268265_10001894 3300028380 Bacteria 16646
687 Ga0268264_10006348 3300028381 Bacteria 9962
688 Ga0268264_10034540 3300028381 Bacteria 4160
689 Ga0265334_10000131 3300028573 Bacteria 47027
690 Ga0265334_10000803 3300028573 Bacteria 15713
691 Ga0265334_10026869 3300028573 Bacteria 2321
692 Ga0265318_10000900 3300028577 Bacteria 19390
693 Ga0265322_10007668 3300028654 Bacteria 3147
694 Ga0265322_10019873 3300028654 Bacteria 1925
695 Ga0265336_10001126 3300028666 Bacteria 12830
696 Ga0265336_10001852 3300028666 Bacteria 9175
697 Ga0307515_10141313 3300028794 Bacteria 2580
698 Ga0265338_10001728 3300028800 Bacteria 34565
699 Ga0265338_10004099 3300028800 Bacteria 19961
700 Ga0265338_10007658 3300028800 Bacteria 13319
701 Ga0265338_10007947 3300028800 Bacteria 12996
702 Ga0265338_10008121 3300028800 Bacteria 12817
703 Ga0265338_10013715 3300028800 Bacteria 9115
704 Ga0265338_10016083 3300028800 Bacteria 8167
705 Ga0265338_10018645 3300028800 Bacteria 7415
706 Ga0265338_10053576 3300028800 Bacteria 3606
707 Ga0265324_10000021 3300029957 Bacteria 170598
708 Ga0265330_10000334 3300031235 Bacteria 33914
709 Ga0265330_10001008 3300031235 Bacteria 17120
710 Ga0265330_10004830 3300031235 Bacteria 6794
711 Ga0265330_10010013 3300031235 Bacteria 4485
712 Ga0265330_10023615 3300031235 Bacteria 2791
713 Ga0265332_10000011 3300031238 Bacteria 284299
714 Ga0265332_10000844 3300031238 Bacteria 18600
715 Ga0265332_10012383 3300031238 Bacteria 3785
716 Ga0265328_10000347 3300031239 Bacteria 21777
717 Ga0265328_10004163 3300031239 Bacteria 6308
718 Ga0265328_10014511 3300031239 Bacteria 3101
719 Ga0265328_10023734 3300031239 Bacteria 2324
720 Ga0265320_10022040 3300031240 Bacteria 3416
721 Ga0265320_10023138 3300031240 Bacteria 3312
722 Ga0265325_10000426 3300031241 Bacteria 30282
723 Ga0265325_10003049 3300031241 Bacteria 11076
724 Ga0265325_10004351 3300031241 Bacteria 8964
725 Ga0265325_10006671 3300031241 Bacteria 6984
726 Ga0265325_10016130 3300031241 Bacteria 4180
727 Ga0265325_10030387 3300031241 Bacteria 2897
728 Ga0265325_10046944 3300031241 Bacteria 2237
729 Ga0265325_10048136 3300031241 Bacteria 2205
730 Ga0265329_10002086 3300031242 Bacteria 9298
731 Ga0265329_10003468 3300031242 Bacteria 6859
732 Ga0265340_10000961 3300031247 Bacteria 16412
733 Ga0265340_10012465 3300031247 Bacteria 4490
734 Ga0265340_10014656 3300031247 Bacteria 4088
735 Ga0265340_10017491 3300031247 Bacteria 3709
736 Ga0265340_10062808 3300031247 Bacteria 1773
737 Ga0265339_10000013 3300031249 Bacteria 197953
738 Ga0265339_10000103 3300031249 Bacteria 68631
739 Ga0265339_10002009 3300031249 Bacteria 14947
740 Ga0265339_10010376 3300031249 Bacteria 5790
741 Ga0265339_10017244 3300031249 Bacteria 4280
742 Ga0265339_10023980 3300031249 Bacteria 3521
743 Ga0265339_10024678 3300031249 Bacteria 3460
744 Ga0265339_10029907 3300031249 Bacteria 3087
745 Ga0265339_10047159 3300031249 Bacteria 2366
746 Ga0265331_10000502 3300031250 Bacteria 36921
747 Ga0265331_10003200 3300031250 Bacteria 10686
748 Ga0265331_10003820 3300031250 Bacteria 9552
749 Ga0265331_10019632 3300031250 Bacteria 3487
750 Ga0265331_10030212 3300031250 Bacteria 2698
751 Ga0265327_10000008 3300031251 Bacteria 658870
752 Ga0265327_10000139 3300031251 Bacteria 159492
753 Ga0265327_10000201 3300031251 Bacteria 124359
754 Ga0265327_10000886 3300031251 Bacteria 44160
755 Ga0265327_10004938 3300031251 Bacteria 11476
756 Ga0265327_10007063 3300031251 Bacteria 8787
757 Ga0265327_10010188 3300031251 Bacteria 6642
758 Ga0265327_10013053 3300031251 Bacteria 5548
759 Ga0265327_10029061 3300031251 Bacteria 3149
760 Ga0265327_10032911 3300031251 Bacteria 2898
761 Ga0265316_10000699 3300031344 Bacteria 37344
762 Ga0265316_10000717 3300031344 Bacteria 36575
763 Ga0265316_10004145 3300031344 Bacteria 14490
764 Ga0265316_10005131 3300031344 Bacteria 12833
765 Ga0265316_10006874 3300031344 Bacteria 10797
766 Ga0265316_10011615 3300031344 Bacteria 7931
767 Ga0265316_10013919 3300031344 Bacteria 7116
768 Ga0265316_10017109 3300031344 Bacteria 6275
769 Ga0265316_10017767 3300031344 Bacteria 6132
770 Ga0265316_10079528 3300031344 Bacteria 2515
771 Ga0265316_10116375 3300031344 Bacteria 2021
772 Ga0307513_10001895 3300031456 Bacteria 29712
773 Ga0265313_10006437 3300031595 Bacteria 8313
774 Ga0265313_10007076 3300031595 Bacteria 7751
775 Ga0265313_10009115 3300031595 Bacteria 6489
776 Ga0265313_10011209 3300031595 Bacteria 5588
777 Ga0265313_10012124 3300031595 Bacteria 5303
778 Ga0265313_10040100 3300031595 Bacteria 2317
779 Ga0265313_10047731 3300031595 Bacteria 2071
780 Ga0316575_10010190 3300031665 Bacteria 3447
781 Ga0316575_10019689 3300031665 Bacteria 2584
782 Ga0316579_10001303 3300031691 Bacteria 9005
783 Ga0316579_10005869 3300031691 Bacteria 4978
784 Ga0316579_10030313 3300031691 Bacteria 2471
785 Ga0316579_10064705 3300031691 Bacteria 1725
786 Ga0265314_10000026 3300031711 Bacteria 284299
787 Ga0265314_10003323 3300031711 Bacteria 15673
788 Ga0265314_10007094 3300031711 Bacteria 9772
789 Ga0265314_10009570 3300031711 Bacteria 8165
790 Ga0265314_10009885 3300031711 Bacteria 8004
791 Ga0265314_10013702 3300031711 Bacteria 6536
792 Ga0265314_10025646 3300031711 Unclassified 4442
793 Ga0265314_10026307 3300031711 Bacteria 4372
794 Ga0265314_10068999 3300031711 Bacteria 2374
795 Ga0265314_10072654 3300031711 Bacteria 2297
796 Ga0265314_10102875 3300031711 Bacteria 1832
797 Ga0265342_10002778 3300031712 Bacteria 14826
798 Ga0265342_10007431 3300031712 Bacteria 8019
799 Ga0265342_10009623 3300031712 Bacteria 6784
800 Ga0265342_10009658 3300031712 Bacteria 6766
801 Ga0265342_10020912 3300031712 Bacteria 4185
802 Ga0265342_10027799 3300031712 Bacteria 3529
803 Ga0265342_10050616 3300031712 Bacteria 2481
804 Ga0265342_10076480 3300031712 Bacteria 1940
805 Ga0316576_10007547 3300031727 Bacteria 6860
806 Ga0316576_10013534 3300031727 Bacteria 5428
807 Ga0316576_10045520 3300031727 Bacteria 3173
808 Ga0316576_10047423 3300031727 Bacteria 3113
809 Ga0316576_10050333 3300031727 Bacteria 3029
810 Ga0316576_10059405 3300031727 Bacteria 2799
811 Ga0316576_10123247 3300031727 Bacteria 1947
812 Ga0316578_10003015 3300031728 Bacteria 7588
813 Ga0316578_10003577 3300031728 Bacteria 7142
814 Ga0316578_10014685 3300031728 Bacteria 4191
815 Ga0316578_10034106 3300031728 Bacteria 2920
816 Ga0316577_10008124 3300031733 Bacteria 5611
817 Ga0316577_10021395 3300031733 Bacteria 3589
818 Ga0316577_10073386 3300031733 Bacteria 1910
819 Ga0316577_10076463 3300031733 Bacteria 1869
820 Ga0307410_10014570 3300031852 Bacteria 4631
821 Ga0307406_10116350 3300031901 Bacteria 1850
822 Ga0307407_10038539 3300031903 Bacteria 2650
823 Ga0307409_100001515 3300031995 Bacteria 11498
824 Ga0307415_100206611 3300032126 Bacteria 1563
825 Ga0316583_10000928 3300032133 Bacteria 9441
826 Ga0316583_10005480 3300032133 Bacteria 4552
827 Ga0316583_10024474 3300032133 Bacteria 2156
828 Ga0316583_10035163 3300032133 Bacteria 1778
829 Ga0316585_10016676 3300032137 Bacteria 2214
830 Ga0316580_10026088 3300032139 Bacteria 1806
831 Ga0373930_0000874 3300034816 Bacteria 4306
832 Ga0373959_0010725 3300034820 Bacteria 1607
833 Ga0373940_0001226 3300035088 Bacteria 4537
834 Ga0373932_0001901 3300035112 Bacteria 5583
835 Ga0373957_0061359 3300035120 Bacteria 1457
836 Ga0373946_0076289 3300035171 Bacteria 1459
837 Ga0316574_0000835 3300035398 Bacteria 13455
838 Ga0316574_0001503 3300035398 Bacteria 11109
839 Ga0316574_0001601 3300035398 Bacteria 10843
840 Ga0316574_0002270 3300035398 Bacteria 9574
841 Ga0316574_0032472 3300035398 Bacteria 3173
842 Ga0316574_0035701 3300035398 Bacteria 3040
843 Ga0316574_0039261 3300035398 Bacteria 2910
844 Ga0316574_0076820 3300035398 Bacteria 2116
845 Ga0373924_0002388 3300035410 Bacteria 6319
846 Ga0373931_0000010 3300035691 Bacteria 334069
847 Ga0373931_0002528 3300035691 Bacteria 8119
848 Ga0373931_0071473 3300035691 Bacteria 1896
849 Ga0373935_0072390 3300035692 Bacteria 2225
850 Ga0373927_0012329 3300035695 Bacteria 5689
851 Ga0373933_0027064 3300035724 Bacteria 3300
852 Ga0373933_0087718 3300035724 Bacteria 1917
853 Ga0373937_0018836 3300036401 Bacteria 6172
854 Ga0373937_0032553 3300036401 Bacteria 4730
855 Ga0373937_0083142 3300036401 Bacteria 2962
856 Ga0373937_0137296 3300036401 Bacteria 2287
857 Ga0316582_0000151 3300036647 Bacteria 20947
858 Ga0316582_0002485 3300036647 Bacteria 8681
859 Ga0316582_0002567 3300036647 Bacteria 8599
860 Ga0316582_0008545 3300036647 Bacteria 5511
861 Ga0316582_0010892 3300036647 Bacteria 5004
862 Ga0316584_0001559 3300036712 Bacteria 13892
863 Ga0316584_0004770 3300036712 Bacteria 8991
864 Ga0316584_0006834 3300036712 Bacteria 7747
865 Ga0316584_0009910 3300036712 Bacteria 6635
866 Ga0316584_0013176 3300036712 Bacteria 5846
867 Ga0316584_0015663 3300036712 Bacteria 5425
868 Ga0316584_0020955 3300036712 Bacteria 4747
869 Ga0316584_0099487 3300036712 Bacteria 2178
870 Ga0316584_0107607 3300036712 Bacteria 2086
871 Ga0316584_0185042 3300036712 Bacteria 1541
872 Ga0373925_0002495 3300037068 Bacteria 14707
873 Ga0373925_0011044 3300037068 Bacteria 6558
874 Ga0373925_0034995 3300037068 Bacteria 3704
875 Ga0395900_0124564 3300037418 Bacteria 2643
876 Ga0395900_0263082 3300037418 Bacteria 1722
877 Ga0395898_0198142 3300037466 Bacteria 1918
878 Ga0395905_0002225 3300037471 Bacteria 21882
879 Ga0395905_0034195 3300037471 Bacteria 4772
880 Ga0395905_0103505 3300037471 Bacteria 2673
881 Ga0400483_027531 3300039062 Bacteria 9448
882 Ga0400483_062504 3300039062 Bacteria 2497
883 Ga0400483_087189 3300039062 Bacteria 18271
884 Ga0400483_247359 3300039062 Bacteria 1903
885 Ga0436365_0014263 3300039437 Bacteria 7602
886 Ga0436365_1360619 3300039437 Bacteria 6605
887 Ga0451789_0749045 3300041443 Bacteria 1822
888 Ga0451841_0881987 3300041498 Bacteria 3860
889 Ga0439448_0001294 3300042005 Bacteria 6400
890 Ga0439435_0000521 3300042436 Bacteria 6160
891 Ga0451577_0000432 3300042876 Bacteria 74811
892 Ga0451577_0001184 3300042876 Bacteria 36620
893 Ga0451577_0003034 3300042876 Bacteria 19097
894 Ga0451577_0010584 3300042876 Bacteria 8796
895 Ga0451577_0031938 3300042876 Bacteria 4747
896 Ga0451577_0047664 3300042876 Bacteria 3831
897 Ga0451577_0066911 3300042876 Bacteria 3204
898 Ga0451577_0316568 3300042876 Bacteria 1415
899 Ga0453683_0002133 3300044673 Bacteria 15770
900 Ga0453683_0004808 3300044673 Bacteria 9511
901 Ga0453683_0020439 3300044673 Bacteria 4231
902 Ga0453683_0123739 3300044673 Bacteria 1628
903 Ga0453684_0000104 3300044712 Bacteria 365431
904 Ga0453684_0000125 3300044712 Bacteria 336972
905 Ga0453684_0004446 3300044712 Bacteria 29581
906 Ga0453684_0020077 3300044712 Bacteria 10114
907 Ga0453684_0023409 3300044712 Bacteria 9101
908 Ga0453684_0054899 3300044712 Bacteria 5184
909 Ga0453684_0185466 3300044712 Bacteria 2439
910 Ga0453684_0198357 3300044712 Bacteria 2341
911 Ga0453684_0307768 3300044712 Bacteria 1799
912 Ga0466959_0046939 3300045049 Bacteria 3178
913 Ga0451576_0002213 3300045051 Bacteria 29932
914 Ga0451576_0002908 3300045051 Bacteria 24421
915 Ga0451576_0003426 3300045051 Bacteria 21810
916 Ga0451576_0004734 3300045051 Bacteria 17490
917 Ga0451576_0015833 3300045051 Bacteria 8341
918 Ga0451576_0020097 3300045051 Bacteria 7278
919 Ga0451576_0034864 3300045051 Bacteria 5343
920 Ga0451576_0088529 3300045051 Bacteria 3220
921 Ga0451576_0143321 3300045051 Bacteria 2492
922 Ga0451576_0163397 3300045051 Bacteria 2324
923 Ga0451576_0221742 3300045051 Bacteria 1974
924 Ga0495592_0049565 3300046454 Bacteria 3122
925 Ga0495629_0089600 3300046459 Bacteria 2146
926 Ga0495651_0000722 3300046462 Bacteria 25617
927 Ga0495651_0010627 3300046462 Bacteria 7081
928 Ga0495651_0072805 3300046462 Bacteria 2609
929 Ga0495651_0152445 3300046462 Bacteria 1664
930 Ga0495580_0040882 3300046472 Bacteria 3309
931 Ga0495580_0061713 3300046472 Bacteria 2631
932 Ga0495582_0011157 3300046473 Bacteria 4948
933 Ga0495582_0018685 3300046473 Bacteria 3789
934 Ga0495664_0051989 3300046477 Bacteria 2433
935 Ga0495608_0029543 3300046511 Bacteria 3717
936 Ga0495608_0036834 3300046511 Bacteria 3291
937 Ga0495608_0038775 3300046511 Bacteria 3197
938 Ga0495628_0151960 3300046516 Bacteria 1763
939 Ga0495652_0013232 3300046529 Bacteria 7427
940 Ga0495652_0050131 3300046529 Bacteria 3571
941 Ga0495640_0089877 3300046533 Bacteria 2028
942 Ga0495586_0007072 3300046535 Bacteria 5982
943 Ga0495586_0024415 3300046535 Bacteria 3232
944 Ga0495586_0062850 3300046535 Bacteria 2022
945 Ga0495587_0015933 3300046536 Bacteria 4680
946 Ga0495587_0017777 3300046536 Bacteria 4411
947 Ga0495587_0078305 3300046536 Bacteria 1918
948 Ga0495645_0001987 3300046543 Bacteria 13893
949 Ga0495645_0029015 3300046543 Bacteria 4021
950 Ga0495667_0013090 3300046559 Bacteria 5619
951 Ga0495667_0043742 3300046559 Bacteria 2967
952 Ga0495634_0005034 3300046642 Bacteria 10203
953 Ga0495635_0037534 3300046663 Bacteria 3354
954 Ga0495635_0074084 3300046663 Bacteria 2332
955 Ga0495635_0104060 3300046663 Bacteria 1940
956 Ga0495599_0014798 3300046678 Bacteria 4831
957 Ga0495599_0106251 3300046678 Bacteria 1749
958 Ga0495623_0008194 3300046679 Bacteria 6797
959 Ga0495623_0034135 3300046679 Bacteria 3263
960 Ga0495647_0035046 3300046681 Bacteria 1883
961 Ga0495647_0040268 3300046681 Bacteria 1775
962 Ga0495658_0063075 3300046683 Bacteria 2132
963 Ga0495658_0148814 3300046683 Bacteria 1437
964 Ga0495613_0006054 3300046689 Bacteria 9053
965 Ga0495613_0015673 3300046689 Bacteria 5641
966 Ga0495613_0105775 3300046689 Bacteria 2031
967 Ga0495671_0028432 3300046692 Bacteria 2880
968 Ga0495600_0050435 3300046809 Bacteria 2716
969 Ga0495604_0062023 3300047317 Bacteria 2858
970 Ga0495674_0252299 3300047319 Bacteria 1452
971 Ga0495672_0000884 3300047320 Bacteria 31539
972 Ga0495680_0002645 3300047322 Bacteria 18132
973 Ga0495675_0007009 3300047444 Bacteria 6931
974 Ga0495675_0023426 3300047444 Bacteria 3934
975 Ga0495684_0006680 3300047471 Bacteria 8950
976 Ga0495602_0047025 3300048088 Bacteria 3892
977 Ga0495602_0124844 3300048088 Bacteria 2064
978 Ga0495602_0127850 3300048088 Bacteria 2032
979 Ga0496100_0020618 3300048903 Bacteria 3955
980 Ga0496100_0031780 3300048903 Bacteria 3285
981 Ga0496101_0012795 3300048904 Bacteria 5611
982 Ga0496101_0201870 3300048904 Bacteria 1537
983 Ga0496102_0006170 3300048905 Bacteria 10220
984 Ga0496102_0039428 3300048905 Bacteria 4269
985 Ga0496102_0041715 3300048905 Bacteria 4157
986 Ga0496102_0140597 3300048905 Bacteria 2263
987 Ga0496102_0190131 3300048905 Bacteria 1934
988 Ga0496102_0319306 3300048905 Bacteria 1463
989 Ga0496103_0028460 3300048906 Bacteria 3391
990 Ga0496103_0073999 3300048906 Bacteria 2135
991 Ga0496104_0008382 3300048907 Bacteria 9187
992 Ga0496104_0012867 3300048907 Bacteria 7537
993 Ga0496104_0021107 3300048907 Bacteria 5975
994 Ga0496104_0036823 3300048907 Bacteria 4575
995 Ga0496104_0089303 3300048907 Bacteria 2944
996 Ga0496104_0155895 3300048907 Bacteria 2191
997 Ga0496104_0204917 3300048907 Bacteria 1884
998 Ga0496104_0284936 3300048907 Bacteria 1565
999 Ga0496105_0003890 3300048908 Bacteria 11161
1000 Ga0496105_0008678 3300048908 Bacteria 7905
1001 Ga0496105_0057782 3300048908 Bacteria 3203
1002 Ga0496105_0161002 3300048908 Bacteria 1842
1003 Ga0496106_0011745 3300048909 Bacteria 6466
1004 Ga0496106_0062862 3300048909 Bacteria 2820
1005 Ga0496106_0079266 3300048909 Bacteria 2521
1006 Ga0496107_0032857 3300048910 Bacteria 3710
1007 Ga0496107_0049592 3300048910 Bacteria 3025
1008 Ga0496108_0004718 3300048911 Bacteria 10992
1009 Ga0496108_0009710 3300048911 Bacteria 7799
1010 Ga0496108_0012603 3300048911 Bacteria 6887
1011 Ga0496109_0011522 3300048912 Bacteria 7607
1012 Ga0496109_0016429 3300048912 Bacteria 6471
1013 Ga0496109_0124563 3300048912 Bacteria 2402
1014 Ga0496109_0216975 3300048912 Bacteria 1799
1015 Ga0496110_0004405 3300048913 Bacteria 10906
1016 Ga0496110_0013314 3300048913 Bacteria 6796
1017 Ga0496110_0020051 3300048913 Bacteria 5638
1018 Ga0496110_0043809 3300048913 Bacteria 3907
1019 Ga0496110_0091193 3300048913 Bacteria 2726
1020 Ga0496111_0002300 3300048914 Bacteria 11484
1021 Ga0496111_0044808 3300048914 Bacteria 3180
1022 Ga0496111_0123041 3300048914 Bacteria 1917
1023 Ga0496111_0158682 3300048914 Bacteria 1679
1024 Ga0496111_0164530 3300048914 Bacteria 1647
1025 Ga0496112_0006868 3300048915 Bacteria 10035
1026 Ga0496113_0013847 3300048916 Bacteria 5481
1027 Ga0496114_0003419 3300048917 Bacteria 12184
1028 Ga0496114_0014551 3300048917 Bacteria 6320
1029 Ga0496114_0049805 3300048917 Bacteria 3486
1030 Ga0496114_0059806 3300048917 Bacteria 3183
1031 Ga0496114_0106117 3300048917 Bacteria 2403
1032 Ga0496114_0126518 3300048917 Bacteria 2203
1033 Ga0496114_0134711 3300048917 Bacteria 2136
1034 Ga0496115_0025365 3300048918 Bacteria 4615
1035 Ga0496116_0013525 3300048919 Bacteria 6571
1036 Ga0496117_0000135 3300048920 Bacteria 160708
1037 Ga0496118_0000098 3300048921 Bacteria 160610
1038 Ga0496119_0008284 3300048922 Bacteria 9172
1039 Ga0496121_0001675 3300048924 Bacteria 36420
1040 Ga0496126_0020593 3300048929 Bacteria 6459
1041 Ga0501031_0001007 3300049568 Bacteria 17096
1042 Ga0501031_0020481 3300049568 Bacteria 4312
1043 Ga0501031_0027058 3300049568 Bacteria 3738
1044 Ga0501031_0132974 3300049568 Bacteria 1625
1045 Ga0501032_0000167 3300049569 Bacteria 53430
1046 Ga0501032_0007868 3300049569 Bacteria 7767
1047 Ga0501032_0009061 3300049569 Bacteria 7227
1048 Ga0501032_0091514 3300049569 Bacteria 2018
1049 Ga0501033_0000280 3300049570 Bacteria 49197
1050 Ga0501033_0003099 3300049570 Bacteria 13806
1051 Ga0501033_0003516 3300049570 Bacteria 12828
1052 Ga0501033_0004862 3300049570 Bacteria 10705
1053 Ga0501034_0013851 3300049571 Bacteria 8300
1054 Ga0501034_0016867 3300049571 Bacteria 7489
1055 Ga0501034_0019794 3300049571 Bacteria 6879
1056 Ga0501034_0088872 3300049571 Bacteria 3087
1057 Ga0501034_0214528 3300049571 Bacteria 1879
1058 Ga0501036_0021687 3300049572 Bacteria 5400
1059 Ga0501036_0030085 3300049572 Bacteria 4587
1060 Ga0501036_0047473 3300049572 Bacteria 3636
1061 Ga0501036_0055259 3300049572 Bacteria 3363
1062 Ga0501036_0100510 3300049572 Bacteria 2446
1063 Ga0501036_0183116 3300049572 Bacteria 1763
1064 Ga0501037_0002482 3300049573 Bacteria 13320
1065 Ga0501037_0011560 3300049573 Bacteria 6497
1066 Ga0501037_0047369 3300049573 Bacteria 3150
1067 Ga0501037_0094697 3300049573 Bacteria 2159
1068 Ga0501037_0095100 3300049573 Bacteria 2154
1069 Ga0501038_0000229 3300049574 Bacteria 47553
1070 Ga0501038_0004863 3300049574 Bacteria 12478
1071 Ga0501038_0006453 3300049574 Bacteria 10857
1072 Ga0501038_0014688 3300049574 Bacteria 7134
1073 Ga0501038_0018426 3300049574 Bacteria 6303
1074 Ga0501038_0022765 3300049574 Bacteria 5609
1075 Ga0501038_0039828 3300049574 Bacteria 4110
1076 Ga0501038_0083590 3300049574 Bacteria 2687
1077 Ga0501039_0000387 3300049575 Bacteria 31653
1078 Ga0501039_0003397 3300049575 Bacteria 11900
1079 Ga0501039_0017945 3300049575 Bacteria 5427
1080 Ga0501039_0021496 3300049575 Bacteria 4949
1081 Ga0501039_0031047 3300049575 Bacteria 4118
1082 Ga0501039_0034279 3300049575 Bacteria 3918
1083 Ga0501039_0098495 3300049575 Bacteria 2281
1084 Ga0501039_0143569 3300049575 Bacteria 1875
1085 Ga0501040_0002042 3300049576 Bacteria 12996
1086 Ga0501040_0019445 3300049576 Bacteria 4517
1087 Ga0501040_0034984 3300049576 Bacteria 3404
1088 Ga0501041_0003026 3300049577 Bacteria 9634
1089 Ga0501041_0018700 3300049577 Bacteria 4127
1090 Ga0501041_0036575 3300049577 Bacteria 2974
1091 Ga0501041_0042345 3300049577 Bacteria 2767
1092 Ga0501042_0002284 3300049578 Bacteria 11707
1093 Ga0501042_0007841 3300049578 Bacteria 7020
1094 Ga0501042_0022259 3300049578 Bacteria 4428
1095 Ga0501043_0000738 3300049579 Bacteria 28995
1096 Ga0501043_0008870 3300049579 Bacteria 7913
1097 Ga0501043_0022536 3300049579 Bacteria 4938
1098 Ga0501043_0030827 3300049579 Bacteria 4216
1099 Ga0501043_0032621 3300049579 Bacteria 4095
1100 Ga0501043_0039334 3300049579 Bacteria 3717
1101 Ga0501046_0000422 3300049580 Bacteria 42250
1102 Ga0501046_0030946 3300049580 Bacteria 4343
1103 Ga0501046_0051650 3300049580 Bacteria 3243
1104 Ga0501047_0002404 3300049581 Bacteria 17888
1105 Ga0501047_0031282 3300049581 Bacteria 5133
1106 Ga0501048_0002435 3300049582 Bacteria 14205
1107 Ga0501048_0018650 3300049582 Bacteria 5102
1108 Ga0501048_0025182 3300049582 Bacteria 4336
1109 Ga0501068_0000685 3300049584 Bacteria 17325
1110 Ga0501068_0004213 3300049584 Bacteria 7802
1111 Ga0501068_0019950 3300049584 Bacteria 3901
1112 Ga0501068_0022839 3300049584 Bacteria 3662
1113 Ga0501068_0052074 3300049584 Bacteria 2477
1114 Ga0501069_0000183 3300049585 Bacteria 28405
1115 Ga0501069_0003234 3300049585 Bacteria 8355
1116 Ga0501070_0002006 3300049586 Bacteria 17889
1117 Ga0501070_0003803 3300049586 Bacteria 13032
1118 Ga0501070_0015028 3300049586 Bacteria 6513
1119 Ga0501070_0048941 3300049586 Bacteria 3510
1120 Ga0501071_0024392 3300049587 Bacteria 4231
1121 Ga0501071_0025266 3300049587 Bacteria 4160
1122 Ga0501071_0042309 3300049587 Bacteria 3263
1123 Ga0501071_0078808 3300049587 Bacteria 2408
1124 Ga0501071_0091180 3300049587 Bacteria 2239
1125 Ga0501072_0000929 3300049588 Bacteria 21565
1126 Ga0501072_0002538 3300049588 Bacteria 13679
1127 Ga0501072_0058627 3300049588 Bacteria 3034
1128 Ga0501073_0002721 3300049589 Bacteria 13247
1129 Ga0501073_0007592 3300049589 Bacteria 8056
1130 Ga0501073_0032687 3300049589 Bacteria 3709
1131 Ga0501074_0031348 3300049590 Bacteria 3852
1132 Ga0501075_0005663 3300049591 Bacteria 8550
1133 Ga0501075_0047166 3300049591 Bacteria 3238
1134 Ga0501075_0054505 3300049591 Bacteria 3008
1135 Ga0501075_0064465 3300049591 Bacteria 2763
1136 Ga0501075_0113840 3300049591 Bacteria 2057
1137 Ga0501076_0011604 3300049592 Bacteria 6573
1138 Ga0501076_0014118 3300049592 Bacteria 6006
1139 Ga0501076_0044681 3300049592 Bacteria 3494
1140 Ga0501076_0052624 3300049592 Bacteria 3225
1141 Ga0501076_0057659 3300049592 Bacteria 3084
1142 Ga0501077_0044738 3300049593 Bacteria 2811
1143 Ga0501077_0110198 3300049593 Bacteria 1744
1144 Ga0501079_0002260 3300049741 Bacteria 13896
1145 Ga0501079_0038750 3300049741 Bacteria 3675
1146 Ga0501079_0096369 3300049741 Bacteria 2293
1147 Ga0501079_0135481 3300049741 Bacteria 1917
1148 Ga0501080_0009843 3300049742 Bacteria 8736
1149 Ga0501080_0023075 3300049742 Bacteria 5769
1150 Ga0501080_0023133 3300049742 Bacteria 5762
1151 Ga0501080_0048979 3300049742 Bacteria 3932
1152 Ga0501080_0051833 3300049742 Bacteria 3820
1153 Ga0501080_0059272 3300049742 Bacteria 3563
1154 Ga0501081_0001591 3300049743 Bacteria 14001
1155 Ga0501081_0104392 3300049743 Bacteria 2006
1156 Ga0501083_0011631 3300049744 Bacteria 6176
1157 Ga0501035_0002589 3300049822 Bacteria 17661
1158 Ga0501035_0007297 3300049822 Bacteria 10341
1159 Ga0501035_0054086 3300049822 Bacteria 3588
1160 Ga0501035_0073114 3300049822 Bacteria 3033
1161 Ga0501044_0000323 3300049823 Bacteria 60420
1162 Ga0501044_0000514 3300049823 Bacteria 47072
1163 Ga0501044_0002434 3300049823 Bacteria 21234
1164 Ga0501044_0006808 3300049823 Bacteria 12594
1165 Ga0501044_0007920 3300049823 Bacteria 11680
1166 Ga0501044_0030465 3300049823 Bacteria 5686
1167 Ga0501045_0000237 3300049824 Bacteria 32030
1168 Ga0501045_0007689 3300049824 Bacteria 7496
1169 Ga0501045_0010042 3300049824 Bacteria 6622
1170 Ga0501045_0047829 3300049824 Bacteria 3116
1171 nmdc:mga05p37_141138_c1 3300050507 Bacteria 2952
1172 nmdc:mga05p37_15817_c1 3300050507 Bacteria 9074
1173 nmdc:mga05p37_169669_c2 3300050507 Bacteria 1693
1174 nmdc:mga05p37_171815_c1 3300050507 Bacteria 2643
1175 nmdc:mga05p37_68180_c1 3300050507 Bacteria 4375
1176 nmdc:mga05p37_94311_c1 3300050507 Bacteria 3688
1177 nmdc:mga09592_116856_c1 3300050508 Bacteria 2289
1178 nmdc:mga09592_49229_c1 3300050508 Bacteria 2796
1179 nmdc:mga09592_796_c1 3300050508 Bacteria 24402
1180 nmdc:mga0qj67_39487_c1 3300050509 Bacteria 3707
1181 nmdc:mga0qj67_6216_c1 3300050509 Bacteria 8767
1182 nmdc:mga06r32_104142_c1 3300050510 Bacteria 2787
1183 nmdc:mga06r32_119442_c1 3300050510 Bacteria 2599
1184 nmdc:mga06r32_54924_c1 3300050510 Bacteria 3820
1185 nmdc:mga06r32_56427_c1 3300050510 Bacteria 3770
1186 nmdc:mga06r32_66005_c1 3300050510 Bacteria 3492
1187 nmdc:mga06r32_810_c1 3300050510 Bacteria 27781
1188 nmdc:mga08y16_13968_c1 3300050511 Bacteria 8453
1189 nmdc:mga08y16_160883_c1 3300050511 Bacteria 2333
1190 nmdc:mga08y16_18798_c1 3300050511 Bacteria 7281
1191 nmdc:mga08y16_19888_c1 3300050511 Bacteria 7082
1192 nmdc:mga08y16_57007_c1 3300050511 Bacteria 4083
1193 nmdc:mga0n895_68039_c1 3300050512 Bacteria 3528
1194 nmdc:mga08x19_106227_c1 3300050514 Bacteria 1868
1195 nmdc:mga08x19_13893_c1 3300050514 Bacteria 4876
1196 nmdc:mga08x19_24216_c1 3300050514 Bacteria 3770
1197 nmdc:mga0a205_107256_c1 3300050515 Bacteria 2691
1198 nmdc:mga0a205_131124_c1 3300050515 Bacteria 2407
1199 Ga0495601_0064162 3300053077 Bacteria 2335
1200 Ga0495595_0008665 3300053084 Bacteria 4184
1201 Ga0495619_0017931 3300053085 Bacteria 4488
1202 Ga0495619_0018671 3300053085 Bacteria 4401
1203 Ga0495619_0028954 3300053085 Bacteria 3575
1204 Ga0495619_0033006 3300053085 Bacteria 3361
1205 Ga0495619_0035380 3300053085 Bacteria 3248
1206 Ga0495619_0097620 3300053085 Bacteria 1996
1207 Ga0500566_0040501 3300053094 Bacteria 2693
1208 Ga0500607_030326 3300053121 Bacteria 2982
1209 Ga0500568_0000135 3300053139 Bacteria 66519
1210 Ga0500616_0000755 3300053153 Bacteria 37233
1211 Ga0500636_0000213 3300053177 Bacteria 31500
1212 Ga0500637_0006937 3300053178 Bacteria 5630
1213 Ga0501084_0009817 3300054114 Bacteria 7912
1214 Ga0501084_0031430 3300054114 Bacteria 4438
1215 Ga0501084_0034157 3300054114 Bacteria 4252
1216 Ga0501082_0006386 3300060353 Bacteria 10228
1217 Ga0501082_0026658 3300060353 Bacteria 4982
1218 Ga0501082_0038447 3300060353 Bacteria 4129
1219 Ga0501082_0098736 3300060353 Bacteria 2525
1220 Ga0501082_0100821 3300060353 Bacteria 2497
1221 Ga0530510_0009754 3300061734 Bacteria 6738
1222 Ga0530510_0012839 3300061734 Bacteria 5888
1223 Ga0530510_0077492 3300061734 Bacteria 2416
1224 Ga0530510_0167361 3300061734 Bacteria 1628
1225 2739612495 2739367655 Bacteria 4051151
1226 2867308048 2867302475 Bacteria 7087181
1227 2867318489 2867312974 Bacteria 7058875
1228 2867320473 2867319477 Bacteria 7069771
1229 2881928623 2881927736 Bacteria 3993927
1230 2887378819 2887375801 Bacteria 5334027
1231 Ga0157370_10009888
1232 Ga0065704_10001221
1233 Ga0065715_10138400
1234 Ga0065707_10001278
1235 Ga0065707_10089312
1236 Ga0070658_10000686
1237 Ga0070658_10026401
1238 Ga0070676_10000222
1239 Ga0070683_100000521
1240 Ga0070683_100008243
1241 Ga0070683_100010563
1242 Ga0070683_100011682
1243 Ga0070683_100069587
1244 Ga0070683_100090408
1245 Ga0070683_100196614
1246 Ga0070683_100204062
1247 Ga0070690_100002441
1248 Ga0070670_100025475
1249 Ga0070670_100026422
1250 Ga0070670_100171873
1251 Ga0070677_10006494
1252 Ga0070677_10006951
1253 Ga0068869_100003200
1254 Ga0068869_100131544
1255 Ga0068869_100163662
1256 Ga0070666_10002423
1257 Ga0070666_10003483
1258 Ga0070666_10064334
1259 Ga0070666_10106295
1260 Ga0070680_100000496
1261 Ga0070680_100000686
1262 Ga0070680_100010122
1263 Ga0070680_100022885
1264 Ga0070680_100024504
1265 Ga0070680_100118172
1266 Ga0070680_100151246
1267 Ga0070680_100166874
1268 Ga0070680_100179283
1269 Ga0070682_100000296
1270 Ga0070682_100001443
1271 Ga0070682_100003005
1272 Ga0070682_100004882
1273 Ga0070682_100013676
1274 Ga0070682_100024788
1275 Ga0068868_100000767
1276 Ga0068868_100004781
1277 Ga0068868_100033664
1278 Ga0068868_100043729
1279 Ga0070660_100001492
1280 Ga0070660_100002914
1281 Ga0070660_100036561
1282 Ga0070660_100062257
1283 Ga0070689_100101089
1284 Ga0070689_100147503
1285 Ga0070691_10028911
1286 Ga0070661_100000821
1287 Ga0070661_100007462
1288 Ga0070661_100043507
1289 Ga0070692_10001608
1290 Ga0070692_10024877
1291 Ga0070668_100007558
1292 Ga0070669_100088488
1293 Ga0070669_100109796
1294 Ga0070675_100000244
1295 Ga0070675_100029173
1296 Ga0070675_100070567
1297 Ga0070675_100088190
1298 Ga0070675_100115349
1299 Ga0070671_100239064
1300 Ga0070674_100001066
1301 Ga0070674_100053015
1302 Ga0070673_100001348
1303 Ga0070673_100001792
1304 Ga0070673_100002263
1305 Ga0070673_100075542
1306 Ga0070688_100016856
1307 Ga0070659_100003371
1308 Ga0070659_100004685
1309 Ga0070659_100013498
1310 Ga0070659_100037536
1311 Ga0070659_100050095
1312 Ga0070667_100005756
1313 Ga0070667_100011925
1314 Ga0070667_100014768
1315 Ga0070703_10007873
1316 Ga0070703_10010267
1317 Ga0070709_10022408
1318 Ga0070709_10086595
1319 Ga0070714_100002263
1320 Ga0070714_100005415
1321 Ga0070714_100057642
1322 Ga0070714_100090177
1323 Ga0070713_100000636
1324 Ga0070713_100202956
1325 Ga0070713_100219357
1326 Ga0070711_100013432
1327 Ga0070705_100075217
1328 Ga0070705_100111864
1329 Ga0070700_100026443
1330 Ga0070700_100113221
1331 Ga0070694_100065637
1332 Ga0070708_100001524
1333 Ga0070708_100076151
1334 Ga0070663_100002959
1335 Ga0070663_100003859
1336 Ga0070663_100010068
1337 Ga0070663_100024000
1338 Ga0070663_100058024
1339 Ga0070678_100025037
1340 Ga0070678_100200531
1341 Ga0070678_100201720
1342 Ga0070662_100001044
1343 Ga0070662_100002448
1344 Ga0070662_100054166
1345 Ga0070681_10000034
1346 Ga0070681_10000474
1347 Ga0070681_10011914
1348 Ga0070681_10032224
1349 Ga0070681_10037614
1350 Ga0070681_10038380
1351 Ga0070681_10074934
1352 Ga0068867_100019381
1353 Ga0070685_10036870
1354 Ga0070706_100000575
1355 Ga0070706_100025719
1356 Ga0070706_100043908
1357 Ga0070706_100049705
1358 Ga0070707_100000941
1359 Ga0070707_100011349
1360 Ga0070707_100042195
1361 Ga0070707_100131183
1362 Ga0070698_100003318
1363 Ga0070698_100004458
1364 Ga0070698_100007700
1365 Ga0070698_100012588
1366 Ga0070698_100028967
1367 Ga0070698_100049362
1368 Ga0070698_100064599
1369 Ga0070698_100156054
1370 Ga0070699_100006715
1371 Ga0070699_100012835
1372 Ga0070699_100027460
1373 Ga0070699_100046228
1374 Ga0070699_100069353
1375 Ga0070679_100000306
1376 Ga0070679_100005633
1377 Ga0070679_100005977
1378 Ga0070679_100023633
1379 Ga0070679_100076045
1380 Ga0070684_100019471
1381 Ga0070684_100032777
1382 Ga0070684_100034894
1383 Ga0070684_100049092
1384 Ga0070684_100057368
1385 Ga0070697_100000035
1386 Ga0070697_100000615
1387 Ga0070697_100001536
1388 Ga0068853_100001751
1389 Ga0068853_100003044
1390 Ga0068853_100005315
1391 Ga0068853_100013122
1392 Ga0068853_100021876
1393 Ga0068853_100053753
1394 Ga0068853_100172702
1395 Ga0070672_100007027
1396 Ga0070672_100021529
1397 Ga0070672_100084431
1398 Ga0070695_100008686
1399 Ga0070695_100016709
1400 Ga0070695_100049952
1401 Ga0070695_100150161
1402 Ga0070696_100000572
1403 Ga0070696_100047299
1404 Ga0070696_100048428
1405 Ga0070696_100114822
1406 Ga0070693_100004401
1407 Ga0070693_100007600
1408 Ga0070665_100098564
1409 Ga0070704_100039599
1410 Ga0070704_100076603
1411 Ga0070704_100094741
1412 Ga0070704_100132781
1413 Ga0070704_100193024
1414 Ga0068855_100000414
1415 Ga0068855_100000524
1416 Ga0068855_100001570
1417 Ga0068855_100008049
1418 Ga0068855_100008840
1419 Ga0068855_100011678
1420 Ga0068855_100018543
1421 Ga0068855_100035782
1422 Ga0068855_100036290
1423 Ga0068855_100069903
1424 Ga0068855_100092972
1425 Ga0068855_100136018
1426 Ga0068855_100286065
1427 Ga0070664_100000926
1428 Ga0070664_100010549
1429 Ga0070664_100010623
1430 Ga0070664_100062403
1431 Ga0070664_100132074
1432 Ga0068857_100004956
1433 Ga0068857_100006775
1434 Ga0068857_100017777
1435 Ga0068857_100059647
1436 Ga0068857_100073627
1437 Ga0068857_100114259
1438 Ga0068854_100046701
1439 Ga0068854_100207746
1440 Ga0068856_100000571
1441 Ga0068856_100001211
1442 Ga0068856_100001271
1443 Ga0068856_100007241
1444 Ga0068856_100009546
1445 Ga0068856_100013497
1446 Ga0068856_100024977
1447 Ga0068856_100025118
1448 Ga0068856_100027978
1449 Ga0068856_100069148
1450 Ga0068856_100095306
1451 Ga0068856_100140924
1452 Ga0068856_100186585
1453 Ga0068856_100206789
1454 Ga0068856_100255173
1455 Ga0070702_100004836
1456 Ga0070702_100068152
1457 Ga0068852_100000985
1458 Ga0068852_100005765
1459 Ga0068852_100006358
1460 Ga0068852_100011845
1461 Ga0068852_100015898
1462 Ga0068852_100234861
1463 Ga0068852_100276338
1464 Ga0068859_100001284
1465 Ga0068859_100020671
1466 Ga0068859_100038265
1467 Ga0068859_100199444
1468 Ga0068864_100000562
1469 Ga0068864_100001544
1470 Ga0068864_100004937
1471 Ga0068864_100011579
1472 Ga0068864_100018864
1473 Ga0068864_100205090
1474 Ga0068861_100002237
1475 Ga0068861_100043468
1476 Ga0068851_10002556
1477 Ga0068851_10060525
1478 Ga0068870_10008382
1479 Ga0068870_10008421
1480 Ga0068863_100003319
1481 Ga0068863_100016850
1482 Ga0068863_100214920
1483 Ga0068858_100002537
1484 Ga0068858_100006133
1485 Ga0068858_100007409
1486 Ga0068858_100008448
1487 Ga0068858_100008547
1488 Ga0068858_100021186
1489 Ga0068858_100024779
1490 Ga0068858_100150868
1491 Ga0068860_100003123
1492 Ga0068860_100027132
1493 Ga0068860_100081559
1494 Ga0068862_100012089
1495 Ga0068862_100185322
1496 Ga0081455_10028093
1497 Ga0081538_10023149
1498 Ga0081538_10044307
1499 Ga0081538_10048901
1500 Ga0070712_100013761
1501 Ga0070712_100028518
1502 Ga0070712_100162508
1503 Ga0097621_100000014
1504 Ga0097621_100000229
1505 Ga0097621_100049235
1506 Ga0097621_100050317
1507 Ga0068871_100000071
1508 Ga0068871_100000166
1509 Ga0068871_100006021
1510 Ga0068871_100008001
1511 Ga0068871_100015338
1512 Ga0068871_100030342
1513 Ga0068871_100122260
1514 Ga0068871_100127503
1515 Ga0068871_100143145
1516 Ga0075428_100005703
1517 Ga0075428_100016232
1518 Ga0075428_100026272
1519 Ga0075428_100062098
1520 Ga0075430_100031785
1521 Ga0075430_100129312
1522 Ga0075431_100000972
1523 Ga0075431_100005121
1524 Ga0075431_100057536
1525 Ga0075431_100133637
1526 Ga0075431_100166202
1527 Ga0075433_10049220
1528 Ga0075433_10052747
1529 Ga0075433_10065601
1530 Ga0075433_10072842
1531 Ga0075434_100164763
1532 Ga0075434_100200892
1533 Ga0075434_100328772
1534 Ga0075429_100000064
1535 Ga0075429_100019992
1536 Ga0075429_100028043
1537 Ga0075429_100063141
1538 Ga0068865_100002091
1539 Ga0068865_100059288
1540 Ga0068865_100138694
1541 Ga0075436_100010845
1542 Ga0075436_100013943
1543 Ga0075436_100016786
1544 Ga0097620_100001284
1545 Ga0097620_100020673
1546 Ga0097620_100038266
1547 Ga0097620_100199430
1548 Ga0075435_100076919
1549 Ga0075435_100113783
1550 Ga0099794_10034794
1551 Ga0099794_10049251
1552 Ga0105240_10007090
1553 Ga0105240_10012786
1554 Ga0105240_10042344
1555 Ga0105240_10048895
1556 Ga0105240_10058157
1557 Ga0105240_10058757
1558 Ga0105240_10096120
1559 Ga0111539_10003448
1560 Ga0111539_10016120
1561 Ga0111539_10110619
1562 Ga0111539_10189404
1563 Ga0111539_10232616
1564 Ga0105245_10002611
1565 Ga0105245_10002798
1566 Ga0105245_10022438
1567 Ga0105245_10106239
1568 Ga0105245_10120506
1569 Ga0114129_10013591
1570 Ga0114129_10016075
1571 Ga0114129_10023131
1572 Ga0114129_10034089
1573 Ga0114129_10145680
1574 Ga0114129_10349874
1575 Ga0105243_10048524
1576 Ga0105241_10002804
1577 Ga0105241_10003233
1578 Ga0105241_10064690
1579 Ga0105241_10073850
1580 Ga0105241_10138455
1581 Ga0105242_10020845
1582 Ga0105242_10034916
1583 Ga0105242_10122324
1584 Ga0105248_10004638
1585 Ga0105248_10006560
1586 Ga0105248_10007456
1587 Ga0105248_10008073
1588 Ga0105248_10038068
1589 Ga0105237_10007410
1590 Ga0105237_10052128
1591 Ga0105237_10094279
1592 Ga0105237_10163746
1593 Ga0105238_10000099
1594 Ga0105238_10003764
1595 Ga0105238_10005829
1596 Ga0105238_10010196
1597 Ga0105238_10016386
1598 Ga0105238_10035933
1599 Ga0105238_10040098
1600 Ga0105238_10040169
1601 Ga0105238_10081010
1602 Ga0105249_10000081
1603 Ga0105239_10004095
1604 Ga0105239_10004843
1605 Ga0105239_10035644
1606 Ga0105239_10061702
1607 Ga0105239_10076966
1608 Ga0105239_10079071
1609 Ga0157373_10006787
1610 Ga0157373_10009664
1611 Ga0157373_10063398
1612 Ga0157371_10029486
1613 Ga0157370_10000476
1614 Ga0157370_10006571
1615 Ga0157370_10014516
1616 Ga0157370_10022525
1617 Ga0157370_10026585
1618 Ga0157370_10029138
1619 Ga0157370_10049903
1620 Ga0157370_10096720
1621 Ga0157370_10110874
1622 Ga0157369_10000042
1623 Ga0157369_10085860
1624 Ga0157369_10110684
1625 Ga0157369_10166961
1626 Ga0157374_10000344
1627 Ga0157374_10001377
1628 Ga0157374_10003868
1629 Ga0157374_10006895
1630 Ga0157374_10007349
1631 Ga0157378_10000866
1632 Ga0157378_10071806
1633 Ga0157378_10214069
1634 Ga0163162_10002959
1635 Ga0163162_10007040
1636 Ga0163162_10104736
1637 Ga0157372_10001080
1638 Ga0157372_10004295
1639 Ga0157372_10004400
1640 Ga0157372_10010092
1641 Ga0157372_10027393
1642 Ga0157372_10028186
1643 Ga0157372_10032131
1644 Ga0157372_10041254
1645 Ga0157372_10125254
1646 Ga0157372_10160437
1647 Ga0157372_10473193
1648 Ga0157375_10005082
1649 Ga0157375_10018493
1650 Ga0157375_10035225
1651 Ga0157375_10068576
1652 Ga0157375_10097095
1653 Ga0157375_10179574
1654 Ga0157375_10238837
1655 Ga0163163_10002850
1656 Ga0163163_10004258
1657 Ga0163163_10009234
1658 Ga0163163_10039952
1659 Ga0163163_10114281
1660 Ga0157380_10003588
1661 Ga0157380_10009850
1662 Ga0157380_10150980
1663 Ga0157380_10154914
1664 Ga0182008_10000720
1665 Ga0182008_10010474
1666 Ga0157377_10001722
1667 Ga0157377_10021215
1668 Ga0157377_10052884
1669 Ga0157379_10001332
1670 Ga0157379_10006917
1671 Ga0157379_10011079
1672 Ga0157379_10032239
1673 Ga0157376_10001448
1674 Ga0157376_10001504
1675 Ga0157376_10017956
1676 Ga0157376_10033705
1677 Ga0157376_10053142
1678 Ga0157376_10071888
1679 Ga0157376_10190797
1680 Ga0182007_10000119
1681 Ga0163161_10007603
1682 Ga0163161_10015776
1683 Ga0206356_11297921
1684 Ga0209759_1000458
1685 Ga0207656_10008370
1686 Ga0207653_10000053
1687 Ga0207682_10009967
1688 Ga0207682_10010753
1689 Ga0207688_10002162
1690 Ga0207680_10037142
1691 Ga0207680_10045478
1692 Ga0207647_10021421
1693 Ga0207699_10106184
1694 Ga0207645_10007684
1695 Ga0207645_10020836
1696 Ga0207645_10062144
1697 Ga0207643_10006926
1698 Ga0207643_10009217
1699 Ga0207705_10007732
1700 Ga0207684_10000443
1701 Ga0207684_10002835
1702 Ga0207684_10026737
1703 Ga0207684_10040794
1704 Ga0207654_10000280
1705 Ga0207654_10000283
1706 Ga0207707_10000155
1707 Ga0207707_10000270
1708 Ga0207707_10000975
1709 Ga0207707_10002951
1710 Ga0207707_10004342
1711 Ga0207707_10005365
1712 Ga0207707_10013266
1713 Ga0207707_10013848
1714 Ga0207707_10029831
1715 Ga0207707_10058314
1716 Ga0207707_10185857
1717 Ga0207695_10005746
1718 Ga0207695_10019440
1719 Ga0207695_10029524
1720 Ga0207695_10032092
1721 Ga0207695_10075716
1722 Ga0207695_10084798
1723 Ga0207695_10105021
1724 Ga0207695_10140976
1725 Ga0207695_10151378
1726 Ga0207695_10189769
1727 Ga0207671_10012967
1728 Ga0207693_10054730
1729 Ga0207693_10079038
1730 Ga0207693_10116592
1731 Ga0207663_10031980
1732 Ga0207660_10000641
1733 Ga0207660_10006144
1734 Ga0207660_10013059
1735 Ga0207660_10048443
1736 Ga0207660_10136747
1737 Ga0207657_10001727
1738 Ga0207657_10047830
1739 Ga0207657_10053081
1740 Ga0207657_10066801
1741 Ga0207657_10084165
1742 Ga0207657_10104441
1743 Ga0207649_10054814
1744 Ga0207652_10000251
1745 Ga0207652_10005961
1746 Ga0207652_10006645
1747 Ga0207652_10018616
1748 Ga0207652_10047694
1749 Ga0207652_10073985
1750 Ga0207646_10000674
1751 Ga0207646_10000680
1752 Ga0207646_10009227
1753 Ga0207646_10042030
1754 Ga0207646_10092100
1755 Ga0207681_10017807
1756 Ga0207681_10092054
1757 Ga0207694_10000936
1758 Ga0207694_10002805
1759 Ga0207694_10010737
1760 Ga0207694_10025645
1761 Ga0207694_10037007
1762 Ga0207694_10050931
1763 Ga0207659_10000416
1764 Ga0207659_10099853
1765 Ga0207659_10147743
1766 Ga0207687_10048332
1767 Ga0207687_10062066
1768 Ga0207700_10010364
1769 Ga0207700_10010548
1770 Ga0207700_10028009
1771 Ga0207664_10003022
1772 Ga0207664_10013961
1773 Ga0207664_10053855
1774 Ga0207664_10074436
1775 Ga0207664_10091134
1776 Ga0207644_10005692
1777 Ga0207690_10003656
1778 Ga0207690_10009501
1779 Ga0207690_10033090
1780 Ga0207706_10000369
1781 Ga0207706_10001191
1782 Ga0207706_10017481
1783 Ga0207706_10031545
1784 Ga0207706_10185834
1785 Ga0207686_10028954
1786 Ga0207670_10080168
1787 Ga0207669_10037902
1788 Ga0207669_10062219
1789 Ga0207704_10001495
1790 Ga0207704_10041860
1791 Ga0207704_10094528
1792 Ga0207691_10012818
1793 Ga0207691_10013944
1794 Ga0207691_10024313
1795 Ga0207691_10029133
1796 Ga0207711_10003977
1797 Ga0207711_10073393
1798 Ga0207711_10091600
1799 Ga0207711_10124216
1800 Ga0207711_10184343
1801 Ga0207711_10251683
1802 Ga0207689_10000410
1803 Ga0207689_10002821
1804 Ga0207689_10005112
1805 Ga0207661_10000719
1806 Ga0207661_10014797
1807 Ga0207661_10022652
1808 Ga0207661_10061463
1809 Ga0207661_10063919
1810 Ga0207661_10070011
1811 Ga0207661_10182699
1812 Ga0207679_10000343
1813 Ga0207679_10032011
1814 Ga0207679_10135610
1815 Ga0207679_10184658
1816 Ga0207667_10000535
1817 Ga0207667_10008360
1818 Ga0207667_10010202
1819 Ga0207667_10013002
1820 Ga0207667_10018924
1821 Ga0207667_10023515
1822 Ga0207667_10048443
1823 Ga0207667_10093889
1824 Ga0207667_10115130
1825 Ga0207667_10164576
1826 Ga0207667_10296921
1827 Ga0207651_10000189
1828 Ga0207651_10139048
1829 Ga0207712_10000532
1830 Ga0207668_10005352
1831 Ga0207640_10021757
1832 Ga0207658_10005948
1833 Ga0207658_10199188
1834 Ga0207677_10000620
1835 Ga0207677_10008146
1836 Ga0207677_10017170
1837 Ga0207677_10026582
1838 Ga0207677_10042195
1839 Ga0207677_10136563
1840 Ga0207703_10002880
1841 Ga0207703_10033841
1842 Ga0207703_10047137
1843 Ga0207703_10079003
1844 Ga0207639_10015987
1845 Ga0207639_10016023
1846 Ga0207639_10037642
1847 Ga0207639_10054681
1848 Ga0207639_10090484
1849 Ga0207639_10093836
1850 Ga0207639_10094882
1851 Ga0207639_10134911
1852 Ga0207639_10149366
1853 Ga0207678_10000790
1854 Ga0207678_10001500
1855 Ga0207678_10003286
1856 Ga0207678_10016506
1857 Ga0207678_10044367
1858 Ga0207708_10015268
1859 Ga0207708_10083257
1860 Ga0207708_10207472
1861 Ga0207702_10001339
1862 Ga0207702_10002228
1863 Ga0207702_10003666
1864 Ga0207702_10013563
1865 Ga0207702_10014914
1866 Ga0207702_10042631
1867 Ga0207702_10052070
1868 Ga0207702_10072441
1869 Ga0207702_10085713
1870 Ga0207702_10110696
1871 Ga0207702_10129024
1872 Ga0207702_10152061
1873 Ga0207641_10007774
1874 Ga0207641_10101100
1875 Ga0207641_10126575
1876 Ga0207641_10184045
1877 Ga0207641_10229442
1878 Ga0207648_10037507
1879 Ga0207648_10038479
1880 Ga0207648_10044629
1881 Ga0207648_10136850
1882 Ga0207648_10142444
1883 Ga0207676_10001204
1884 Ga0207676_10001770
1885 Ga0207676_10006609
1886 Ga0207676_10011380
1887 Ga0207676_10025513
1888 Ga0207674_10000611
1889 Ga0207674_10006991
1890 Ga0207674_10023865
1891 Ga0207674_10027407
1892 Ga0207674_10027990
1893 Ga0207674_10038645
1894 Ga0207674_10058393
1895 Ga0207674_10084803
1896 Ga0207675_100000689
1897 Ga0207675_100047242
1898 Ga0207675_100111169
1899 Ga0207683_10042423
1900 Ga0207698_10004507
1901 Ga0207698_10011766
1902 Ga0207698_10011768
1903 Ga0207698_10014733
1904 Ga0207698_10155640
1905 Ga0207698_10156015
1906 Ga0207698_10203285
1907 Ga0209995_1009809
1908 Ga0210002_1002477
1909 Ga0209971_1002614
1910 Ga0209974_10000067
1911 Ga0209974_10003260
1912 Ga0207428_10004501
1913 Ga0207428_10008071
1914 Ga0207428_10008172
1915 Ga0207428_10042896
1916 Ga0268265_10001894
1917 Ga0268264_10006348
1918 Ga0268264_10034540
1919 Ga0265334_10000131
1920 Ga0265334_10000803
1921 Ga0265334_10026869
1922 Ga0265318_10000900
1923 Ga0265322_10007668
1924 Ga0265322_10019873
1925 Ga0265336_10001126
1926 Ga0265336_10001852
1927 Ga0307515_10141313
1928 Ga0265338_10001728
1929 Ga0265338_10004099
1930 Ga0265338_10007658
1931 Ga0265338_10007947
1932 Ga0265338_10008121
1933 Ga0265338_10013715
1934 Ga0265338_10016083
1935 Ga0265338_10018645
1936 Ga0265338_10053576
1937 Ga0265324_10000021
1938 Ga0265330_10000334
1939 Ga0265330_10001008
1940 Ga0265330_10004830
1941 Ga0265330_10010013
1942 Ga0265330_10023615
1943 Ga0265332_10000011
1944 Ga0265332_10000844
1945 Ga0265332_10012383
1946 Ga0265328_10000347
1947 Ga0265328_10004163
1948 Ga0265328_10014511
1949 Ga0265328_10023734
1950 Ga0265320_10022040
1951 Ga0265320_10023138
1952 Ga0265325_10000426
1953 Ga0265325_10003049
1954 Ga0265325_10004351
1955 Ga0265325_10006671
1956 Ga0265325_10016130
1957 Ga0265325_10030387
1958 Ga0265325_10046944
1959 Ga0265325_10048136
1960 Ga0265329_10002086
1961 Ga0265329_10003468
1962 Ga0265340_10000961
1963 Ga0265340_10012465
1964 Ga0265340_10014656
1965 Ga0265340_10017491
1966 Ga0265340_10062808
1967 Ga0265339_10000013
1968 Ga0265339_10000103
1969 Ga0265339_10002009
1970 Ga0265339_10010376
1971 Ga0265339_10017244
1972 Ga0265339_10023980
1973 Ga0265339_10024678
1974 Ga0265339_10029907
1975 Ga0265339_10047159
1976 Ga0265331_10000502
1977 Ga0265331_10003200
1978 Ga0265331_10003820
1979 Ga0265331_10019632
1980 Ga0265331_10030212
1981 Ga0265327_10000008
1982 Ga0265327_10000139
1983 Ga0265327_10000201
1984 Ga0265327_10000886
1985 Ga0265327_10004938
1986 Ga0265327_10007063
1987 Ga0265327_10010188
1988 Ga0265327_10013053
1989 Ga0265327_10029061
1990 Ga0265327_10032911
1991 Ga0265316_10000699
1992 Ga0265316_10000717
1993 Ga0265316_10004145
1994 Ga0265316_10005131
1995 Ga0265316_10006874
1996 Ga0265316_10011615
1997 Ga0265316_10013919
1998 Ga0265316_10017109
1999 Ga0265316_10017767
2000 Ga0265316_10079528
2001 Ga0265316_10116375
2002 Ga0307513_10001895
2003 Ga0265313_10006437
2004 Ga0265313_10007076
2005 Ga0265313_10009115
2006 Ga0265313_10011209
2007 Ga0265313_10012124
2008 Ga0265313_10040100
2009 Ga0265313_10047731
2010 Ga0316575_10010190
2011 Ga0316575_10019689
2012 Ga0316579_10001303
2013 Ga0316579_10005869
2014 Ga0316579_10030313
2015 Ga0316579_10064705
2016 Ga0265314_10000026
2017 Ga0265314_10003323
2018 Ga0265314_10007094
2019 Ga0265314_10009570
2020 Ga0265314_10009885
2021 Ga0265314_10013702
2022 Ga0265314_10025646
2023 Ga0265314_10026307
2024 Ga0265314_10068999
2025 Ga0265314_10072654
2026 Ga0265314_10102875
2027 Ga0265342_10002778
2028 Ga0265342_10007431
2029 Ga0265342_10009623
2030 Ga0265342_10009658
2031 Ga0265342_10020912
2032 Ga0265342_10027799
2033 Ga0265342_10050616
2034 Ga0265342_10076480
2035 Ga0316576_10007547
2036 Ga0316576_10013534
2037 Ga0316576_10045520
2038 Ga0316576_10047423
2039 Ga0316576_10050333
2040 Ga0316576_10059405
2041 Ga0316576_10123247
2042 Ga0316578_10003015
2043 Ga0316578_10003577
2044 Ga0316578_10014685
2045 Ga0316578_10034106
2046 Ga0316577_10008124
2047 Ga0316577_10021395
2048 Ga0316577_10073386
2049 Ga0316577_10076463
2050 Ga0307410_10014570
2051 Ga0307406_10116350
2052 Ga0307407_10038539
2053 Ga0307409_100001515
2054 Ga0307415_100206611
2055 Ga0316583_10000928
2056 Ga0316583_10005480
2057 Ga0316583_10024474
2058 Ga0316583_10035163
2059 Ga0316585_10016676
2060 Ga0316580_10026088
2061 Ga0373930_0000874
2062 Ga0373959_0010725
2063 Ga0373940_0001226
2064 Ga0373932_0001901
2065 Ga0373957_0061359
2066 Ga0373946_0076289
2067 Ga0316574_0000835
2068 Ga0316574_0001503
2069 Ga0316574_0001601
2070 Ga0316574_0002270
2071 Ga0316574_0032472
2072 Ga0316574_0035701
2073 Ga0316574_0039261
2074 Ga0316574_0076820
2075 Ga0373924_0002388
2076 Ga0373931_0000010
2077 Ga0373931_0002528
2078 Ga0373931_0071473
2079 Ga0373935_0072390
2080 Ga0373927_0012329
2081 Ga0373933_0027064
2082 Ga0373933_0087718
2083 Ga0373937_0018836
2084 Ga0373937_0032553
2085 Ga0373937_0083142
2086 Ga0373937_0137296
2087 Ga0316582_0000151
2088 Ga0316582_0002485
2089 Ga0316582_0002567
2090 Ga0316582_0008545
2091 Ga0316582_0010892
2092 Ga0316584_0001559
2093 Ga0316584_0004770
2094 Ga0316584_0006834
2095 Ga0316584_0009910
2096 Ga0316584_0013176
2097 Ga0316584_0015663
2098 Ga0316584_0020955
2099 Ga0316584_0099487
2100 Ga0316584_0107607
2101 Ga0316584_0185042
2102 Ga0373925_0002495
2103 Ga0373925_0011044
2104 Ga0373925_0034995
2105 Ga0395900_0124564
2106 Ga0395900_0263082
2107 Ga0395898_0198142
2108 Ga0395905_0002225
2109 Ga0395905_0034195
2110 Ga0395905_0103505
2111 Ga0400483_027531
2112 Ga0400483_062504
2113 Ga0400483_087189
2114 Ga0400483_247359
2115 Ga0436365_0014263
2116 Ga0436365_1360619
2117 Ga0451789_0749045
2118 Ga0451841_0881987
2119 Ga0439448_0001294
2120 Ga0439435_0000521
2121 Ga0451577_0000432
2122 Ga0451577_0001184
2123 Ga0451577_0003034
2124 Ga0451577_0010584
2125 Ga0451577_0031938
2126 Ga0451577_0047664
2127 Ga0451577_0066911
2128 Ga0451577_0316568
2129 Ga0453683_0002133
2130 Ga0453683_0004808
2131 Ga0453683_0020439
2132 Ga0453683_0123739
2133 Ga0453684_0000104
2134 Ga0453684_0000125
2135 Ga0453684_0004446
2136 Ga0453684_0020077
2137 Ga0453684_0023409
2138 Ga0453684_0054899
2139 Ga0453684_0185466
2140 Ga0453684_0198357
2141 Ga0453684_0307768
2142 Ga0466959_0046939
2143 Ga0451576_0002213
2144 Ga0451576_0002908
2145 Ga0451576_0003426
2146 Ga0451576_0004734
2147 Ga0451576_0015833
2148 Ga0451576_0020097
2149 Ga0451576_0034864
2150 Ga0451576_0088529
2151 Ga0451576_0143321
2152 Ga0451576_0163397
2153 Ga0451576_0221742
2154 Ga0495592_0049565
2155 Ga0495629_0089600
2156 Ga0495651_0000722
2157 Ga0495651_0010627
2158 Ga0495651_0072805
2159 Ga0495651_0152445
2160 Ga0495580_0040882
2161 Ga0495580_0061713
2162 Ga0495582_0011157
2163 Ga0495582_0018685
2164 Ga0495664_0051989
2165 Ga0495608_0029543
2166 Ga0495608_0036834
2167 Ga0495608_0038775
2168 Ga0495628_0151960
2169 Ga0495652_0013232
2170 Ga0495652_0050131
2171 Ga0495640_0089877
2172 Ga0495586_0007072
2173 Ga0495586_0024415
2174 Ga0495586_0062850
2175 Ga0495587_0015933
2176 Ga0495587_0017777
2177 Ga0495587_0078305
2178 Ga0495645_0001987
2179 Ga0495645_0029015
2180 Ga0495667_0013090
2181 Ga0495667_0043742
2182 Ga0495634_0005034
2183 Ga0495635_0037534
2184 Ga0495635_0074084
2185 Ga0495635_0104060
2186 Ga0495599_0014798
2187 Ga0495599_0106251
2188 Ga0495623_0008194
2189 Ga0495623_0034135
2190 Ga0495647_0035046
2191 Ga0495647_0040268
2192 Ga0495658_0063075
2193 Ga0495658_0148814
2194 Ga0495613_0006054
2195 Ga0495613_0015673
2196 Ga0495613_0105775
2197 Ga0495671_0028432
2198 Ga0495600_0050435
2199 Ga0495604_0062023
2200 Ga0495674_0252299
2201 Ga0495672_0000884
2202 Ga0495680_0002645
2203 Ga0495675_0007009
2204 Ga0495675_0023426
2205 Ga0495684_0006680
2206 Ga0495602_0047025
2207 Ga0495602_0124844
2208 Ga0495602_0127850
2209 Ga0496100_0020618
2210 Ga0496100_0031780
2211 Ga0496101_0012795
2212 Ga0496101_0201870
2213 Ga0496102_0006170
2214 Ga0496102_0039428
2215 Ga0496102_0041715
2216 Ga0496102_0140597
2217 Ga0496102_0190131
2218 Ga0496102_0319306
2219 Ga0496103_0028460
2220 Ga0496103_0073999
2221 Ga0496104_0008382
2222 Ga0496104_0012867
2223 Ga0496104_0021107
2224 Ga0496104_0036823
2225 Ga0496104_0089303
2226 Ga0496104_0155895
2227 Ga0496104_0204917
2228 Ga0496104_0284936
2229 Ga0496105_0003890
2230 Ga0496105_0008678
2231 Ga0496105_0057782
2232 Ga0496105_0161002
2233 Ga0496106_0011745
2234 Ga0496106_0062862
2235 Ga0496106_0079266
2236 Ga0496107_0032857
2237 Ga0496107_0049592
2238 Ga0496108_0004718
2239 Ga0496108_0009710
2240 Ga0496108_0012603
2241 Ga0496109_0011522
2242 Ga0496109_0016429
2243 Ga0496109_0124563
2244 Ga0496109_0216975
2245 Ga0496110_0004405
2246 Ga0496110_0013314
2247 Ga0496110_0020051
2248 Ga0496110_0043809
2249 Ga0496110_0091193
2250 Ga0496111_0002300
2251 Ga0496111_0044808
2252 Ga0496111_0123041
2253 Ga0496111_0158682
2254 Ga0496111_0164530
2255 Ga0496112_0006868
2256 Ga0496113_0013847
2257 Ga0496114_0003419
2258 Ga0496114_0014551
2259 Ga0496114_0049805
2260 Ga0496114_0059806
2261 Ga0496114_0106117
2262 Ga0496114_0126518
2263 Ga0496114_0134711
2264 Ga0496115_0025365
2265 Ga0496116_0013525
2266 Ga0496117_0000135
2267 Ga0496118_0000098
2268 Ga0496119_0008284
2269 Ga0496121_0001675
2270 Ga0496126_0020593
2271 Ga0501031_0001007
2272 Ga0501031_0020481
2273 Ga0501031_0027058
2274 Ga0501031_0132974
2275 Ga0501032_0000167
2276 Ga0501032_0007868
2277 Ga0501032_0009061
2278 Ga0501032_0091514
2279 Ga0501033_0000280
2280 Ga0501033_0003099
2281 Ga0501033_0003516
2282 Ga0501033_0004862
2283 Ga0501034_0013851
2284 Ga0501034_0016867
2285 Ga0501034_0019794
2286 Ga0501034_0088872
2287 Ga0501034_0214528
2288 Ga0501036_0021687
2289 Ga0501036_0030085
2290 Ga0501036_0047473
2291 Ga0501036_0055259
2292 Ga0501036_0100510
2293 Ga0501036_0183116
2294 Ga0501037_0002482
2295 Ga0501037_0011560
2296 Ga0501037_0047369
2297 Ga0501037_0094697
2298 Ga0501037_0095100
2299 Ga0501038_0000229
2300 Ga0501038_0004863
2301 Ga0501038_0006453
2302 Ga0501038_0014688
2303 Ga0501038_0018426
2304 Ga0501038_0022765
2305 Ga0501038_0039828
2306 Ga0501038_0083590
2307 Ga0501039_0000387
2308 Ga0501039_0003397
2309 Ga0501039_0017945
2310 Ga0501039_0021496
2311 Ga0501039_0031047
2312 Ga0501039_0034279
2313 Ga0501039_0098495
2314 Ga0501039_0143569
2315 Ga0501040_0002042
2316 Ga0501040_0019445
2317 Ga0501040_0034984
2318 Ga0501041_0003026
2319 Ga0501041_0018700
2320 Ga0501041_0036575
2321 Ga0501041_0042345
2322 Ga0501042_0002284
2323 Ga0501042_0007841
2324 Ga0501042_0022259
2325 Ga0501043_0000738
2326 Ga0501043_0008870
2327 Ga0501043_0022536
2328 Ga0501043_0030827
2329 Ga0501043_0032621
2330 Ga0501043_0039334
2331 Ga0501046_0000422
2332 Ga0501046_0030946
2333 Ga0501046_0051650
2334 Ga0501047_0002404
2335 Ga0501047_0031282
2336 Ga0501048_0002435
2337 Ga0501048_0018650
2338 Ga0501048_0025182
2339 Ga0501068_0000685
2340 Ga0501068_0004213
2341 Ga0501068_0019950
2342 Ga0501068_0022839
2343 Ga0501068_0052074
2344 Ga0501069_0000183
2345 Ga0501069_0003234
2346 Ga0501070_0002006
2347 Ga0501070_0003803
2348 Ga0501070_0015028
2349 Ga0501070_0048941
2350 Ga0501071_0024392
2351 Ga0501071_0025266
2352 Ga0501071_0042309
2353 Ga0501071_0078808
2354 Ga0501071_0091180
2355 Ga0501072_0000929
2356 Ga0501072_0002538
2357 Ga0501072_0058627
2358 Ga0501073_0002721
2359 Ga0501073_0007592
2360 Ga0501073_0032687
2361 Ga0501074_0031348
2362 Ga0501075_0005663
2363 Ga0501075_0047166
2364 Ga0501075_0054505
2365 Ga0501075_0064465
2366 Ga0501075_0113840
2367 Ga0501076_0011604
2368 Ga0501076_0014118
2369 Ga0501076_0044681
2370 Ga0501076_0052624
2371 Ga0501076_0057659
2372 Ga0501077_0044738
2373 Ga0501077_0110198
2374 Ga0501079_0002260
2375 Ga0501079_0038750
2376 Ga0501079_0096369
2377 Ga0501079_0135481
2378 Ga0501080_0009843
2379 Ga0501080_0023075
2380 Ga0501080_0023133
2381 Ga0501080_0048979
2382 Ga0501080_0051833
2383 Ga0501080_0059272
2384 Ga0501081_0001591
2385 Ga0501081_0104392
2386 Ga0501083_0011631
2387 Ga0501035_0002589
2388 Ga0501035_0007297
2389 Ga0501035_0054086
2390 Ga0501035_0073114
2391 Ga0501044_0000323
2392 Ga0501044_0000514
2393 Ga0501044_0002434
2394 Ga0501044_0006808
2395 Ga0501044_0007920
2396 Ga0501044_0030465
2397 Ga0501045_0000237
2398 Ga0501045_0007689
2399 Ga0501045_0010042
2400 Ga0501045_0047829
2401 nmdc:mga05p37_141138_c1
2402 nmdc:mga05p37_15817_c1
2403 nmdc:mga05p37_169669_c2
2404 nmdc:mga05p37_171815_c1
2405 nmdc:mga05p37_68180_c1
2406 nmdc:mga05p37_94311_c1
2407 nmdc:mga09592_116856_c1
2408 nmdc:mga09592_49229_c1
2409 nmdc:mga09592_796_c1
2410 nmdc:mga0qj67_39487_c1
2411 nmdc:mga0qj67_6216_c1
2412 nmdc:mga06r32_104142_c1
2413 nmdc:mga06r32_119442_c1
2414 nmdc:mga06r32_54924_c1
2415 nmdc:mga06r32_56427_c1
2416 nmdc:mga06r32_66005_c1
2417 nmdc:mga06r32_810_c1
2418 nmdc:mga08y16_13968_c1
2419 nmdc:mga08y16_160883_c1
2420 nmdc:mga08y16_18798_c1
2421 nmdc:mga08y16_19888_c1
2422 nmdc:mga08y16_57007_c1
2423 nmdc:mga0n895_68039_c1
2424 nmdc:mga08x19_106227_c1
2425 nmdc:mga08x19_13893_c1
2426 nmdc:mga08x19_24216_c1
2427 nmdc:mga0a205_107256_c1
2428 nmdc:mga0a205_131124_c1
2429 Ga0495601_0064162
2430 Ga0495595_0008665
2431 Ga0495619_0017931
2432 Ga0495619_0018671
2433 Ga0495619_0028954
2434 Ga0495619_0033006
2435 Ga0495619_0035380
2436 Ga0495619_0097620
2437 Ga0500566_0040501
2438 Ga0500607_030326
2439 Ga0500568_0000135
2440 Ga0500616_0000755
2441 Ga0500636_0000213
2442 Ga0500637_0006937
2443 Ga0501084_0009817
2444 Ga0501084_0031430
2445 Ga0501084_0034157
2446 Ga0501082_0006386
2447 Ga0501082_0026658
2448 Ga0501082_0038447
2449 Ga0501082_0098736
2450 Ga0501082_0100821
2451 Ga0530510_0009754
2452 Ga0530510_0012839
2453 Ga0530510_0077492
2454 Ga0530510_0167361
2455 2739612495
2456 2867308048
2457 2867318489
2458 2867320473
2459 2881928623
2460 2887378819

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

90

262

0.95

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

264

540

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9515 11 465
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9476 10 465
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9474 11 465
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.942 9 465
5ukw-assembly1.cif.gz_A crystal structure of human glucose 6-phosphate dehydrogenase mutant (a277c) complexed with g6p 0.9397 10 461
ID Description Score Start End Superfamily
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9751 11 169 3.40.50.720
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9748 11 172 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 16 170 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 11 169 3.40.50.720
af_O14137_172_472_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9434 172 456 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A5R2MUC2-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9983 209 302 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A659UKS1-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9946 197 309 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9944 211 326 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A528LVB6-F1-model_v4 Glucose-6-phosphate dehydrogenase (NADP(+)) 0.9919 9 340 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A435EGM9-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9919 9 310 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map