F491951

General Info

Members Datasets Scaffolds Average Seq Length
1227 344 1217 372

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581305|2585262686
Length 415
Sequence VVVPTLGESITEATLGQWLKKPGEAVKVDEPIASLETDKVAVDVPSPVSGVIGELVVAEGDTVNVGAVIARIEAGASAVVTATPAVEDRTAVGQAEAAAPAEPASAPADHGGDPLTLSPAVRRAVLEHHVDPSKIRGTGKDGRLTKDDVLAAAQAGNAAMVTAPAAPPAPTPAPAPAAVVAGGRKEERVKMTRLRKTVASRLKEAQNTAAMLTTFNDVDMTAVIEARNKYKDLFEKKHGVRLGFMGFFVKAACMALRDVPAVNGSIEGEEIVYHDFVDVSVAVSAPNGLVVPVIRNAETLSVADIEKMIGDFGKRAKDGTLKLDEMKGGTFTISNGGVFGSLMSTPIINPPQSGVLGLHRIEDRPVVRDGQIVIRPMMYLALSYDHRLIDGREAVTFLVALKNAIEDPTRLLIDL

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
8 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
9 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
232 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
312 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
313 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
314 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
317 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
327 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
328 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
331 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
332 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
333 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
334 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
341 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.16
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 3.59
Rhizosphere 87.61
Stem 0
Stem Tuber 0.08
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000039 3300001976 Bacteria 15608
2 JGI24740J21852_10002423 3300001979 Bacteria 8473
3 JGI24740J21852_10009893 3300001979 Bacteria 3703
4 JGI24739J22299_10001619 3300001989 Bacteria 8546
5 JGI24739J22299_10001638 3300001989 Bacteria 8495
6 JGI24739J22299_10002242 3300001989 Bacteria 7430
7 JGI24739J22299_10019088 3300001989 Bacteria 2457
8 JGI24737J22298_10000011 3300001990 Bacteria 53665
9 JGI24737J22298_10001553 3300001990 Bacteria 8163
10 JGI24737J22298_10001858 3300001990 Bacteria 7549
11 JGI24737J22298_10006047 3300001990 Bacteria 4152
12 JGI24737J22298_10006277 3300001990 Bacteria 4066
13 JGI24735J21928_10013921 3300002067 Bacteria 2523
14 JGI24748J21848_1000141 3300002074 Bacteria 12220
15 JGI24738J21930_10000318 3300002075 Bacteria 13312
16 JGI24738J21930_10000423 3300002075 Bacteria 11923
17 JGI24738J21930_10002219 3300002075 Bacteria 5163
18 JGI24749J21850_1001203 3300002076 Bacteria 3676
19 JGI24034J26672_10000067 3300002239 Bacteria 32416
20 JGI24751J29686_10000069 3300002459 Bacteria 59733
21 JGI24751J29686_10008566 3300002459 Bacteria 2094
22 JGI25150J39212_1000243 3300002774 Bacteria 28944
23 JGI25153J46596_10000007 3300003215 Bacteria 377573
24 JGI25153J46596_10000027 3300003215 Bacteria 210760
25 Ga0055529_1000002 3300003763 Bacteria 537914
26 Ga0055529_1000021 3300003763 Bacteria 321484
27 Ga0055537_1001355 3300003773 Bacteria 9892
28 Ga0055530_10024355 3300003791 Bacteria 1718
29 Ga0055540_1003541 3300003792 Bacteria 7480
30 Ga0065165_1005217 3300005262 Bacteria 7468
31 Ga0065712_10078154 3300005290 Bacteria 3386
32 Ga0065707_10083783 3300005295 Bacteria 8251
33 Ga0070658_10000057 3300005327 Bacteria 113572
34 Ga0070658_10000710 3300005327 Bacteria 28818
35 Ga0070658_10006114 3300005327 Bacteria 9763
36 Ga0070658_10007067 3300005327 Bacteria 9059
37 Ga0070658_10027180 3300005327 Bacteria 4593
38 Ga0070658_10030478 3300005327 Bacteria 4333
39 Ga0070658_10055744 3300005327 Bacteria 3211
40 Ga0070658_10063593 3300005327 Bacteria 3009
41 Ga0070676_10007349 3300005328 Bacteria 5909
42 Ga0070676_10010490 3300005328 Bacteria 5028
43 Ga0070690_100000112 3300005330 Bacteria 42428
44 Ga0070690_100008046 3300005330 Bacteria 6054
45 Ga0070690_100012671 3300005330 Bacteria 4964
46 Ga0070670_100000005 3300005331 Bacteria 351569
47 Ga0070670_100000030 3300005331 Bacteria 164211
48 Ga0070670_100001795 3300005331 Bacteria 17478
49 Ga0070670_100010273 3300005331 Bacteria 7990
50 Ga0070670_100010599 3300005331 Bacteria 7871
51 Ga0070670_100012249 3300005331 Bacteria 7337
52 Ga0070670_100042376 3300005331 Bacteria 3913
53 Ga0070670_100056038 3300005331 Bacteria 3383
54 Ga0070677_10000958 3300005333 Bacteria 9321
55 Ga0068869_100054419 3300005334 Bacteria 2913
56 Ga0070666_10000009 3300005335 Bacteria 279209
57 Ga0070666_10000445 3300005335 Bacteria 25271
58 Ga0070666_10000978 3300005335 Bacteria 17439
59 Ga0070680_100004343 3300005336 Bacteria 10658
60 Ga0070680_100005776 3300005336 Bacteria 9392
61 Ga0070680_100006159 3300005336 Bacteria 9099
62 Ga0068868_100000002 3300005338 Bacteria 159433
63 Ga0068868_100010852 3300005338 Bacteria 6609
64 Ga0068868_100016955 3300005338 Bacteria 5420
65 Ga0068868_100020310 3300005338 Bacteria 4987
66 Ga0068868_100060162 3300005338 Bacteria 3006
67 Ga0068868_100098547 3300005338 Bacteria 2364
68 Ga0070660_100000539 3300005339 Bacteria 25340
69 Ga0070660_100000688 3300005339 Bacteria 22377
70 Ga0070660_100017908 3300005339 Bacteria 5168
71 Ga0070660_100034319 3300005339 Bacteria 3832
72 Ga0070660_100049848 3300005339 Bacteria 3220
73 Ga0070660_100121149 3300005339 Bacteria 2088
74 Ga0070660_100133639 3300005339 Bacteria 1987
75 Ga0070689_100035610 3300005340 Bacteria 3804
76 Ga0070689_100242779 3300005340 Bacteria 1484
77 Ga0070691_10008789 3300005341 Bacteria 4624
78 Ga0070661_100001700 3300005344 Bacteria 15257
79 Ga0070661_100009029 3300005344 Bacteria 6897
80 Ga0070661_100021800 3300005344 Bacteria 4582
81 Ga0070661_100025548 3300005344 Bacteria 4246
82 Ga0070661_100027167 3300005344 Bacteria 4119
83 Ga0070661_100040208 3300005344 Bacteria 3410
84 Ga0070661_100151968 3300005344 Bacteria 1750
85 Ga0070661_100191755 3300005344 Bacteria 1559
86 Ga0070692_10001332 3300005345 Bacteria 8892
87 Ga0070692_10025047 3300005345 Bacteria 2939
88 Ga0070692_10032924 3300005345 Bacteria 2610
89 Ga0070668_100000020 3300005347 Bacteria 98203
90 Ga0070668_100001661 3300005347 Bacteria 16140
91 Ga0070668_100027279 3300005347 Bacteria 4336
92 Ga0070668_100045599 3300005347 Bacteria 3364
93 Ga0070668_100087329 3300005347 Bacteria 2454
94 Ga0070668_100111899 3300005347 Bacteria 2174
95 Ga0070669_100000267 3300005353 Bacteria 42707
96 Ga0070669_100000422 3300005353 Bacteria 32380
97 Ga0070669_100008563 3300005353 Bacteria 7303
98 Ga0070669_100014539 3300005353 Bacteria 5599
99 Ga0070669_100029397 3300005353 Bacteria 3960
100 Ga0070669_100088618 3300005353 Bacteria 2316
101 Ga0070669_100145324 3300005353 Bacteria 1832
102 Ga0070675_100004004 3300005354 Bacteria 11182
103 Ga0070675_100009739 3300005354 Bacteria 7488
104 Ga0070675_100023162 3300005354 Bacteria 4962
105 Ga0070675_100084394 3300005354 Bacteria 2652
106 Ga0070671_100000401 3300005355 Bacteria 29891
107 Ga0070671_100001714 3300005355 Bacteria 16642
108 Ga0070671_100004306 3300005355 Bacteria 11266
109 Ga0070671_100004842 3300005355 Bacteria 10705
110 Ga0070671_100006859 3300005355 Bacteria 9118
111 Ga0070671_100023182 3300005355 Bacteria 5077
112 Ga0070671_100024633 3300005355 Bacteria 4930
113 Ga0070671_100040480 3300005355 Bacteria 3871
114 Ga0070671_100062950 3300005355 Bacteria 3089
115 Ga0070671_100070960 3300005355 Bacteria 2907
116 Ga0070674_100061829 3300005356 Bacteria 2615
117 Ga0070673_100000044 3300005364 Bacteria 51857
118 Ga0070673_100002984 3300005364 Bacteria 10442
119 Ga0070673_100032531 3300005364 Bacteria 3928
120 Ga0070673_100067103 3300005364 Bacteria 2868
121 Ga0070673_100068009 3300005364 Bacteria 2851
122 Ga0070673_100079467 3300005364 Bacteria 2656
123 Ga0070673_100127300 3300005364 Bacteria 2132
124 Ga0070688_100005094 3300005365 Bacteria 6889
125 Ga0070659_100000029 3300005366 Bacteria 139518
126 Ga0070659_100006940 3300005366 Bacteria 8200
127 Ga0070659_100010971 3300005366 Bacteria 6690
128 Ga0070659_100019038 3300005366 Bacteria 5191
129 Ga0070659_100022106 3300005366 Bacteria 4853
130 Ga0070659_100036925 3300005366 Bacteria 3808
131 Ga0070659_100045852 3300005366 Bacteria 3426
132 Ga0070659_100079309 3300005366 Bacteria 2620
133 Ga0070659_100094546 3300005366 Bacteria 2400
134 Ga0070659_100131251 3300005366 Bacteria 2035
135 Ga0070667_100000055 3300005367 Bacteria 151072
136 Ga0070667_100000161 3300005367 Bacteria 83551
137 Ga0070667_100000166 3300005367 Bacteria 82268
138 Ga0070667_100003053 3300005367 Bacteria 14391
139 Ga0070667_100005534 3300005367 Bacteria 10541
140 Ga0070667_100006585 3300005367 Bacteria 9659
141 Ga0070667_100011333 3300005367 Bacteria 7374
142 Ga0070667_100011915 3300005367 Bacteria 7194
143 Ga0070667_100043413 3300005367 Bacteria 3773
144 Ga0070714_100026373 3300005435 Bacteria 4802
145 Ga0070713_100044558 3300005436 Bacteria 3632
146 Ga0070713_100110916 3300005436 Bacteria 2392
147 Ga0070694_100006826 3300005444 Bacteria 6934
148 Ga0070663_100011207 3300005455 Bacteria 5617
149 Ga0070663_100022983 3300005455 Bacteria 4174
150 Ga0070663_100157445 3300005455 Bacteria 1746
151 Ga0070663_100229725 3300005455 Bacteria 1460
152 Ga0070662_100006906 3300005457 Bacteria 7346
153 Ga0070662_100013940 3300005457 Bacteria 5355
154 Ga0070662_100014902 3300005457 Bacteria 5199
155 Ga0070662_100028308 3300005457 Bacteria 3898
156 Ga0070662_100037361 3300005457 Bacteria 3443
157 Ga0070662_100094457 3300005457 Bacteria 2251
158 Ga0070662_100099128 3300005457 Bacteria 2202
159 Ga0070662_100174025 3300005457 Bacteria 1692
160 Ga0070681_10064117 3300005458 Bacteria 3646
161 Ga0070681_10068988 3300005458 Bacteria 3502
162 Ga0070681_10089381 3300005458 Bacteria 3032
163 Ga0068867_100005479 3300005459 Bacteria 8981
164 Ga0068867_100046914 3300005459 Bacteria 3175
165 Ga0068867_100096714 3300005459 Bacteria 2249
166 Ga0070685_10000342 3300005466 Bacteria 28567
167 Ga0070685_10047880 3300005466 Bacteria 2460
168 Ga0070679_100210485 3300005530 Bacteria 1908
169 Ga0070684_100003281 3300005535 Bacteria 12120
170 Ga0068853_100001903 3300005539 Bacteria 15374
171 Ga0068853_100013991 3300005539 Bacteria 6564
172 Ga0068853_100069427 3300005539 Bacteria 3065
173 Ga0068853_100123734 3300005539 Bacteria 2309
174 Ga0070672_100001615 3300005543 Bacteria 14013
175 Ga0070672_100010680 3300005543 Bacteria 6378
176 Ga0070672_100028308 3300005543 Bacteria 4190
177 Ga0070672_100045263 3300005543 Bacteria 3402
178 Ga0070686_100000006 3300005544 Bacteria 243316
179 Ga0070686_100001142 3300005544 Bacteria 15252
180 Ga0070696_100029955 3300005546 Bacteria 3723
181 Ga0070693_100024130 3300005547 Bacteria 3258
182 Ga0070693_100077887 3300005547 Bacteria 1969
183 Ga0070665_100000071 3300005548 Bacteria 200675
184 Ga0070665_100000154 3300005548 Bacteria 125835
185 Ga0070665_100000316 3300005548 Bacteria 75107
186 Ga0070665_100001220 3300005548 Bacteria 31311
187 Ga0070665_100001688 3300005548 Bacteria 25443
188 Ga0070665_100003821 3300005548 Bacteria 15948
189 Ga0070665_100042791 3300005548 Bacteria 4553
190 Ga0070665_100084017 3300005548 Bacteria 3189
191 Ga0068855_100009958 3300005563 Bacteria 11462
192 Ga0068855_100026500 3300005563 Bacteria 6934
193 Ga0068855_100090861 3300005563 Bacteria 3522
194 Ga0068855_100101005 3300005563 Bacteria 3321
195 Ga0068855_100244037 3300005563 Bacteria 2006
196 Ga0068855_100291320 3300005563 Bacteria 1809
197 Ga0068855_100389610 3300005563 Bacteria 1529
198 Ga0070664_100006742 3300005564 Bacteria 9257
199 Ga0070664_100011816 3300005564 Bacteria 7087
200 Ga0070664_100012617 3300005564 Bacteria 6877
201 Ga0070664_100022162 3300005564 Bacteria 5240
202 Ga0070664_100044400 3300005564 Bacteria 3753
203 Ga0070664_100045606 3300005564 Bacteria 3702
204 Ga0070664_100046850 3300005564 Bacteria 3652
205 Ga0070664_100073492 3300005564 Bacteria 2934
206 Ga0070664_100100753 3300005564 Bacteria 2511
207 Ga0070664_100104248 3300005564 Bacteria 2469
208 Ga0068857_100013033 3300005577 Bacteria 7243
209 Ga0068857_100015553 3300005577 Bacteria 6648
210 Ga0068857_100018103 3300005577 Bacteria 6179
211 Ga0068857_100025779 3300005577 Bacteria 5177
212 Ga0068857_100030015 3300005577 Bacteria 4797
213 Ga0068857_100048792 3300005577 Bacteria 3757
214 Ga0068857_100059919 3300005577 Bacteria 3382
215 Ga0068857_100092990 3300005577 Bacteria 2700
216 Ga0068857_100094203 3300005577 Bacteria 2681
217 Ga0068854_100001186 3300005578 Bacteria 15636
218 Ga0068854_100001332 3300005578 Bacteria 14903
219 Ga0068854_100005361 3300005578 Bacteria 8095
220 Ga0068854_100046007 3300005578 Bacteria 3105
221 Ga0068854_100048464 3300005578 Bacteria 3032
222 Ga0068856_100021339 3300005614 Bacteria 6294
223 Ga0068856_100034607 3300005614 Bacteria 4947
224 Ga0068856_100068028 3300005614 Bacteria 3520
225 Ga0068856_100087391 3300005614 Bacteria 3099
226 Ga0068852_100000725 3300005616 Bacteria 21626
227 Ga0068852_100006660 3300005616 Bacteria 8370
228 Ga0068852_100023744 3300005616 Bacteria 4942
229 Ga0068852_100024382 3300005616 Bacteria 4888
230 Ga0068852_100027869 3300005616 Bacteria 4611
231 Ga0068852_100063312 3300005616 Bacteria 3220
232 Ga0068852_100078833 3300005616 Bacteria 2915
233 Ga0068852_100215523 3300005616 Bacteria 1824
234 Ga0068852_100233174 3300005616 Bacteria 1755
235 Ga0068859_100000144 3300005617 Bacteria 67220
236 Ga0068859_100007415 3300005617 Bacteria 11135
237 Ga0068859_100009558 3300005617 Bacteria 9790
238 Ga0068859_100020039 3300005617 Bacteria 6716
239 Ga0068859_100021307 3300005617 Bacteria 6504
240 Ga0068859_100040234 3300005617 Bacteria 4692
241 Ga0068859_100053878 3300005617 Bacteria 4045
242 Ga0068859_100055815 3300005617 Bacteria 3974
243 Ga0068859_100084841 3300005617 Bacteria 3212
244 Ga0068859_100113220 3300005617 Bacteria 2777
245 Ga0068864_100000011 3300005618 Bacteria 350056
246 Ga0068864_100000041 3300005618 Bacteria 165878
247 Ga0068864_100000092 3300005618 Bacteria 94499
248 Ga0068864_100000646 3300005618 Bacteria 29246
249 Ga0068864_100007306 3300005618 Bacteria 9088
250 Ga0068864_100016122 3300005618 Bacteria 6218
251 Ga0068864_100021028 3300005618 Bacteria 5464
252 Ga0068864_100060492 3300005618 Bacteria 3279
253 Ga0068864_100093264 3300005618 Bacteria 2659
254 Ga0068866_10022525 3300005718 Bacteria 2916
255 Ga0068861_100001685 3300005719 Bacteria 14172
256 Ga0068861_100001751 3300005719 Bacteria 13950
257 Ga0068861_100010296 3300005719 Bacteria 6488
258 Ga0068851_10018890 3300005834 Bacteria 3327
259 Ga0068851_10024527 3300005834 Bacteria 2953
260 Ga0068851_10034336 3300005834 Bacteria 2531
261 Ga0068863_100000035 3300005841 Bacteria 165877
262 Ga0068863_100000040 3300005841 Bacteria 158465
263 Ga0068863_100000748 3300005841 Bacteria 32471
264 Ga0068863_100007529 3300005841 Bacteria 10649
265 Ga0068863_100011358 3300005841 Bacteria 8624
266 Ga0068863_100012981 3300005841 Bacteria 8033
267 Ga0068863_100017920 3300005841 Bacteria 6777
268 Ga0068863_100028944 3300005841 Bacteria 5291
269 Ga0068863_100046433 3300005841 Bacteria 4122
270 Ga0068863_100101395 3300005841 Bacteria 2736
271 Ga0068858_100000186 3300005842 Bacteria 65965
272 Ga0068858_100000256 3300005842 Bacteria 56844
273 Ga0068858_100000807 3300005842 Bacteria 32790
274 Ga0068858_100000868 3300005842 Bacteria 31246
275 Ga0068858_100000920 3300005842 Bacteria 30532
276 Ga0068858_100001078 3300005842 Bacteria 28261
277 Ga0068858_100015577 3300005842 Bacteria 7152
278 Ga0068858_100028299 3300005842 Bacteria 5206
279 Ga0068858_100079082 3300005842 Bacteria 3055
280 Ga0068858_100094583 3300005842 Bacteria 2784
281 Ga0068860_100000022 3300005843 Bacteria 279209
282 Ga0068860_100000090 3300005843 Bacteria 151520
283 Ga0068860_100000245 3300005843 Bacteria 82268
284 Ga0068860_100002023 3300005843 Bacteria 21398
285 Ga0068860_100019559 3300005843 Bacteria 6565
286 Ga0068860_100088172 3300005843 Bacteria 2953
287 Ga0068860_100185437 3300005843 Bacteria 2012
288 Ga0068860_100342650 3300005843 Bacteria 1470
289 Ga0068862_100000042 3300005844 Bacteria 165084
290 Ga0068862_100000104 3300005844 Bacteria 100182
291 Ga0068862_100000148 3300005844 Bacteria 79789
292 Ga0068862_100000790 3300005844 Bacteria 31384
293 Ga0068862_100000930 3300005844 Bacteria 28251
294 Ga0068862_100010138 3300005844 Bacteria 7778
295 Ga0068862_100020239 3300005844 Bacteria 5558
296 Ga0068862_100034248 3300005844 Bacteria 4296
297 Ga0068862_100060393 3300005844 Bacteria 3256
298 Ga0068862_100072123 3300005844 Bacteria 2982
299 Ga0068862_100214658 3300005844 Bacteria 1740
300 Ga0081455_10000131 3300005937 Bacteria 87553
301 Ga0081539_10013211 3300005985 Bacteria 6246
302 Ga0081539_10021433 3300005985 Bacteria 4318
303 Ga0070712_100065929 3300006175 Bacteria 2572
304 Ga0075366_10001930 3300006195 Bacteria 10472
305 Ga0097621_100009078 3300006237 Bacteria 7206
306 Ga0097621_100073010 3300006237 Bacteria 2839
307 Ga0075370_10005454 3300006353 Bacteria 6327
308 Ga0075370_10014156 3300006353 Bacteria 4250
309 Ga0068871_100021017 3300006358 Bacteria 5009
310 Ga0075431_100080079 3300006847 Bacteria 3372
311 Ga0075433_10021679 3300006852 Bacteria 5388
312 Ga0075434_100215755 3300006871 Bacteria 1939
313 Ga0068865_100004527 3300006881 Bacteria 8388
314 Ga0097620_100000144 3300006931 Bacteria 67220
315 Ga0097620_100007415 3300006931 Bacteria 11135
316 Ga0097620_100009557 3300006931 Bacteria 9790
317 Ga0097620_100020039 3300006931 Bacteria 6716
318 Ga0097620_100021307 3300006931 Bacteria 6504
319 Ga0097620_100040233 3300006931 Bacteria 4692
320 Ga0097620_100053881 3300006931 Bacteria 4045
321 Ga0097620_100055817 3300006931 Bacteria 3974
322 Ga0097620_100084842 3300006931 Bacteria 3212
323 Ga0097620_100113217 3300006931 Bacteria 2777
324 Ga0105251_10000165 3300009011 Bacteria 68081
325 Ga0105250_10038465 3300009092 Bacteria 1918
326 Ga0105240_10021368 3300009093 Bacteria 8609
327 Ga0105240_10046023 3300009093 Bacteria 5531
328 Ga0105240_10048387 3300009093 Bacteria 5374
329 Ga0105240_10051957 3300009093 Bacteria 5155
330 Ga0105240_10084316 3300009093 Bacteria 3896
331 Ga0111539_10024579 3300009094 Bacteria 7390
332 Ga0111539_10091535 3300009094 Bacteria 3573
333 Ga0105245_10000617 3300009098 Bacteria 32256
334 Ga0105245_10009345 3300009098 Bacteria 8552
335 Ga0105245_10010975 3300009098 Bacteria 7884
336 Ga0105245_10014740 3300009098 Bacteria 6808
337 Ga0105245_10119113 3300009098 Bacteria 2464
338 Ga0105245_10124308 3300009098 Bacteria 2413
339 Ga0105247_10004564 3300009101 Bacteria 8828
340 Ga0105247_10026032 3300009101 Bacteria 3531
341 Ga0105247_10120764 3300009101 Bacteria 1697
342 Ga0105248_10000045 3300009177 Bacteria 165909
343 Ga0105248_10000229 3300009177 Bacteria 64280
344 Ga0105248_10000426 3300009177 Bacteria 47826
345 Ga0105248_10001078 3300009177 Bacteria 30151
346 Ga0105248_10001711 3300009177 Bacteria 24398
347 Ga0105248_10022738 3300009177 Bacteria 6958
348 Ga0105248_10041892 3300009177 Bacteria 5134
349 Ga0105248_10062441 3300009177 Bacteria 4183
350 Ga0105248_10178768 3300009177 Bacteria 2391
351 Ga0105248_10208368 3300009177 Bacteria 2203
352 Ga0105248_10211531 3300009177 Bacteria 2185
353 Ga0105237_10067974 3300009545 Bacteria 3557
354 Ga0105238_10007040 3300009551 Bacteria 11246
355 Ga0105238_10017403 3300009551 Bacteria 7303
356 Ga0105238_10046743 3300009551 Bacteria 4366
357 Ga0105238_10067909 3300009551 Bacteria 3566
358 Ga0105238_10116478 3300009551 Bacteria 2652
359 Ga0105249_10000014 3300009553 Bacteria 283274
360 Ga0105249_10000055 3300009553 Bacteria 161674
361 Ga0105249_10000056 3300009553 Bacteria 160443
362 Ga0105249_10003121 3300009553 Bacteria 14322
363 Ga0105249_10009802 3300009553 Bacteria 8395
364 Ga0105249_10033334 3300009553 Bacteria 4662
365 Ga0105249_10040715 3300009553 Bacteria 4221
366 Ga0105239_10058772 3300010375 Bacteria 4220
367 Ga0105239_10168913 3300010375 Bacteria 2446
368 Ga0105239_10197128 3300010375 Bacteria 2255
369 Ga0105246_10014176 3300011119 Bacteria 5009
370 Ga0157326_1000170 3300012513 Bacteria 7138
371 Ga0157373_10009064 3300013100 Bacteria 7363
372 Ga0157373_10026620 3300013100 Bacteria 4175
373 Ga0157373_10032582 3300013100 Bacteria 3751
374 Ga0157373_10046840 3300013100 Bacteria 3085
375 Ga0157371_10000011 3300013102 Bacteria 377608
376 Ga0157371_10002929 3300013102 Bacteria 15932
377 Ga0157371_10005491 3300013102 Bacteria 10678
378 Ga0157371_10055527 3300013102 Bacteria 2810
379 Ga0157371_10061154 3300013102 Bacteria 2670
380 Ga0157371_10192406 3300013102 Bacteria 1461
381 Ga0157370_10050051 3300013104 Bacteria 3996
382 Ga0157370_10069379 3300013104 Bacteria 3330
383 Ga0157370_10297570 3300013104 Bacteria 1490
384 Ga0157369_10014410 3300013105 Bacteria 8927
385 Ga0157369_10023754 3300013105 Bacteria 6825
386 Ga0157369_10115296 3300013105 Bacteria 2853
387 Ga0157374_10004138 3300013296 Bacteria 12185
388 Ga0157378_10000428 3300013297 Bacteria 41097
389 Ga0157378_10157689 3300013297 Bacteria 2120
390 Ga0163162_10018410 3300013306 Bacteria 6844
391 Ga0163162_10031019 3300013306 Bacteria 5299
392 Ga0163162_10111261 3300013306 Bacteria 2836
393 Ga0163162_10145545 3300013306 Bacteria 2485
394 Ga0157372_10002932 3300013307 Bacteria 18418
395 Ga0157372_10029886 3300013307 Bacteria 5954
396 Ga0157372_10049775 3300013307 Bacteria 4661
397 Ga0157372_10164956 3300013307 Bacteria 2561
398 Ga0157372_10209739 3300013307 Bacteria 2257
399 Ga0157375_10016992 3300013308 Bacteria 6555
400 Ga0163163_10000080 3300014325 Bacteria 106006
401 Ga0163163_10024380 3300014325 Bacteria 5758
402 Ga0163163_10034771 3300014325 Bacteria 4884
403 Ga0163163_10036134 3300014325 Bacteria 4797
404 Ga0157380_10000083 3300014326 Bacteria 52136
405 Ga0157380_10001477 3300014326 Bacteria 15380
406 Ga0157380_10001524 3300014326 Bacteria 15215
407 Ga0157380_10011365 3300014326 Bacteria 6433
408 Ga0157379_10012633 3300014968 Bacteria 7377
409 Ga0157379_10078836 3300014968 Bacteria 2950
410 Ga0157379_10094881 3300014968 Bacteria 2677
411 Ga0157379_10276066 3300014968 Bacteria 1529
412 Ga0157376_10058403 3300014969 Bacteria 3231
413 Ga0163161_10000571 3300017792 Bacteria 29595
414 Ga0163161_10022829 3300017792 Bacteria 4408
415 Ga0163161_10160079 3300017792 Bacteria 1716
416 Ga0206356_10205632 3300020070 Bacteria 1601
417 Ga0213873_10000017 3300021358 Bacteria 123962
418 Ga0213876_10000071 3300021384 Bacteria 123962
419 Ga0213875_10001398 3300021388 Bacteria 15764
420 Ga0213875_10006840 3300021388 Bacteria 5951
421 Ga0209147_100453 3300025229 Bacteria 25782
422 Ga0207425_1000005 3300025245 Bacteria 900502
423 Ga0209148_1000008 3300025254 Bacteria 1504371
424 Ga0209148_1002533 3300025254 Bacteria 6117
425 Ga0209129_1000288 3300025258 Bacteria 48099
426 Ga0209565_1000231 3300025263 Bacteria 61384
427 Ga0209455_1000002 3300025272 Bacteria 1505459
428 Ga0209455_1000347 3300025272 Bacteria 43550
429 Ga0209673_1025079 3300025273 Bacteria 1989
430 Ga0209676_1010080 3300025292 Bacteria 3986
431 Ga0209025_1000515 3300025294 Bacteria 73801
432 Ga0209564_1000619 3300025295 Bacteria 54397
433 Ga0209758_1000002 3300025297 Bacteria 1400310
434 Ga0209758_1000017 3300025297 Bacteria 754393
435 Ga0209050_1000001 3300025298 Bacteria 3563507
436 Ga0209050_1000483 3300025298 Bacteria 69796
437 Ga0209051_1001199 3300025303 Bacteria 23406
438 Ga0209257_1003144 3300025304 Bacteria 14726
439 Ga0209257_1003889 3300025304 Bacteria 12182
440 Ga0207697_10000142 3300025315 Bacteria 34778
441 Ga0207697_10017761 3300025315 Bacteria 2923
442 Ga0207697_10040679 3300025315 Bacteria 1908
443 Ga0207656_10042647 3300025321 Bacteria 1931
444 Ga0207713_1001365 3300025735 Bacteria 19850
445 Ga0207682_10001425 3300025893 Bacteria 11046
446 Ga0207682_10002099 3300025893 Bacteria 9031
447 Ga0207682_10003573 3300025893 Bacteria 6723
448 Ga0207710_10002325 3300025900 Bacteria 8882
449 Ga0207710_10006116 3300025900 Bacteria 5156
450 Ga0207688_10000182 3300025901 Bacteria 27994
451 Ga0207688_10008427 3300025901 Bacteria 5607
452 Ga0207688_10030047 3300025901 Bacteria 2995
453 Ga0207688_10048285 3300025901 Bacteria 2378
454 Ga0207680_10000007 3300025903 Bacteria 623574
455 Ga0207680_10004029 3300025903 Bacteria 6941
456 Ga0207680_10014931 3300025903 Bacteria 4038
457 Ga0207680_10019851 3300025903 Bacteria 3604
458 Ga0207647_10000203 3300025904 Bacteria 48448
459 Ga0207647_10001025 3300025904 Bacteria 21722
460 Ga0207647_10006164 3300025904 Bacteria 8734
461 Ga0207647_10006976 3300025904 Bacteria 8187
462 Ga0207647_10008623 3300025904 Bacteria 7292
463 Ga0207647_10016621 3300025904 Bacteria 5019
464 Ga0207645_10012835 3300025907 Bacteria 5671
465 Ga0207645_10013177 3300025907 Bacteria 5581
466 Ga0207645_10021337 3300025907 Bacteria 4224
467 Ga0207645_10141323 3300025907 Bacteria 1569
468 Ga0207643_10041490 3300025908 Bacteria 2593
469 Ga0207643_10060686 3300025908 Bacteria 2159
470 Ga0207705_10000117 3300025909 Bacteria 88666
471 Ga0207705_10000335 3300025909 Bacteria 42589
472 Ga0207705_10000622 3300025909 Bacteria 29600
473 Ga0207705_10001455 3300025909 Bacteria 18886
474 Ga0207705_10006344 3300025909 Bacteria 8773
475 Ga0207705_10009894 3300025909 Bacteria 6944
476 Ga0207705_10042652 3300025909 Bacteria 3257
477 Ga0207705_10052399 3300025909 Bacteria 2937
478 Ga0207705_10068162 3300025909 Bacteria 2575
479 Ga0207705_10075092 3300025909 Bacteria 2454
480 Ga0207654_10000924 3300025911 Bacteria 16223
481 Ga0207654_10045706 3300025911 Bacteria 2493
482 Ga0207707_10028068 3300025912 Bacteria 4920
483 Ga0207707_10057899 3300025912 Bacteria 3373
484 Ga0207707_10062953 3300025912 Bacteria 3229
485 Ga0207695_10012312 3300025913 Bacteria 10277
486 Ga0207695_10015122 3300025913 Bacteria 9105
487 Ga0207695_10021564 3300025913 Bacteria 7346
488 Ga0207695_10021664 3300025913 Bacteria 7326
489 Ga0207671_10001694 3300025914 Bacteria 24966
490 Ga0207671_10018274 3300025914 Bacteria 5383
491 Ga0207671_10119207 3300025914 Bacteria 2016
492 Ga0207660_10000372 3300025917 Bacteria 29302
493 Ga0207660_10000472 3300025917 Bacteria 26680
494 Ga0207660_10002715 3300025917 Bacteria 11597
495 Ga0207660_10129102 3300025917 Bacteria 1922
496 Ga0207660_10266178 3300025917 Bacteria 1357
497 Ga0207662_10051413 3300025918 Bacteria 2452
498 Ga0207657_10000145 3300025919 Bacteria 72001
499 Ga0207657_10000655 3300025919 Bacteria 36836
500 Ga0207657_10002767 3300025919 Bacteria 18879
501 Ga0207657_10004043 3300025919 Bacteria 15582
502 Ga0207657_10021945 3300025919 Bacteria 5994
503 Ga0207657_10043223 3300025919 Bacteria 3971
504 Ga0207657_10048055 3300025919 Bacteria 3727
505 Ga0207657_10083473 3300025919 Bacteria 2680
506 Ga0207657_10108216 3300025919 Bacteria 2298
507 Ga0207657_10134142 3300025919 Bacteria 2027
508 Ga0207657_10183914 3300025919 Bacteria 1688
509 Ga0207657_10216581 3300025919 Bacteria 1535
510 Ga0207649_10001417 3300025920 Bacteria 14183
511 Ga0207649_10001501 3300025920 Bacteria 13704
512 Ga0207649_10002484 3300025920 Bacteria 10304
513 Ga0207649_10007148 3300025920 Bacteria 6067
514 Ga0207649_10028294 3300025920 Bacteria 3299
515 Ga0207649_10108104 3300025920 Bacteria 1853
516 Ga0207652_10020140 3300025921 Bacteria 5492
517 Ga0207652_10149423 3300025921 Bacteria 2091
518 Ga0207652_10216574 3300025921 Bacteria 1725
519 Ga0207681_10000001 3300025923 Bacteria 1105841
520 Ga0207681_10000199 3300025923 Bacteria 47783
521 Ga0207681_10004789 3300025923 Bacteria 8321
522 Ga0207681_10007428 3300025923 Bacteria 6712
523 Ga0207681_10008302 3300025923 Bacteria 6351
524 Ga0207681_10012904 3300025923 Bacteria 5166
525 Ga0207681_10044950 3300025923 Bacteria 2962
526 Ga0207681_10053467 3300025923 Bacteria 2742
527 Ga0207681_10087464 3300025923 Bacteria 2217
528 Ga0207694_10010538 3300025924 Bacteria 6973
529 Ga0207694_10030232 3300025924 Bacteria 4136
530 Ga0207694_10085339 3300025924 Bacteria 2485
531 Ga0207694_10090550 3300025924 Bacteria 2414
532 Ga0207694_10091959 3300025924 Bacteria 2394
533 Ga0207694_10098282 3300025924 Bacteria 2317
534 Ga0207650_10000018 3300025925 Bacteria 352120
535 Ga0207650_10000111 3300025925 Bacteria 107416
536 Ga0207650_10000977 3300025925 Bacteria 21524
537 Ga0207650_10006376 3300025925 Bacteria 8034
538 Ga0207650_10006873 3300025925 Bacteria 7757
539 Ga0207650_10007801 3300025925 Bacteria 7297
540 Ga0207650_10015414 3300025925 Bacteria 5322
541 Ga0207659_10010321 3300025926 Bacteria 5864
542 Ga0207659_10070500 3300025926 Bacteria 2549
543 Ga0207659_10132311 3300025926 Bacteria 1927
544 Ga0207659_10141270 3300025926 Bacteria 1869
545 Ga0207687_10000394 3300025927 Bacteria 29568
546 Ga0207687_10004989 3300025927 Bacteria 8795
547 Ga0207687_10005831 3300025927 Bacteria 8148
548 Ga0207687_10006475 3300025927 Bacteria 7735
549 Ga0207700_10134740 3300025928 Bacteria 2022
550 Ga0207700_10140663 3300025928 Bacteria 1983
551 Ga0207664_10053606 3300025929 Bacteria 3193
552 Ga0207644_10000050 3300025931 Bacteria 93772
553 Ga0207644_10000259 3300025931 Bacteria 35648
554 Ga0207644_10000558 3300025931 Bacteria 23912
555 Ga0207644_10000595 3300025931 Bacteria 23038
556 Ga0207644_10000837 3300025931 Bacteria 19551
557 Ga0207644_10001602 3300025931 Bacteria 14603
558 Ga0207644_10002970 3300025931 Bacteria 10920
559 Ga0207644_10019650 3300025931 Bacteria 4587
560 Ga0207644_10026976 3300025931 Bacteria 3965
561 Ga0207644_10036639 3300025931 Bacteria 3445
562 Ga0207644_10195116 3300025931 Bacteria 1594
563 Ga0207690_10000004 3300025932 Bacteria 746138
564 Ga0207690_10002597 3300025932 Bacteria 10901
565 Ga0207690_10015913 3300025932 Bacteria 4568
566 Ga0207690_10023880 3300025932 Bacteria 3822
567 Ga0207690_10027615 3300025932 Bacteria 3588
568 Ga0207690_10030160 3300025932 Bacteria 3456
569 Ga0207690_10032259 3300025932 Bacteria 3359
570 Ga0207690_10049935 3300025932 Bacteria 2790
571 Ga0207690_10052035 3300025932 Bacteria 2742
572 Ga0207690_10052464 3300025932 Bacteria 2732
573 Ga0207690_10086040 3300025932 Bacteria 2208
574 Ga0207690_10121168 3300025932 Bacteria 1900
575 Ga0207690_10132603 3300025932 Bacteria 1825
576 Ga0207706_10007479 3300025933 Bacteria 10100
577 Ga0207706_10007662 3300025933 Bacteria 9975
578 Ga0207706_10012593 3300025933 Bacteria 7701
579 Ga0207706_10024287 3300025933 Bacteria 5433
580 Ga0207706_10026981 3300025933 Bacteria 5138
581 Ga0207706_10052262 3300025933 Bacteria 3607
582 Ga0207706_10061651 3300025933 Bacteria 3303
583 Ga0207706_10073337 3300025933 Bacteria 3010
584 Ga0207706_10075102 3300025933 Bacteria 2972
585 Ga0207706_10142679 3300025933 Bacteria 2107
586 Ga0207706_10196715 3300025933 Bacteria 1768
587 Ga0207706_10261474 3300025933 Bacteria 1511
588 Ga0207670_10014973 3300025936 Bacteria 4620
589 Ga0207704_10056906 3300025938 Bacteria 2399
590 Ga0207704_10083174 3300025938 Bacteria 2076
591 Ga0207665_10075458 3300025939 Bacteria 2309
592 Ga0207691_10001140 3300025940 Bacteria 26349
593 Ga0207691_10002983 3300025940 Bacteria 16515
594 Ga0207691_10008826 3300025940 Bacteria 9671
595 Ga0207691_10013356 3300025940 Bacteria 7865
596 Ga0207691_10049207 3300025940 Bacteria 3862
597 Ga0207691_10060409 3300025940 Bacteria 3444
598 Ga0207691_10062733 3300025940 Bacteria 3371
599 Ga0207691_10079279 3300025940 Bacteria 2956
600 Ga0207711_10000027 3300025941 Bacteria 236548
601 Ga0207711_10000187 3300025941 Bacteria 66307
602 Ga0207711_10000510 3300025941 Bacteria 39938
603 Ga0207711_10000594 3300025941 Bacteria 36660
604 Ga0207711_10002993 3300025941 Bacteria 14766
605 Ga0207711_10003956 3300025941 Bacteria 12744
606 Ga0207711_10007399 3300025941 Bacteria 9187
607 Ga0207711_10023075 3300025941 Bacteria 5210
608 Ga0207711_10065959 3300025941 Bacteria 3130
609 Ga0207689_10000125 3300025942 Bacteria 64633
610 Ga0207689_10052421 3300025942 Bacteria 3362
611 Ga0207689_10066078 3300025942 Bacteria 2974
612 Ga0207661_10004111 3300025944 Bacteria 10175
613 Ga0207661_10006302 3300025944 Bacteria 8394
614 Ga0207679_10002092 3300025945 Bacteria 12395
615 Ga0207679_10020436 3300025945 Bacteria 4468
616 Ga0207679_10028044 3300025945 Bacteria 3902
617 Ga0207679_10047306 3300025945 Bacteria 3124
618 Ga0207679_10119466 3300025945 Bacteria 2095
619 Ga0207679_10164431 3300025945 Bacteria 1820
620 Ga0207667_10000001 3300025949 Bacteria 1178522
621 Ga0207667_10000670 3300025949 Bacteria 44352
622 Ga0207667_10002785 3300025949 Bacteria 21649
623 Ga0207667_10020182 3300025949 Bacteria 7418
624 Ga0207667_10021396 3300025949 Bacteria 7167
625 Ga0207667_10024163 3300025949 Bacteria 6677
626 Ga0207667_10036599 3300025949 Bacteria 5258
627 Ga0207667_10098991 3300025949 Bacteria 3008
628 Ga0207667_10112805 3300025949 Bacteria 2803
629 Ga0207667_10116095 3300025949 Bacteria 2758
630 Ga0207667_10154605 3300025949 Bacteria 2360
631 Ga0207667_10163836 3300025949 Bacteria 2286
632 Ga0207667_10188728 3300025949 Bacteria 2115
633 Ga0207667_10233739 3300025949 Bacteria 1882
634 Ga0207651_10002877 3300025960 Bacteria 8304
635 Ga0207651_10004902 3300025960 Bacteria 6825
636 Ga0207651_10025573 3300025960 Bacteria 3672
637 Ga0207651_10026473 3300025960 Bacteria 3624
638 Ga0207651_10037348 3300025960 Bacteria 3181
639 Ga0207651_10040831 3300025960 Bacteria 3074
640 Ga0207651_10047180 3300025960 Bacteria 2902
641 Ga0207651_10089798 3300025960 Bacteria 2244
642 Ga0207712_10000004 3300025961 Bacteria 614655
643 Ga0207712_10000015 3300025961 Bacteria 346689
644 Ga0207712_10000131 3300025961 Bacteria 79015
645 Ga0207712_10000946 3300025961 Bacteria 20945
646 Ga0207712_10030191 3300025961 Bacteria 3642
647 Ga0207668_10000044 3300025972 Bacteria 103256
648 Ga0207668_10000062 3300025972 Bacteria 88123
649 Ga0207668_10000213 3300025972 Bacteria 39220
650 Ga0207668_10018419 3300025972 Bacteria 4394
651 Ga0207668_10022110 3300025972 Bacteria 4066
652 Ga0207668_10093712 3300025972 Bacteria 2213
653 Ga0207640_10000363 3300025981 Bacteria 29456
654 Ga0207640_10003562 3300025981 Bacteria 8397
655 Ga0207640_10008542 3300025981 Bacteria 5688
656 Ga0207640_10013048 3300025981 Bacteria 4752
657 Ga0207640_10034064 3300025981 Bacteria 3175
658 Ga0207640_10035423 3300025981 Bacteria 3124
659 Ga0207658_10000034 3300025986 Bacteria 155561
660 Ga0207658_10000128 3300025986 Bacteria 82259
661 Ga0207658_10000238 3300025986 Bacteria 57993
662 Ga0207658_10001984 3300025986 Bacteria 15265
663 Ga0207658_10004369 3300025986 Bacteria 9827
664 Ga0207658_10004383 3300025986 Bacteria 9815
665 Ga0207658_10006316 3300025986 Bacteria 8092
666 Ga0207658_10013838 3300025986 Bacteria 5520
667 Ga0207658_10036557 3300025986 Bacteria 3521
668 Ga0207658_10043715 3300025986 Bacteria 3258
669 Ga0207658_10055135 3300025986 Bacteria 2944
670 Ga0207677_10000080 3300026023 Bacteria 79544
671 Ga0207703_10000231 3300026035 Bacteria 63888
672 Ga0207703_10000849 3300026035 Bacteria 29915
673 Ga0207703_10001787 3300026035 Bacteria 19177
674 Ga0207703_10002564 3300026035 Bacteria 15695
675 Ga0207703_10006281 3300026035 Bacteria 9500
676 Ga0207703_10007907 3300026035 Bacteria 8409
677 Ga0207703_10020969 3300026035 Bacteria 5113
678 Ga0207703_10056143 3300026035 Bacteria 3206
679 Ga0207703_10084791 3300026035 Bacteria 2650
680 Ga0207639_10008118 3300026041 Bacteria 7178
681 Ga0207639_10017189 3300026041 Bacteria 5127
682 Ga0207639_10048006 3300026041 Bacteria 3229
683 Ga0207639_10070810 3300026041 Bacteria 2725
684 Ga0207639_10089838 3300026041 Bacteria 2456
685 Ga0207639_10241774 3300026041 Bacteria 1570
686 Ga0207678_10006903 3300026067 Bacteria 10074
687 Ga0207678_10010454 3300026067 Bacteria 8149
688 Ga0207678_10017746 3300026067 Bacteria 6249
689 Ga0207678_10022937 3300026067 Bacteria 5462
690 Ga0207678_10029991 3300026067 Bacteria 4749
691 Ga0207678_10067054 3300026067 Bacteria 3080
692 Ga0207678_10086272 3300026067 Bacteria 2683
693 Ga0207678_10164754 3300026067 Bacteria 1893
694 Ga0207678_10300581 3300026067 Bacteria 1379
695 Ga0207702_10001583 3300026078 Bacteria 22544
696 Ga0207702_10005973 3300026078 Bacteria 10571
697 Ga0207702_10006703 3300026078 Bacteria 9895
698 Ga0207702_10044145 3300026078 Bacteria 3746
699 Ga0207702_10057431 3300026078 Bacteria 3307
700 Ga0207702_10062450 3300026078 Bacteria 3181
701 Ga0207702_10085706 3300026078 Bacteria 2746
702 Ga0207702_10106329 3300026078 Bacteria 2486
703 Ga0207641_10000039 3300026088 Bacteria 199453
704 Ga0207641_10000041 3300026088 Bacteria 191595
705 Ga0207641_10000175 3300026088 Bacteria 89110
706 Ga0207641_10000216 3300026088 Bacteria 74765
707 Ga0207641_10000831 3300026088 Bacteria 32876
708 Ga0207641_10005831 3300026088 Bacteria 10452
709 Ga0207641_10007120 3300026088 Bacteria 9343
710 Ga0207641_10012101 3300026088 Bacteria 7077
711 Ga0207641_10014215 3300026088 Bacteria 6523
712 Ga0207641_10019869 3300026088 Bacteria 5511
713 Ga0207641_10021641 3300026088 Bacteria 5283
714 Ga0207641_10032389 3300026088 Bacteria 4340
715 Ga0207641_10089430 3300026088 Bacteria 2691
716 Ga0207641_10108204 3300026088 Bacteria 2460
717 Ga0207648_10000530 3300026089 Bacteria 42624
718 Ga0207648_10026086 3300026089 Bacteria 5195
719 Ga0207648_10156517 3300026089 Bacteria 2012
720 Ga0207676_10000004 3300026095 Bacteria 725417
721 Ga0207676_10000039 3300026095 Bacteria 171142
722 Ga0207676_10000138 3300026095 Bacteria 63283
723 Ga0207676_10001416 3300026095 Bacteria 17820
724 Ga0207676_10003178 3300026095 Bacteria 11706
725 Ga0207676_10006048 3300026095 Bacteria 8537
726 Ga0207676_10010563 3300026095 Bacteria 6580
727 Ga0207676_10015664 3300026095 Bacteria 5476
728 Ga0207676_10027735 3300026095 Bacteria 4221
729 Ga0207676_10208562 3300026095 Bacteria 1732
730 Ga0207674_10001746 3300026116 Bacteria 27810
731 Ga0207674_10002750 3300026116 Bacteria 21946
732 Ga0207674_10003722 3300026116 Bacteria 18621
733 Ga0207674_10008360 3300026116 Bacteria 11971
734 Ga0207674_10016671 3300026116 Bacteria 8030
735 Ga0207674_10022465 3300026116 Bacteria 6772
736 Ga0207674_10074028 3300026116 Bacteria 3419
737 Ga0207674_10145525 3300026116 Bacteria 2328
738 Ga0207674_10150402 3300026116 Bacteria 2285
739 Ga0207675_100000058 3300026118 Bacteria 81487
740 Ga0207675_100001397 3300026118 Bacteria 24176
741 Ga0207675_100005093 3300026118 Bacteria 12647
742 Ga0207675_100005139 3300026118 Bacteria 12597
743 Ga0207675_100133716 3300026118 Bacteria 2352
744 Ga0207675_100247623 3300026118 Bacteria 1724
745 Ga0207683_10016043 3300026121 Bacteria 6375
746 Ga0207683_10024784 3300026121 Bacteria 5168
747 Ga0207683_10078689 3300026121 Bacteria 2922
748 Ga0207683_10123272 3300026121 Bacteria 2328
749 Ga0207698_10009614 3300026142 Bacteria 6174
750 Ga0207698_10012092 3300026142 Bacteria 5631
751 Ga0207698_10024324 3300026142 Bacteria 4249
752 Ga0207698_10034474 3300026142 Bacteria 3690
753 Ga0207698_10052867 3300026142 Bacteria 3114
754 Ga0207698_10069965 3300026142 Bacteria 2778
755 Ga0207698_10078285 3300026142 Bacteria 2654
756 Ga0207698_10086673 3300026142 Bacteria 2547
757 Ga0207698_10131862 3300026142 Bacteria 2137
758 Ga0207698_10180673 3300026142 Bacteria 1869
759 Ga0209974_10001657 3300027876 Bacteria 8053
760 Ga0268266_10000002 3300028379 Bacteria 3059047
761 Ga0268266_10000040 3300028379 Bacteria 323843
762 Ga0268266_10000093 3300028379 Bacteria 191879
763 Ga0268266_10000437 3300028379 Bacteria 62490
764 Ga0268266_10000584 3300028379 Bacteria 50438
765 Ga0268266_10009696 3300028379 Bacteria 8463
766 Ga0268266_10041266 3300028379 Bacteria 3937
767 Ga0268266_10041811 3300028379 Bacteria 3913
768 Ga0268265_10000002 3300028380 Bacteria 1035381
769 Ga0268265_10000061 3300028380 Bacteria 148625
770 Ga0268265_10000168 3300028380 Bacteria 79798
771 Ga0268265_10000294 3300028380 Bacteria 56208
772 Ga0268265_10000880 3300028380 Bacteria 28075
773 Ga0268265_10007183 3300028380 Bacteria 7526
774 Ga0268265_10007394 3300028380 Bacteria 7417
775 Ga0268265_10009046 3300028380 Bacteria 6734
776 Ga0268265_10031955 3300028380 Bacteria 3807
777 Ga0268265_10032625 3300028380 Bacteria 3776
778 Ga0268265_10070629 3300028380 Bacteria 2716
779 Ga0268265_10163662 3300028380 Bacteria 1893
780 Ga0268265_10166848 3300028380 Bacteria 1877
781 Ga0268264_10000003 3300028381 Bacteria 1141976
782 Ga0268264_10000075 3300028381 Bacteria 256011
783 Ga0268264_10000296 3300028381 Bacteria 82267
784 Ga0268264_10001379 3300028381 Bacteria 22755
785 Ga0268264_10002990 3300028381 Bacteria 14672
786 Ga0268264_10003522 3300028381 Bacteria 13489
787 Ga0268264_10009076 3300028381 Bacteria 8246
788 Ga0268264_10009299 3300028381 Bacteria 8135
789 Ga0268264_10035547 3300028381 Bacteria 4102
790 Ga0268264_10082517 3300028381 Bacteria 2751
791 Ga0268264_10096572 3300028381 Bacteria 2560
792 Ga0268264_10304711 3300028381 Bacteria 1501
793 Ga0307517_10067615 3300028786 Bacteria 3268
794 Ga0307517_10154579 3300028786 Bacteria 1561
795 Ga0307513_10033474 3300031456 Bacteria 5776
796 Ga0307408_100010901 3300031548 Bacteria 5999
797 Ga0307408_100024986 3300031548 Bacteria 4086
798 Ga0307408_100058722 3300031548 Bacteria 2798
799 Ga0307408_100108569 3300031548 Bacteria 2127
800 Ga0307408_100120135 3300031548 Bacteria 2034
801 Ga0307408_100136438 3300031548 Bacteria 1920
802 Ga0307405_10026867 3300031731 Bacteria 3328
803 Ga0307405_10067690 3300031731 Bacteria 2282
804 Ga0307405_10070519 3300031731 Bacteria 2245
805 Ga0307405_10117465 3300031731 Bacteria 1813
806 Ga0307405_10162043 3300031731 Bacteria 1585
807 Ga0307413_10004519 3300031824 Bacteria 6064
808 Ga0307413_10004980 3300031824 Bacteria 5859
809 Ga0307413_10010568 3300031824 Bacteria 4487
810 Ga0307413_10026601 3300031824 Bacteria 3191
811 Ga0307413_10045712 3300031824 Bacteria 2598
812 Ga0307413_10077591 3300031824 Bacteria 2116
813 Ga0307410_10002232 3300031852 Bacteria 9247
814 Ga0307410_10005049 3300031852 Bacteria 6935
815 Ga0307410_10006709 3300031852 Bacteria 6236
816 Ga0307410_10009758 3300031852 Bacteria 5402
817 Ga0307410_10019724 3300031852 Bacteria 4108
818 Ga0307410_10081567 3300031852 Bacteria 2272
819 Ga0307410_10104312 3300031852 Bacteria 2038
820 Ga0307410_10106741 3300031852 Bacteria 2018
821 Ga0307410_10118820 3300031852 Bacteria 1924
822 Ga0307410_10226832 3300031852 Bacteria 1440
823 Ga0307406_10016165 3300031901 Bacteria 4331
824 Ga0307406_10031010 3300031901 Bacteria 3252
825 Ga0307406_10100059 3300031901 Bacteria 1973
826 Ga0307406_10120682 3300031901 Bacteria 1822
827 Ga0307407_10008840 3300031903 Bacteria 4652
828 Ga0307407_10011829 3300031903 Bacteria 4172
829 Ga0307407_10017423 3300031903 Bacteria 3604
830 Ga0307407_10108286 3300031903 Bacteria 1739
831 Ga0307412_10001745 3300031911 Bacteria 12024
832 Ga0307412_10003365 3300031911 Bacteria 8886
833 Ga0307412_10024170 3300031911 Bacteria 3748
834 Ga0307412_10134540 3300031911 Bacteria 1801
835 Ga0307412_10135855 3300031911 Bacteria 1794
836 Ga0307409_100000240 3300031995 Bacteria 22082
837 Ga0307409_100001643 3300031995 Bacteria 11203
838 Ga0307409_100012288 3300031995 Bacteria 5450
839 Ga0307409_100041226 3300031995 Bacteria 3446
840 Ga0307409_100079530 3300031995 Bacteria 2642
841 Ga0307409_100090426 3300031995 Bacteria 2506
842 Ga0307409_100091004 3300031995 Bacteria 2499
843 Ga0307409_100181536 3300031995 Bacteria 1863
844 Ga0307409_100218022 3300031995 Bacteria 1720
845 Ga0307416_100006181 3300032002 Bacteria 7470
846 Ga0307416_100010519 3300032002 Bacteria 6116
847 Ga0307416_100091319 3300032002 Bacteria 2615
848 Ga0307416_100224170 3300032002 Bacteria 1806
849 Ga0307416_100300127 3300032002 Bacteria 1596
850 Ga0307416_100332334 3300032002 Bacteria 1528
851 Ga0307416_100365073 3300032002 Bacteria 1467
852 Ga0307414_10000664 3300032004 Bacteria 17619
853 Ga0307414_10000800 3300032004 Bacteria 16106
854 Ga0307414_10000921 3300032004 Bacteria 15040
855 Ga0307414_10006422 3300032004 Bacteria 6555
856 Ga0307414_10018606 3300032004 Bacteria 4283
857 Ga0307414_10021693 3300032004 Bacteria 4037
858 Ga0307414_10028159 3300032004 Bacteria 3640
859 Ga0307414_10039746 3300032004 Bacteria 3172
860 Ga0307414_10050336 3300032004 Bacteria 2885
861 Ga0307414_10085871 3300032004 Bacteria 2320
862 Ga0307414_10106498 3300032004 Bacteria 2122
863 Ga0307414_10165269 3300032004 Bacteria 1763
864 Ga0307411_10007449 3300032005 Bacteria 5576
865 Ga0307411_10012103 3300032005 Bacteria 4688
866 Ga0307411_10012989 3300032005 Bacteria 4574
867 Ga0307411_10015671 3300032005 Bacteria 4266
868 Ga0307411_10018673 3300032005 Bacteria 3985
869 Ga0307411_10022396 3300032005 Bacteria 3719
870 Ga0307411_10032751 3300032005 Bacteria 3215
871 Ga0307411_10076294 3300032005 Bacteria 2291
872 Ga0307411_10097669 3300032005 Bacteria 2068
873 Ga0307411_10177853 3300032005 Bacteria 1611
874 Ga0307415_100043282 3300032126 Bacteria 3003
875 Ga0307415_100116574 3300032126 Bacteria 1993
876 Ga0307415_100161424 3300032126 Bacteria 1737
877 Ga0307510_10013520 3300033180 Bacteria 9682
878 Ga0307510_10133175 3300033180 Bacteria 2151
879 Ga0373943_0017139 3300035170 Bacteria 3313
880 Ga0373955_0001792 3300035172 Bacteria 9226
881 Ga0373935_0068062 3300035692 Bacteria 2291
882 Ga0373937_0010114 3300036401 Bacteria 8227
883 Ga0373925_0031833 3300037068 Bacteria 3880
884 Ga0395899_0000112 3300037312 Bacteria 138389
885 Ga0395899_0000684 3300037312 Bacteria 34177
886 Ga0395899_0001082 3300037312 Bacteria 24549
887 Ga0395899_0013837 3300037312 Bacteria 6164
888 Ga0395899_0020126 3300037312 Bacteria 5062
889 Ga0395899_0025938 3300037312 Bacteria 4423
890 Ga0395899_0029970 3300037312 Bacteria 4094
891 Ga0395899_0034749 3300037312 Bacteria 3786
892 Ga0395899_0065623 3300037312 Bacteria 2667
893 Ga0395899_0082256 3300037312 Bacteria 2342
894 Ga0395900_0000614 3300037418 Bacteria 48329
895 Ga0395900_0000881 3300037418 Bacteria 39365
896 Ga0395900_0001333 3300037418 Bacteria 29893
897 Ga0395900_0001439 3300037418 Bacteria 28412
898 Ga0395900_0010639 3300037418 Bacteria 9409
899 Ga0395900_0016220 3300037418 Bacteria 7589
900 Ga0395900_0017167 3300037418 Bacteria 7387
901 Ga0395900_0021454 3300037418 Bacteria 6603
902 Ga0395900_0025649 3300037418 Bacteria 6033
903 Ga0395900_0037100 3300037418 Bacteria 5026
904 Ga0395900_0040115 3300037418 Bacteria 4824
905 Ga0395900_0040572 3300037418 Bacteria 4796
906 Ga0395900_0049578 3300037418 Bacteria 4326
907 Ga0395900_0055072 3300037418 Bacteria 4094
908 Ga0395900_0070328 3300037418 Bacteria 3598
909 Ga0395900_0071462 3300037418 Bacteria 3567
910 Ga0395900_0097322 3300037418 Bacteria 3023
911 Ga0395900_0102846 3300037418 Bacteria 2934
912 Ga0395900_0103653 3300037418 Bacteria 2922
913 Ga0395900_0125252 3300037418 Bacteria 2635
914 Ga0395900_0174111 3300037418 Bacteria 2189
915 Ga0395900_0177262 3300037418 Bacteria 2167
916 Ga0395900_0199865 3300037418 Bacteria 2023
917 Ga0395900_0293372 3300037418 Bacteria 1614
918 Ga0395898_0002116 3300037466 Bacteria 24521
919 Ga0395898_0009114 3300037466 Bacteria 10451
920 Ga0395898_0010122 3300037466 Bacteria 9870
921 Ga0395898_0013356 3300037466 Bacteria 8458
922 Ga0395898_0016783 3300037466 Bacteria 7481
923 Ga0395898_0018829 3300037466 Bacteria 7034
924 Ga0395898_0020345 3300037466 Bacteria 6739
925 Ga0395898_0038438 3300037466 Bacteria 4743
926 Ga0395898_0039372 3300037466 Bacteria 4679
927 Ga0395898_0056318 3300037466 Bacteria 3832
928 Ga0395898_0078635 3300037466 Bacteria 3182
929 Ga0395898_0086314 3300037466 Bacteria 3024
930 Ga0395898_0187487 3300037466 Bacteria 1976
931 Ga0395898_0242457 3300037466 Bacteria 1719
932 Ga0395905_0000089 3300037471 Bacteria 152196
933 Ga0395905_0001957 3300037471 Bacteria 23573
934 Ga0395905_0004094 3300037471 Bacteria 15277
935 Ga0395905_0006090 3300037471 Bacteria 12185
936 Ga0395905_0006216 3300037471 Bacteria 12055
937 Ga0395905_0010107 3300037471 Bacteria 9198
938 Ga0395905_0010449 3300037471 Bacteria 9032
939 Ga0395905_0018446 3300037471 Bacteria 6623
940 Ga0395905_0020390 3300037471 Bacteria 6281
941 Ga0395905_0030513 3300037471 Bacteria 5079
942 Ga0395905_0031269 3300037471 Bacteria 5012
943 Ga0395905_0034052 3300037471 Bacteria 4783
944 Ga0395905_0036898 3300037471 Bacteria 4591
945 Ga0395905_0039173 3300037471 Bacteria 4446
946 Ga0395905_0039877 3300037471 Bacteria 4405
947 Ga0395905_0078164 3300037471 Bacteria 3100
948 Ga0395905_0080065 3300037471 Bacteria 3061
949 Ga0395905_0102637 3300037471 Bacteria 2685
950 Ga0395905_0102812 3300037471 Bacteria 2682
951 Ga0395905_0125387 3300037471 Bacteria 2414
952 Ga0395905_0175612 3300037471 Bacteria 2011
953 Ga0395905_0189278 3300037471 Bacteria 1931
954 Ga0395905_0198824 3300037471 Bacteria 1879
955 Ga0395905_0214336 3300037471 Bacteria 1803
956 Ga0395905_0277287 3300037471 Bacteria 1562
957 Ga0436364_0103913 3300037853 Bacteria 7699
958 Ga0436364_1065372 3300037853 Bacteria 196587
959 Ga0395901_0000047 3300038443 Bacteria 175221
960 Ga0395901_0000548 3300038443 Bacteria 43338
961 Ga0395901_0000826 3300038443 Bacteria 34177
962 Ga0395901_0014632 3300038443 Bacteria 7972
963 Ga0395901_0015760 3300038443 Bacteria 7701
964 Ga0395901_0017341 3300038443 Bacteria 7351
965 Ga0395901_0019930 3300038443 Bacteria 6862
966 Ga0395901_0023062 3300038443 Bacteria 6379
967 Ga0395901_0029098 3300038443 Bacteria 5684
968 Ga0395901_0029662 3300038443 Bacteria 5632
969 Ga0395901_0030986 3300038443 Bacteria 5512
970 Ga0395901_0044455 3300038443 Bacteria 4607
971 Ga0395901_0044717 3300038443 Bacteria 4592
972 Ga0395901_0053000 3300038443 Bacteria 4215
973 Ga0395901_0098530 3300038443 Bacteria 3065
974 Ga0395901_0133816 3300038443 Bacteria 2605
975 Ga0395901_0133995 3300038443 Bacteria 2603
976 Ga0395901_0172681 3300038443 Bacteria 2268
977 Ga0395901_0181013 3300038443 Bacteria 2210
978 Ga0395901_0207532 3300038443 Bacteria 2051
979 Ga0395901_0212271 3300038443 Bacteria 2026
980 Ga0395901_0258300 3300038443 Bacteria 1813
981 Ga0395901_0262740 3300038443 Bacteria 1796
982 Ga0436365_0602472 3300039437 Bacteria 8577
983 Ga0436365_0646826 3300039437 Bacteria 110896
984 Ga0436362_0199967 3300039453 Bacteria 28994
985 Ga0439445_0000213 3300042004 Bacteria 10661
986 Ga0439445_0001098 3300042004 Bacteria 5788
987 Ga0439448_0001844 3300042005 Bacteria 5610
988 Ga0439448_0010080 3300042005 Bacteria 2793
989 Ga0439448_0011396 3300042005 Bacteria 2649
990 Ga0439432_000507 3300042006 Bacteria 14445
991 Ga0439455_0002452 3300042012 Bacteria 3375
992 Ga0450920_001427 3300042122 Bacteria 3952
993 Ga0439458_0000958 3300042157 Bacteria 7432
994 Ga0439458_0001177 3300042157 Bacteria 6648
995 Ga0439458_0001229 3300042157 Bacteria 6472
996 Ga0439464_0002916 3300042439 Bacteria 4261
997 Ga0466969_0000819 3300044656 Bacteria 16886
998 Ga0466969_0009242 3300044656 Bacteria 5226
999 Ga0466972_0010112 3300044658 Bacteria 4740
1000 Ga0466966_0018318 3300044684 Bacteria 4619
1001 Ga0466966_0047704 3300044684 Bacteria 2730
1002 Ga0466961_0002991 3300044693 Bacteria 10497
1003 Ga0466961_0028386 3300044693 Bacteria 3598
1004 Ga0466963_0010789 3300044694 Bacteria 5546
1005 Ga0466963_0016665 3300044694 Bacteria 4571
1006 Ga0466963_0022078 3300044694 Bacteria 4026
1007 Ga0466963_0022329 3300044694 Bacteria 4006
1008 Ga0466963_0023879 3300044694 Bacteria 3888
1009 Ga0466963_0025605 3300044694 Bacteria 3765
1010 Ga0466963_0051521 3300044694 Bacteria 2729
1011 Ga0466963_0119818 3300044694 Bacteria 1810
1012 Ga0466971_0022307 3300044719 Bacteria 2820
1013 Ga0466968_0009318 3300044735 Bacteria 3777
1014 Ga0466968_0027089 3300044735 Bacteria 2357
1015 Ga0466970_0004585 3300044765 Bacteria 6821
1016 Ga0466970_0029521 3300044765 Bacteria 2887
1017 Ga0466957_0001655 3300044842 Bacteria 11692
1018 Ga0466957_0001830 3300044842 Bacteria 11220
1019 Ga0466957_0007293 3300044842 Bacteria 6247
1020 Ga0466957_0007350 3300044842 Bacteria 6227
1021 Ga0466957_0169306 3300044842 Bacteria 1422
1022 Ga0466960_0008031 3300044901 Bacteria 4308
1023 Ga0466959_0005388 3300045049 Bacteria 8756
1024 Ga0466959_0013164 3300045049 Bacteria 5992
1025 Ga0466959_0028180 3300045049 Bacteria 4164
1026 Ga0466959_0042172 3300045049 Bacteria 3366
1027 Ga0451576_0009133 3300045051 Bacteria 11524
1028 Ga0466958_0002858 3300045836 Bacteria 8792
1029 Ga0466958_0039196 3300045836 Bacteria 2845
1030 Ga0466967_0024861 3300045976 Bacteria 4931
1031 Ga0466967_0030065 3300045976 Bacteria 4554
1032 Ga0466967_0042108 3300045976 Bacteria 3944
1033 Ga0466967_0052033 3300045976 Bacteria 3592
1034 Ga0466967_0092762 3300045976 Bacteria 2746
1035 Ga0466967_0131423 3300045976 Bacteria 2324
1036 Ga0466967_0162825 3300045976 Bacteria 2095
1037 Ga0466967_0328052 3300045976 Bacteria 1477
1038 Ga0495617_009383 3300046452 Bacteria 3359
1039 Ga0495650_0000983 3300046471 Bacteria 32562
1040 Ga0495584_0039697 3300046491 Bacteria 2378
1041 Ga0495585_0022559 3300046492 Bacteria 3613
1042 Ga0495583_0000201 3300046506 Bacteria 100380
1043 Ga0495583_0008573 3300046506 Bacteria 6228
1044 Ga0495583_0076032 3300046506 Bacteria 1467
1045 Ga0495606_0000842 3300046507 Bacteria 46207
1046 Ga0495610_0000072 3300046512 Bacteria 120618
1047 Ga0495631_0036765 3300046518 Bacteria 2185
1048 Ga0495632_0000079 3300046519 Bacteria 100131
1049 Ga0495637_0001604 3300046520 Bacteria 13126
1050 Ga0495637_0005948 3300046520 Bacteria 6169
1051 Ga0495643_0000146 3300046522 Bacteria 114508
1052 Ga0495643_0029045 3300046522 Bacteria 3095
1053 Ga0495648_0001068 3300046524 Bacteria 27825
1054 Ga0495663_0000006 3300046525 Bacteria 306938
1055 Ga0495663_0007156 3300046525 Bacteria 3080
1056 Ga0495642_0004857 3300046528 Bacteria 5195
1057 Ga0495654_0005346 3300046530 Bacteria 7482
1058 Ga0495598_0015826 3300046537 Bacteria 1912
1059 Ga0495621_0001233 3300046539 Bacteria 6589
1060 Ga0495621_0012970 3300046539 Bacteria 2610
1061 Ga0495633_0000227 3300046558 Bacteria 69862
1062 Ga0495633_0010107 3300046558 Bacteria 5169
1063 Ga0495633_0012046 3300046558 Bacteria 4619
1064 Ga0495633_0017356 3300046558 Bacteria 3683
1065 Ga0495668_0026146 3300046616 Bacteria 3314
1066 Ga0495668_0026158 3300046616 Bacteria 3313
1067 Ga0495611_0007536 3300046648 Bacteria 4617
1068 Ga0495625_0000287 3300046660 Bacteria 78023
1069 Ga0495625_0000645 3300046660 Bacteria 50263
1070 Ga0495625_0004846 3300046660 Bacteria 12559
1071 Ga0495625_0059115 3300046660 Bacteria 2721
1072 Ga0495659_0015631 3300046664 Bacteria 2497
1073 Ga0495669_0000340 3300046684 Bacteria 24667
1074 Ga0495669_0001180 3300046684 Bacteria 10848
1075 Ga0495669_0016242 3300046684 Bacteria 3188
1076 Ga0495669_0020996 3300046684 Bacteria 2831
1077 Ga0495669_0027257 3300046684 Bacteria 2499
1078 Ga0495669_0045295 3300046684 Bacteria 1961
1079 Ga0495670_0000165 3300046691 Bacteria 28951
1080 Ga0495670_0002753 3300046691 Bacteria 8691
1081 Ga0495670_0008592 3300046691 Bacteria 5026
1082 Ga0495671_0000100 3300046692 Bacteria 78876
1083 Ga0495683_0002339 3300047323 Bacteria 11514
1084 Ga0495687_000250 3300047443 Bacteria 72797
1085 Ga0495687_001110 3300047443 Bacteria 26203
1086 Ga0495677_0001529 3300047445 Bacteria 9309
1087 Ga0495677_0010685 3300047445 Bacteria 3364
1088 Ga0495681_0000043 3300047470 Bacteria 115514
1089 Ga0495681_0009486 3300047470 Bacteria 5991
1090 Ga0495686_0000368 3300047472 Bacteria 73088
1091 Ga0495686_0000467 3300047472 Bacteria 60242
1092 Ga0495686_0000513 3300047472 Bacteria 56005
1093 Ga0495686_0003725 3300047472 Bacteria 13010
1094 Ga0495686_0069808 3300047472 Bacteria 2165
1095 Ga0495602_0064387 3300048088 Bacteria 3170
1096 Ga0496101_0019282 3300048904 Bacteria 4654
1097 Ga0496101_0025424 3300048904 Bacteria 4109
1098 Ga0496101_0135958 3300048904 Bacteria 1870
1099 Ga0496102_0000022 3300048905 Bacteria 246314
1100 Ga0496102_0001154 3300048905 Bacteria 24131
1101 Ga0496102_0147100 3300048905 Bacteria 2212
1102 Ga0496103_0000167 3300048906 Bacteria 68561
1103 Ga0496103_0000736 3300048906 Bacteria 24121
1104 Ga0496103_0001482 3300048906 Bacteria 15679
1105 Ga0496103_0034979 3300048906 Bacteria 3074
1106 Ga0496104_0034498 3300048907 Bacteria 4719
1107 Ga0496104_0100399 3300048907 Bacteria 2770
1108 Ga0496106_0149452 3300048909 Bacteria 1842
1109 Ga0496107_0026887 3300048910 Bacteria 4083
1110 Ga0496107_0079337 3300048910 Bacteria 2393
1111 Ga0496108_0015808 3300048911 Bacteria 6152
1112 Ga0496108_0017277 3300048911 Bacteria 5901
1113 Ga0496108_0036738 3300048911 Bacteria 4076
1114 Ga0496108_0093051 3300048911 Bacteria 2564
1115 Ga0496109_0040977 3300048912 Bacteria 4196
1116 Ga0496110_0074124 3300048913 Bacteria 3022
1117 Ga0496110_0079515 3300048913 Bacteria 2919
1118 Ga0496110_0104656 3300048913 Bacteria 2539
1119 Ga0496110_0194226 3300048913 Bacteria 1843
1120 Ga0496111_0014965 3300048914 Bacteria 5314
1121 Ga0496111_0019919 3300048914 Bacteria 4666
1122 Ga0496111_0049375 3300048914 Bacteria 3034
1123 Ga0496112_0007370 3300048915 Bacteria 9762
1124 Ga0496112_0024046 3300048915 Bacteria 5830
1125 Ga0496112_0032879 3300048915 Bacteria 5037
1126 Ga0496112_0052265 3300048915 Bacteria 4010
1127 Ga0496112_0060171 3300048915 Bacteria 3742
1128 Ga0496112_0099438 3300048915 Bacteria 2878
1129 Ga0496112_0133373 3300048915 Bacteria 2454
1130 Ga0496113_0012753 3300048916 Bacteria 5661
1131 Ga0496113_0032491 3300048916 Bacteria 3793
1132 Ga0496113_0045320 3300048916 Bacteria 3261
1133 Ga0496114_0000033 3300048917 Bacteria 166897
1134 Ga0496114_0034246 3300048917 Bacteria 4189
1135 Ga0496114_0034987 3300048917 Bacteria 4147
1136 Ga0496114_0047537 3300048917 Bacteria 3569
1137 Ga0496115_0000029 3300048918 Bacteria 141359
1138 Ga0496115_0002304 3300048918 Bacteria 13672
1139 Ga0496116_0006054 3300048919 Bacteria 11066
1140 Ga0496116_0008559 3300048919 Bacteria 8861
1141 Ga0496116_0068502 3300048919 Bacteria 2261
1142 Ga0496117_0000072 3300048920 Bacteria 238366
1143 Ga0496117_0008938 3300048920 Bacteria 9434
1144 Ga0496117_0016190 3300048920 Bacteria 6301
1145 Ga0496117_0019714 3300048920 Bacteria 5527
1146 Ga0496117_0030716 3300048920 Bacteria 4116
1147 Ga0496118_0000030 3300048921 Bacteria 339946
1148 Ga0496118_0000039 3300048921 Bacteria 305458
1149 Ga0496118_0000297 3300048921 Bacteria 86454
1150 Ga0496119_0017588 3300048922 Bacteria 5371
1151 Ga0496120_0010474 3300048923 Bacteria 6467
1152 Ga0496121_0024666 3300048924 Bacteria 5741
1153 Ga0496121_0064172 3300048924 Bacteria 2996
1154 Ga0496121_0068393 3300048924 Bacteria 2873
1155 Ga0496122_0001328 3300048925 Bacteria 40504
1156 Ga0496122_0005310 3300048925 Bacteria 15411
1157 Ga0496123_0001988 3300048926 Bacteria 26435
1158 Ga0496123_0005663 3300048926 Bacteria 12474
1159 Ga0496123_0021258 3300048926 Bacteria 5048
1160 Ga0496124_0000061 3300048927 Bacteria 238225
1161 Ga0496124_0000076 3300048927 Bacteria 215767
1162 Ga0496124_0114770 3300048927 Bacteria 2162
1163 Ga0496125_0001403 3300048928 Bacteria 35176
1164 Ga0496125_0036510 3300048928 Bacteria 4289
1165 Ga0496126_0000469 3300048929 Bacteria 80156
1166 Ga0501312_008634 3300049528 Bacteria 1327
1167 Ga0501034_0033093 3300049571 Bacteria 5249
1168 Ga0501034_0056573 3300049571 Bacteria 3946
1169 Ga0501038_0126698 3300049574 Bacteria 2101
1170 Ga0501047_0003516 3300049581 Bacteria 14792
1171 Ga0501068_0086500 3300049584 Bacteria 1930
1172 Ga0501070_0180080 3300049586 Bacteria 1739
1173 Ga0501223_004955 3300049663 Bacteria 2817
1174 Ga0501249_000093 3300049679 Bacteria 27755
1175 Ga0501257_000066 3300049686 Bacteria 28746
1176 Ga0501225_0000027 3300049705 Bacteria 48411
1177 Ga0501080_0020468 3300049742 Bacteria 6126
1178 Ga0501204_000461 3300049850 Bacteria 3517
1179 Ga0501226_000037 3300049853 Bacteria 64584
1180 nmdc:mga0k408_45040_c1 3300050493 Bacteria 2545
1181 nmdc:mga0k408_6931_c1 3300050493 Bacteria 6043
1182 nmdc:mga07m45_90819_c1 3300050496 Bacteria 1749
1183 nmdc:mga08y16_151600_c1 3300050511 Bacteria 2409
1184 nmdc:mga08y16_97949_c1 3300050511 Bacteria 3054
1185 nmdc:mga0a205_50078_c1 3300050515 Bacteria 4033
1186 Ga0500610_0000189 3300053079 Bacteria 18595
1187 Ga0500643_000066 3300053087 Bacteria 119317
1188 Ga0500643_001124 3300053087 Bacteria 15971
1189 Ga0500643_010608 3300053087 Bacteria 3416
1190 Ga0500643_022143 3300053087 Bacteria 2050
1191 Ga0500651_0012593 3300053093 Bacteria 5131
1192 Ga0500641_0033368 3300053096 Bacteria 2043
1193 Ga0500555_000621 3300053103 Bacteria 13721
1194 Ga0500556_0000935 3300053104 Bacteria 15794
1195 Ga0500592_000556 3300053116 Bacteria 6159
1196 Ga0500592_001444 3300053116 Bacteria 3849
1197 Ga0500642_0012567 3300053130 Bacteria 3077
1198 Ga0500655_000146 3300053133 Bacteria 17749
1199 Ga0500658_0000023 3300053134 Bacteria 123176
1200 Ga0500573_0000081 3300053140 Bacteria 45934
1201 Ga0500577_0020271 3300053142 Bacteria 2172
1202 Ga0500590_003458 3300053148 Bacteria 7286
1203 Ga0500604_0000017 3300053151 Bacteria 82010
1204 Ga0500604_0006681 3300053151 Bacteria 3051
1205 Ga0500616_0003013 3300053153 Bacteria 13278
1206 Ga0500616_0004704 3300053153 Bacteria 9608
1207 Ga0500622_0058072 3300053156 Bacteria 1978
1208 Ga0500624_000035 3300053157 Bacteria 97314
1209 Ga0500627_0000208 3300053158 Bacteria 16936
1210 Ga0500627_0000778 3300053158 Bacteria 8492
1211 Ga0500637_0000188 3300053178 Bacteria 22961
1212 Ga0500570_012399 3300053724 Bacteria 4766
1213 Ga0500645_000024 3300053730 Bacteria 126024
1214 Ga0500645_001351 3300053730 Bacteria 12691
1215 Ga0500645_008843 3300053730 Bacteria 3411
1216 Ga0466962_0001169 3300061719 Bacteria 12079
1217 Ga0466962_0015200 3300061719 Bacteria 3711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100011915 Ga0070667_1000119155 331
2 3300025986 Ga0207658_10013838 Ga0207658_100138384 331
3 3300025909 Ga0207705_10052399 Ga0207705_100523992 332
4 3300037312 Ga0395899_0034749 Ga0395899_0034749_887_2182 332
5 3300044684 Ga0466966_0018318 Ga0466966_0018318_2929_4254 332
6 3300005455 Ga0070663_100157445 Ga0070663_1001574452 334
7 3300025321 Ga0207656_10042647 Ga0207656_100426472 334
8 3300025919 Ga0207657_10083473 Ga0207657_100834732 334
9 3300025920 Ga0207649_10108104 Ga0207649_101081042 334
10 3300025932 Ga0207690_10032259 Ga0207690_100322592 334
11 3300026142 Ga0207698_10009614 Ga0207698_100096147 334
12 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007352 335
13 3300005333 Ga0070677_10000958 Ga0070677_100009582 335
14 3300025297 Ga0209758_1000017 Ga0209758_1000017348 335
15 3300025893 Ga0207682_10002099 Ga0207682_100020997 335
16 3300037418 Ga0395900_0040115 Ga0395900_0040115_2773_4065 335
17 3300037466 Ga0395898_0013356 Ga0395898_0013356_4320_5612 335
18 3300038443 Ga0395901_0023062 Ga0395901_0023062_3065_4357 335
19 3300046660 Ga0495625_0004846 Ga0495625_0004846_2074_3333 335
20 3300001990 JGI24737J22298_10001858 JGI24737J22298_100018585 336
21 3300002774 JGI25150J39212_1000243 JGI25150J39212_100024316 336
22 3300003215 JGI25153J46596_10000027 JGI25153J46596_10000027141 336
23 3300005366 Ga0070659_100022106 Ga0070659_1000221062 336
24 3300005834 Ga0068851_10034336 Ga0068851_100343363 336
25 3300013102 Ga0157371_10000011 Ga0157371_1000001135 336
26 3300025245 Ga0207425_1000005 Ga0207425_1000005263 336
27 3300025258 Ga0209129_1000288 Ga0209129_100028816 336
28 3300025294 Ga0209025_1000515 Ga0209025_100051562 336
29 3300025297 Ga0209758_1000002 Ga0209758_10000021081 336
30 3300025901 Ga0207688_10048285 Ga0207688_100482852 336
31 3300025932 Ga0207690_10015913 Ga0207690_100159132 336
32 3300026067 Ga0207678_10010454 Ga0207678_100104545 336
33 3300044694 Ga0466963_0025605 Ga0466963_0025605_2026_3342 336
34 3300048911 Ga0496108_0093051 Ga0496108_0093051_204_1544 336
35 3300005327 Ga0070658_10055744 Ga0070658_100557442 337
36 3300005336 Ga0070680_100006159 Ga0070680_1000061592 337
37 3300005344 Ga0070661_100021800 Ga0070661_1000218003 337
38 3300005366 Ga0070659_100019038 Ga0070659_1000190382 337
39 3300005458 Ga0070681_10068988 Ga0070681_100689882 337
40 3300005577 Ga0068857_100094203 Ga0068857_1000942032 337
41 3300005578 Ga0068854_100005361 Ga0068854_1000053612 337
42 3300005614 Ga0068856_100087391 Ga0068856_1000873912 337
43 3300005616 Ga0068852_100024382 Ga0068852_1000243823 337
44 3300009093 Ga0105240_10046023 Ga0105240_100460232 337
45 3300009098 Ga0105245_10000617 Ga0105245_100006178 337
46 3300009551 Ga0105238_10067909 Ga0105238_100679092 337
47 3300013100 Ga0157373_10026620 Ga0157373_100266202 337
48 3300013102 Ga0157371_10061154 Ga0157371_100611542 337
49 3300013104 Ga0157370_10050051 Ga0157370_100500512 337
50 3300013307 Ga0157372_10029886 Ga0157372_100298862 337
51 3300025904 Ga0207647_10006976 Ga0207647_100069762 337
52 3300025909 Ga0207705_10000622 Ga0207705_100006226 337
53 3300025913 Ga0207695_10015122 Ga0207695_100151225 337
54 3300025917 Ga0207660_10129102 Ga0207660_101291021 337
55 3300025920 Ga0207649_10001417 Ga0207649_100014179 337
56 3300025924 Ga0207694_10098282 Ga0207694_100982822 337
57 3300025927 Ga0207687_10000394 Ga0207687_100003945 337
58 3300025932 Ga0207690_10030160 Ga0207690_100301602 337
59 3300025949 Ga0207667_10036599 Ga0207667_100365993 337
60 3300025981 Ga0207640_10003562 Ga0207640_100035622 337
61 3300026067 Ga0207678_10017746 Ga0207678_100177463 337
62 3300026078 Ga0207702_10062450 Ga0207702_100624501 337
63 3300026142 Ga0207698_10034474 Ga0207698_100344743 337
64 3300037466 Ga0395898_0010122 Ga0395898_0010122_2264_3568 337
65 3300037466 Ga0395898_0038438 Ga0395898_0038438_1384_2694 337
66 3300037471 Ga0395905_0001957 Ga0395905_0001957_22032_23336 337
67 3300038443 Ga0395901_0014632 Ga0395901_0014632_366_1670 337
68 3300038443 Ga0395901_0044455 Ga0395901_0044455_3148_4446 337
69 3300003792 Ga0055540_1003541 Ga0055540_10035415 338
70 3300005344 Ga0070661_100191755 Ga0070661_1001917551 338
71 3300005458 Ga0070681_10089381 Ga0070681_100893813 338
72 3300005547 Ga0070693_100024130 Ga0070693_1000241303 338
73 3300005614 Ga0068856_100021339 Ga0068856_1000213394 338
74 3300005616 Ga0068852_100233174 Ga0068852_1002331742 338
75 3300013100 Ga0157373_10046840 Ga0157373_100468402 338
76 3300025292 Ga0209676_1010080 Ga0209676_10100802 338
77 3300025298 Ga0209050_1000001 Ga0209050_10000011067 338
78 3300025298 Ga0209050_1000483 Ga0209050_100048356 338
79 3300025303 Ga0209051_1001199 Ga0209051_100119919 338
80 3300025304 Ga0209257_1003144 Ga0209257_100314410 338
81 3300025304 Ga0209257_1003889 Ga0209257_100388910 338
82 3300025912 Ga0207707_10028068 Ga0207707_100280683 338
83 3300025912 Ga0207707_10062953 Ga0207707_100629531 338
84 3300025917 Ga0207660_10266178 Ga0207660_102661781 338
85 3300026067 Ga0207678_10067054 Ga0207678_100670542 338
86 3300026078 Ga0207702_10106329 Ga0207702_101063293 338
87 3300037471 Ga0395905_0125387 Ga0395905_0125387_256_1542 338
88 3300046492 Ga0495585_0022559 Ga0495585_0022559_1524_2777 338
89 3300048915 Ga0496112_0007370 Ga0496112_0007370_2047_3351 338
90 3300048916 Ga0496113_0012753 Ga0496113_0012753_2046_3350 338
91 3300049584 Ga0501068_0086500 Ga0501068_0086500_276_1592 338
92 3300006871 Ga0075434_100215755 Ga0075434_1002157552 339
93 3300037312 Ga0395899_0020126 Ga0395899_0020126_1763_3076 339
94 3300037471 Ga0395905_0078164 Ga0395905_0078164_1472_2785 339
95 3300044694 Ga0466963_0022078 Ga0466963_0022078_83_1384 339
96 3300003791 Ga0055530_10024355 Ga0055530_100243551 340
97 3300005617 Ga0068859_100113220 Ga0068859_1001132202 340
98 3300005842 Ga0068858_100094583 Ga0068858_1000945832 340
99 3300006931 Ga0097620_100113217 Ga0097620_1001132172 340
100 3300025944 Ga0207661_10004111 Ga0207661_100041112 340
101 3300026035 Ga0207703_10056143 Ga0207703_100561432 340
102 3300032002 Ga0307416_100332334 Ga0307416_1003323342 340
103 3300032004 Ga0307414_10165269 Ga0307414_101652691 340
104 3300033180 Ga0307510_10013520 Ga0307510_100135208 340
105 3300037312 Ga0395899_0013837 Ga0395899_0013837_346_1623 340
106 3300037418 Ga0395900_0071462 Ga0395900_0071462_341_1627 340
107 3300037418 Ga0395900_0177262 Ga0395900_0177262_719_1999 340
108 3300037471 Ga0395905_0039877 Ga0395905_0039877_1047_2324 340
109 3300037471 Ga0395905_0198824 Ga0395905_0198824_198_1478 340
110 3300038443 Ga0395901_0029098 Ga0395901_0029098_3940_5217 340
111 3300038443 Ga0395901_0258300 Ga0395901_0258300_198_1478 340
112 3300044658 Ga0466972_0010112 Ga0466972_0010112_2687_3985 340
113 3300044693 Ga0466961_0002991 Ga0466961_0002991_1261_2559 340
114 3300044735 Ga0466968_0027089 Ga0466968_0027089_336_1634 340
115 3300044765 Ga0466970_0029521 Ga0466970_0029521_1062_2360 340
116 3300045049 Ga0466959_0013164 Ga0466959_0013164_3746_5044 340
117 3300046522 Ga0495643_0029045 Ga0495643_0029045_1758_2996 340
118 3300046528 Ga0495642_0004857 Ga0495642_0004857_829_2067 340
119 3300047445 Ga0495677_0001529 Ga0495677_0001529_731_1969 340
120 3300001979 JGI24740J21852_10002423 JGI24740J21852_100024232 341
121 3300001990 JGI24737J22298_10000011 JGI24737J22298_1000001120 341
122 3300002075 JGI24738J21930_10000318 JGI24738J21930_100003182 341
123 3300003773 Ga0055537_1001355 Ga0055537_10013553 341
124 3300005331 Ga0070670_100010273 Ga0070670_1000102733 341
125 3300005331 Ga0070670_100056038 Ga0070670_1000560382 341
126 3300005338 Ga0068868_100016955 Ga0068868_1000169556 341
127 3300005339 Ga0070660_100000539 Ga0070660_1000005397 341
128 3300005353 Ga0070669_100000422 Ga0070669_10000042230 341
129 3300005355 Ga0070671_100040480 Ga0070671_1000404803 341
130 3300005366 Ga0070659_100000029 Ga0070659_100000029105 341
131 3300005366 Ga0070659_100036925 Ga0070659_1000369252 341
132 3300005366 Ga0070659_100131251 Ga0070659_1001312512 341
133 3300005577 Ga0068857_100025779 Ga0068857_1000257793 341
134 3300005842 Ga0068858_100000807 Ga0068858_1000008072 341
135 3300009098 Ga0105245_10014740 Ga0105245_100147406 341
136 3300013297 Ga0157378_10000428 Ga0157378_100004282 341
137 3300025263 Ga0209565_1000231 Ga0209565_100023110 341
138 3300025273 Ga0209673_1025079 Ga0209673_10250791 341
139 3300025315 Ga0207697_10000142 Ga0207697_1000014231 341
140 3300025901 Ga0207688_10000182 Ga0207688_100001829 341
141 3300025914 Ga0207671_10119207 Ga0207671_101192072 341
142 3300025919 Ga0207657_10000655 Ga0207657_1000065534 341
143 3300025919 Ga0207657_10004043 Ga0207657_100040439 341
144 3300025923 Ga0207681_10004789 Ga0207681_100047892 341
145 3300025927 Ga0207687_10004989 Ga0207687_100049895 341
146 3300025931 Ga0207644_10026976 Ga0207644_100269763 341
147 3300025931 Ga0207644_10036639 Ga0207644_100366392 341
148 3300025932 Ga0207690_10000004 Ga0207690_10000004688 341
149 3300025932 Ga0207690_10132603 Ga0207690_101326032 341
150 3300025960 Ga0207651_10004902 Ga0207651_100049025 341
151 3300026088 Ga0207641_10021641 Ga0207641_100216412 341
152 3300026095 Ga0207676_10027735 Ga0207676_100277352 341
153 3300026142 Ga0207698_10078285 Ga0207698_100782852 341
154 3300045976 Ga0466967_0131423 Ga0466967_0131423_721_2007 341
155 3300005339 Ga0070660_100000688 Ga0070660_1000006882 342
156 3300005347 Ga0070668_100111899 Ga0070668_1001118992 342
157 3300005844 Ga0068862_100214658 Ga0068862_1002146582 342
158 3300025909 Ga0207705_10009894 Ga0207705_100098947 342
159 3300025909 Ga0207705_10075092 Ga0207705_100750922 342
160 3300028380 Ga0268265_10163662 Ga0268265_101636622 342
161 3300037418 Ga0395900_0017167 Ga0395900_0017167_3813_5120 342
162 3300037418 Ga0395900_0125252 Ga0395900_0125252_888_2174 342
163 3300037466 Ga0395898_0009114 Ga0395898_0009114_1095_2402 342
164 3300038443 Ga0395901_0015760 Ga0395901_0015760_2268_3575 342
165 3300053087 Ga0500643_010608 Ga0500643_010608_2130_3371 342
166 3300005578 Ga0068854_100001186 Ga0068854_10000118612 343
167 3300005842 Ga0068858_100015577 Ga0068858_1000155772 343
168 3300009093 Ga0105240_10021368 Ga0105240_100213682 343
169 3300013105 Ga0157369_10115296 Ga0157369_101152962 343
170 3300013307 Ga0157372_10164956 Ga0157372_101649563 343
171 3300025908 Ga0207643_10041490 Ga0207643_100414902 343
172 3300025913 Ga0207695_10021664 Ga0207695_100216642 343
173 3300025981 Ga0207640_10000363 Ga0207640_1000036318 343
174 3300026035 Ga0207703_10007907 Ga0207703_100079072 343
175 3300044684 Ga0466966_0047704 Ga0466966_0047704_204_1523 343
176 3300045049 Ga0466959_0028180 Ga0466959_0028180_50_1369 343
177 3300046530 Ga0495654_0005346 Ga0495654_0005346_607_1857 343
178 3300048920 Ga0496117_0030716 Ga0496117_0030716_2074_3372 343
179 3300048924 Ga0496121_0068393 Ga0496121_0068393_359_1657 343
180 3300053151 Ga0500604_0006681 Ga0500604_0006681_1291_2541 343
181 3300053158 Ga0500627_0000778 Ga0500627_0000778_584_1834 343
182 3300005367 Ga0070667_100006585 Ga0070667_10000658510 344
183 3300005617 Ga0068859_100007415 Ga0068859_10000741510 344
184 3300005844 Ga0068862_100020239 Ga0068862_1000202394 344
185 3300006931 Ga0097620_100007415 Ga0097620_1000074153 344
186 3300009177 Ga0105248_10041892 Ga0105248_100418922 344
187 3300025924 Ga0207694_10030232 Ga0207694_100302322 344
188 3300025941 Ga0207711_10003956 Ga0207711_100039564 344
189 3300028380 Ga0268265_10007183 Ga0268265_100071835 344
190 3300028381 Ga0268264_10096572 Ga0268264_100965722 344
191 3300042157 Ga0439458_0000958 Ga0439458_0000958_4088_5386 344
192 3300042439 Ga0439464_0002916 Ga0439464_0002916_1762_3054 344
193 3300044656 Ga0466969_0000819 Ga0466969_0000819_3788_5086 344
194 3300044693 Ga0466961_0028386 Ga0466961_0028386_408_1727 344
195 3300044765 Ga0466970_0004585 Ga0466970_0004585_1187_2485 344
196 3300044842 Ga0466957_0001830 Ga0466957_0001830_5519_6817 344
197 3300045049 Ga0466959_0005388 Ga0466959_0005388_4928_6226 344
198 3300045836 Ga0466958_0002858 Ga0466958_0002858_4811_6109 344
199 3300049742 Ga0501080_0020468 Ga0501080_0020468_4138_5454 344
200 3300053104 Ga0500556_0000935 Ga0500556_0000935_9710_10972 344
201 3300061719 Ga0466962_0001169 Ga0466962_0001169_6834_8132 344
202 3300001989 JGI24739J22299_10001619 JGI24739J22299_100016195 345
203 3300005328 Ga0070676_10010490 Ga0070676_100104903 345
204 3300005334 Ga0068869_100054419 Ga0068869_1000544192 345
205 3300005347 Ga0070668_100045599 Ga0070668_1000455993 345
206 3300005364 Ga0070673_100000044 Ga0070673_1000000446 345
207 3300005366 Ga0070659_100079309 Ga0070659_1000793092 345
208 3300005457 Ga0070662_100028308 Ga0070662_1000283082 345
209 3300005459 Ga0068867_100005479 Ga0068867_1000054797 345
210 3300005539 Ga0068853_100001903 Ga0068853_10000190316 345
211 3300005543 Ga0070672_100001615 Ga0070672_10000161512 345
212 3300005548 Ga0070665_100000154 Ga0070665_10000015475 345
213 3300005563 Ga0068855_100026500 Ga0068855_1000265003 345
214 3300005578 Ga0068854_100001332 Ga0068854_10000133214 345
215 3300005616 Ga0068852_100023744 Ga0068852_1000237443 345
216 3300005843 Ga0068860_100088172 Ga0068860_1000881723 345
217 3300005985 Ga0081539_10013211 Ga0081539_100132112 345
218 3300006358 Ga0068871_100021017 Ga0068871_1000210172 345
219 3300006881 Ga0068865_100004527 Ga0068865_1000045272 345
220 3300009177 Ga0105248_10001711 Ga0105248_1000171115 345
221 3300010375 Ga0105239_10058772 Ga0105239_100587722 345
222 3300011119 Ga0105246_10014176 Ga0105246_100141763 345
223 3300013100 Ga0157373_10032582 Ga0157373_100325822 345
224 3300013102 Ga0157371_10005491 Ga0157371_100054919 345
225 3300025907 Ga0207645_10013177 Ga0207645_100131773 345
226 3300025933 Ga0207706_10007479 Ga0207706_100074799 345
227 3300025940 Ga0207691_10002983 Ga0207691_1000298311 345
228 3300025942 Ga0207689_10000125 Ga0207689_1000012558 345
229 3300025949 Ga0207667_10021396 Ga0207667_100213965 345
230 3300025972 Ga0207668_10093712 Ga0207668_100937121 345
231 3300026035 Ga0207703_10020969 Ga0207703_100209693 345
232 3300026089 Ga0207648_10000530 Ga0207648_1000053020 345
233 3300026116 Ga0207674_10002750 Ga0207674_1000275022 345
234 3300028379 Ga0268266_10000093 Ga0268266_10000093109 345
235 3300028381 Ga0268264_10035547 Ga0268264_100355473 345
236 3300031852 Ga0307410_10019724 Ga0307410_100197242 345
237 3300031911 Ga0307412_10001745 Ga0307412_100017452 345
238 3300032004 Ga0307414_10018606 Ga0307414_100186062 345
239 3300032005 Ga0307411_10097669 Ga0307411_100976692 345
240 3300032126 Ga0307415_100116574 Ga0307415_1001165742 345
241 3300037471 Ga0395905_0102812 Ga0395905_0102812_1332_2639 345
242 3300045051 Ga0451576_0009133 Ga0451576_0009133_3868_5124 345
243 3300045976 Ga0466967_0024861 Ga0466967_0024861_555_1907 345
244 3300047470 Ga0495681_0000043 Ga0495681_0000043_103270_104496 345
245 3300002074 JGI24748J21848_1000141 JGI24748J21848_10001414 346
246 3300002239 JGI24034J26672_10000067 JGI24034J26672_1000006711 346
247 3300005328 Ga0070676_10007349 Ga0070676_100073496 346
248 3300005330 Ga0070690_100000112 Ga0070690_10000011235 346
249 3300005335 Ga0070666_10000009 Ga0070666_1000000910 346
250 3300005347 Ga0070668_100001661 Ga0070668_1000016618 346
251 3300005347 Ga0070668_100087329 Ga0070668_1000873292 346
252 3300005353 Ga0070669_100029397 Ga0070669_1000293972 346
253 3300005355 Ga0070671_100004842 Ga0070671_1000048429 346
254 3300005364 Ga0070673_100032531 Ga0070673_1000325312 346
255 3300005367 Ga0070667_100011333 Ga0070667_1000113337 346
256 3300005459 Ga0068867_100046914 Ga0068867_1000469142 346
257 3300005543 Ga0070672_100045263 Ga0070672_1000452633 346
258 3300005544 Ga0070686_100000006 Ga0070686_10000000617 346
259 3300005617 Ga0068859_100000144 Ga0068859_10000014448 346
260 3300005618 Ga0068864_100000092 Ga0068864_10000009285 346
261 3300005618 Ga0068864_100093264 Ga0068864_1000932641 346
262 3300005719 Ga0068861_100001751 Ga0068861_1000017513 346
263 3300005841 Ga0068863_100000748 Ga0068863_10000074817 346
264 3300005842 Ga0068858_100000256 Ga0068858_10000025632 346
265 3300005843 Ga0068860_100000022 Ga0068860_10000002211 346
266 3300005844 Ga0068862_100000790 Ga0068862_10000079016 346
267 3300006931 Ga0097620_100000144 Ga0097620_10000014430 346
268 3300009092 Ga0105250_10038465 Ga0105250_100384652 346
269 3300009177 Ga0105248_10000426 Ga0105248_1000042632 346
270 3300009553 Ga0105249_10000014 Ga0105249_1000001411 346
271 3300013306 Ga0163162_10031019 Ga0163162_100310194 346
272 3300014325 Ga0163163_10000080 Ga0163163_1000008083 346
273 3300014326 Ga0157380_10001477 Ga0157380_100014772 346
274 3300014968 Ga0157379_10012633 Ga0157379_100126335 346
275 3300017792 Ga0163161_10000571 Ga0163161_1000057116 346
276 3300025903 Ga0207680_10000007 Ga0207680_10000007268 346
277 3300025907 Ga0207645_10012835 Ga0207645_100128355 346
278 3300025923 Ga0207681_10007428 Ga0207681_100074284 346
279 3300025931 Ga0207644_10000259 Ga0207644_100002598 346
280 3300025933 Ga0207706_10196715 Ga0207706_101967152 346
281 3300025940 Ga0207691_10062733 Ga0207691_100627332 346
282 3300025941 Ga0207711_10000187 Ga0207711_1000018716 346
283 3300025942 Ga0207689_10052421 Ga0207689_100524213 346
284 3300025960 Ga0207651_10026473 Ga0207651_100264732 346
285 3300025961 Ga0207712_10000004 Ga0207712_10000004256 346
286 3300025972 Ga0207668_10000062 Ga0207668_1000006288 346
287 3300025972 Ga0207668_10022110 Ga0207668_100221104 346
288 3300025986 Ga0207658_10001984 Ga0207658_100019848 346
289 3300025986 Ga0207658_10006316 Ga0207658_100063163 346
290 3300025986 Ga0207658_10055135 Ga0207658_100551352 346
291 3300026035 Ga0207703_10002564 Ga0207703_1000256411 346
292 3300026067 Ga0207678_10164754 Ga0207678_101647542 346
293 3300026088 Ga0207641_10000175 Ga0207641_1000017564 346
294 3300026088 Ga0207641_10000216 Ga0207641_1000021610 346
295 3300026089 Ga0207648_10026086 Ga0207648_100260865 346
296 3300026095 Ga0207676_10000138 Ga0207676_1000013814 346
297 3300026095 Ga0207676_10010563 Ga0207676_100105633 346
298 3300026118 Ga0207675_100005139 Ga0207675_1000051396 346
299 3300026118 Ga0207675_100133716 Ga0207675_1001337162 346
300 3300026121 Ga0207683_10078689 Ga0207683_100786892 346
301 3300028380 Ga0268265_10000294 Ga0268265_1000029410 346
302 3300028380 Ga0268265_10032625 Ga0268265_100326252 346
303 3300028381 Ga0268264_10000003 Ga0268264_10000003270 346
304 3300028381 Ga0268264_10001379 Ga0268264_1000137915 346
305 3300031824 Ga0307413_10010568 Ga0307413_100105682 346
306 3300031852 Ga0307410_10009758 Ga0307410_100097585 346
307 3300031911 Ga0307412_10135855 Ga0307412_101358552 346
308 3300031995 Ga0307409_100079530 Ga0307409_1000795302 346
309 3300045976 Ga0466967_0030065 Ga0466967_0030065_465_1772 346
310 3300046471 Ga0495650_0000983 Ga0495650_0000983_25704_26951 346
311 3300046491 Ga0495584_0039697 Ga0495584_0039697_755_1993 346
312 3300048907 Ga0496104_0100399 Ga0496104_0100399_1068_2327 346
313 3300048910 Ga0496107_0079337 Ga0496107_0079337_633_1892 346
314 3300048913 Ga0496110_0194226 Ga0496110_0194226_427_1734 346
315 3300049705 Ga0501225_0000027 Ga0501225_0000027_6146_7363 346
316 3300049853 Ga0501226_000037 Ga0501226_000037_6153_7370 346
317 3300053134 Ga0500658_0000023 Ga0500658_0000023_115349_116650 346
318 3300001990 JGI24737J22298_10006277 JGI24737J22298_100062773 347
319 3300005327 Ga0070658_10000710 Ga0070658_1000071014 347
320 3300005339 Ga0070660_100017908 Ga0070660_1000179083 347
321 3300005339 Ga0070660_100049848 Ga0070660_1000498482 347
322 3300005364 Ga0070673_100068009 Ga0070673_1000680092 347
323 3300005834 Ga0068851_10018890 Ga0068851_100188902 347
324 3300013104 Ga0157370_10297570 Ga0157370_102975701 347
325 3300013307 Ga0157372_10002932 Ga0157372_100029322 347
326 3300020070 Ga0206356_10205632 Ga0206356_102056322 347
327 3300025909 Ga0207705_10000335 Ga0207705_1000033528 347
328 3300025914 Ga0207671_10018274 Ga0207671_100182742 347
329 3300025919 Ga0207657_10021945 Ga0207657_100219454 347
330 3300025919 Ga0207657_10134142 Ga0207657_101341422 347
331 3300025931 Ga0207644_10002970 Ga0207644_100029705 347
332 3300025932 Ga0207690_10002597 Ga0207690_100025972 347
333 3300025949 Ga0207667_10000001 Ga0207667_10000001513 347
334 3300026041 Ga0207639_10048006 Ga0207639_100480062 347
335 3300026088 Ga0207641_10032389 Ga0207641_100323893 347
336 3300026095 Ga0207676_10208562 Ga0207676_102085621 347
337 3300026142 Ga0207698_10086673 Ga0207698_100866733 347
338 3300026142 Ga0207698_10131862 Ga0207698_101318621 347
339 3300028786 Ga0307517_10154579 Ga0307517_101545791 347
340 3300031456 Ga0307513_10033474 Ga0307513_100334742 347
341 3300031852 Ga0307410_10226832 Ga0307410_102268321 347
342 3300032005 Ga0307411_10018673 Ga0307411_100186732 347
343 3300037418 Ga0395900_0016220 Ga0395900_0016220_5534_6844 347
344 3300037471 Ga0395905_0080065 Ga0395905_0080065_774_2084 347
345 3300038443 Ga0395901_0019930 Ga0395901_0019930_3510_4808 347
346 3300045976 Ga0466967_0092762 Ga0466967_0092762_1058_2365 347
347 3300048915 Ga0496112_0060171 Ga0496112_0060171_2276_3586 347
348 3300048916 Ga0496113_0032491 Ga0496113_0032491_1757_3067 347
349 3300049571 Ga0501034_0056573 Ga0501034_0056573_2445_3650 347
350 3300049574 Ga0501038_0126698 Ga0501038_0126698_154_1410 347
351 3300053096 Ga0500641_0033368 Ga0500641_0033368_815_2026 347
352 3300053730 Ga0500645_008843 Ga0500645_008843_796_2028 347
353 3300005331 Ga0070670_100042376 Ga0070670_1000423762 348
354 3300005719 Ga0068861_100001685 Ga0068861_10000168511 348
355 3300005841 Ga0068863_100046433 Ga0068863_1000464332 348
356 3300013307 Ga0157372_10049775 Ga0157372_100497752 348
357 3300025941 Ga0207711_10002993 Ga0207711_100029935 348
358 3300025941 Ga0207711_10065959 Ga0207711_100659592 348
359 3300026088 Ga0207641_10012101 Ga0207641_100121012 348
360 3300026118 Ga0207675_100000058 Ga0207675_10000005869 348
361 3300048913 Ga0496110_0074124 Ga0496110_0074124_1640_2941 348
362 3300048915 Ga0496112_0133373 Ga0496112_0133373_229_1530 348
363 3300048925 Ga0496122_0001328 Ga0496122_0001328_6510_7778 348
364 3300048926 Ga0496123_0005663 Ga0496123_0005663_4414_5682 348
365 3300005336 Ga0070680_100005776 Ga0070680_1000057762 349
366 3300005354 Ga0070675_100009739 Ga0070675_1000097393 349
367 3300006353 Ga0075370_10005454 Ga0075370_100054545 349
368 3300009553 Ga0105249_10000056 Ga0105249_100000569 349
369 3300025911 Ga0207654_10000924 Ga0207654_100009249 349
370 3300025917 Ga0207660_10002715 Ga0207660_100027152 349
371 3300025926 Ga0207659_10010321 Ga0207659_100103212 349
372 3300025961 Ga0207712_10000015 Ga0207712_10000015286 349
373 3300031548 Ga0307408_100108569 Ga0307408_1001085692 349
374 3300031731 Ga0307405_10070519 Ga0307405_100705192 349
375 3300032004 Ga0307414_10000800 Ga0307414_100008009 349
376 3300032004 Ga0307414_10039746 Ga0307414_100397463 349
377 3300032126 Ga0307415_100161424 Ga0307415_1001614241 349
378 3300037312 Ga0395899_0000112 Ga0395899_0000112_20335_21618 349
379 3300037312 Ga0395899_0029970 Ga0395899_0029970_747_2048 349
380 3300037418 Ga0395900_0000614 Ga0395900_0000614_20413_21696 349
381 3300037466 Ga0395898_0018829 Ga0395898_0018829_868_2151 349
382 3300038443 Ga0395901_0000047 Ga0395901_0000047_62522_63805 349
383 3300042005 Ga0439448_0001844 Ga0439448_0001844_3501_4793 349
384 3300042005 Ga0439448_0010080 Ga0439448_0010080_73_1371 349
385 3300042012 Ga0439455_0002452 Ga0439455_0002452_1532_2830 349
386 3300042157 Ga0439458_0001177 Ga0439458_0001177_3143_4441 349
387 3300048905 Ga0496102_0000022 Ga0496102_0000022_178140_179378 349
388 3300048906 Ga0496103_0000167 Ga0496103_0000167_3313_4551 349
389 3300048907 Ga0496104_0034498 Ga0496104_0034498_1606_2844 349
390 3300048914 Ga0496111_0014965 Ga0496111_0014965_1115_2353 349
391 3300048917 Ga0496114_0034246 Ga0496114_0034246_1947_3185 349
392 3300048918 Ga0496115_0000029 Ga0496115_0000029_136472_137710 349
393 3300048919 Ga0496116_0008559 Ga0496116_0008559_5099_6337 349
394 3300048920 Ga0496117_0016190 Ga0496117_0016190_3422_4660 349
395 3300048921 Ga0496118_0000039 Ga0496118_0000039_269034_270272 349
396 3300048922 Ga0496119_0017588 Ga0496119_0017588_3226_4464 349
397 3300048923 Ga0496120_0010474 Ga0496120_0010474_2031_3269 349
398 3300048924 Ga0496121_0024666 Ga0496121_0024666_3403_4641 349
399 3300048926 Ga0496123_0021258 Ga0496123_0021258_667_1905 349
400 3300048927 Ga0496124_0000076 Ga0496124_0000076_36096_37334 349
401 3300048928 Ga0496125_0001403 Ga0496125_0001403_28993_30231 349
402 3300048929 Ga0496126_0000469 Ga0496126_0000469_3559_4797 349
403 3300053157 Ga0500624_000035 Ga0500624_000035_49297_50514 349
404 3300053178 Ga0500637_0000188 Ga0500637_0000188_5553_6770 349
405 3300005338 Ga0068868_100000002 Ga0068868_100000002161 350
406 3300005344 Ga0070661_100151968 Ga0070661_1001519682 350
407 3300005563 Ga0068855_100291320 Ga0068855_1002913202 350
408 3300009098 Ga0105245_10124308 Ga0105245_101243082 350
409 3300013296 Ga0157374_10004138 Ga0157374_100041383 350
410 3300025919 Ga0207657_10043223 Ga0207657_100432232 350
411 3300025920 Ga0207649_10001501 Ga0207649_1000150111 350
412 3300025921 Ga0207652_10216574 Ga0207652_102165742 350
413 3300025949 Ga0207667_10112805 Ga0207667_101128052 350
414 3300026023 Ga0207677_10000080 Ga0207677_1000008045 350
415 3300026067 Ga0207678_10029991 Ga0207678_100299911 350
416 3300026078 Ga0207702_10005973 Ga0207702_100059733 350
417 3300037418 Ga0395900_0037100 Ga0395900_0037100_1266_2543 350
418 3300042004 Ga0439445_0000213 Ga0439445_0000213_1760_2986 350
419 3300042005 Ga0439448_0011396 Ga0439448_0011396_444_1742 350
420 3300042006 Ga0439432_000507 Ga0439432_000507_11313_12539 350
421 3300046506 Ga0495583_0008573 Ga0495583_0008573_1157_2398 350
422 3300046558 Ga0495633_0017356 Ga0495633_0017356_426_1673 350
423 3300053116 Ga0500592_001444 Ga0500592_001444_2197_3474 350
424 3300005331 Ga0070670_100012249 Ga0070670_1000122491 351
425 3300005355 Ga0070671_100004306 Ga0070671_1000043062 351
426 3300005616 Ga0068852_100063312 Ga0068852_1000633122 351
427 3300005618 Ga0068864_100007306 Ga0068864_1000073066 351
428 3300009101 Ga0105247_10026032 Ga0105247_100260323 351
429 3300014325 Ga0163163_10036134 Ga0163163_100361343 351
430 3300014326 Ga0157380_10011365 Ga0157380_100113655 351
431 3300025925 Ga0207650_10006376 Ga0207650_100063764 351
432 3300025931 Ga0207644_10000558 Ga0207644_1000055824 351
433 3300025931 Ga0207644_10000837 Ga0207644_1000083716 351
434 3300025932 Ga0207690_10027615 Ga0207690_100276153 351
435 3300031852 Ga0307410_10005049 Ga0307410_100050494 351
436 3300031995 Ga0307409_100000240 Ga0307409_10000024014 351
437 3300032002 Ga0307416_100006181 Ga0307416_1000061813 351
438 3300032004 Ga0307414_10028159 Ga0307414_100281592 351
439 3300035172 Ga0373955_0001792 Ga0373955_0001792_3478_4791 351
440 3300036401 Ga0373937_0010114 Ga0373937_0010114_304_1617 351
441 3300037312 Ga0395899_0000684 Ga0395899_0000684_7419_8729 351
442 3300037418 Ga0395900_0055072 Ga0395900_0055072_2578_3888 351
443 3300037466 Ga0395898_0020345 Ga0395898_0020345_3606_4916 351
444 3300037471 Ga0395905_0006216 Ga0395905_0006216_5130_6440 351
445 3300038443 Ga0395901_0181013 Ga0395901_0181013_824_2134 351
446 3300046452 Ga0495617_009383 Ga0495617_009383_1538_2794 351
447 3300046512 Ga0495610_0000072 Ga0495610_0000072_102221_103477 351
448 3300046519 Ga0495632_0000079 Ga0495632_0000079_82224_83471 351
449 3300046520 Ga0495637_0001604 Ga0495637_0001604_5399_6646 351
450 3300046522 Ga0495643_0000146 Ga0495643_0000146_10787_12034 351
451 3300046525 Ga0495663_0000006 Ga0495663_0000006_223468_224715 351
452 3300046558 Ga0495633_0012046 Ga0495633_0012046_1577_2824 351
453 3300046660 Ga0495625_0000645 Ga0495625_0000645_12923_14164 351
454 3300046692 Ga0495671_0000100 Ga0495671_0000100_5405_6652 351
455 3300047470 Ga0495681_0009486 Ga0495681_0009486_1851_3098 351
456 3300047472 Ga0495686_0000513 Ga0495686_0000513_10631_11854 351
457 3300048088 Ga0495602_0064387 Ga0495602_0064387_1504_2817 351
458 3300048906 Ga0496103_0001482 Ga0496103_0001482_6702_7961 351
459 3300048914 Ga0496111_0049375 Ga0496111_0049375_512_1813 351
460 3300048920 Ga0496117_0008938 Ga0496117_0008938_7719_8978 351
461 3300048924 Ga0496121_0064172 Ga0496121_0064172_678_1937 351
462 3300048925 Ga0496122_0005310 Ga0496122_0005310_10052_11341 351
463 3300048926 Ga0496123_0001988 Ga0496123_0001988_17611_18900 351
464 3300048927 Ga0496124_0114770 Ga0496124_0114770_580_1869 351
465 3300005327 Ga0070658_10006114 Ga0070658_1000611410 352
466 3300005535 Ga0070684_100003281 Ga0070684_1000032814 352
467 3300005539 Ga0068853_100069427 Ga0068853_1000694273 352
468 3300005539 Ga0068853_100123734 Ga0068853_1001237341 352
469 3300005564 Ga0070664_100104248 Ga0070664_1001042482 352
470 3300005577 Ga0068857_100048792 Ga0068857_1000487922 352
471 3300005617 Ga0068859_100021307 Ga0068859_1000213074 352
472 3300005841 Ga0068863_100028944 Ga0068863_1000289442 352
473 3300005843 Ga0068860_100002023 Ga0068860_10000202316 352
474 3300005844 Ga0068862_100000148 Ga0068862_10000014838 352
475 3300006931 Ga0097620_100021307 Ga0097620_1000213074 352
476 3300009094 Ga0111539_10024579 Ga0111539_100245792 352
477 3300009101 Ga0105247_10120764 Ga0105247_101207642 352
478 3300013104 Ga0157370_10069379 Ga0157370_100693792 352
479 3300017792 Ga0163161_10160079 Ga0163161_101600792 352
480 3300025900 Ga0207710_10006116 Ga0207710_100061164 352
481 3300025920 Ga0207649_10007148 Ga0207649_100071483 352
482 3300025921 Ga0207652_10149423 Ga0207652_101494232 352
483 3300025933 Ga0207706_10026981 Ga0207706_100269812 352
484 3300025939 Ga0207665_10075458 Ga0207665_100754582 352
485 3300025944 Ga0207661_10006302 Ga0207661_100063024 352
486 3300025945 Ga0207679_10119466 Ga0207679_101194662 352
487 3300025981 Ga0207640_10034064 Ga0207640_100340642 352
488 3300026041 Ga0207639_10089838 Ga0207639_100898382 352
489 3300026078 Ga0207702_10085706 Ga0207702_100857062 352
490 3300026088 Ga0207641_10014215 Ga0207641_100142152 352
491 3300026116 Ga0207674_10022465 Ga0207674_100224653 352
492 3300026142 Ga0207698_10052867 Ga0207698_100528672 352
493 3300028380 Ga0268265_10000168 Ga0268265_1000016842 352
494 3300028381 Ga0268264_10002990 Ga0268264_1000299011 352
495 3300032002 Ga0307416_100300127 Ga0307416_1003001271 352
496 3300037312 Ga0395899_0082256 Ga0395899_0082256_667_1977 352
497 3300037418 Ga0395900_0010639 Ga0395900_0010639_1007_2311 352
498 3300037418 Ga0395900_0097322 Ga0395900_0097322_44_1375 352
499 3300037418 Ga0395900_0293372 Ga0395900_0293372_197_1489 352
500 3300037471 Ga0395905_0030513 Ga0395905_0030513_185_1495 352
501 3300037471 Ga0395905_0039173 Ga0395905_0039173_1430_2761 352
502 3300037471 Ga0395905_0214336 Ga0395905_0214336_76_1380 352
503 3300038443 Ga0395901_0017341 Ga0395901_0017341_155_1384 352
504 3300044694 Ga0466963_0051521 Ga0466963_0051521_94_1425 352
505 3300044842 Ga0466957_0169306 Ga0466957_0169306_66_1379 352
506 3300046558 Ga0495633_0000227 Ga0495633_0000227_26249_27496 352
507 3300046684 Ga0495669_0027257 Ga0495669_0027257_605_1933 352
508 3300050511 nmdc:mga08y16_97949_c1 nmdc:mga08y16_97949_c1_470_1768 352
509 3300001979 JGI24740J21852_10009893 JGI24740J21852_100098933 353
510 3300005262 Ga0065165_1005217 Ga0065165_10052172 353
511 3300005290 Ga0065712_10078154 Ga0065712_100781543 353
512 3300005338 Ga0068868_100020310 Ga0068868_1000203101 353
513 3300005341 Ga0070691_10008789 Ga0070691_100087892 353
514 3300005354 Ga0070675_100023162 Ga0070675_1000231622 353
515 3300005364 Ga0070673_100127300 Ga0070673_1001273002 353
516 3300009177 Ga0105248_10022738 Ga0105248_100227382 353
517 3300013306 Ga0163162_10111261 Ga0163162_101112612 353
518 3300025909 Ga0207705_10001455 Ga0207705_100014553 353
519 3300025913 Ga0207695_10012312 Ga0207695_100123129 353
520 3300025940 Ga0207691_10008826 Ga0207691_1000882610 353
521 3300025960 Ga0207651_10089798 Ga0207651_100897983 353
522 3300026041 Ga0207639_10017189 Ga0207639_100171893 353
523 3300031548 Ga0307408_100120135 Ga0307408_1001201352 353
524 3300031852 Ga0307410_10106741 Ga0307410_101067411 353
525 3300032005 Ga0307411_10015671 Ga0307411_100156712 353
526 3300037418 Ga0395900_0199865 Ga0395900_0199865_555_1886 353
527 3300037466 Ga0395898_0187487 Ga0395898_0187487_85_1416 353
528 3300037471 Ga0395905_0175612 Ga0395905_0175612_37_1368 353
529 3300048913 Ga0496110_0104656 Ga0496110_0104656_488_1798 353
530 3300048919 Ga0496116_0068502 Ga0496116_0068502_556_1815 353
531 3300053087 Ga0500643_001124 Ga0500643_001124_13218_14468 353
532 3300053730 Ga0500645_001351 Ga0500645_001351_1588_2850 353
533 3300001989 JGI24739J22299_10019088 JGI24739J22299_100190882 354
534 3300001990 JGI24737J22298_10001553 JGI24737J22298_100015532 354
535 3300002067 JGI24735J21928_10013921 JGI24735J21928_100139211 354
536 3300002075 JGI24738J21930_10002219 JGI24738J21930_100022192 354
537 3300002076 JGI24749J21850_1001203 JGI24749J21850_10012034 354
538 3300005457 Ga0070662_100014902 Ga0070662_1000149023 354
539 3300005844 Ga0068862_100072123 Ga0068862_1000721233 354
540 3300013307 Ga0157372_10209739 Ga0157372_102097391 354
541 3300025229 Ga0209147_100453 Ga0209147_10045312 354
542 3300025295 Ga0209564_1000619 Ga0209564_100061912 354
543 3300025904 Ga0207647_10000203 Ga0207647_1000020336 354
544 3300025933 Ga0207706_10052262 Ga0207706_100522622 354
545 3300026067 Ga0207678_10300581 Ga0207678_103005811 354
546 3300028380 Ga0268265_10031955 Ga0268265_100319552 354
547 3300028786 Ga0307517_10067615 Ga0307517_100676152 354
548 3300031903 Ga0307407_10017423 Ga0307407_100174232 354
549 3300038443 Ga0395901_0212271 Ga0395901_0212271_145_1443 354
550 3300046518 Ga0495631_0036765 Ga0495631_0036765_818_2050 354
551 3300046524 Ga0495648_0001068 Ga0495648_0001068_5111_6355 354
552 3300046660 Ga0495625_0000287 Ga0495625_0000287_70442_71644 354
553 3300046684 Ga0495669_0016242 Ga0495669_0016242_61_1368 354
554 3300005327 Ga0070658_10007067 Ga0070658_100070672 355
555 3300005366 Ga0070659_100010971 Ga0070659_1000109714 355
556 3300005436 Ga0070713_100110916 Ga0070713_1001109161 355
557 3300005548 Ga0070665_100000316 Ga0070665_10000031698 355
558 3300025254 Ga0209148_1002533 Ga0209148_10025332 355
559 3300025272 Ga0209455_1000347 Ga0209455_100034729 355
560 3300025909 Ga0207705_10006344 Ga0207705_100063447 355
561 3300025919 Ga0207657_10048055 Ga0207657_100480552 355
562 3300025928 Ga0207700_10140663 Ga0207700_101406631 355
563 3300025931 Ga0207644_10195116 Ga0207644_101951162 355
564 3300025932 Ga0207690_10049935 Ga0207690_100499352 355
565 3300026041 Ga0207639_10241774 Ga0207639_102417742 355
566 3300028379 Ga0268266_10000002 Ga0268266_10000002980 355
567 3300031901 Ga0307406_10120682 Ga0307406_101206822 355
568 3300031903 Ga0307407_10008840 Ga0307407_100088402 355
569 3300032002 Ga0307416_100010519 Ga0307416_1000105192 355
570 3300032004 Ga0307414_10106498 Ga0307414_101064981 355
571 3300032005 Ga0307411_10007449 Ga0307411_100074494 355
572 3300037418 Ga0395900_0025649 Ga0395900_0025649_611_1912 355
573 3300037466 Ga0395898_0016783 Ga0395898_0016783_3367_4668 355
574 3300038443 Ga0395901_0029662 Ga0395901_0029662_2257_3558 355
575 3300045976 Ga0466967_0162825 Ga0466967_0162825_676_1959 355
576 3300046539 Ga0495621_0001233 Ga0495621_0001233_5205_6542 355
577 3300005336 Ga0070680_100004343 Ga0070680_1000043434 356
578 3300005339 Ga0070660_100121149 Ga0070660_1001211492 356
579 3300005344 Ga0070661_100040208 Ga0070661_1000402082 356
580 3300005345 Ga0070692_10025047 Ga0070692_100250472 356
581 3300005353 Ga0070669_100008563 Ga0070669_1000085633 356
582 3300005457 Ga0070662_100094457 Ga0070662_1000944572 356
583 3300005563 Ga0068855_100389610 Ga0068855_1003896101 356
584 3300005564 Ga0070664_100012617 Ga0070664_1000126174 356
585 3300005577 Ga0068857_100015553 Ga0068857_1000155535 356
586 3300005578 Ga0068854_100046007 Ga0068854_1000460072 356
587 3300005616 Ga0068852_100078833 Ga0068852_1000788332 356
588 3300005617 Ga0068859_100055815 Ga0068859_1000558152 356
589 3300005841 Ga0068863_100011358 Ga0068863_1000113586 356
590 3300005842 Ga0068858_100028299 Ga0068858_1000282994 356
591 3300005844 Ga0068862_100010138 Ga0068862_1000101382 356
592 3300006195 Ga0075366_10001930 Ga0075366_100019305 356
593 3300006931 Ga0097620_100055817 Ga0097620_1000558172 356
594 3300009553 Ga0105249_10033334 Ga0105249_100333342 356
595 3300025917 Ga0207660_10000472 Ga0207660_100004722 356
596 3300025918 Ga0207662_10051413 Ga0207662_100514132 356
597 3300025923 Ga0207681_10008302 Ga0207681_100083021 356
598 3300025926 Ga0207659_10132311 Ga0207659_101323112 356
599 3300025932 Ga0207690_10121168 Ga0207690_101211682 356
600 3300025945 Ga0207679_10028044 Ga0207679_100280444 356
601 3300025949 Ga0207667_10163836 Ga0207667_101638361 356
602 3300026088 Ga0207641_10019869 Ga0207641_100198694 356
603 3300026089 Ga0207648_10156517 Ga0207648_101565172 356
604 3300026095 Ga0207676_10001416 Ga0207676_100014162 356
605 3300026116 Ga0207674_10008360 Ga0207674_100083604 356
606 3300026116 Ga0207674_10145525 Ga0207674_101455252 356
607 3300026142 Ga0207698_10180673 Ga0207698_101806732 356
608 3300028380 Ga0268265_10007394 Ga0268265_1000739410 356
609 3300028380 Ga0268265_10009046 Ga0268265_100090463 356
610 3300028381 Ga0268264_10009076 Ga0268264_100090762 356
611 3300037312 Ga0395899_0065623 Ga0395899_0065623_1057_2388 356
612 3300037418 Ga0395900_0103653 Ga0395900_0103653_360_1682 356
613 3300037466 Ga0395898_0078635 Ga0395898_0078635_1838_3169 356
614 3300037471 Ga0395905_0018446 Ga0395905_0018446_5078_6400 356
615 3300038443 Ga0395901_0098530 Ga0395901_0098530_314_1636 356
616 3300042157 Ga0439458_0001229 Ga0439458_0001229_2715_4013 356
617 3300046520 Ga0495637_0005948 Ga0495637_0005948_2642_3901 356
618 3300047472 Ga0495686_0000467 Ga0495686_0000467_1849_3042 356
619 3300050493 nmdc:mga0k408_6931_c1 nmdc:mga0k408_6931_c1_1538_2782 356
620 3300053140 Ga0500573_0000081 Ga0500573_0000081_33541_34791 356
621 3300005344 Ga0070661_100025548 Ga0070661_1000255482 357
622 3300005355 Ga0070671_100000401 Ga0070671_10000040111 357
623 3300005436 Ga0070713_100044558 Ga0070713_1000445582 357
624 3300005564 Ga0070664_100046850 Ga0070664_1000468503 357
625 3300021388 Ga0213875_10006840 Ga0213875_100068402 357
626 3300025909 Ga0207705_10042652 Ga0207705_100426523 357
627 3300025945 Ga0207679_10047306 Ga0207679_100473062 357
628 3300031824 Ga0307413_10045712 Ga0307413_100457122 357
629 3300031995 Ga0307409_100091004 Ga0307409_1000910043 357
630 3300032126 Ga0307415_100043282 Ga0307415_1000432822 357
631 3300033180 Ga0307510_10133175 Ga0307510_101331752 357
632 3300037418 Ga0395900_0070328 Ga0395900_0070328_1436_2749 357
633 3300037418 Ga0395900_0102846 Ga0395900_0102846_399_1697 357
634 3300037466 Ga0395898_0086314 Ga0395898_0086314_1650_2948 357
635 3300037853 Ga0436364_0103913 Ga0436364_0103913_2421_3752 357
636 3300046506 Ga0495583_0076032 Ga0495583_0076032_195_1451 357
637 3300046537 Ga0495598_0015826 Ga0495598_0015826_71_1381 357
638 3300046648 Ga0495611_0007536 Ga0495611_0007536_1833_3089 357
639 3300046684 Ga0495669_0000340 Ga0495669_0000340_3382_4638 357
640 3300047443 Ga0495687_001110 Ga0495687_001110_21611_22867 357
641 3300053079 Ga0500610_0000189 Ga0500610_0000189_13019_14275 357
642 3300053730 Ga0500645_000024 Ga0500645_000024_65669_66925 357
643 3300005344 Ga0070661_100001700 Ga0070661_1000017007 358
644 3300005455 Ga0070663_100011207 Ga0070663_1000112072 358
645 3300005546 Ga0070696_100029955 Ga0070696_1000299552 358
646 3300005564 Ga0070664_100045606 Ga0070664_1000456062 358
647 3300005577 Ga0068857_100030015 Ga0068857_1000300152 358
648 3300005616 Ga0068852_100000725 Ga0068852_10000072511 358
649 3300013102 Ga0157371_10002929 Ga0157371_100029296 358
650 3300013105 Ga0157369_10023754 Ga0157369_100237545 358
651 3300025907 Ga0207645_10021337 Ga0207645_100213372 358
652 3300025920 Ga0207649_10002484 Ga0207649_100024842 358
653 3300025920 Ga0207649_10028294 Ga0207649_100282943 358
654 3300025932 Ga0207690_10023880 Ga0207690_100238802 358
655 3300025949 Ga0207667_10020182 Ga0207667_100201822 358
656 3300025949 Ga0207667_10098991 Ga0207667_100989912 358
657 3300025981 Ga0207640_10013048 Ga0207640_100130483 358
658 3300026078 Ga0207702_10006703 Ga0207702_100067038 358
659 3300026078 Ga0207702_10057431 Ga0207702_100574312 358
660 3300026088 Ga0207641_10108204 Ga0207641_101082042 358
661 3300026116 Ga0207674_10003722 Ga0207674_1000372217 358
662 3300026116 Ga0207674_10150402 Ga0207674_101504022 358
663 3300026142 Ga0207698_10024324 Ga0207698_100243242 358
664 3300037418 Ga0395900_0001439 Ga0395900_0001439_10964_12280 358
665 3300037418 Ga0395900_0040572 Ga0395900_0040572_1239_2570 358
666 3300037466 Ga0395898_0056318 Ga0395898_0056318_2462_3778 358
667 3300037471 Ga0395905_0004094 Ga0395905_0004094_6339_7655 358
668 3300037471 Ga0395905_0031269 Ga0395905_0031269_3121_4452 358
669 3300038443 Ga0395901_0133995 Ga0395901_0133995_183_1499 358
670 3300044901 Ga0466960_0008031 Ga0466960_0008031_2643_3971 358
671 3300049850 Ga0501204_000461 Ga0501204_000461_1477_2697 358
672 3300005435 Ga0070714_100026373 Ga0070714_1000263732 359
673 3300005547 Ga0070693_100077887 Ga0070693_1000778872 359
674 3300005618 Ga0068864_100000646 Ga0068864_10000064621 359
675 3300005842 Ga0068858_100000920 Ga0068858_10000092034 359
676 3300009553 Ga0105249_10040715 Ga0105249_100407152 359
677 3300025315 Ga0207697_10040679 Ga0207697_100406793 359
678 3300025926 Ga0207659_10070500 Ga0207659_100705002 359
679 3300025929 Ga0207664_10053606 Ga0207664_100536062 359
680 3300025941 Ga0207711_10023075 Ga0207711_100230755 359
681 3300026035 Ga0207703_10000849 Ga0207703_100008492 359
682 3300026095 Ga0207676_10003178 Ga0207676_100031785 359
683 3300031995 Ga0307409_100012288 Ga0307409_1000122884 359
684 3300044656 Ga0466969_0009242 Ga0466969_0009242_465_1781 359
685 3300044694 Ga0466963_0010789 Ga0466963_0010789_233_1585 359
686 3300044842 Ga0466957_0001655 Ga0466957_0001655_4948_6300 359
687 3300045836 Ga0466958_0039196 Ga0466958_0039196_1221_2573 359
688 3300045976 Ga0466967_0052033 Ga0466967_0052033_1810_3162 359
689 3300046525 Ga0495663_0007156 Ga0495663_0007156_1295_2527 359
690 3300046558 Ga0495633_0010107 Ga0495633_0010107_1676_2986 359
691 3300046691 Ga0495670_0002753 Ga0495670_0002753_4882_6192 359
692 3300047323 Ga0495683_0002339 Ga0495683_0002339_3362_4594 359
693 3300047445 Ga0495677_0010685 Ga0495677_0010685_180_1490 359
694 3300005327 Ga0070658_10063593 Ga0070658_100635932 360
695 3300005331 Ga0070670_100001795 Ga0070670_1000017952 360
696 3300005331 Ga0070670_100010599 Ga0070670_1000105996 360
697 3300005340 Ga0070689_100035610 Ga0070689_1000356102 360
698 3300005344 Ga0070661_100027167 Ga0070661_1000271671 360
699 3300005353 Ga0070669_100000267 Ga0070669_10000026711 360
700 3300005354 Ga0070675_100004004 Ga0070675_1000040045 360
701 3300005365 Ga0070688_100005094 Ga0070688_1000050942 360
702 3300005366 Ga0070659_100045852 Ga0070659_1000458522 360
703 3300005366 Ga0070659_100094546 Ga0070659_1000945462 360
704 3300005458 Ga0070681_10064117 Ga0070681_100641172 360
705 3300005466 Ga0070685_10000342 Ga0070685_1000034216 360
706 3300005530 Ga0070679_100210485 Ga0070679_1002104851 360
707 3300005548 Ga0070665_100000071 Ga0070665_100000071180 360
708 3300005564 Ga0070664_100006742 Ga0070664_1000067428 360
709 3300005617 Ga0068859_100009558 Ga0068859_1000095584 360
710 3300005842 Ga0068858_100001078 Ga0068858_1000010789 360
711 3300005844 Ga0068862_100060393 Ga0068862_1000603932 360
712 3300006931 Ga0097620_100009557 Ga0097620_1000095574 360
713 3300009177 Ga0105248_10178768 Ga0105248_101787683 360
714 3300009545 Ga0105237_10067974 Ga0105237_100679742 360
715 3300009551 Ga0105238_10007040 Ga0105238_1000704010 360
716 3300010375 Ga0105239_10197128 Ga0105239_101971281 360
717 3300025893 Ga0207682_10003573 Ga0207682_100035732 360
718 3300025901 Ga0207688_10008427 Ga0207688_100084272 360
719 3300025911 Ga0207654_10045706 Ga0207654_100457062 360
720 3300025923 Ga0207681_10000199 Ga0207681_1000019910 360
721 3300025925 Ga0207650_10015414 Ga0207650_100154142 360
722 3300025932 Ga0207690_10052035 Ga0207690_100520352 360
723 3300025936 Ga0207670_10014973 Ga0207670_100149733 360
724 3300025945 Ga0207679_10020436 Ga0207679_100204362 360
725 3300026116 Ga0207674_10001746 Ga0207674_1000174621 360
726 3300028379 Ga0268266_10000040 Ga0268266_10000040181 360
727 3300031901 Ga0307406_10100059 Ga0307406_101000592 360
728 3300037418 Ga0395900_0021454 Ga0395900_0021454_4514_5833 360
729 3300037466 Ga0395898_0242457 Ga0395898_0242457_263_1564 360
730 3300046684 Ga0495669_0020996 Ga0495669_0020996_457_1779 360
731 3300046691 Ga0495670_0000165 Ga0495670_0000165_7490_8719 360
732 3300046691 Ga0495670_0008592 Ga0495670_0008592_3379_4701 360
733 3300049663 Ga0501223_004955 Ga0501223_004955_1059_2297 360
734 3300053087 Ga0500643_000066 Ga0500643_000066_10088_11347 360
735 3300005327 Ga0070658_10027180 Ga0070658_100271802 361
736 3300005339 Ga0070660_100034319 Ga0070660_1000343194 361
737 3300025912 Ga0207707_10057899 Ga0207707_100578992 361
738 3300025919 Ga0207657_10002767 Ga0207657_1000276713 361
739 3300025919 Ga0207657_10108216 Ga0207657_101082161 361
740 3300025960 Ga0207651_10037348 Ga0207651_100373484 361
741 3300026041 Ga0207639_10008118 Ga0207639_100081186 361
742 3300026116 Ga0207674_10016671 Ga0207674_100166712 361
743 3300031995 Ga0307409_100001643 Ga0307409_1000016439 361
744 3300031995 Ga0307409_100041226 Ga0307409_1000412262 361
745 3300032004 Ga0307414_10000921 Ga0307414_100009218 361
746 3300037471 Ga0395905_0020390 Ga0395905_0020390_1435_2754 361
747 3300037471 Ga0395905_0036898 Ga0395905_0036898_2045_3349 361
748 3300042004 Ga0439445_0001098 Ga0439445_0001098_3943_5259 361
749 3300047443 Ga0495687_000250 Ga0495687_000250_6007_7245 361
750 3300053116 Ga0500592_000556 Ga0500592_000556_764_2023 361
751 3300053158 Ga0500627_0000208 Ga0500627_0000208_11729_12988 361
752 3300005355 Ga0070671_100070960 Ga0070671_1000709602 362
753 3300005563 Ga0068855_100090861 Ga0068855_1000908614 362
754 3300005614 Ga0068856_100068028 Ga0068856_1000680282 362
755 3300005616 Ga0068852_100006660 Ga0068852_1000066602 362
756 3300009093 Ga0105240_10051957 Ga0105240_100519574 362
757 3300021358 Ga0213873_10000017 Ga0213873_1000001722 362
758 3300021384 Ga0213876_10000071 Ga0213876_10000071115 362
759 3300025904 Ga0207647_10016621 Ga0207647_100166213 362
760 3300025932 Ga0207690_10086040 Ga0207690_100860402 362
761 3300025945 Ga0207679_10164431 Ga0207679_101644311 362
762 3300025949 Ga0207667_10116095 Ga0207667_101160952 362
763 3300025949 Ga0207667_10188728 Ga0207667_101887282 362
764 3300025949 Ga0207667_10233739 Ga0207667_102337392 362
765 3300031852 Ga0307410_10118820 Ga0307410_101188202 362
766 3300032002 Ga0307416_100365073 Ga0307416_1003650731 362
767 3300032005 Ga0307411_10177853 Ga0307411_101778532 362
768 3300035170 Ga0373943_0017139 Ga0373943_0017139_40_1341 362
769 3300035692 Ga0373935_0068062 Ga0373935_0068062_497_1798 362
770 3300037068 Ga0373925_0031833 Ga0373925_0031833_2079_3380 362
771 3300037471 Ga0395905_0010107 Ga0395905_0010107_1364_2686 362
772 3300039437 Ga0436365_0646826 Ga0436365_0646826_106932_108233 362
773 3300039453 Ga0436362_0199967 Ga0436362_0199967_10158_11459 362
774 3300044694 Ga0466963_0023879 Ga0466963_0023879_1175_2515 362
775 3300044719 Ga0466971_0022307 Ga0466971_0022307_1258_2598 362
776 3300044842 Ga0466957_0007293 Ga0466957_0007293_2185_3525 362
777 3300045049 Ga0466959_0042172 Ga0466959_0042172_729_2069 362
778 3300049686 Ga0501257_000066 Ga0501257_000066_25636_26874 362
779 3300061719 Ga0466962_0015200 Ga0466962_0015200_1165_2505 362
780 3300017792 Ga0163161_10022829 Ga0163161_100228292 363
781 3300025917 Ga0207660_10000372 Ga0207660_1000037217 363
782 3300025938 Ga0207704_10056906 Ga0207704_100569062 363
783 3300031731 Ga0307405_10162043 Ga0307405_101620431 363
784 3300031852 Ga0307410_10081567 Ga0307410_100815672 363
785 3300031903 Ga0307407_10108286 Ga0307407_101082862 363
786 3300031995 Ga0307409_100181536 Ga0307409_1001815362 363
787 3300037471 Ga0395905_0102637 Ga0395905_0102637_1244_2536 363
788 3300038443 Ga0395901_0000826 Ga0395901_0000826_16239_17579 363
789 3300045976 Ga0466967_0328052 Ga0466967_0328052_119_1456 363
790 3300048904 Ga0496101_0025424 Ga0496101_0025424_2777_4063 363
791 3300048910 Ga0496107_0026887 Ga0496107_0026887_766_2052 363
792 3300048917 Ga0496114_0034987 Ga0496114_0034987_1650_2936 363
793 3300005335 Ga0070666_10000978 Ga0070666_1000097810 364
794 3300005338 Ga0068868_100060162 Ga0068868_1000601622 364
795 3300005354 Ga0070675_100084394 Ga0070675_1000843942 364
796 3300005364 Ga0070673_100002984 Ga0070673_1000029845 364
797 3300005367 Ga0070667_100005534 Ga0070667_1000055347 364
798 3300005457 Ga0070662_100006906 Ga0070662_1000069062 364
799 3300005466 Ga0070685_10047880 Ga0070685_100478802 364
800 3300005543 Ga0070672_100010680 Ga0070672_1000106803 364
801 3300005548 Ga0070665_100003821 Ga0070665_1000038218 364
802 3300005564 Ga0070664_100044400 Ga0070664_1000444002 364
803 3300005616 Ga0068852_100215523 Ga0068852_1002155232 364
804 3300005618 Ga0068864_100016122 Ga0068864_1000161224 364
805 3300006237 Ga0097621_100009078 Ga0097621_1000090784 364
806 3300009177 Ga0105248_10211531 Ga0105248_102115311 364
807 3300013308 Ga0157375_10016992 Ga0157375_100169924 364
808 3300014325 Ga0163163_10034771 Ga0163163_100347712 364
809 3300025903 Ga0207680_10004029 Ga0207680_100040294 364
810 3300025925 Ga0207650_10006873 Ga0207650_100068734 364
811 3300025931 Ga0207644_10001602 Ga0207644_1000160210 364
812 3300025933 Ga0207706_10061651 Ga0207706_100616512 364
813 3300025940 Ga0207691_10013356 Ga0207691_100133563 364
814 3300025960 Ga0207651_10047180 Ga0207651_100471802 364
815 3300025986 Ga0207658_10036557 Ga0207658_100365572 364
816 3300026035 Ga0207703_10006281 Ga0207703_100062818 364
817 3300026095 Ga0207676_10006048 Ga0207676_100060483 364
818 3300026121 Ga0207683_10024784 Ga0207683_100247842 364
819 3300026121 Ga0207683_10123272 Ga0207683_101232722 364
820 3300028379 Ga0268266_10009696 Ga0268266_100096963 364
821 3300031548 Ga0307408_100058722 Ga0307408_1000587222 364
822 3300031731 Ga0307405_10117465 Ga0307405_101174652 364
823 3300031852 Ga0307410_10002232 Ga0307410_100022328 364
824 3300031901 Ga0307406_10031010 Ga0307406_100310102 364
825 3300031903 Ga0307407_10011829 Ga0307407_100118292 364
826 3300031911 Ga0307412_10003365 Ga0307412_100033654 364
827 3300031995 Ga0307409_100090426 Ga0307409_1000904262 364
828 3300032002 Ga0307416_100091319 Ga0307416_1000913192 364
829 3300032004 Ga0307414_10000664 Ga0307414_100006648 364
830 3300032005 Ga0307411_10022396 Ga0307411_100223963 364
831 3300032005 Ga0307411_10032751 Ga0307411_100327512 364
832 3300038443 Ga0395901_0207532 Ga0395901_0207532_73_1392 364
833 3300044694 Ga0466963_0016665 Ga0466963_0016665_310_1716 364
834 3300044735 Ga0466968_0009318 Ga0466968_0009318_1087_2337 364
835 3300044842 Ga0466957_0007350 Ga0466957_0007350_2854_4260 364
836 3300045976 Ga0466967_0042108 Ga0466967_0042108_1396_2724 364
837 3300046539 Ga0495621_0012970 Ga0495621_0012970_318_1619 364
838 3300046684 Ga0495669_0001180 Ga0495669_0001180_8743_10056 364
839 3300048909 Ga0496106_0149452 Ga0496106_0149452_289_1602 364
840 3300048911 Ga0496108_0036738 Ga0496108_0036738_818_2131 364
841 3300048913 Ga0496110_0079515 Ga0496110_0079515_374_1687 364
842 3300048914 Ga0496111_0019919 Ga0496111_0019919_995_2308 364
843 3300048915 Ga0496112_0099438 Ga0496112_0099438_995_2308 364
844 3300048916 Ga0496113_0045320 Ga0496113_0045320_1347_2660 364
845 3300009094 Ga0111539_10091535 Ga0111539_100915352 365
846 3300014326 Ga0157380_10001524 Ga0157380_1000152418 365
847 3300025933 Ga0207706_10007662 Ga0207706_100076626 365
848 3300025940 Ga0207691_10001140 Ga0207691_100011408 365
849 3300025960 Ga0207651_10025573 Ga0207651_100255732 365
850 3300026118 Ga0207675_100005093 Ga0207675_1000050932 365
851 3300032002 Ga0307416_100224170 Ga0307416_1002241703 365
852 3300050511 nmdc:mga08y16_151600_c1 nmdc:mga08y16_151600_c1_103_1461 365
853 3300005353 Ga0070669_100145324 Ga0070669_1001453242 366
854 3300005577 Ga0068857_100092990 Ga0068857_1000929902 366
855 3300025923 Ga0207681_10053467 Ga0207681_100534672 366
856 3300037471 Ga0395905_0189278 Ga0395905_0189278_280_1596 366
857 3300047472 Ga0495686_0000368 Ga0495686_0000368_21274_22548 366
858 3300048911 Ga0496108_0015808 Ga0496108_0015808_4073_5386 366
859 3300005355 Ga0070671_100006859 Ga0070671_1000068599 367
860 3300005544 Ga0070686_100001142 Ga0070686_1000011422 367
861 3300009551 Ga0105238_10046743 Ga0105238_100467432 367
862 3300025924 Ga0207694_10090550 Ga0207694_100905502 367
863 3300025931 Ga0207644_10019650 Ga0207644_100196502 367
864 3300037471 Ga0395905_0277287 Ga0395905_0277287_199_1536 367
865 3300038443 Ga0395901_0053000 Ga0395901_0053000_614_1951 367
866 3300044694 Ga0466963_0022329 Ga0466963_0022329_1566_2885 367
867 3300048918 Ga0496115_0002304 Ga0496115_0002304_12089_13381 367
868 3300048928 Ga0496125_0036510 Ga0496125_0036510_1404_2675 367
869 3300053151 Ga0500604_0000017 Ga0500604_0000017_6254_7519 367
870 3300003763 Ga0055529_1000002 Ga0055529_1000002356 368
871 3300003763 Ga0055529_1000021 Ga0055529_1000021124 368
872 3300005295 Ga0065707_10083783 Ga0065707_100837833 368
873 3300005548 Ga0070665_100001220 Ga0070665_10000122011 368
874 3300005577 Ga0068857_100018103 Ga0068857_1000181035 368
875 3300025254 Ga0209148_1000008 Ga0209148_10000081073 368
876 3300025272 Ga0209455_1000002 Ga0209455_1000002352 368
877 3300025932 Ga0207690_10052464 Ga0207690_100524642 368
878 3300027876 Ga0209974_10001657 Ga0209974_100016576 368
879 3300028379 Ga0268266_10000437 Ga0268266_1000043750 368
880 3300031548 Ga0307408_100010901 Ga0307408_1000109013 368
881 3300031548 Ga0307408_100136438 Ga0307408_1001364382 368
882 3300031824 Ga0307413_10004980 Ga0307413_100049804 368
883 3300031852 Ga0307410_10006709 Ga0307410_100067095 368
884 3300031901 Ga0307406_10016165 Ga0307406_100161652 368
885 3300031911 Ga0307412_10134540 Ga0307412_101345402 368
886 3300031995 Ga0307409_100218022 Ga0307409_1002180222 368
887 3300032004 Ga0307414_10006422 Ga0307414_100064222 368
888 3300032004 Ga0307414_10085871 Ga0307414_100858712 368
889 3300032005 Ga0307411_10012103 Ga0307411_100121032 368
890 3300049528 Ga0501312_008634 Ga0501312_008634_13_1263 368
891 3300049571 Ga0501034_0033093 Ga0501034_0033093_3696_4982 368
892 3300049586 Ga0501070_0180080 Ga0501070_0180080_16_1302 368
893 3300049679 Ga0501249_000093 Ga0501249_000093_14120_15370 368
894 3300005340 Ga0070689_100242779 Ga0070689_1002427791 369
895 3300005457 Ga0070662_100099128 Ga0070662_1000991282 369
896 3300005563 Ga0068855_100009958 Ga0068855_1000099587 369
897 3300005614 Ga0068856_100034607 Ga0068856_1000346073 369
898 3300009093 Ga0105240_10048387 Ga0105240_100483872 369
899 3300009551 Ga0105238_10017403 Ga0105238_100174032 369
900 3300010375 Ga0105239_10168913 Ga0105239_101689132 369
901 3300025913 Ga0207695_10021564 Ga0207695_100215645 369
902 3300025924 Ga0207694_10085339 Ga0207694_100853392 369
903 3300025949 Ga0207667_10000670 Ga0207667_1000067040 369
904 3300026078 Ga0207702_10044145 Ga0207702_100441452 369
905 3300028380 Ga0268265_10166848 Ga0268265_101668482 369
906 3300037418 Ga0395900_0049578 Ga0395900_0049578_2616_3920 369
907 3300037466 Ga0395898_0039372 Ga0395898_0039372_2955_4259 369
908 3300037471 Ga0395905_0010449 Ga0395905_0010449_328_1629 369
909 3300038443 Ga0395901_0044717 Ga0395901_0044717_311_1612 369
910 3300038443 Ga0395901_0262740 Ga0395901_0262740_165_1469 369
911 3300049581 Ga0501047_0003516 Ga0501047_0003516_12881_14131 369
912 3300001989 JGI24739J22299_10001638 JGI24739J22299_100016384 370
913 3300005327 Ga0070658_10000057 Ga0070658_100000576 370
914 3300005364 Ga0070673_100067103 Ga0070673_1000671032 370
915 3300005457 Ga0070662_100174025 Ga0070662_1001740251 370
916 3300005539 Ga0068853_100013991 Ga0068853_1000139913 370
917 3300005563 Ga0068855_100244037 Ga0068855_1002440372 370
918 3300005564 Ga0070664_100073492 Ga0070664_1000734922 370
919 3300005578 Ga0068854_100048464 Ga0068854_1000484642 370
920 3300006847 Ga0075431_100080079 Ga0075431_1000800792 370
921 3300009098 Ga0105245_10010975 Ga0105245_100109753 370
922 3300009551 Ga0105238_10116478 Ga0105238_101164782 370
923 3300025909 Ga0207705_10000117 Ga0207705_1000011740 370
924 3300025919 Ga0207657_10000145 Ga0207657_1000014528 370
925 3300025923 Ga0207681_10044950 Ga0207681_100449502 370
926 3300025926 Ga0207659_10141270 Ga0207659_101412702 370
927 3300025933 Ga0207706_10142679 Ga0207706_101426792 370
928 3300025940 Ga0207691_10060409 Ga0207691_100604092 370
929 3300025949 Ga0207667_10024163 Ga0207667_100241632 370
930 3300025960 Ga0207651_10040831 Ga0207651_100408312 370
931 3300025981 Ga0207640_10035423 Ga0207640_100354232 370
932 3300031824 Ga0307413_10026601 Ga0307413_100266012 370
933 3300037312 Ga0395899_0001082 Ga0395899_0001082_7669_8979 370
934 3300037418 Ga0395900_0000881 Ga0395900_0000881_18805_20115 370
935 3300037466 Ga0395898_0002116 Ga0395898_0002116_7651_8961 370
936 3300037471 Ga0395905_0000089 Ga0395905_0000089_38636_39946 370
937 3300038443 Ga0395901_0000548 Ga0395901_0000548_23791_25101 370
938 3300048904 Ga0496101_0019282 Ga0496101_0019282_3276_4568 370
939 3300048915 Ga0496112_0032879 Ga0496112_0032879_1938_3230 370
940 3300048917 Ga0496114_0047537 Ga0496114_0047537_1980_3272 370
941 3300053087 Ga0500643_022143 Ga0500643_022143_166_1437 370
942 3300053153 Ga0500616_0003013 Ga0500616_0003013_6791_8071 370
943 3300005353 Ga0070669_100088618 Ga0070669_1000886182 371
944 3300005577 Ga0068857_100013033 Ga0068857_1000130333 371
945 3300005577 Ga0068857_100059919 Ga0068857_1000599192 371
946 3300005842 Ga0068858_100079082 Ga0068858_1000790822 371
947 3300025921 Ga0207652_10020140 Ga0207652_100201403 371
948 3300025923 Ga0207681_10012904 Ga0207681_100129044 371
949 3300025942 Ga0207689_10066078 Ga0207689_100660782 371
950 3300026035 Ga0207703_10084791 Ga0207703_100847912 371
951 3300026088 Ga0207641_10089430 Ga0207641_100894302 371
952 3300031731 Ga0307405_10067690 Ga0307405_100676902 371
953 3300032005 Ga0307411_10076294 Ga0307411_100762942 371
954 3300053153 Ga0500616_0004704 Ga0500616_0004704_8028_9293 371
955 3300005345 Ga0070692_10032924 Ga0070692_100329242 372
956 3300005355 Ga0070671_100062950 Ga0070671_1000629502 372
957 3300005617 Ga0068859_100020039 Ga0068859_1000200392 372
958 3300005841 Ga0068863_100012981 Ga0068863_1000129812 372
959 3300006931 Ga0097620_100020039 Ga0097620_1000200392 372
960 3300009177 Ga0105248_10208368 Ga0105248_102083682 372
961 3300013105 Ga0157369_10014410 Ga0157369_100144102 372
962 3300013297 Ga0157378_10157689 Ga0157378_101576892 372
963 3300025904 Ga0207647_10006164 Ga0207647_100061647 372
964 3300031731 Ga0307405_10026867 Ga0307405_100268672 372
965 3300031911 Ga0307412_10024170 Ga0307412_100241703 372
966 3300037312 Ga0395899_0025938 Ga0395899_0025938_634_1953 372
967 3300037471 Ga0395905_0034052 Ga0395905_0034052_516_1826 372
968 3300038443 Ga0395901_0030986 Ga0395901_0030986_1570_2889 372
969 3300038443 Ga0395901_0133816 Ga0395901_0133816_501_1826 372
970 3300046664 Ga0495659_0015631 Ga0495659_0015631_726_2027 372
971 3300048905 Ga0496102_0147100 Ga0496102_0147100_409_1704 372
972 3300005330 Ga0070690_100008046 Ga0070690_1000080462 373
973 3300005335 Ga0070666_10000445 Ga0070666_1000044518 373
974 3300005364 Ga0070673_100079467 Ga0070673_1000794672 373
975 3300005367 Ga0070667_100003053 Ga0070667_1000030534 373
976 3300005548 Ga0070665_100042791 Ga0070665_1000427912 373
977 3300005548 Ga0070665_100084017 Ga0070665_1000840172 373
978 3300005564 Ga0070664_100011816 Ga0070664_1000118162 373
979 3300005616 Ga0068852_100027869 Ga0068852_1000278692 373
980 3300005842 Ga0068858_100000868 Ga0068858_10000086824 373
981 3300006852 Ga0075433_10021679 Ga0075433_100216792 373
982 3300009093 Ga0105240_10084316 Ga0105240_100843162 373
983 3300009177 Ga0105248_10001078 Ga0105248_1000107822 373
984 3300025903 Ga0207680_10014931 Ga0207680_100149314 373
985 3300025938 Ga0207704_10083174 Ga0207704_100831741 373
986 3300025940 Ga0207691_10049207 Ga0207691_100492072 373
987 3300025941 Ga0207711_10000510 Ga0207711_1000051035 373
988 3300025945 Ga0207679_10002092 Ga0207679_100020922 373
989 3300025960 Ga0207651_10002877 Ga0207651_100028772 373
990 3300025986 Ga0207658_10004383 Ga0207658_100043838 373
991 3300026035 Ga0207703_10001787 Ga0207703_100017872 373
992 3300026121 Ga0207683_10016043 Ga0207683_100160434 373
993 3300028379 Ga0268266_10041811 Ga0268266_100418114 373
994 3300039437 Ga0436365_0602472 Ga0436365_0602472_3196_4533 373
995 3300048911 Ga0496108_0017277 Ga0496108_0017277_277_1599 373
996 3300050515 nmdc:mga0a205_50078_c1 nmdc:mga0a205_50078_c1_997_2310 373
997 3300005339 Ga0070660_100133639 Ga0070660_1001336391 374
998 3300005563 Ga0068855_100101005 Ga0068855_1001010052 374
999 3300005564 Ga0070664_100100753 Ga0070664_1001007532 374
1000 3300013102 Ga0157371_10055527 Ga0157371_100555272 374
1001 3300025909 Ga0207705_10068162 Ga0207705_100681622 374
1002 3300026067 Ga0207678_10006903 Ga0207678_100069032 374
1003 3300031824 Ga0307413_10004519 Ga0307413_100045194 374
1004 3300031824 Ga0307413_10077591 Ga0307413_100775912 374
1005 3300032004 Ga0307414_10021693 Ga0307414_100216933 374
1006 3300032005 Ga0307411_10012989 Ga0307411_100129892 374
1007 3300037418 Ga0395900_0001333 Ga0395900_0001333_25767_27086 374
1008 3300048915 Ga0496112_0052265 Ga0496112_0052265_381_1685 374
1009 3300005327 Ga0070658_10030478 Ga0070658_100304782 375
1010 3300005355 Ga0070671_100024633 Ga0070671_1000246332 375
1011 3300005356 Ga0070674_100061829 Ga0070674_1000618292 375
1012 3300005457 Ga0070662_100037361 Ga0070662_1000373613 375
1013 3300005548 Ga0070665_100001688 Ga0070665_10000168827 375
1014 3300005564 Ga0070664_100022162 Ga0070664_1000221623 375
1015 3300005718 Ga0068866_10022525 Ga0068866_100225252 375
1016 3300005841 Ga0068863_100000040 Ga0068863_100000040148 375
1017 3300006175 Ga0070712_100065929 Ga0070712_1000659292 375
1018 3300006353 Ga0075370_10014156 Ga0075370_100141562 375
1019 3300025315 Ga0207697_10017761 Ga0207697_100177612 375
1020 3300025893 Ga0207682_10001425 Ga0207682_1000142510 375
1021 3300025919 Ga0207657_10216581 Ga0207657_102165812 375
1022 3300025925 Ga0207650_10007801 Ga0207650_100078012 375
1023 3300025933 Ga0207706_10075102 Ga0207706_100751022 375
1024 3300026088 Ga0207641_10000039 Ga0207641_1000003942 375
1025 3300026142 Ga0207698_10069965 Ga0207698_100699651 375
1026 3300028379 Ga0268266_10000584 Ga0268266_1000058418 375
1027 3300028381 Ga0268264_10304711 Ga0268264_103047111 375
1028 3300031852 Ga0307410_10104312 Ga0307410_101043122 375
1029 3300037418 Ga0395900_0174111 Ga0395900_0174111_588_1889 375
1030 3300038443 Ga0395901_0172681 Ga0395901_0172681_710_2008 375
1031 3300050496 nmdc:mga07m45_90819_c1 nmdc:mga07m45_90819_c1_18_1268 375
1032 3300001990 JGI24737J22298_10006047 JGI24737J22298_100060472 376
1033 3300005345 Ga0070692_10001332 Ga0070692_100013322 376
1034 3300005347 Ga0070668_100027279 Ga0070668_1000272795 376
1035 3300005366 Ga0070659_100006940 Ga0070659_1000069402 376
1036 3300005444 Ga0070694_100006826 Ga0070694_1000068262 376
1037 3300005457 Ga0070662_100013940 Ga0070662_1000139402 376
1038 3300005543 Ga0070672_100028308 Ga0070672_1000283082 376
1039 3300005843 Ga0068860_100019559 Ga0068860_1000195592 376
1040 3300009553 Ga0105249_10009802 Ga0105249_100098025 376
1041 3300013306 Ga0163162_10145545 Ga0163162_101455451 376
1042 3300025904 Ga0207647_10008623 Ga0207647_100086235 376
1043 3300025907 Ga0207645_10141323 Ga0207645_101413231 376
1044 3300025919 Ga0207657_10183914 Ga0207657_101839142 376
1045 3300025928 Ga0207700_10134740 Ga0207700_101347402 376
1046 3300025933 Ga0207706_10261474 Ga0207706_102614741 376
1047 3300025961 Ga0207712_10000946 Ga0207712_1000094610 376
1048 3300025972 Ga0207668_10018419 Ga0207668_100184194 376
1049 3300028381 Ga0268264_10003522 Ga0268264_100035229 376
1050 3300037471 Ga0395905_0006090 Ga0395905_0006090_4777_6096 376
1051 3300047472 Ga0495686_0069808 Ga0495686_0069808_446_1717 376
1052 3300001989 JGI24739J22299_10002242 JGI24739J22299_100022425 377
1053 3300002459 JGI24751J29686_10000069 JGI24751J29686_1000006947 377
1054 3300005330 Ga0070690_100012671 Ga0070690_1000126712 377
1055 3300005331 Ga0070670_100000005 Ga0070670_100000005318 377
1056 3300005338 Ga0068868_100010852 Ga0068868_1000108527 377
1057 3300005338 Ga0068868_100098547 Ga0068868_1000985473 377
1058 3300005353 Ga0070669_100014539 Ga0070669_1000145391 377
1059 3300005355 Ga0070671_100001714 Ga0070671_1000017148 377
1060 3300005367 Ga0070667_100043413 Ga0070667_1000434132 377
1061 3300005455 Ga0070663_100022983 Ga0070663_1000229832 377
1062 3300005617 Ga0068859_100053878 Ga0068859_1000538785 377
1063 3300005618 Ga0068864_100000011 Ga0068864_100000011318 377
1064 3300005719 Ga0068861_100010296 Ga0068861_1000102963 377
1065 3300005844 Ga0068862_100000104 Ga0068862_10000010419 377
1066 3300005844 Ga0068862_100034248 Ga0068862_1000342482 377
1067 3300006931 Ga0097620_100053881 Ga0097620_1000538815 377
1068 3300009098 Ga0105245_10009345 Ga0105245_100093457 377
1069 3300009177 Ga0105248_10000229 Ga0105248_1000022951 377
1070 3300009553 Ga0105249_10003121 Ga0105249_100031217 377
1071 3300014325 Ga0163163_10024380 Ga0163163_100243807 377
1072 3300014326 Ga0157380_10000083 Ga0157380_1000008349 377
1073 3300025901 Ga0207688_10030047 Ga0207688_100300471 377
1074 3300025923 Ga0207681_10000001 Ga0207681_10000001341 377
1075 3300025924 Ga0207694_10091959 Ga0207694_100919592 377
1076 3300025925 Ga0207650_10000018 Ga0207650_10000018317 377
1077 3300025927 Ga0207687_10005831 Ga0207687_100058316 377
1078 3300025927 Ga0207687_10006475 Ga0207687_100064752 377
1079 3300025931 Ga0207644_10000595 Ga0207644_1000059513 377
1080 3300025933 Ga0207706_10024287 Ga0207706_100242872 377
1081 3300025933 Ga0207706_10073337 Ga0207706_100733372 377
1082 3300025941 Ga0207711_10000594 Ga0207711_1000059421 377
1083 3300025961 Ga0207712_10030191 Ga0207712_100301914 377
1084 3300025972 Ga0207668_10000213 Ga0207668_100002136 377
1085 3300025986 Ga0207658_10004369 Ga0207658_100043695 377
1086 3300025986 Ga0207658_10043715 Ga0207658_100437152 377
1087 3300026067 Ga0207678_10022937 Ga0207678_100229373 377
1088 3300026095 Ga0207676_10000004 Ga0207676_10000004710 377
1089 3300026118 Ga0207675_100001397 Ga0207675_10000139717 377
1090 3300028379 Ga0268266_10041266 Ga0268266_100412662 377
1091 3300028380 Ga0268265_10000002 Ga0268265_10000002347 377
1092 3300028380 Ga0268265_10070629 Ga0268265_100706292 377
1093 3300028381 Ga0268264_10009299 Ga0268264_100092995 377
1094 3300044694 Ga0466963_0119818 Ga0466963_0119818_443_1789 377
1095 3300046684 Ga0495669_0045295 Ga0495669_0045295_114_1412 377
1096 3300005985 Ga0081539_10021433 Ga0081539_100214332 378
1097 3300025949 Ga0207667_10154605 Ga0207667_101546052 378
1098 3300042122 Ga0450920_001427 Ga0450920_001427_1494_2843 378
1099 iso_pu_bacteria 2896429255 2896431167 378
1100 3300005455 Ga0070663_100229725 Ga0070663_1002297251 379
1101 3300005617 Ga0068859_100040234 Ga0068859_1000402345 379
1102 3300005843 Ga0068860_100185437 Ga0068860_1001854372 379
1103 3300006931 Ga0097620_100040233 Ga0097620_1000402335 379
1104 3300009177 Ga0105248_10062441 Ga0105248_100624412 379
1105 3300014968 Ga0157379_10078836 Ga0157379_100788362 379
1106 3300025908 Ga0207643_10060686 Ga0207643_100606862 379
1107 3300025941 Ga0207711_10007399 Ga0207711_100073998 379
1108 3300028381 Ga0268264_10082517 Ga0268264_100825171 379
1109 3300046616 Ga0495668_0026158 Ga0495668_0026158_1677_2930 379
1110 iso_pu_bacteria 2885427238 2885427533 379
1111 3300005459 Ga0068867_100096714 Ga0068867_1000967142 380
1112 3300005841 Ga0068863_100101395 Ga0068863_1001013952 380
1113 3300005843 Ga0068860_100342650 Ga0068860_1003426502 380
1114 3300006237 Ga0097621_100073010 Ga0097621_1000730102 380
1115 3300014968 Ga0157379_10276066 Ga0157379_102760661 380
1116 3300046507 Ga0495606_0000842 Ga0495606_0000842_36361_37638 380
1117 3300047472 Ga0495686_0003725 Ga0495686_0003725_11228_12502 380
1118 3300048904 Ga0496101_0135958 Ga0496101_0135958_538_1860 380
1119 3300048912 Ga0496109_0040977 Ga0496109_0040977_628_1950 380
1120 3300005344 Ga0070661_100009029 Ga0070661_1000090292 381
1121 3300005618 Ga0068864_100060492 Ga0068864_1000604923 381
1122 3300009098 Ga0105245_10119113 Ga0105245_101191132 381
1123 3300013100 Ga0157373_10009064 Ga0157373_100090642 381
1124 3300013102 Ga0157371_10192406 Ga0157371_101924061 381
1125 3300014969 Ga0157376_10058403 Ga0157376_100584032 381
1126 3300025933 Ga0207706_10012593 Ga0207706_100125932 381
1127 3300025940 Ga0207691_10079279 Ga0207691_100792792 381
1128 3300046616 Ga0495668_0026146 Ga0495668_0026146_1264_2526 381
1129 3300046660 Ga0495625_0059115 Ga0495625_0059115_1140_2402 381
1130 3300048915 Ga0496112_0024046 Ga0496112_0024046_2437_3759 381
1131 3300048917 Ga0496114_0000033 Ga0496114_0000033_40128_41453 381
1132 3300053093 Ga0500651_0012593 Ga0500651_0012593_822_2084 381
1133 3300053130 Ga0500642_0012567 Ga0500642_0012567_1383_2645 381
1134 3300053133 Ga0500655_000146 Ga0500655_000146_8022_9284 381
1135 3300053142 Ga0500577_0020271 Ga0500577_0020271_735_1997 381
1136 3300053148 Ga0500590_003458 Ga0500590_003458_2551_3813 381
1137 3300053156 Ga0500622_0058072 Ga0500622_0058072_33_1295 381
1138 3300053724 Ga0500570_012399 Ga0500570_012399_1991_3253 381
1139 3300021388 Ga0213875_10001398 Ga0213875_100013987 382
1140 3300032004 Ga0307414_10050336 Ga0307414_100503362 382
1141 3300037853 Ga0436364_1065372 Ga0436364_1065372_67989_69317 382
1142 3300012513 Ga0157326_1000170 Ga0157326_10001704 383
1143 iso_pu_bacteria 8057101203 8057104395 383
1144 3300026118 Ga0207675_100247623 Ga0207675_1002476231 384
1145 3300002459 JGI24751J29686_10008566 JGI24751J29686_100085662 385
1146 3300005347 Ga0070668_100000020 Ga0070668_10000002034 385
1147 3300005355 Ga0070671_100023182 Ga0070671_1000231825 385
1148 3300005367 Ga0070667_100000055 Ga0070667_10000005512 385
1149 3300005842 Ga0068858_100000186 Ga0068858_10000018617 385
1150 3300005843 Ga0068860_100000090 Ga0068860_10000009012 385
1151 3300005844 Ga0068862_100000930 Ga0068862_1000009309 385
1152 3300025903 Ga0207680_10019851 Ga0207680_100198512 385
1153 3300025923 Ga0207681_10087464 Ga0207681_100874642 385
1154 3300025925 Ga0207650_10000977 Ga0207650_1000097713 385
1155 3300025931 Ga0207644_10000050 Ga0207644_1000005021 385
1156 3300025972 Ga0207668_10000044 Ga0207668_1000004448 385
1157 3300025986 Ga0207658_10000034 Ga0207658_10000034127 385
1158 3300026035 Ga0207703_10000231 Ga0207703_1000023157 385
1159 3300026088 Ga0207641_10000831 Ga0207641_1000083128 385
1160 3300028380 Ga0268265_10000880 Ga0268265_1000088018 385
1161 3300028381 Ga0268264_10000075 Ga0268264_10000075150 385
1162 3300031548 Ga0307408_100024986 Ga0307408_1000249862 385
1163 3300050493 nmdc:mga0k408_45040_c1 nmdc:mga0k408_45040_c1_939_2177 385
1164 iso_pu_bacteria 2599185359 2600228343 385
1165 iso_pu_bacteria 2928526807 2928528119 385
1166 3300005367 Ga0070667_100000166 Ga0070667_10000016641 386
1167 3300005841 Ga0068863_100017920 Ga0068863_1000179204 386
1168 3300005843 Ga0068860_100000245 Ga0068860_10000024541 386
1169 3300025986 Ga0207658_10000128 Ga0207658_1000012839 386
1170 3300026088 Ga0207641_10005831 Ga0207641_100058312 386
1171 3300028381 Ga0268264_10000296 Ga0268264_1000029639 386
1172 iso_pu_bacteria 2643221541 2643728961 387
1173 iso_pu_bacteria 2643221606 2644044976 387
1174 iso_pu_bacteria 2643221671 2644391149 387
1175 3300005841 Ga0068863_100007529 Ga0068863_1000075297 388
1176 3300009101 Ga0105247_10004564 Ga0105247_100045648 388
1177 3300009177 Ga0105248_10000045 Ga0105248_10000045141 388
1178 3300009553 Ga0105249_10000055 Ga0105249_1000005530 388
1179 3300013306 Ga0163162_10018410 Ga0163162_100184102 388
1180 3300025900 Ga0207710_10002325 Ga0207710_100023252 388
1181 3300025941 Ga0207711_10000027 Ga0207711_1000002796 388
1182 3300025961 Ga0207712_10000131 Ga0207712_1000013130 388
1183 3300026088 Ga0207641_10007120 Ga0207641_100071207 388
1184 iso_pu_bacteria 2582581305 2585262686 388
1185 iso_pu_bacteria 2643221605 2644038210 388
1186 3300005617 Ga0068859_100084841 Ga0068859_1000848412 389
1187 3300006931 Ga0097620_100084842 Ga0097620_1000848423 389
1188 3300048905 Ga0496102_0001154 Ga0496102_0001154_6675_7928 389
1189 3300048906 Ga0496103_0000736 Ga0496103_0000736_6665_7918 389
1190 3300048919 Ga0496116_0006054 Ga0496116_0006054_6309_7562 389
1191 3300048920 Ga0496117_0000072 Ga0496117_0000072_6687_7940 389
1192 3300048921 Ga0496118_0000030 Ga0496118_0000030_230427_231680 389
1193 3300048927 Ga0496124_0000061 Ga0496124_0000061_230427_231680 389
1194 3300005618 Ga0068864_100021028 Ga0068864_1000210282 390
1195 3300026095 Ga0207676_10015664 Ga0207676_100156642 390
1196 3300026067 Ga0207678_10086272 Ga0207678_100862722 391
1197 3300046506 Ga0495583_0000201 Ga0495583_0000201_80518_81783 391
1198 3300053103 Ga0500555_000621 Ga0500555_000621_4578_5843 391
1199 3300002075 JGI24738J21930_10000423 JGI24738J21930_100004236 392
1200 3300005834 Ga0068851_10024527 Ga0068851_100245273 392
1201 3300025904 Ga0207647_10001025 Ga0207647_100010254 392
1202 3300025914 Ga0207671_10001694 Ga0207671_100016944 392
1203 3300025924 Ga0207694_10010538 Ga0207694_100105385 392
1204 3300025949 Ga0207667_10002785 Ga0207667_100027859 392
1205 3300025981 Ga0207640_10008542 Ga0207640_100085421 392
1206 3300026041 Ga0207639_10070810 Ga0207639_100708102 392
1207 3300026078 Ga0207702_10001583 Ga0207702_100015838 392
1208 3300026116 Ga0207674_10074028 Ga0207674_100740282 392
1209 3300026142 Ga0207698_10012092 Ga0207698_100120922 392
1210 3300014968 Ga0157379_10094881 Ga0157379_100948812 393
1211 3300001976 JGI24752J21851_1000039 JGI24752J21851_10000399 394
1212 3300005331 Ga0070670_100000030 Ga0070670_100000030145 394
1213 3300005367 Ga0070667_100000161 Ga0070667_10000016112 394
1214 3300005618 Ga0068864_100000041 Ga0068864_100000041144 394
1215 3300005841 Ga0068863_100000035 Ga0068863_100000035144 394
1216 3300005844 Ga0068862_100000042 Ga0068862_10000004231 394
1217 3300005937 Ga0081455_10000131 Ga0081455_1000013132 394
1218 3300009011 Ga0105251_10000165 Ga0105251_1000016525 394
1219 3300025735 Ga0207713_1001365 Ga0207713_10013655 394
1220 3300025925 Ga0207650_10000111 Ga0207650_1000011184 394
1221 3300025986 Ga0207658_10000238 Ga0207658_1000023812 394
1222 3300026088 Ga0207641_10000041 Ga0207641_10000041143 394
1223 3300026095 Ga0207676_10000039 Ga0207676_1000003934 394
1224 3300028380 Ga0268265_10000061 Ga0268265_100000619 394
1225 3300048906 Ga0496103_0034979 Ga0496103_0034979_971_2248 394
1226 3300048920 Ga0496117_0019714 Ga0496117_0019714_3323_4600 394
1227 3300048921 Ga0496118_0000297 Ga0496118_0000297_42138_43415 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

183

413

0.98

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

1

72

0.98

PF02817

E3_binding

e3 binding domain

116

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9533 3 77
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9402 3 77
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.9399 1 77
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9367 1 77
3va7-assembly1.cif.gz_A crystal structure of the kluyveromyces lactis urea carboxylase 0.9334 1 77
ID Description Score Start End Superfamily
af_Q9FLQ4_93_170_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9849 3 79 2.40.50.100
af_Q8H107_76_169_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9849 2 79 2.40.50.100
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9828 5 77 2.40.50.100
af_A4I3X3_25_102_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9819 3 79 2.40.50.100
af_P0AFG6_2_81_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9639 1 80 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A6J4TNW2-F1-model_v4 Lipoyl-binding domain-containing protein 0.9838 1 79 GO:0006086
GO:0045254
AF-A0A6N2EAQ1-F1-model_v4 Lipoyl-binding domain-containing protein 0.9779 1 79 GO:0005737
GO:0016407
GO:0031405
AF-A0A6G6X4P7-F1-model_v4 2-oxoglutarate dehydrogenase E1 component (Alpha-ketoglutarate dehydrogenase) 0.9776 2 78 GO:0016624
AF-A0A2X2V770-F1-model_v4 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) 0.9736 191 294 GO:0004149
GO:0005829
GO:0006099
AF-A0A6J4TNW2-F1-model_v4 Lipoyl-binding domain-containing protein 0.9717 1 79 GO:0006086
GO:0045254

Feature Viewer

pLDDT pTM Quality
81.37 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map