F491941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1227 | 679 | 970 | 397 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10000597|Ga0081455_1000059731 |
| Length | 458 |
| Sequence | VISPLPLPGGKTQRSPPLGSLGQTDVAPQIPACCPDTLRGVTSIFFSKGALTMSSLTDAQHVAPMTSYEVSHGAVLRSLIIGLTAFLTVVDLFATQAILPSLTKAYGVMPAAMGFAVNASTFGMAIAGLAVGFLSPKIDRRFGVLISLVALAIPTTLLASAPNLAVFTALRVAQGLCMASAFTLTLAYLGEQCSAMDAGGAFAAYITGNVASNLIGRLISAAVADTFGLAANFYFFAALNLSGAVLVYFTLRGVRPMAMVAEGDTPFAALRAHLRDPSLRAAFAIGFCILFAFIGTFTFVNFVLVREPLSLDRMQLGWVYLVFLPSIVTTLMAGRVVNRIGTRAAIGGSLALAGLGLVFLLMRELPLVLAGMVLVAVGTFFAQAVATGFVGQTAQQSRGIASGVYLACYFLGGLAGTAVLGRLFDSFGWTACVMGVAGSLAAAAGLAPRLRPSTPDRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 6 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 9 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 10 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 11 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 19 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 20 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 21 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 22 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 23 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 24 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 25 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 26 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 27 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 28 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 29 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 30 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 31 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 32 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 33 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 34 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 35 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 36 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 37 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 38 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 39 | 2791355199 | |||
| 40 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 41 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 42 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 43 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 44 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 45 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 46 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 58 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 59 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 60 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 61 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 62 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 63 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 64 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 65 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 66 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 73 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 74 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 75 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 76 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 77 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 78 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 79 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 80 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 81 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 82 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 83 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 84 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 85 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 86 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 87 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 88 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 89 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 90 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 91 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 92 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 93 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 94 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 95 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 96 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 97 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 98 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 99 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 100 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 101 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 102 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 103 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 104 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 105 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 106 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 107 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 108 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 109 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 110 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 111 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 112 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 113 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 114 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 115 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 116 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 117 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 118 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 119 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 120 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 121 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 122 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 123 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 124 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 125 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 126 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 127 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 128 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 129 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 130 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 131 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 132 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 133 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 134 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 135 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 136 | 2904699407 | |||
| 137 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 138 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 139 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 140 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 141 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 142 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 143 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 144 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 145 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 146 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 147 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 148 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 149 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 150 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 151 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 152 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 153 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 154 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 155 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 156 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 157 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 158 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 159 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 160 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 161 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 162 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 163 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 164 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 165 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 166 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 167 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 168 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 169 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 170 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 171 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 172 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 173 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 174 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 175 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 176 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 177 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 178 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 179 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 180 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 181 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 182 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 183 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 184 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 185 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 186 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 187 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 188 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 189 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 190 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 191 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 192 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 193 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 194 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 195 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 196 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 197 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 198 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 199 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 200 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 201 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 202 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 203 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 204 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 205 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 206 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 207 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 208 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 209 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 210 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 211 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 212 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 213 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 214 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 215 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 216 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 217 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 218 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 219 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 220 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 221 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 222 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 223 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 224 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 225 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 226 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 227 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 228 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 229 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 230 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 231 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 232 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 233 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 234 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 235 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 236 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 238 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 239 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 240 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 241 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 242 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 243 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 244 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 245 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 246 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 247 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 248 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 249 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 250 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 252 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 255 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 256 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 258 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 268 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 270 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 271 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 278 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 279 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 280 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 281 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 283 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 284 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 285 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 286 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 288 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 289 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 293 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 294 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 295 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 296 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 298 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 299 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 300 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 301 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 302 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 303 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 304 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 305 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 306 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 307 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 308 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 309 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 310 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 311 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 312 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 313 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 314 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 315 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 316 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 317 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 318 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 319 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 320 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 321 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 323 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 324 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 325 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 326 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 327 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 328 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 329 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 330 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 331 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 333 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 334 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 335 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 344 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 345 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 347 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 348 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 359 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 360 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 362 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 363 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 364 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 365 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 366 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 367 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 368 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 372 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 373 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 375 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 431 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 432 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 433 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 434 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 436 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 440 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 441 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 442 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 443 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 444 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 445 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 446 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 447 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 448 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 449 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 450 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 451 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 452 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 453 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 454 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 455 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 456 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 457 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 458 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 459 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 460 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 461 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 462 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 463 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 464 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 465 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 466 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 467 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 468 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 469 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 470 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 471 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 472 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 473 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 474 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 475 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 476 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 477 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 478 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 479 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 480 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 481 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 482 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 483 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 484 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 485 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 486 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 558 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 559 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 560 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 561 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 562 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 563 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 564 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 565 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 566 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 567 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 568 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 569 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 570 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 571 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 572 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 573 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 574 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 575 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 576 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 577 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 578 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 579 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 580 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 581 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 585 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 586 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 587 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 588 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 591 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 592 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 594 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 595 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 596 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 608 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 609 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 610 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 611 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 612 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 613 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 614 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 615 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 616 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 617 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 618 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 619 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 620 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 621 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 622 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 623 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 624 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 629 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 630 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 631 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 632 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 633 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 634 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 635 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 636 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 637 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 638 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 639 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 640 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 641 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 642 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 643 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 644 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 645 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 646 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 647 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 648 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 649 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 650 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 651 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 652 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 653 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 654 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 655 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 657 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 658 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 659 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 660 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 661 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 662 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 663 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 664 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 665 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 666 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 667 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 668 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 669 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 670 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 671 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 672 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 673 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 674 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 675 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 676 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 677 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 678 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 679 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.02 |
| Metatranscriptomes | 0.16 |
| Isolates | 20.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.58 |
| Nodule | 16.79 |
| Rhizoplane | 5.05 |
| Rhizosphere | 63.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214770201 | 2209111006 | Bacteria | 2717 |
| 2 | ARcpr5yngRDRAFT_c000153 | 3300000043 | Bacteria | 11013 |
| 3 | ARSoilOldRDRAFT_c000159 | 3300000044 | Bacteria | 11417 |
| 4 | JGI24740J21852_10005779 | 3300001979 | Bacteria | 5197 |
| 5 | JGI24740J21852_10017985 | 3300001979 | Bacteria | 2517 |
| 6 | JGI24739J22299_10011157 | 3300001989 | Bacteria | 3320 |
| 7 | JGI24737J22298_10022085 | 3300001990 | Bacteria | 2022 |
| 8 | JGI24735J21928_10018519 | 3300002067 | Bacteria | 2146 |
| 9 | JGI25406J46586_10004853 | 3300003203 | Bacteria | 6250 |
| 10 | JGI25153J46596_10000132 | 3300003215 | Bacteria | 79600 |
| 11 | JGI25153J46596_10000884 | 3300003215 | Bacteria | 18219 |
| 12 | JGI25153J46596_10001525 | 3300003215 | Bacteria | 13779 |
| 13 | JGI25153J46596_10010116 | 3300003215 | Bacteria | 4300 |
| 14 | rootH2_10089381 | 3300003320 | Bacteria | 1929 |
| 15 | rootH1_10010522 | 3300003323 | Bacteria | 1752 |
| 16 | JGI25404J52841_10001159 | 3300003659 | Bacteria | 4478 |
| 17 | JGI25404J52841_10006470 | 3300003659 | Bacteria | 2453 |
| 18 | Ga0055531_10005753 | 3300003794 | Bacteria | 7182 |
| 19 | Ga0065165_1013172 | 3300005262 | Bacteria | 3307 |
| 20 | Ga0065165_1020027 | 3300005262 | Bacteria | 2370 |
| 21 | Ga0065704_10119026 | 3300005289 | Bacteria | 1806 |
| 22 | Ga0070658_10027153 | 3300005327 | Bacteria | 4596 |
| 23 | Ga0070690_100016506 | 3300005330 | Bacteria | 4425 |
| 24 | Ga0070670_100093365 | 3300005331 | Bacteria | 2588 |
| 25 | Ga0070666_10021842 | 3300005335 | Bacteria | 4150 |
| 26 | Ga0070680_100103460 | 3300005336 | Bacteria | 2366 |
| 27 | Ga0070680_100204894 | 3300005336 | Bacteria | 1664 |
| 28 | Ga0070680_100220727 | 3300005336 | Bacteria | 1600 |
| 29 | Ga0068868_100041625 | 3300005338 | Bacteria | 3579 |
| 30 | Ga0068868_100117797 | 3300005338 | Bacteria | 2164 |
| 31 | Ga0070660_100111925 | 3300005339 | Bacteria | 2173 |
| 32 | Ga0070689_100037348 | 3300005340 | Bacteria | 3714 |
| 33 | Ga0070661_100116134 | 3300005344 | Bacteria | 2002 |
| 34 | Ga0070661_100136708 | 3300005344 | Bacteria | 1845 |
| 35 | Ga0070668_100236870 | 3300005347 | Bacteria | 1511 |
| 36 | Ga0070669_100089650 | 3300005353 | Bacteria | 2304 |
| 37 | Ga0070675_100140491 | 3300005354 | Bacteria | 2064 |
| 38 | Ga0070671_100019458 | 3300005355 | Bacteria | 5526 |
| 39 | Ga0070671_100049175 | 3300005355 | Bacteria | 3509 |
| 40 | Ga0070671_100222670 | 3300005355 | Bacteria | 1600 |
| 41 | Ga0070674_100056827 | 3300005356 | Bacteria | 2714 |
| 42 | Ga0070673_100099740 | 3300005364 | Bacteria | 2389 |
| 43 | Ga0070673_100103631 | 3300005364 | Bacteria | 2348 |
| 44 | Ga0070659_100083201 | 3300005366 | Bacteria | 2558 |
| 45 | Ga0070667_100051633 | 3300005367 | Bacteria | 3467 |
| 46 | Ga0070709_10014253 | 3300005434 | Bacteria | 4494 |
| 47 | Ga0070714_100011902 | 3300005435 | Bacteria | 6919 |
| 48 | Ga0070714_100169183 | 3300005435 | Bacteria | 1982 |
| 49 | Ga0070713_100011978 | 3300005436 | Bacteria | 6344 |
| 50 | Ga0070713_100019042 | 3300005436 | Bacteria | 5229 |
| 51 | Ga0070713_100070534 | 3300005436 | Bacteria | 2950 |
| 52 | Ga0070713_100084740 | 3300005436 | Bacteria | 2713 |
| 53 | Ga0070713_100107094 | 3300005436 | Bacteria | 2431 |
| 54 | Ga0070710_10002383 | 3300005437 | Bacteria | 8899 |
| 55 | Ga0070710_10006619 | 3300005437 | Bacteria | 5571 |
| 56 | Ga0070710_10011141 | 3300005437 | Bacteria | 4436 |
| 57 | Ga0070710_10134207 | 3300005437 | Bacteria | 1512 |
| 58 | Ga0070711_100004924 | 3300005439 | Bacteria | 7928 |
| 59 | Ga0070711_100007381 | 3300005439 | Bacteria | 6687 |
| 60 | Ga0070711_100018280 | 3300005439 | Bacteria | 4472 |
| 61 | Ga0070705_100115440 | 3300005440 | Bacteria | 1724 |
| 62 | Ga0070708_100056305 | 3300005445 | Bacteria | 3497 |
| 63 | Ga0070663_100018999 | 3300005455 | Bacteria | 4520 |
| 64 | Ga0070663_100166097 | 3300005455 | Bacteria | 1702 |
| 65 | Ga0070678_100007290 | 3300005456 | Bacteria | 6549 |
| 66 | Ga0070678_100009926 | 3300005456 | Bacteria | 5788 |
| 67 | Ga0070678_100018567 | 3300005456 | Bacteria | 4509 |
| 68 | Ga0070662_100310017 | 3300005457 | Bacteria | 1284 |
| 69 | Ga0070681_10016111 | 3300005458 | Bacteria | 7451 |
| 70 | Ga0070681_10291672 | 3300005458 | Bacteria | 1541 |
| 71 | Ga0070685_10069110 | 3300005466 | Bacteria | 2088 |
| 72 | Ga0070706_100042684 | 3300005467 | Bacteria | 4190 |
| 73 | Ga0070706_100124731 | 3300005467 | Bacteria | 2401 |
| 74 | Ga0070698_100356962 | 3300005471 | Bacteria | 1393 |
| 75 | Ga0070699_100129129 | 3300005518 | Bacteria | 2227 |
| 76 | Ga0070679_100004347 | 3300005530 | Bacteria | 13087 |
| 77 | Ga0070684_100007310 | 3300005535 | Bacteria | 8582 |
| 78 | Ga0070697_100062643 | 3300005536 | Bacteria | 3036 |
| 79 | Ga0068853_100031588 | 3300005539 | Bacteria | 4479 |
| 80 | Ga0068853_100346679 | 3300005539 | Bacteria | 1381 |
| 81 | Ga0070672_100156434 | 3300005543 | Bacteria | 1888 |
| 82 | Ga0070672_100193010 | 3300005543 | Bacteria | 1701 |
| 83 | Ga0070686_100003943 | 3300005544 | Bacteria | 8159 |
| 84 | Ga0070695_100092429 | 3300005545 | Bacteria | 2023 |
| 85 | Ga0070696_100024719 | 3300005546 | Bacteria | 4083 |
| 86 | Ga0070696_100070185 | 3300005546 | Bacteria | 2464 |
| 87 | Ga0070693_100040355 | 3300005547 | Bacteria | 2620 |
| 88 | Ga0070665_100000767 | 3300005548 | Bacteria | 42433 |
| 89 | Ga0070665_100005441 | 3300005548 | Bacteria | 13132 |
| 90 | Ga0070665_100128801 | 3300005548 | Bacteria | 2533 |
| 91 | Ga0070665_100177873 | 3300005548 | Bacteria | 2128 |
| 92 | Ga0070665_100194716 | 3300005548 | Bacteria | 2028 |
| 93 | Ga0070665_100207191 | 3300005548 | Bacteria | 1962 |
| 94 | Ga0070665_100300953 | 3300005548 | Bacteria | 1607 |
| 95 | Ga0070704_100105605 | 3300005549 | Bacteria | 2133 |
| 96 | Ga0068855_100000006 | 3300005563 | Bacteria | 298092 |
| 97 | Ga0068855_100062964 | 3300005563 | Bacteria | 4329 |
| 98 | Ga0068855_100067922 | 3300005563 | Bacteria | 4151 |
| 99 | Ga0068855_100136732 | 3300005563 | Bacteria | 2795 |
| 100 | Ga0068855_100312069 | 3300005563 | Bacteria | 1740 |
| 101 | Ga0068855_100498275 | 3300005563 | Bacteria | 1324 |
| 102 | Ga0068854_100004568 | 3300005578 | Bacteria | 8728 |
| 103 | Ga0068856_100029401 | 3300005614 | Bacteria | 5368 |
| 104 | Ga0068856_100441838 | 3300005614 | Bacteria | 1321 |
| 105 | Ga0070702_100061499 | 3300005615 | Bacteria | 2187 |
| 106 | Ga0068852_100001922 | 3300005616 | Bacteria | 14156 |
| 107 | Ga0068852_100031085 | 3300005616 | Bacteria | 4401 |
| 108 | Ga0068852_100045552 | 3300005616 | Bacteria | 3732 |
| 109 | Ga0068852_100248147 | 3300005616 | Bacteria | 1704 |
| 110 | Ga0068859_100074094 | 3300005617 | Bacteria | 3443 |
| 111 | Ga0068859_100197207 | 3300005617 | Bacteria | 2098 |
| 112 | Ga0068859_100364428 | 3300005617 | Bacteria | 1540 |
| 113 | Ga0068864_100030673 | 3300005618 | Bacteria | 4558 |
| 114 | Ga0068864_100225316 | 3300005618 | Bacteria | 1731 |
| 115 | Ga0068866_10071692 | 3300005718 | Bacteria | 1833 |
| 116 | Ga0068861_100057800 | 3300005719 | Bacteria | 2963 |
| 117 | Ga0068861_100202004 | 3300005719 | Bacteria | 1669 |
| 118 | Ga0068851_10030723 | 3300005834 | Bacteria | 2665 |
| 119 | Ga0068863_100087457 | 3300005841 | Bacteria | 2952 |
| 120 | Ga0068863_100123046 | 3300005841 | Bacteria | 2475 |
| 121 | Ga0068858_100030613 | 3300005842 | Bacteria | 4997 |
| 122 | Ga0068858_100215097 | 3300005842 | Bacteria | 1819 |
| 123 | Ga0068858_100217665 | 3300005842 | Bacteria | 1808 |
| 124 | Ga0068858_100261472 | 3300005842 | Bacteria | 1645 |
| 125 | Ga0068858_100380920 | 3300005842 | Bacteria | 1354 |
| 126 | Ga0068860_100022255 | 3300005843 | Bacteria | 6134 |
| 127 | Ga0068860_100160031 | 3300005843 | Bacteria | 2171 |
| 128 | Ga0068860_100179134 | 3300005843 | Bacteria | 2049 |
| 129 | Ga0068860_100312200 | 3300005843 | Bacteria | 1542 |
| 130 | Ga0068862_100008935 | 3300005844 | Bacteria | 8295 |
| 131 | Ga0068862_100015601 | 3300005844 | Bacteria | 6311 |
| 132 | Ga0081455_10000479 | 3300005937 | Bacteria | 51768 |
| 133 | Ga0081455_10000597 | 3300005937 | Bacteria | 46858 |
| 134 | Ga0081455_10001978 | 3300005937 | Bacteria | 24467 |
| 135 | Ga0081455_10002720 | 3300005937 | Bacteria | 20867 |
| 136 | Ga0081455_10005841 | 3300005937 | Bacteria | 13387 |
| 137 | Ga0081455_10011587 | 3300005937 | Bacteria | 8850 |
| 138 | Ga0081455_10013535 | 3300005937 | Bacteria | 8045 |
| 139 | Ga0081455_10020968 | 3300005937 | Bacteria | 6140 |
| 140 | Ga0081455_10022033 | 3300005937 | Bacteria | 5965 |
| 141 | Ga0081455_10108891 | 3300005937 | Bacteria | 2205 |
| 142 | Ga0081455_10150556 | 3300005937 | Bacteria | 1795 |
| 143 | Ga0081540_1000703 | 3300005983 | Bacteria | 31069 |
| 144 | Ga0081540_1003793 | 3300005983 | Bacteria | 11827 |
| 145 | Ga0081540_1005364 | 3300005983 | Bacteria | 9592 |
| 146 | Ga0081540_1007737 | 3300005983 | Bacteria | 7610 |
| 147 | Ga0081540_1008055 | 3300005983 | Bacteria | 7409 |
| 148 | Ga0081540_1008398 | 3300005983 | Bacteria | 7218 |
| 149 | Ga0081540_1008775 | 3300005983 | Bacteria | 7026 |
| 150 | Ga0081540_1017077 | 3300005983 | Bacteria | 4509 |
| 151 | Ga0081540_1025914 | 3300005983 | Bacteria | 3361 |
| 152 | Ga0081540_1031323 | 3300005983 | Bacteria | 2927 |
| 153 | Ga0081540_1067510 | 3300005983 | Bacteria | 1671 |
| 154 | Ga0081540_1074391 | 3300005983 | Bacteria | 1557 |
| 155 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 156 | Ga0081539_10002228 | 3300005985 | Bacteria | 28275 |
| 157 | Ga0081539_10004536 | 3300005985 | Bacteria | 15239 |
| 158 | Ga0081539_10065465 | 3300005985 | Bacteria | 1974 |
| 159 | Ga0070717_10009288 | 3300006028 | Bacteria | 7391 |
| 160 | Ga0070717_10017426 | 3300006028 | Bacteria | 5589 |
| 161 | Ga0070717_10033651 | 3300006028 | Bacteria | 4135 |
| 162 | Ga0070717_10040159 | 3300006028 | Bacteria | 3811 |
| 163 | Ga0075365_10007353 | 3300006038 | Bacteria | 6160 |
| 164 | Ga0075368_10028132 | 3300006042 | Bacteria | 2171 |
| 165 | Ga0075363_100105989 | 3300006048 | Bacteria | 1559 |
| 166 | Ga0075364_10002835 | 3300006051 | Bacteria | 9762 |
| 167 | Ga0075364_10078265 | 3300006051 | Bacteria | 2183 |
| 168 | Ga0070716_100009774 | 3300006173 | Bacteria | 4793 |
| 169 | Ga0070712_100034943 | 3300006175 | Bacteria | 3409 |
| 170 | Ga0070712_100069405 | 3300006175 | Bacteria | 2514 |
| 171 | Ga0075362_10000592 | 3300006177 | Bacteria | 10626 |
| 172 | Ga0075367_10018665 | 3300006178 | Bacteria | 3832 |
| 173 | Ga0075367_10056354 | 3300006178 | Bacteria | 2334 |
| 174 | Ga0075369_10000268 | 3300006186 | Bacteria | 15479 |
| 175 | Ga0075366_10021583 | 3300006195 | Bacteria | 3743 |
| 176 | Ga0075366_10127288 | 3300006195 | Bacteria | 1536 |
| 177 | Ga0097621_100067278 | 3300006237 | Bacteria | 2953 |
| 178 | Ga0097621_100120396 | 3300006237 | Bacteria | 2226 |
| 179 | Ga0075370_10018948 | 3300006353 | Bacteria | 3738 |
| 180 | Ga0075370_10029395 | 3300006353 | Bacteria | 3061 |
| 181 | Ga0068871_100009687 | 3300006358 | Bacteria | 6994 |
| 182 | Ga0068871_100041919 | 3300006358 | Bacteria | 3672 |
| 183 | Ga0075428_100101489 | 3300006844 | Bacteria | 3136 |
| 184 | Ga0075430_100004132 | 3300006846 | Bacteria | 12251 |
| 185 | Ga0075430_100139853 | 3300006846 | Bacteria | 2016 |
| 186 | Ga0075431_100007365 | 3300006847 | Bacteria | 10959 |
| 187 | Ga0075431_100115054 | 3300006847 | Bacteria | 2776 |
| 188 | Ga0075433_10001633 | 3300006852 | Bacteria | 16644 |
| 189 | Ga0075433_10007265 | 3300006852 | Bacteria | 8779 |
| 190 | Ga0075433_10041337 | 3300006852 | Bacteria | 3994 |
| 191 | Ga0075434_100001874 | 3300006871 | Bacteria | 18197 |
| 192 | Ga0075434_100009598 | 3300006871 | Bacteria | 9034 |
| 193 | Ga0075434_100039468 | 3300006871 | Bacteria | 4678 |
| 194 | Ga0075434_100127116 | 3300006871 | Bacteria | 2566 |
| 195 | Ga0075434_100154603 | 3300006871 | Bacteria | 2313 |
| 196 | Ga0075429_100020847 | 3300006880 | Bacteria | 5688 |
| 197 | Ga0068865_100014777 | 3300006881 | Bacteria | 4968 |
| 198 | Ga0097620_100074094 | 3300006931 | Bacteria | 3443 |
| 199 | Ga0097620_100197210 | 3300006931 | Bacteria | 2098 |
| 200 | Ga0097620_100364417 | 3300006931 | Bacteria | 1540 |
| 201 | Ga0099823_1056234 | 3300006944 | Bacteria | 2203 |
| 202 | Ga0075435_100053578 | 3300007076 | Bacteria | 3253 |
| 203 | Ga0099794_10033208 | 3300007265 | Bacteria | 2426 |
| 204 | Ga0105251_10027458 | 3300009011 | Bacteria | 2886 |
| 205 | Ga0105240_10000080 | 3300009093 | Bacteria | 195633 |
| 206 | Ga0105240_10019955 | 3300009093 | Bacteria | 8950 |
| 207 | Ga0105240_10236563 | 3300009093 | Unclassified | 2119 |
| 208 | Ga0105240_10273743 | 3300009093 | Bacteria | 1943 |
| 209 | Ga0111539_10026475 | 3300009094 | Bacteria | 7090 |
| 210 | Ga0111539_10029217 | 3300009094 | Bacteria | 6718 |
| 211 | Ga0111539_10116263 | 3300009094 | Bacteria | 3136 |
| 212 | Ga0105245_10025672 | 3300009098 | Bacteria | 5181 |
| 213 | Ga0105245_10033787 | 3300009098 | Bacteria | 4533 |
| 214 | Ga0105245_10067141 | 3300009098 | Bacteria | 3248 |
| 215 | Ga0105247_10010363 | 3300009101 | Bacteria | 5637 |
| 216 | Ga0105247_10031058 | 3300009101 | Bacteria | 3240 |
| 217 | Ga0105247_10070391 | 3300009101 | Bacteria | 2185 |
| 218 | Ga0105247_10082847 | 3300009101 | Bacteria | 2025 |
| 219 | Ga0105247_10136163 | 3300009101 | Bacteria | 1605 |
| 220 | Ga0114129_10008567 | 3300009147 | Bacteria | 14580 |
| 221 | Ga0114129_10046902 | 3300009147 | Bacteria | 6073 |
| 222 | Ga0105243_10051407 | 3300009148 | Bacteria | 3260 |
| 223 | Ga0105243_10059810 | 3300009148 | Bacteria | 3042 |
| 224 | Ga0105243_10062079 | 3300009148 | Bacteria | 2991 |
| 225 | Ga0105241_10002269 | 3300009174 | Bacteria | 14448 |
| 226 | Ga0105241_10004292 | 3300009174 | Bacteria | 10545 |
| 227 | Ga0105241_10013031 | 3300009174 | Bacteria | 6096 |
| 228 | Ga0105241_10013273 | 3300009174 | Bacteria | 6038 |
| 229 | Ga0105241_10036380 | 3300009174 | Bacteria | 3704 |
| 230 | Ga0105241_10059230 | 3300009174 | Bacteria | 2944 |
| 231 | Ga0105241_10069409 | 3300009174 | Bacteria | 2732 |
| 232 | Ga0105241_10083649 | 3300009174 | Bacteria | 2504 |
| 233 | Ga0105248_10027112 | 3300009177 | Bacteria | 6374 |
| 234 | Ga0105248_10030358 | 3300009177 | Bacteria | 6034 |
| 235 | Ga0105248_10064482 | 3300009177 | Bacteria | 4113 |
| 236 | Ga0105237_10008317 | 3300009545 | Bacteria | 11257 |
| 237 | Ga0105237_10068809 | 3300009545 | Bacteria | 3534 |
| 238 | Ga0105237_10069211 | 3300009545 | Bacteria | 3525 |
| 239 | Ga0105237_10126084 | 3300009545 | Bacteria | 2554 |
| 240 | Ga0105237_10126256 | 3300009545 | Bacteria | 2553 |
| 241 | Ga0105237_10159030 | 3300009545 | Bacteria | 2257 |
| 242 | Ga0105238_10000677 | 3300009551 | Bacteria | 35835 |
| 243 | Ga0105238_10003618 | 3300009551 | Bacteria | 15406 |
| 244 | Ga0105238_10050080 | 3300009551 | Bacteria | 4205 |
| 245 | Ga0105238_10073339 | 3300009551 | Bacteria | 3418 |
| 246 | Ga0105238_10153401 | 3300009551 | Bacteria | 2278 |
| 247 | Ga0105238_10414624 | 3300009551 | Bacteria | 1341 |
| 248 | Ga0105249_10141900 | 3300009553 | Bacteria | 2304 |
| 249 | Ga0105249_10206766 | 3300009553 | Bacteria | 1924 |
| 250 | Ga0105249_10245812 | 3300009553 | Bacteria | 1771 |
| 251 | Ga0105249_10286132 | 3300009553 | Bacteria | 1648 |
| 252 | Ga0099796_10007245 | 3300010159 | Bacteria | 2890 |
| 253 | Ga0105239_10001550 | 3300010375 | Bacteria | 30371 |
| 254 | Ga0105239_10019302 | 3300010375 | Bacteria | 7530 |
| 255 | Ga0105239_10020128 | 3300010375 | Bacteria | 7362 |
| 256 | Ga0105239_10061277 | 3300010375 | Bacteria | 4129 |
| 257 | Ga0105239_10063147 | 3300010375 | Bacteria | 4066 |
| 258 | Ga0105239_10065977 | 3300010375 | Bacteria | 3977 |
| 259 | Ga0105239_10088255 | 3300010375 | Bacteria | 3420 |
| 260 | Ga0105239_10127209 | 3300010375 | Bacteria | 2833 |
| 261 | Ga0105239_10155796 | 3300010375 | Bacteria | 2551 |
| 262 | Ga0105239_10217294 | 3300010375 | Bacteria | 2143 |
| 263 | Ga0105239_10268688 | 3300010375 | Bacteria | 1918 |
| 264 | Ga0105239_10286979 | 3300010375 | Bacteria | 1853 |
| 265 | Ga0105239_10344223 | 3300010375 | Bacteria | 1683 |
| 266 | Ga0105239_10380867 | 3300010375 | Bacteria | 1595 |
| 267 | Ga0105239_10393554 | 3300010375 | Bacteria | 1568 |
| 268 | Ga0105246_10033761 | 3300011119 | Bacteria | 3403 |
| 269 | Ga0157370_10037994 | 3300013104 | Bacteria | 4660 |
| 270 | Ga0157369_10018062 | 3300013105 | Bacteria | 7911 |
| 271 | Ga0157374_10042893 | 3300013296 | Bacteria | 4176 |
| 272 | Ga0157378_10009779 | 3300013297 | Bacteria | 8358 |
| 273 | Ga0157378_10016311 | 3300013297 | Bacteria | 6506 |
| 274 | Ga0157378_10162229 | 3300013297 | Bacteria | 2091 |
| 275 | Ga0163162_10034244 | 3300013306 | Bacteria | 5054 |
| 276 | Ga0163162_10414419 | 3300013306 | Bacteria | 1479 |
| 277 | Ga0157372_10057946 | 3300013307 | Bacteria | 4330 |
| 278 | Ga0157375_10197011 | 3300013308 | Bacteria | 2169 |
| 279 | Ga0157375_10288331 | 3300013308 | Bacteria | 1804 |
| 280 | Ga0157375_10293625 | 3300013308 | Bacteria | 1789 |
| 281 | Ga0163163_10077645 | 3300014325 | Bacteria | 3316 |
| 282 | Ga0163163_10083737 | 3300014325 | Bacteria | 3195 |
| 283 | Ga0163163_10158222 | 3300014325 | Bacteria | 2310 |
| 284 | Ga0163163_10163606 | 3300014325 | Bacteria | 2271 |
| 285 | Ga0163163_10166764 | 3300014325 | Bacteria | 2249 |
| 286 | Ga0163163_10195679 | 3300014325 | Bacteria | 2069 |
| 287 | Ga0163163_10283800 | 3300014325 | Bacteria | 1707 |
| 288 | Ga0163163_10284851 | 3300014325 | Bacteria | 1704 |
| 289 | Ga0182008_10062630 | 3300014497 | Bacteria | 1833 |
| 290 | Ga0157379_10000395 | 3300014968 | Bacteria | 35355 |
| 291 | Ga0157379_10112274 | 3300014968 | Bacteria | 2449 |
| 292 | Ga0157379_10129585 | 3300014968 | Bacteria | 2270 |
| 293 | Ga0157376_10103217 | 3300014969 | Bacteria | 2496 |
| 294 | Ga0157376_10116919 | 3300014969 | Bacteria | 2357 |
| 295 | Ga0157376_10273498 | 3300014969 | Bacteria | 1588 |
| 296 | Ga0182007_10014866 | 3300015262 | Bacteria | 2919 |
| 297 | Ga0163161_10199605 | 3300017792 | Bacteria | 1541 |
| 298 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 299 | Ga0214544_1016901 | 3300021320 | Bacteria | 6824 |
| 300 | Ga0214542_1000606 | 3300021321 | Bacteria | 66272 |
| 301 | Ga0214542_1016862 | 3300021321 | Bacteria | 6884 |
| 302 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 303 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 304 | Ga0214543_1024357 | 3300021327 | Bacteria | 3765 |
| 305 | Ga0213876_10016173 | 3300021384 | Bacteria | 3943 |
| 306 | Ga0209677_100746 | 3300025253 | Bacteria | 16488 |
| 307 | Ga0209148_1001164 | 3300025254 | Bacteria | 15296 |
| 308 | Ga0209455_1003325 | 3300025272 | Bacteria | 5756 |
| 309 | Ga0209564_1019793 | 3300025295 | Bacteria | 2498 |
| 310 | Ga0209758_1000079 | 3300025297 | Bacteria | 262874 |
| 311 | Ga0209758_1000169 | 3300025297 | Bacteria | 149782 |
| 312 | Ga0209758_1000477 | 3300025297 | Bacteria | 66111 |
| 313 | Ga0209758_1002906 | 3300025297 | Bacteria | 16534 |
| 314 | Ga0209758_1004503 | 3300025297 | Bacteria | 11559 |
| 315 | Ga0209758_1004588 | 3300025297 | Bacteria | 11382 |
| 316 | Ga0209758_1005549 | 3300025297 | Bacteria | 9621 |
| 317 | Ga0209050_1008734 | 3300025298 | Bacteria | 5336 |
| 318 | Ga0209256_1010598 | 3300025299 | Bacteria | 3831 |
| 319 | Ga0207426_1000519 | 3300025302 | Bacteria | 56155 |
| 320 | Ga0207426_1002865 | 3300025302 | Bacteria | 10232 |
| 321 | Ga0209257_1001891 | 3300025304 | Bacteria | 22638 |
| 322 | Ga0209257_1004960 | 3300025304 | Bacteria | 9758 |
| 323 | Ga0207656_10033315 | 3300025321 | Unclassified | 2145 |
| 324 | Ga0207692_10003877 | 3300025898 | Bacteria | 5877 |
| 325 | Ga0207692_10012613 | 3300025898 | Bacteria | 3635 |
| 326 | Ga0207692_10026144 | 3300025898 | Bacteria | 2736 |
| 327 | Ga0207710_10015843 | 3300025900 | Bacteria | 3189 |
| 328 | Ga0207710_10020193 | 3300025900 | Bacteria | 2847 |
| 329 | Ga0207680_10002857 | 3300025903 | Bacteria | 8083 |
| 330 | Ga0207647_10010287 | 3300025904 | Bacteria | 6608 |
| 331 | Ga0207647_10017568 | 3300025904 | Bacteria | 4861 |
| 332 | Ga0207647_10058110 | 3300025904 | Bacteria | 2369 |
| 333 | Ga0207699_10004401 | 3300025906 | Bacteria | 6738 |
| 334 | Ga0207699_10004981 | 3300025906 | Bacteria | 6350 |
| 335 | Ga0207645_10160148 | 3300025907 | Bacteria | 1472 |
| 336 | Ga0207705_10033730 | 3300025909 | Bacteria | 3657 |
| 337 | Ga0207684_10028224 | 3300025910 | Bacteria | 4780 |
| 338 | Ga0207654_10000362 | 3300025911 | Bacteria | 26747 |
| 339 | Ga0207654_10012598 | 3300025911 | Bacteria | 4335 |
| 340 | Ga0207654_10134306 | 3300025911 | Bacteria | 1570 |
| 341 | Ga0207707_10000962 | 3300025912 | Bacteria | 27734 |
| 342 | Ga0207707_10199037 | 3300025912 | Bacteria | 1747 |
| 343 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 344 | Ga0207695_10046839 | 3300025913 | Bacteria | 4581 |
| 345 | Ga0207671_10012411 | 3300025914 | Bacteria | 6851 |
| 346 | Ga0207693_10003098 | 3300025915 | Bacteria | 14323 |
| 347 | Ga0207693_10012329 | 3300025915 | Bacteria | 6906 |
| 348 | Ga0207693_10031616 | 3300025915 | Bacteria | 4182 |
| 349 | Ga0207693_10114171 | 3300025915 | Bacteria | 2119 |
| 350 | Ga0207663_10010101 | 3300025916 | Bacteria | 5008 |
| 351 | Ga0207663_10205555 | 3300025916 | Bacteria | 1423 |
| 352 | Ga0207660_10096446 | 3300025917 | Bacteria | 2202 |
| 353 | Ga0207657_10051755 | 3300025919 | Bacteria | 3569 |
| 354 | Ga0207657_10078838 | 3300025919 | Bacteria | 2772 |
| 355 | Ga0207652_10008084 | 3300025921 | Bacteria | 8444 |
| 356 | Ga0207681_10165038 | 3300025923 | Bacteria | 1674 |
| 357 | Ga0207694_10000014 | 3300025924 | Bacteria | 374435 |
| 358 | Ga0207694_10003423 | 3300025924 | Bacteria | 12628 |
| 359 | Ga0207694_10008420 | 3300025924 | Bacteria | 7783 |
| 360 | Ga0207694_10116421 | 3300025924 | Bacteria | 2130 |
| 361 | Ga0207694_10177602 | 3300025924 | Bacteria | 1725 |
| 362 | Ga0207650_10026441 | 3300025925 | Bacteria | 4140 |
| 363 | Ga0207659_10109687 | 3300025926 | Bacteria | 2095 |
| 364 | Ga0207687_10011239 | 3300025927 | Bacteria | 5847 |
| 365 | Ga0207687_10030267 | 3300025927 | Bacteria | 3649 |
| 366 | Ga0207687_10144333 | 3300025927 | Bacteria | 1809 |
| 367 | Ga0207687_10269329 | 3300025927 | Bacteria | 1361 |
| 368 | Ga0207700_10002297 | 3300025928 | Bacteria | 10968 |
| 369 | Ga0207700_10043281 | 3300025928 | Bacteria | 3307 |
| 370 | Ga0207700_10160347 | 3300025928 | Bacteria | 1867 |
| 371 | Ga0207664_10007341 | 3300025929 | Bacteria | 7639 |
| 372 | Ga0207664_10012913 | 3300025929 | Bacteria | 5985 |
| 373 | Ga0207664_10226617 | 3300025929 | Bacteria | 1623 |
| 374 | Ga0207644_10011173 | 3300025931 | Bacteria | 5933 |
| 375 | Ga0207644_10083705 | 3300025931 | Bacteria | 2363 |
| 376 | Ga0207706_10025090 | 3300025933 | Bacteria | 5344 |
| 377 | Ga0207706_10029359 | 3300025933 | Bacteria | 4909 |
| 378 | Ga0207706_10140759 | 3300025933 | Bacteria | 2122 |
| 379 | Ga0207706_10163887 | 3300025933 | Bacteria | 1954 |
| 380 | Ga0207706_10176941 | 3300025933 | Bacteria | 1874 |
| 381 | Ga0207686_10013343 | 3300025934 | Bacteria | 4543 |
| 382 | Ga0207670_10044000 | 3300025936 | Bacteria | 2952 |
| 383 | Ga0207704_10139348 | 3300025938 | Bacteria | 1694 |
| 384 | Ga0207665_10012851 | 3300025939 | Bacteria | 5507 |
| 385 | Ga0207665_10015031 | 3300025939 | Bacteria | 5082 |
| 386 | Ga0207691_10152405 | 3300025940 | Bacteria | 2032 |
| 387 | Ga0207711_10015827 | 3300025941 | Bacteria | 6256 |
| 388 | Ga0207711_10066838 | 3300025941 | Bacteria | 3110 |
| 389 | Ga0207711_10079519 | 3300025941 | Bacteria | 2862 |
| 390 | Ga0207711_10322564 | 3300025941 | Bacteria | 1427 |
| 391 | Ga0207689_10021152 | 3300025942 | Bacteria | 5469 |
| 392 | Ga0207689_10087574 | 3300025942 | Bacteria | 2558 |
| 393 | Ga0207689_10126797 | 3300025942 | Bacteria | 2099 |
| 394 | Ga0207661_10132653 | 3300025944 | Bacteria | 2136 |
| 395 | Ga0207667_10000202 | 3300025949 | Bacteria | 86408 |
| 396 | Ga0207667_10090752 | 3300025949 | Bacteria | 3157 |
| 397 | Ga0207667_10189149 | 3300025949 | Bacteria | 2112 |
| 398 | Ga0207667_10387321 | 3300025949 | Bacteria | 1424 |
| 399 | Ga0207651_10081661 | 3300025960 | Bacteria | 2330 |
| 400 | Ga0207651_10268175 | 3300025960 | Bacteria | 1405 |
| 401 | Ga0207712_10031760 | 3300025961 | Bacteria | 3559 |
| 402 | Ga0207712_10042142 | 3300025961 | Bacteria | 3142 |
| 403 | Ga0207668_10000033 | 3300025972 | Bacteria | 121080 |
| 404 | Ga0207668_10092923 | 3300025972 | Bacteria | 2222 |
| 405 | Ga0207668_10294555 | 3300025972 | Bacteria | 1336 |
| 406 | Ga0207640_10198155 | 3300025981 | Bacteria | 1519 |
| 407 | Ga0207658_10001268 | 3300025986 | Bacteria | 19958 |
| 408 | Ga0207658_10052566 | 3300025986 | Bacteria | 3007 |
| 409 | Ga0207658_10093958 | 3300025986 | Bacteria | 2333 |
| 410 | Ga0207677_10077257 | 3300026023 | Bacteria | 2374 |
| 411 | Ga0207677_10164440 | 3300026023 | Bacteria | 1728 |
| 412 | Ga0207703_10053636 | 3300026035 | Bacteria | 3278 |
| 413 | Ga0207703_10160375 | 3300026035 | Bacteria | 1969 |
| 414 | Ga0207639_10103867 | 3300026041 | Bacteria | 2303 |
| 415 | Ga0207678_10004265 | 3300026067 | Bacteria | 12822 |
| 416 | Ga0207678_10031887 | 3300026067 | Bacteria | 4594 |
| 417 | Ga0207678_10050743 | 3300026067 | Bacteria | 3584 |
| 418 | Ga0207708_10078051 | 3300026075 | Bacteria | 2542 |
| 419 | Ga0207702_10006411 | 3300026078 | Bacteria | 10149 |
| 420 | Ga0207702_10049798 | 3300026078 | Bacteria | 3535 |
| 421 | Ga0207641_10063951 | 3300026088 | Bacteria | 3144 |
| 422 | Ga0207676_10021519 | 3300026095 | Bacteria | 4731 |
| 423 | Ga0207676_10068846 | 3300026095 | Bacteria | 2832 |
| 424 | Ga0207676_10172743 | 3300026095 | Bacteria | 1884 |
| 425 | Ga0207674_10161731 | 3300026116 | Bacteria | 2193 |
| 426 | Ga0207675_100004262 | 3300026118 | Bacteria | 13835 |
| 427 | Ga0207675_100071196 | 3300026118 | Bacteria | 3250 |
| 428 | Ga0207675_100212550 | 3300026118 | Bacteria | 1861 |
| 429 | Ga0207675_100231902 | 3300026118 | Bacteria | 1781 |
| 430 | Ga0207683_10014300 | 3300026121 | Bacteria | 6761 |
| 431 | Ga0207683_10017904 | 3300026121 | Bacteria | 6041 |
| 432 | Ga0207698_10003027 | 3300026142 | Bacteria | 10076 |
| 433 | Ga0207698_10058457 | 3300026142 | Bacteria | 2988 |
| 434 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 435 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 436 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 437 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 438 | Ga0209489_102003 | 3300027361 | Bacteria | 41928 |
| 439 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 440 | Ga0209588_1001310 | 3300027671 | Bacteria | 6471 |
| 441 | Ga0207428_10000141 | 3300027907 | Bacteria | 97064 |
| 442 | Ga0207428_10024101 | 3300027907 | Bacteria | 5110 |
| 443 | Ga0207428_10100379 | 3300027907 | Bacteria | 2237 |
| 444 | Ga0268266_10001064 | 3300028379 | Bacteria | 34416 |
| 445 | Ga0268266_10039534 | 3300028379 | Bacteria | 4018 |
| 446 | Ga0268266_10084516 | 3300028379 | Bacteria | 2771 |
| 447 | Ga0268266_10220068 | 3300028379 | Bacteria | 1745 |
| 448 | Ga0268266_10230442 | 3300028379 | Bacteria | 1706 |
| 449 | Ga0268265_10003494 | 3300028380 | Bacteria | 11255 |
| 450 | Ga0268265_10034906 | 3300028380 | Bacteria | 3669 |
| 451 | Ga0268265_10074523 | 3300028380 | Bacteria | 2655 |
| 452 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 453 | Ga0268264_10172450 | 3300028381 | Bacteria | 1957 |
| 454 | Ga0265334_10014054 | 3300028573 | Bacteria | 3343 |
| 455 | Ga0307515_10000121 | 3300028794 | Bacteria | 188657 |
| 456 | Ga0307511_10074407 | 3300030521 | Bacteria | 2448 |
| 457 | Ga0265340_10029401 | 3300031247 | Bacteria | 2760 |
| 458 | Ga0265327_10000359 | 3300031251 | Bacteria | 86745 |
| 459 | Ga0307513_10186349 | 3300031456 | Bacteria | 1932 |
| 460 | Ga0307408_100062279 | 3300031548 | Bacteria | 2726 |
| 461 | Ga0307508_10014365 | 3300031616 | Bacteria | 7224 |
| 462 | Ga0307508_10056557 | 3300031616 | Bacteria | 3473 |
| 463 | Ga0307508_10086954 | 3300031616 | Bacteria | 2710 |
| 464 | Ga0307405_10138910 | 3300031731 | Bacteria | 1691 |
| 465 | Ga0307407_10124419 | 3300031903 | Bacteria | 1640 |
| 466 | Ga0315911_1000015 | 3300033442 | Bacteria | 185247 |
| 467 | Ga0373938_0007345 | 3300034957 | Bacteria | 1935 |
| 468 | Ga0373926_0000112 | 3300035083 | Bacteria | 16360 |
| 469 | Ga0373926_0059385 | 3300035083 | Bacteria | 1392 |
| 470 | Ga0373944_0000117 | 3300035089 | Bacteria | 14831 |
| 471 | Ga0373949_0019325 | 3300035090 | Bacteria | 1551 |
| 472 | Ga0373952_0011540 | 3300035092 | Bacteria | 1725 |
| 473 | Ga0373923_0000131 | 3300035111 | Bacteria | 13932 |
| 474 | Ga0373923_0003454 | 3300035111 | Bacteria | 5067 |
| 475 | Ga0373923_0067501 | 3300035111 | Bacteria | 1530 |
| 476 | Ga0373936_0017475 | 3300035113 | Bacteria | 2762 |
| 477 | Ga0373945_0000318 | 3300035116 | Bacteria | 13708 |
| 478 | Ga0373953_0014930 | 3300035117 | Bacteria | 2803 |
| 479 | Ga0373954_0000600 | 3300035118 | Bacteria | 13674 |
| 480 | Ga0373954_0004094 | 3300035118 | Bacteria | 6249 |
| 481 | Ga0373957_0002034 | 3300035120 | Bacteria | 5661 |
| 482 | Ga0373957_0022745 | 3300035120 | Bacteria | 2236 |
| 483 | Ga0373957_0035902 | 3300035120 | Bacteria | 1844 |
| 484 | Ga0373943_0026878 | 3300035170 | Bacteria | 2699 |
| 485 | Ga0373946_0000433 | 3300035171 | Bacteria | 13673 |
| 486 | Ga0373946_0007217 | 3300035171 | Bacteria | 4056 |
| 487 | Ga0373924_0003004 | 3300035410 | Bacteria | 5739 |
| 488 | Ga0373924_0022390 | 3300035410 | Bacteria | 2471 |
| 489 | Ga0373931_0001099 | 3300035691 | Bacteria | 11481 |
| 490 | Ga0373931_0002375 | 3300035691 | Bacteria | 8328 |
| 491 | Ga0373931_0054255 | 3300035691 | Bacteria | 2142 |
| 492 | Ga0373935_0006788 | 3300035692 | Bacteria | 6838 |
| 493 | Ga0373935_0031439 | 3300035692 | Bacteria | 3294 |
| 494 | Ga0373935_0041660 | 3300035692 | Bacteria | 2886 |
| 495 | Ga0373935_0042112 | 3300035692 | Bacteria | 2871 |
| 496 | Ga0373927_0002771 | 3300035695 | Bacteria | 12795 |
| 497 | Ga0373927_0011590 | 3300035695 | Bacteria | 5872 |
| 498 | Ga0373927_0030797 | 3300035695 | Bacteria | 3500 |
| 499 | Ga0373927_0035904 | 3300035695 | Bacteria | 3225 |
| 500 | Ga0373927_0066987 | 3300035695 | Bacteria | 2323 |
| 501 | Ga0373927_0238209 | 3300035695 | Bacteria | 1196 |
| 502 | Ga0373933_0002820 | 3300035724 | Bacteria | 9707 |
| 503 | Ga0373933_0010022 | 3300035724 | Bacteria | 5187 |
| 504 | Ga0373947_0001734 | 3300035725 | Bacteria | 13338 |
| 505 | Ga0373947_0002867 | 3300035725 | Bacteria | 10303 |
| 506 | Ga0373947_0007909 | 3300035725 | Bacteria | 6130 |
| 507 | Ga0373937_0010847 | 3300036401 | Bacteria | 7975 |
| 508 | Ga0373937_0013664 | 3300036401 | Bacteria | 7154 |
| 509 | Ga0373937_0028390 | 3300036401 | Bacteria | 5063 |
| 510 | Ga0373937_0035546 | 3300036401 | Bacteria | 4536 |
| 511 | Ga0373937_0076740 | 3300036401 | Bacteria | 3086 |
| 512 | Ga0373937_0095760 | 3300036401 | Bacteria | 2752 |
| 513 | Ga0373937_0096910 | 3300036401 | Bacteria | 2735 |
| 514 | Ga0373937_0228637 | 3300036401 | Bacteria | 1751 |
| 515 | Ga0373937_0355813 | 3300036401 | Bacteria | 1387 |
| 516 | Ga0373925_0001112 | 3300037068 | Bacteria | 23957 |
| 517 | Ga0373925_0002792 | 3300037068 | Bacteria | 13797 |
| 518 | Ga0373925_0030889 | 3300037068 | Bacteria | 3934 |
| 519 | Ga0373925_0038208 | 3300037068 | Bacteria | 3548 |
| 520 | Ga0373925_0058587 | 3300037068 | Bacteria | 2888 |
| 521 | Ga0373925_0157260 | 3300037068 | Bacteria | 1788 |
| 522 | Ga0373925_0203408 | 3300037068 | Bacteria | 1575 |
| 523 | Ga0395900_0108032 | 3300037418 | Bacteria | 2859 |
| 524 | Ga0395905_0004064 | 3300037471 | Bacteria | 15340 |
| 525 | Ga0395905_0020297 | 3300037471 | Bacteria | 6295 |
| 526 | Ga0395905_0025863 | 3300037471 | Bacteria | 5532 |
| 527 | Ga0395905_0039141 | 3300037471 | Bacteria | 4448 |
| 528 | Ga0395905_0098816 | 3300037471 | Bacteria | 2741 |
| 529 | Ga0395901_0008600 | 3300038443 | Bacteria | 10318 |
| 530 | Ga0436365_1269767 | 3300039437 | Bacteria | 15018 |
| 531 | Ga0436365_1361869 | 3300039437 | Bacteria | 9721 |
| 532 | Ga0436360_0251089 | 3300039438 | Bacteria | 4507 |
| 533 | Ga0436360_0806801 | 3300039438 | Bacteria | 1669 |
| 534 | Ga0436361_0820451 | 3300039447 | Bacteria | 3335 |
| 535 | Ga0436363_1351751 | 3300039450 | Bacteria | 9321 |
| 536 | Ga0436362_0524297 | 3300039453 | Bacteria | 4315 |
| 537 | Ga0436362_0601100 | 3300039453 | Bacteria | 4202 |
| 538 | Ga0451795_0980836 | 3300041456 | Bacteria | 1424 |
| 539 | Ga0439458_0007286 | 3300042157 | Bacteria | 2462 |
| 540 | Ga0439459_0018515 | 3300042438 | Bacteria | 1309 |
| 541 | Ga0466972_0000850 | 3300044658 | Bacteria | 14632 |
| 542 | Ga0466972_0008407 | 3300044658 | Bacteria | 5175 |
| 543 | Ga0466960_0026844 | 3300044901 | Bacteria | 2620 |
| 544 | Ga0466960_0078755 | 3300044901 | Bacteria | 1655 |
| 545 | Ga0451576_0121035 | 3300045051 | Bacteria | 2725 |
| 546 | Ga0466967_0003126 | 3300045976 | Bacteria | 10658 |
| 547 | Ga0495592_0001758 | 3300046454 | Bacteria | 15240 |
| 548 | Ga0495592_0005289 | 3300046454 | Bacteria | 9514 |
| 549 | Ga0495603_0000183 | 3300046455 | Bacteria | 32300 |
| 550 | Ga0495603_0014702 | 3300046455 | Bacteria | 4732 |
| 551 | Ga0495603_0015327 | 3300046455 | Bacteria | 4638 |
| 552 | Ga0495603_0046067 | 3300046455 | Bacteria | 2599 |
| 553 | Ga0495629_0000585 | 3300046459 | Bacteria | 29571 |
| 554 | Ga0495629_0002289 | 3300046459 | Bacteria | 14763 |
| 555 | Ga0495629_0002778 | 3300046459 | Bacteria | 13377 |
| 556 | Ga0495629_0006344 | 3300046459 | Bacteria | 8773 |
| 557 | Ga0495629_0010123 | 3300046459 | Bacteria | 6876 |
| 558 | Ga0495629_0027490 | 3300046459 | Bacteria | 4039 |
| 559 | Ga0495638_0004117 | 3300046460 | Bacteria | 11125 |
| 560 | Ga0495638_0007340 | 3300046460 | Bacteria | 7912 |
| 561 | Ga0495638_0013934 | 3300046460 | Bacteria | 5454 |
| 562 | Ga0495638_0016915 | 3300046460 | Bacteria | 4875 |
| 563 | Ga0495641_0009829 | 3300046461 | Bacteria | 5635 |
| 564 | Ga0495641_0043522 | 3300046461 | Bacteria | 2076 |
| 565 | Ga0495651_0003868 | 3300046462 | Bacteria | 11450 |
| 566 | Ga0495651_0030168 | 3300046462 | Bacteria | 4228 |
| 567 | Ga0495651_0031330 | 3300046462 | Bacteria | 4147 |
| 568 | Ga0495653_0000404 | 3300046463 | Bacteria | 34649 |
| 569 | Ga0495653_0004843 | 3300046463 | Bacteria | 10913 |
| 570 | Ga0495653_0035602 | 3300046463 | Bacteria | 3927 |
| 571 | Ga0495580_0001167 | 3300046472 | Bacteria | 23111 |
| 572 | Ga0495582_0000625 | 3300046473 | Bacteria | 19484 |
| 573 | Ga0495582_0002024 | 3300046473 | Bacteria | 11363 |
| 574 | Ga0495582_0012870 | 3300046473 | Bacteria | 4609 |
| 575 | Ga0495639_0000075 | 3300046475 | Bacteria | 46617 |
| 576 | Ga0495639_0002778 | 3300046475 | Bacteria | 7608 |
| 577 | Ga0495639_0009632 | 3300046475 | Bacteria | 4145 |
| 578 | Ga0495639_0016556 | 3300046475 | Bacteria | 3201 |
| 579 | Ga0495662_0006110 | 3300046476 | Bacteria | 6019 |
| 580 | Ga0495662_0012265 | 3300046476 | Bacteria | 4185 |
| 581 | Ga0495664_0001938 | 3300046477 | Bacteria | 11029 |
| 582 | Ga0495664_0002309 | 3300046477 | Bacteria | 10221 |
| 583 | Ga0495664_0007514 | 3300046477 | Bacteria | 6059 |
| 584 | Ga0495664_0027419 | 3300046477 | Bacteria | 3321 |
| 585 | Ga0495584_0008302 | 3300046491 | Bacteria | 5379 |
| 586 | Ga0495585_0000943 | 3300046492 | Bacteria | 24521 |
| 587 | Ga0495594_0000120 | 3300046499 | Bacteria | 36823 |
| 588 | Ga0495594_0002491 | 3300046499 | Bacteria | 9593 |
| 589 | Ga0495607_0004889 | 3300046501 | Bacteria | 9750 |
| 590 | Ga0495583_0074913 | 3300046506 | Unclassified | 1481 |
| 591 | Ga0495606_0024526 | 3300046507 | Bacteria | 4343 |
| 592 | Ga0495608_0013850 | 3300046511 | Bacteria | 5596 |
| 593 | Ga0495608_0019535 | 3300046511 | Bacteria | 4662 |
| 594 | Ga0495608_0046826 | 3300046511 | Bacteria | 2876 |
| 595 | Ga0495618_0029855 | 3300046514 | Bacteria | 3403 |
| 596 | Ga0495628_0023196 | 3300046516 | Bacteria | 5095 |
| 597 | Ga0495628_0028560 | 3300046516 | Bacteria | 4530 |
| 598 | Ga0495628_0038186 | 3300046516 | Bacteria | 3845 |
| 599 | Ga0495630_0001312 | 3300046517 | Bacteria | 17112 |
| 600 | Ga0495630_0006828 | 3300046517 | Bacteria | 8138 |
| 601 | Ga0495631_0019215 | 3300046518 | Bacteria | 3206 |
| 602 | Ga0495643_0030555 | 3300046522 | Bacteria | 3007 |
| 603 | Ga0495644_0000565 | 3300046523 | Bacteria | 15558 |
| 604 | Ga0495663_0024935 | 3300046525 | Bacteria | 1741 |
| 605 | Ga0495666_0005200 | 3300046526 | Bacteria | 6568 |
| 606 | Ga0495642_0062124 | 3300046528 | Bacteria | 1551 |
| 607 | Ga0495652_0010990 | 3300046529 | Bacteria | 8204 |
| 608 | Ga0495652_0055968 | 3300046529 | Bacteria | 3352 |
| 609 | Ga0495652_0072645 | 3300046529 | Bacteria | 2866 |
| 610 | Ga0495665_0000085 | 3300046531 | Bacteria | 41455 |
| 611 | Ga0495665_0001252 | 3300046531 | Bacteria | 13525 |
| 612 | Ga0495640_0000210 | 3300046533 | Bacteria | 38945 |
| 613 | Ga0495640_0026242 | 3300046533 | Bacteria | 4212 |
| 614 | Ga0495640_0057745 | 3300046533 | Bacteria | 2648 |
| 615 | Ga0495640_0084696 | 3300046533 | Bacteria | 2102 |
| 616 | Ga0495640_0144985 | 3300046533 | Bacteria | 1528 |
| 617 | Ga0495586_0006149 | 3300046535 | Bacteria | 6417 |
| 618 | Ga0495598_0009037 | 3300046537 | Bacteria | 2341 |
| 619 | Ga0495609_0073708 | 3300046538 | Bacteria | 1497 |
| 620 | Ga0495621_0019410 | 3300046539 | Bacteria | 2219 |
| 621 | Ga0495645_0006472 | 3300046543 | Bacteria | 8128 |
| 622 | Ga0495645_0046341 | 3300046543 | Bacteria | 3169 |
| 623 | Ga0495645_0157895 | 3300046543 | Bacteria | 1570 |
| 624 | Ga0495622_0001140 | 3300046557 | Bacteria | 13849 |
| 625 | Ga0495622_0001209 | 3300046557 | Bacteria | 13287 |
| 626 | Ga0495622_0005529 | 3300046557 | Bacteria | 5859 |
| 627 | Ga0495622_0020270 | 3300046557 | Bacteria | 3096 |
| 628 | Ga0495622_0067945 | 3300046557 | Bacteria | 1646 |
| 629 | Ga0495633_0010513 | 3300046558 | Bacteria | 5045 |
| 630 | Ga0495667_0010297 | 3300046559 | Bacteria | 6326 |
| 631 | Ga0495667_0079624 | 3300046559 | Bacteria | 2130 |
| 632 | Ga0495656_0000718 | 3300046615 | Bacteria | 10695 |
| 633 | Ga0495656_0015466 | 3300046615 | Bacteria | 2880 |
| 634 | Ga0495634_0000064 | 3300046642 | Bacteria | 85710 |
| 635 | Ga0495634_0029550 | 3300046642 | Bacteria | 3793 |
| 636 | Ga0495634_0038079 | 3300046642 | Bacteria | 3280 |
| 637 | Ga0495634_0062139 | 3300046642 | Bacteria | 2481 |
| 638 | Ga0495634_0128297 | 3300046642 | Bacteria | 1619 |
| 639 | Ga0495611_0002127 | 3300046648 | Bacteria | 9265 |
| 640 | Ga0495625_0054128 | 3300046660 | Bacteria | 2867 |
| 641 | Ga0495625_0162567 | 3300046660 | Bacteria | 1495 |
| 642 | Ga0495635_0000316 | 3300046663 | Bacteria | 31407 |
| 643 | Ga0495635_0003249 | 3300046663 | Bacteria | 11213 |
| 644 | Ga0495635_0005996 | 3300046663 | Bacteria | 8479 |
| 645 | Ga0495635_0140531 | 3300046663 | Bacteria | 1645 |
| 646 | Ga0495635_0156185 | 3300046663 | Bacteria | 1553 |
| 647 | Ga0495659_0001109 | 3300046664 | Bacteria | 9377 |
| 648 | Ga0495659_0016606 | 3300046664 | Bacteria | 2431 |
| 649 | Ga0495661_0025457 | 3300046665 | Bacteria | 3821 |
| 650 | Ga0495588_0001783 | 3300046674 | Bacteria | 9172 |
| 651 | Ga0495588_0037158 | 3300046674 | Bacteria | 2473 |
| 652 | Ga0495657_0002292 | 3300046675 | Bacteria | 16171 |
| 653 | Ga0495657_0078810 | 3300046675 | Bacteria | 2134 |
| 654 | Ga0495599_0008570 | 3300046678 | Bacteria | 6225 |
| 655 | Ga0495599_0034703 | 3300046678 | Bacteria | 3168 |
| 656 | Ga0495623_0033774 | 3300046679 | Bacteria | 3283 |
| 657 | Ga0495623_0122639 | 3300046679 | Bacteria | 1563 |
| 658 | Ga0495646_0012099 | 3300046680 | Bacteria | 5487 |
| 659 | Ga0495646_0012566 | 3300046680 | Bacteria | 5380 |
| 660 | Ga0495646_0027050 | 3300046680 | Bacteria | 3600 |
| 661 | Ga0495647_0000458 | 3300046681 | Bacteria | 11752 |
| 662 | Ga0495647_0001656 | 3300046681 | Bacteria | 6898 |
| 663 | Ga0495647_0009459 | 3300046681 | Bacteria | 3303 |
| 664 | Ga0495658_0006005 | 3300046683 | Bacteria | 5961 |
| 665 | Ga0495658_0012805 | 3300046683 | Bacteria | 4258 |
| 666 | Ga0495658_0018258 | 3300046683 | Bacteria | 3643 |
| 667 | Ga0495613_0000290 | 3300046689 | Bacteria | 46122 |
| 668 | Ga0495613_0001871 | 3300046689 | Bacteria | 15980 |
| 669 | Ga0495613_0029334 | 3300046689 | Bacteria | 4090 |
| 670 | Ga0495613_0067259 | 3300046689 | Bacteria | 2616 |
| 671 | Ga0495624_0001019 | 3300046690 | Bacteria | 22166 |
| 672 | Ga0495624_0004102 | 3300046690 | Bacteria | 10715 |
| 673 | Ga0495624_0081568 | 3300046690 | Bacteria | 2003 |
| 674 | Ga0495670_0002874 | 3300046691 | Bacteria | 8503 |
| 675 | Ga0495589_0033890 | 3300046794 | Bacteria | 2563 |
| 676 | Ga0495600_0001374 | 3300046809 | Bacteria | 13435 |
| 677 | Ga0495600_0002145 | 3300046809 | Bacteria | 11183 |
| 678 | Ga0495600_0104438 | 3300046809 | Bacteria | 1846 |
| 679 | Ga0495581_0000014 | 3300047315 | Bacteria | 60735 |
| 680 | Ga0495581_0001425 | 3300047315 | Bacteria | 13268 |
| 681 | Ga0495581_0008984 | 3300047315 | Bacteria | 5782 |
| 682 | Ga0495581_0046986 | 3300047315 | Bacteria | 2495 |
| 683 | Ga0495604_0016273 | 3300047317 | Bacteria | 5943 |
| 684 | Ga0495604_0024989 | 3300047317 | Bacteria | 4762 |
| 685 | Ga0495604_0038331 | 3300047317 | Bacteria | 3770 |
| 686 | Ga0495604_0045111 | 3300047317 | Bacteria | 3441 |
| 687 | Ga0495636_0079051 | 3300047318 | Bacteria | 1414 |
| 688 | Ga0495674_0003302 | 3300047319 | Bacteria | 15671 |
| 689 | Ga0495674_0017430 | 3300047319 | Bacteria | 6681 |
| 690 | Ga0495674_0042848 | 3300047319 | Bacteria | 4033 |
| 691 | Ga0495676_0035424 | 3300047321 | Bacteria | 4174 |
| 692 | Ga0495680_0000920 | 3300047322 | Bacteria | 32673 |
| 693 | Ga0495680_0004774 | 3300047322 | Bacteria | 12866 |
| 694 | Ga0495680_0008385 | 3300047322 | Bacteria | 9400 |
| 695 | Ga0495680_0013405 | 3300047322 | Bacteria | 7152 |
| 696 | Ga0495680_0035330 | 3300047322 | Bacteria | 4026 |
| 697 | Ga0495680_0225335 | 3300047322 | Bacteria | 1337 |
| 698 | Ga0495687_017251 | 3300047443 | Bacteria | 3607 |
| 699 | Ga0495687_048053 | 3300047443 | Bacteria | 1833 |
| 700 | Ga0495675_0028151 | 3300047444 | Bacteria | 3582 |
| 701 | Ga0495679_029239 | 3300047446 | Bacteria | 1799 |
| 702 | Ga0495684_0003681 | 3300047471 | Bacteria | 11952 |
| 703 | Ga0495684_0064910 | 3300047471 | Bacteria | 2775 |
| 704 | Ga0495684_0121630 | 3300047471 | Bacteria | 1965 |
| 705 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 706 | Ga0495593_0000567 | 3300047673 | Bacteria | 21016 |
| 707 | Ga0495602_0000619 | 3300048088 | Bacteria | 33402 |
| 708 | Ga0495602_0003728 | 3300048088 | Bacteria | 15826 |
| 709 | Ga0495602_0134900 | 3300048088 | Bacteria | 1963 |
| 710 | Ga0495614_0001621 | 3300048089 | Bacteria | 9805 |
| 711 | Ga0495614_0003091 | 3300048089 | Bacteria | 7417 |
| 712 | Ga0496100_0024359 | 3300048903 | Bacteria | 3691 |
| 713 | Ga0496100_0098409 | 3300048903 | Bacteria | 2011 |
| 714 | Ga0496101_0146657 | 3300048904 | Bacteria | 1802 |
| 715 | Ga0496102_0012597 | 3300048905 | Bacteria | 7326 |
| 716 | Ga0496102_0171491 | 3300048905 | Bacteria | 2042 |
| 717 | Ga0496103_0013673 | 3300048906 | Bacteria | 4815 |
| 718 | Ga0496103_0015202 | 3300048906 | Bacteria | 4576 |
| 719 | Ga0496103_0031264 | 3300048906 | Bacteria | 3242 |
| 720 | Ga0496103_0037885 | 3300048906 | Bacteria | 2957 |
| 721 | Ga0496104_0017710 | 3300048907 | Bacteria | 6494 |
| 722 | Ga0496104_0023289 | 3300048907 | Bacteria | 5693 |
| 723 | Ga0496104_0055220 | 3300048907 | Bacteria | 3755 |
| 724 | Ga0496104_0079256 | 3300048907 | Bacteria | 3130 |
| 725 | Ga0496104_0092644 | 3300048907 | Bacteria | 2889 |
| 726 | Ga0496104_0115499 | 3300048907 | Bacteria | 2575 |
| 727 | Ga0496105_0022475 | 3300048908 | Bacteria | 5108 |
| 728 | Ga0496106_0002346 | 3300048909 | Bacteria | 14105 |
| 729 | Ga0496106_0017681 | 3300048909 | Bacteria | 5273 |
| 730 | Ga0496106_0067734 | 3300048909 | Bacteria | 2722 |
| 731 | Ga0496106_0193301 | 3300048909 | Bacteria | 1618 |
| 732 | Ga0496107_0024125 | 3300048910 | Bacteria | 4301 |
| 733 | Ga0496107_0261401 | 3300048910 | Bacteria | 1288 |
| 734 | Ga0496108_0031446 | 3300048911 | Bacteria | 4405 |
| 735 | Ga0496108_0042515 | 3300048911 | Bacteria | 3794 |
| 736 | Ga0496108_0100688 | 3300048911 | Bacteria | 2465 |
| 737 | Ga0496109_0037236 | 3300048912 | Bacteria | 4395 |
| 738 | Ga0496109_0041700 | 3300048912 | Bacteria | 4157 |
| 739 | Ga0496109_0055081 | 3300048912 | Bacteria | 3628 |
| 740 | Ga0496109_0270154 | 3300048912 | Bacteria | 1602 |
| 741 | Ga0496110_0005345 | 3300048913 | Bacteria | 10062 |
| 742 | Ga0496110_0015600 | 3300048913 | Bacteria | 6326 |
| 743 | Ga0496110_0074582 | 3300048913 | Bacteria | 3013 |
| 744 | Ga0496110_0104702 | 3300048913 | Bacteria | 2538 |
| 745 | Ga0496110_0137941 | 3300048913 | Bacteria | 2205 |
| 746 | Ga0496110_0339174 | 3300048913 | Bacteria | 1369 |
| 747 | Ga0496111_0029072 | 3300048914 | Bacteria | 3922 |
| 748 | Ga0496111_0094900 | 3300048914 | Bacteria | 2188 |
| 749 | Ga0496111_0108637 | 3300048914 | Bacteria | 2042 |
| 750 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 751 | Ga0496112_0001615 | 3300048915 | Bacteria | 17438 |
| 752 | Ga0496112_0008849 | 3300048915 | Bacteria | 9033 |
| 753 | Ga0496112_0025987 | 3300048915 | Bacteria | 5628 |
| 754 | Ga0496112_0038338 | 3300048915 | Bacteria | 4678 |
| 755 | Ga0496112_0039611 | 3300048915 | Bacteria | 4606 |
| 756 | Ga0496112_0082009 | 3300048915 | Bacteria | 3190 |
| 757 | Ga0496112_0096063 | 3300048915 | Bacteria | 2934 |
| 758 | Ga0496112_0121832 | 3300048915 | Bacteria | 2578 |
| 759 | Ga0496113_0014198 | 3300048916 | Bacteria | 5425 |
| 760 | Ga0496113_0034090 | 3300048916 | Bacteria | 3712 |
| 761 | Ga0496113_0038768 | 3300048916 | Bacteria | 3504 |
| 762 | Ga0496113_0041498 | 3300048916 | Bacteria | 3396 |
| 763 | Ga0496113_0049675 | 3300048916 | Bacteria | 3124 |
| 764 | Ga0496113_0256887 | 3300048916 | Bacteria | 1396 |
| 765 | Ga0496113_0280867 | 3300048916 | Bacteria | 1331 |
| 766 | Ga0496114_0002810 | 3300048917 | Bacteria | 13341 |
| 767 | Ga0496114_0024532 | 3300048917 | Bacteria | 4924 |
| 768 | Ga0496114_0081861 | 3300048917 | Bacteria | 2728 |
| 769 | Ga0496115_0183672 | 3300048918 | Bacteria | 1728 |
| 770 | Ga0496115_0205737 | 3300048918 | Bacteria | 1626 |
| 771 | Ga0496118_0003678 | 3300048921 | Bacteria | 19028 |
| 772 | Ga0496118_0042068 | 3300048921 | Bacteria | 3609 |
| 773 | Ga0496119_0071576 | 3300048922 | Bacteria | 2029 |
| 774 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 775 | Ga0496121_0054782 | 3300048924 | Bacteria | 3329 |
| 776 | Ga0496121_0068548 | 3300048924 | Bacteria | 2869 |
| 777 | Ga0496122_0001094 | 3300048925 | Bacteria | 46993 |
| 778 | Ga0496123_0001198 | 3300048926 | Bacteria | 38067 |
| 779 | Ga0496123_0136243 | 3300048926 | Bacteria | 1351 |
| 780 | Ga0496123_0153368 | 3300048926 | Bacteria | 1239 |
| 781 | Ga0496124_0011558 | 3300048927 | Bacteria | 8810 |
| 782 | Ga0496124_0080696 | 3300048927 | Bacteria | 2676 |
| 783 | Ga0496125_0039946 | 3300048928 | Bacteria | 4032 |
| 784 | Ga0496125_0092132 | 3300048928 | Bacteria | 2267 |
| 785 | Ga0496125_0162414 | 3300048928 | Bacteria | 1515 |
| 786 | Ga0496126_0003109 | 3300048929 | Bacteria | 21428 |
| 787 | Ga0496126_0016607 | 3300048929 | Bacteria | 7357 |
| 788 | Ga0496126_0022299 | 3300048929 | Bacteria | 6164 |
| 789 | Ga0496126_0056273 | 3300048929 | Bacteria | 3556 |
| 790 | Ga0496126_0075527 | 3300048929 | Bacteria | 2991 |
| 791 | Ga0495682_0000505 | 3300049460 | Bacteria | 27003 |
| 792 | Ga0501031_0028352 | 3300049568 | Plasmid | 3650 |
| 793 | Ga0501033_0122956 | 3300049570 | Unclassified | 1882 |
| 794 | Ga0501036_0061544 | 3300049572 | Bacteria | 3179 |
| 795 | Ga0501036_0217132 | 3300049572 | Unclassified | 1606 |
| 796 | Ga0501037_0060968 | 3300049573 | Bacteria | 2751 |
| 797 | Ga0501038_0067254 | 3300049574 | Bacteria | 3049 |
| 798 | Ga0501038_0091213 | 3300049574 | Bacteria | 2553 |
| 799 | Ga0501039_0004025 | 3300049575 | Bacteria | 11043 |
| 800 | Ga0501039_0109738 | 3300049575 | Unclassified | 2157 |
| 801 | Ga0501039_0140031 | 3300049575 | Bacteria | 1900 |
| 802 | Ga0501039_0150509 | 3300049575 | Bacteria | 1828 |
| 803 | Ga0501040_0020286 | 3300049576 | Bacteria | 4429 |
| 804 | Ga0501040_0020464 | 3300049576 | Bacteria | 4409 |
| 805 | Ga0501040_0112507 | 3300049576 | Unclassified | 1904 |
| 806 | Ga0501041_0000986 | 3300049577 | Bacteria | 15550 |
| 807 | Ga0501041_0003213 | 3300049577 | Bacteria | 9392 |
| 808 | Ga0501041_0043878 | 3300049577 | Bacteria | 2718 |
| 809 | Ga0501042_0005770 | 3300049578 | Bacteria | 7994 |
| 810 | Ga0501042_0029610 | 3300049578 | Bacteria | 3862 |
| 811 | Ga0501042_0105162 | 3300049578 | Bacteria | 2031 |
| 812 | Ga0501043_0084041 | 3300049579 | Plasmid | 2502 |
| 813 | Ga0501046_0238802 | 3300049580 | Bacteria | 1341 |
| 814 | Ga0501047_0009098 | 3300049581 | Bacteria | 9379 |
| 815 | Ga0501047_0020880 | 3300049581 | Bacteria | 6290 |
| 816 | Ga0501048_0001956 | 3300049582 | Bacteria | 15664 |
| 817 | Ga0501048_0014698 | 3300049582 | Bacteria | 5791 |
| 818 | Ga0501067_0000469 | 3300049583 | Bacteria | 21964 |
| 819 | Ga0501068_0046997 | 3300049584 | Bacteria | 2603 |
| 820 | Ga0501068_0123833 | 3300049584 | Bacteria | 1613 |
| 821 | Ga0501071_0027922 | 3300049587 | Bacteria | 3972 |
| 822 | Ga0501072_0004083 | 3300049588 | Bacteria | 11048 |
| 823 | Ga0501072_0053029 | 3300049588 | Bacteria | 3193 |
| 824 | Ga0501072_0063405 | 3300049588 | Bacteria | 2915 |
| 825 | Ga0501072_0074758 | 3300049588 | Bacteria | 2679 |
| 826 | Ga0501073_0002098 | 3300049589 | Bacteria | 14941 |
| 827 | Ga0501073_0180325 | 3300049589 | Bacteria | 1462 |
| 828 | Ga0501075_0001740 | 3300049591 | Bacteria | 14312 |
| 829 | Ga0501075_0005586 | 3300049591 | Bacteria | 8601 |
| 830 | Ga0501075_0041883 | 3300049591 | Bacteria | 3432 |
| 831 | Ga0501075_0078183 | 3300049591 | Bacteria | 2504 |
| 832 | Ga0501075_0080380 | 3300049591 | Bacteria | 2467 |
| 833 | Ga0501076_0003169 | 3300049592 | Bacteria | 11472 |
| 834 | Ga0501076_0010701 | 3300049592 | Bacteria | 6818 |
| 835 | Ga0501076_0058073 | 3300049592 | Bacteria | 3074 |
| 836 | Ga0501076_0222507 | 3300049592 | Bacteria | 1542 |
| 837 | Ga0501076_0234456 | 3300049592 | Bacteria | 1500 |
| 838 | Ga0501076_0279265 | 3300049592 | Bacteria | 1368 |
| 839 | Ga0501077_0010828 | 3300049593 | Bacteria | 5682 |
| 840 | Ga0501077_0016581 | 3300049593 | Bacteria | 4642 |
| 841 | Ga0501077_0177889 | 3300049593 | Bacteria | 1352 |
| 842 | Ga0501079_0000363 | 3300049741 | Bacteria | 29190 |
| 843 | Ga0501079_0021433 | 3300049741 | Bacteria | 4943 |
| 844 | Ga0501079_0021691 | 3300049741 | Bacteria | 4916 |
| 845 | Ga0501079_0102110 | 3300049741 | Unclassified | 2224 |
| 846 | Ga0501079_0134116 | 3300049741 | Bacteria | 1927 |
| 847 | Ga0501080_0001162 | 3300049742 | Bacteria | 21747 |
| 848 | Ga0501080_0084330 | 3300049742 | Bacteria | 2952 |
| 849 | Ga0501080_0100705 | 3300049742 | Bacteria | 2680 |
| 850 | Ga0501081_0003993 | 3300049743 | Bacteria | 9454 |
| 851 | Ga0501081_0030845 | 3300049743 | Bacteria | 3632 |
| 852 | Ga0501081_0040380 | 3300049743 | Bacteria | 3195 |
| 853 | Ga0501081_0075352 | 3300049743 | Unclassified | 2355 |
| 854 | Ga0501083_0091754 | 3300049744 | Unclassified | 2005 |
| 855 | Ga0501035_0118062 | 3300049822 | Bacteria | 2321 |
| 856 | Ga0501045_0007017 | 3300049824 | Bacteria | 7811 |
| 857 | Ga0501045_0032680 | 3300049824 | Unclassified | 3771 |
| 858 | Ga0501045_0033401 | 3300049824 | Bacteria | 3730 |
| 859 | Ga0501045_0056643 | 3300049824 | Bacteria | 2867 |
| 860 | Ga0501045_0195591 | 3300049824 | Bacteria | 1507 |
| 861 | nmdc:mga03683_31637_c1 | 3300050489 | Bacteria | 2124 |
| 862 | nmdc:mga03683_321_c2 | 3300050489 | Bacteria | 8139 |
| 863 | nmdc:mga03n38_22850_c1 | 3300050490 | Bacteria | 2537 |
| 864 | nmdc:mga00v17_2537_c1 | 3300050491 | Bacteria | 9348 |
| 865 | nmdc:mga00v17_83131_c1 | 3300050491 | Bacteria | 2002 |
| 866 | nmdc:mga0yw44_11924_c1 | 3300050492 | Bacteria | 4511 |
| 867 | nmdc:mga0yw44_18940_c1 | 3300050492 | Bacteria | 3784 |
| 868 | nmdc:mga0yw44_2683_c1 | 3300050492 | Bacteria | 7675 |
| 869 | nmdc:mga0k408_1654_c1 | 3300050493 | Bacteria | 12039 |
| 870 | nmdc:mga0k408_33663_c1 | 3300050493 | Bacteria | 2931 |
| 871 | nmdc:mga06z11_11275_c1 | 3300050494 | Bacteria | 3849 |
| 872 | nmdc:mga06z11_31985_c1 | 3300050494 | Bacteria | 2562 |
| 873 | nmdc:mga06z11_39059_c2 | 3300050494 | Bacteria | 1631 |
| 874 | nmdc:mga06z11_54958_c1 | 3300050494 | Bacteria | 2054 |
| 875 | nmdc:mga04h51_10605_c2 | 3300050495 | Bacteria | 2123 |
| 876 | nmdc:mga07m45_6030_c1 | 3300050496 | Bacteria | 6099 |
| 877 | nmdc:mga07m45_7056_c1 | 3300050496 | Bacteria | 5718 |
| 878 | nmdc:mga07m45_94345_c1 | 3300050496 | Bacteria | 1716 |
| 879 | nmdc:mga05p37_117995_c1 | 3300050507 | Bacteria | 3261 |
| 880 | nmdc:mga09592_2872_c1 | 3300050508 | Bacteria | 13969 |
| 881 | nmdc:mga0qj67_19636_c1 | 3300050509 | Bacteria | 5166 |
| 882 | nmdc:mga0qj67_214949_c1 | 3300050509 | Bacteria | 1561 |
| 883 | nmdc:mga06r32_131736_c1 | 3300050510 | Bacteria | 2473 |
| 884 | nmdc:mga06r32_146541_c1 | 3300050510 | Bacteria | 2338 |
| 885 | nmdc:mga06r32_299270_c1 | 3300050510 | Bacteria | 1595 |
| 886 | nmdc:mga06r32_99566_c1 | 3300050510 | Bacteria | 2851 |
| 887 | nmdc:mga08y16_161240_c1 | 3300050511 | Bacteria | 2330 |
| 888 | nmdc:mga08y16_22860_c1 | 3300050511 | Bacteria | 6599 |
| 889 | nmdc:mga08y16_7584_c1 | 3300050511 | Bacteria | 11358 |
| 890 | nmdc:mga08y16_88510_c1 | 3300050511 | Bacteria | 3227 |
| 891 | nmdc:mga0n895_1857_c1 | 3300050512 | Bacteria | 16116 |
| 892 | nmdc:mga0n895_234335_c1 | 3300050512 | Bacteria | 1863 |
| 893 | nmdc:mga0n895_26094_c1 | 3300050512 | Bacteria | 5528 |
| 894 | nmdc:mga0n895_416443_c1 | 3300050512 | Bacteria | 1358 |
| 895 | nmdc:mga0n895_41751_c1 | 3300050512 | Bacteria | 4460 |
| 896 | nmdc:mga0n895_67313_c1 | 3300050512 | Bacteria | 3547 |
| 897 | nmdc:mga0a205_56157_c1 | 3300050515 | Bacteria | 3802 |
| 898 | nmdc:mga0a205_961_c1 | 3300050515 | Bacteria | 23815 |
| 899 | Ga0495601_0006916 | 3300053077 | Bacteria | 6645 |
| 900 | Ga0495601_0019745 | 3300053077 | Bacteria | 4112 |
| 901 | Ga0495601_0038817 | 3300053077 | Bacteria | 2979 |
| 902 | Ga0495601_0042137 | 3300053077 | Bacteria | 2863 |
| 903 | Ga0495612_0001185 | 3300053078 | Bacteria | 10746 |
| 904 | Ga0495612_0003715 | 3300053078 | Bacteria | 6337 |
| 905 | Ga0495595_0002633 | 3300053084 | Bacteria | 7041 |
| 906 | Ga0495595_0008813 | 3300053084 | Bacteria | 4154 |
| 907 | Ga0495595_0018656 | 3300053084 | Bacteria | 3001 |
| 908 | Ga0495595_0046427 | 3300053084 | Bacteria | 2001 |
| 909 | Ga0495619_0000903 | 3300053085 | Bacteria | 19439 |
| 910 | Ga0495619_0004968 | 3300053085 | Bacteria | 8450 |
| 911 | Ga0495619_0010588 | 3300053085 | Bacteria | 5801 |
| 912 | Ga0495619_0017008 | 3300053085 | Bacteria | 4609 |
| 913 | Ga0500578_0006822 | 3300053086 | Bacteria | 7586 |
| 914 | Ga0500643_000373 | 3300053087 | Bacteria | 35007 |
| 915 | Ga0500644_0051611 | 3300053088 | Bacteria | 1413 |
| 916 | Ga0500647_0017242 | 3300053091 | Bacteria | 3327 |
| 917 | Ga0500583_0057419 | 3300053092 | Bacteria | 1827 |
| 918 | Ga0500651_0004361 | 3300053093 | Bacteria | 7909 |
| 919 | Ga0500566_0023534 | 3300053094 | Bacteria | 3617 |
| 920 | Ga0500555_001336 | 3300053103 | Bacteria | 7741 |
| 921 | Ga0500556_0000488 | 3300053104 | Bacteria | 27556 |
| 922 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 923 | Ga0500562_006314 | 3300053108 | Bacteria | 2989 |
| 924 | Ga0500595_002369 | 3300053119 | Bacteria | 9417 |
| 925 | Ga0500595_006016 | 3300053119 | Bacteria | 5212 |
| 926 | Ga0500595_035470 | 3300053119 | Bacteria | 1642 |
| 927 | Ga0500608_041016 | 3300053122 | Bacteria | 2219 |
| 928 | Ga0500642_0000138 | 3300053130 | Bacteria | 32489 |
| 929 | Ga0500642_0027689 | 3300053130 | Bacteria | 2329 |
| 930 | Ga0500642_0062954 | 3300053130 | Bacteria | 1670 |
| 931 | Ga0500655_005677 | 3300053133 | Bacteria | 2245 |
| 932 | Ga0500568_0000211 | 3300053139 | Bacteria | 50486 |
| 933 | Ga0500568_0006843 | 3300053139 | Bacteria | 5678 |
| 934 | Ga0500588_0000191 | 3300053146 | Bacteria | 8554 |
| 935 | Ga0500588_0037457 | 3300053146 | Bacteria | 1440 |
| 936 | Ga0500590_103773 | 3300053148 | Bacteria | 1361 |
| 937 | Ga0500603_000522 | 3300053150 | Bacteria | 9717 |
| 938 | Ga0500604_0008026 | 3300053151 | Bacteria | 2800 |
| 939 | Ga0500604_0044376 | 3300053151 | Bacteria | 1353 |
| 940 | Ga0500616_0001014 | 3300053153 | Bacteria | 29976 |
| 941 | Ga0500616_0002878 | 3300053153 | Bacteria | 13806 |
| 942 | Ga0500616_0005315 | 3300053153 | Bacteria | 8779 |
| 943 | Ga0500620_000219 | 3300053155 | Bacteria | 11314 |
| 944 | Ga0500622_0000277 | 3300053156 | Bacteria | 52401 |
| 945 | Ga0500622_0116574 | 3300053156 | Bacteria | 1299 |
| 946 | Ga0500636_0000857 | 3300053177 | Bacteria | 16345 |
| 947 | Ga0500636_0090836 | 3300053177 | Bacteria | 1748 |
| 948 | Ga0500611_007782 | 3300053727 | Bacteria | 1628 |
| 949 | Ga0500625_004251 | 3300053729 | Bacteria | 5814 |
| 950 | Ga0500609_002374 | 3300053731 | Bacteria | 2690 |
| 951 | Ga0501084_0037509 | 3300054114 | Bacteria | 4049 |
| 952 | Ga0501084_0052699 | 3300054114 | Unclassified | 3403 |
| 953 | Ga0501084_0072294 | 3300054114 | Bacteria | 2889 |
| 954 | Ga0501084_0350736 | 3300054114 | Bacteria | 1247 |
| 955 | Ga0587077_002369 | 3300059493 | Bacteria | 2222 |
| 956 | Ga0587076_000364 | 3300059645 | Bacteria | 3539 |
| 957 | Ga0501082_0000476 | 3300060353 | Bacteria | 35465 |
| 958 | Ga0501082_0030779 | 3300060353 | Bacteria | 4626 |
| 959 | Ga0501082_0031517 | 3300060353 | Unclassified | 4572 |
| 960 | Ga0501082_0231080 | 3300060353 | Bacteria | 1609 |
| 961 | Ga0501082_0379979 | 3300060353 | Bacteria | 1232 |
| 962 | Ga0530510_0000124 | 3300061734 | Bacteria | 44414 |
| 963 | Ga0530510_0016203 | 3300061734 | Bacteria | 5270 |
| 964 | Ga0530510_0034130 | 3300061734 | Bacteria | 3664 |
| 965 | Ga0530510_0057525 | 3300061734 | Bacteria | 2809 |
| 966 | Ga0530510_0059231 | 3300061734 | Bacteria | 2770 |
| 967 | Ga0530510_0062640 | 3300061734 | Bacteria | 2692 |
| 968 | Ga0530510_0184123 | 3300061734 | Bacteria | 1549 |
| 969 | Ga0530510_0243445 | 3300061734 | Bacteria | 1339 |
| 970 | Ga0530510_0263898 | 3300061734 | Bacteria | 1285 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10108891 | Ga0081455_101088914 | 289 |
| 2 | 3300025940 | Ga0207691_10152405 | Ga0207691_101524053 | 295 |
| 3 | 3300006042 | Ga0075368_10028132 | Ga0075368_100281322 | 313 |
| 4 | 3300053146 | Ga0500588_0037457 | Ga0500588_0037457_434_1426 | 314 |
| 5 | 3300053146 | Ga0500588_0000191 | Ga0500588_0000191_2735_3943 | 319 |
| 6 | 3300050510 | nmdc:mga06r32_299270_c1 | nmdc:mga06r32_299270_c1_516_1562 | 324 |
| 7 | 3300050491 | nmdc:mga00v17_83131_c1 | nmdc:mga00v17_83131_c1_743_1951 | 325 |
| 8 | 3300050495 | nmdc:mga04h51_10605_c2 | nmdc:mga04h51_10605_c2_444_1652 | 325 |
| 9 | 3300050494 | nmdc:mga06z11_31985_c1 | nmdc:mga06z11_31985_c1_1061_2281 | 326 |
| 10 | 3300005937 | Ga0081455_10000479 | Ga0081455_1000047919 | 329 |
| 11 | 3300003794 | Ga0055531_10005753 | Ga0055531_100057533 | 332 |
| 12 | 3300025298 | Ga0209050_1008734 | Ga0209050_10087343 | 332 |
| 13 | 3300025304 | Ga0209257_1001891 | Ga0209257_100189122 | 332 |
| 14 | 3300005548 | Ga0070665_100177873 | Ga0070665_1001778732 | 333 |
| 15 | 3300021384 | Ga0213876_10016173 | Ga0213876_100161735 | 334 |
| 16 | 3300036401 | Ga0373937_0355813 | Ga0373937_0355813_38_1096 | 334 |
| 17 | 3300050512 | nmdc:mga0n895_416443_c1 | nmdc:mga0n895_416443_c1_274_1329 | 334 |
| 18 | 3300035695 | Ga0373927_0238209 | Ga0373927_0238209_23_1123 | 337 |
| 19 | 3300039438 | Ga0436360_0251089 | Ga0436360_0251089_681_1886 | 337 |
| 20 | 3300039447 | Ga0436361_0820451 | Ga0436361_0820451_486_1691 | 337 |
| 21 | 3300045051 | Ga0451576_0121035 | Ga0451576_0121035_121_1416 | 338 |
| 22 | 3300048904 | Ga0496101_0146657 | Ga0496101_0146657_221_1492 | 338 |
| 23 | 3300048907 | Ga0496104_0017710 | Ga0496104_0017710_762_2033 | 338 |
| 24 | 3300048913 | Ga0496110_0074582 | Ga0496110_0074582_1242_2513 | 338 |
| 25 | 3300048914 | Ga0496111_0108637 | Ga0496111_0108637_146_1417 | 338 |
| 26 | 3300048915 | Ga0496112_0008849 | Ga0496112_0008849_247_1518 | 338 |
| 27 | 3300048916 | Ga0496113_0049675 | Ga0496113_0049675_369_1640 | 338 |
| 28 | 3300048918 | Ga0496115_0183672 | Ga0496115_0183672_181_1452 | 338 |
| 29 | 3300049592 | Ga0501076_0279265 | Ga0501076_0279265_35_1261 | 338 |
| 30 | 3300053088 | Ga0500644_0051611 | Ga0500644_0051611_27_1247 | 338 |
| 31 | 3300061734 | Ga0530510_0243445 | Ga0530510_0243445_42_1268 | 338 |
| 32 | 3300014325 | Ga0163163_10163606 | Ga0163163_101636062 | 339 |
| 33 | 3300048925 | Ga0496122_0001094 | Ga0496122_0001094_9527_10762 | 339 |
| 34 | 3300048926 | Ga0496123_0001198 | Ga0496123_0001198_36183_37418 | 339 |
| 35 | 3300005937 | Ga0081455_10150556 | Ga0081455_101505562 | 340 |
| 36 | 3300003659 | JGI25404J52841_10001159 | JGI25404J52841_100011596 | 341 |
| 37 | 3300005983 | Ga0081540_1003793 | Ga0081540_10037935 | 341 |
| 38 | 3300005983 | Ga0081540_1067510 | Ga0081540_10675101 | 341 |
| 39 | 3300053153 | Ga0500616_0001014 | Ga0500616_0001014_20776_21999 | 342 |
| 40 | 3300025927 | Ga0207687_10269329 | Ga0207687_102693291 | 343 |
| 41 | 3300048907 | Ga0496104_0092644 | Ga0496104_0092644_1370_2629 | 343 |
| 42 | 3300048912 | Ga0496109_0041700 | Ga0496109_0041700_1192_2451 | 343 |
| 43 | 3300048913 | Ga0496110_0104702 | Ga0496110_0104702_1247_2506 | 343 |
| 44 | 3300035725 | Ga0373947_0002867 | Ga0373947_0002867_6141_7373 | 345 |
| 45 | 3300045976 | Ga0466967_0003126 | Ga0466967_0003126_687_1895 | 345 |
| 46 | 3300046455 | Ga0495603_0000183 | Ga0495603_0000183_18804_20036 | 345 |
| 47 | 3300046459 | Ga0495629_0002778 | Ga0495629_0002778_7314_8546 | 345 |
| 48 | 3300046472 | Ga0495580_0001167 | Ga0495580_0001167_18828_20060 | 345 |
| 49 | 3300046473 | Ga0495582_0000625 | Ga0495582_0000625_16353_17585 | 345 |
| 50 | 3300046475 | Ga0495639_0002778 | Ga0495639_0002778_3161_4393 | 345 |
| 51 | 3300046499 | Ga0495594_0002491 | Ga0495594_0002491_5189_6421 | 345 |
| 52 | 3300046557 | Ga0495622_0001140 | Ga0495622_0001140_1179_2411 | 345 |
| 53 | 3300046642 | Ga0495634_0062139 | Ga0495634_0062139_933_2165 | 345 |
| 54 | 3300046674 | Ga0495588_0037158 | Ga0495588_0037158_337_1569 | 345 |
| 55 | 3300046681 | Ga0495647_0001656 | Ga0495647_0001656_5385_6617 | 345 |
| 56 | 3300046689 | Ga0495613_0000290 | Ga0495613_0000290_42574_43806 | 345 |
| 57 | 3300047315 | Ga0495581_0001425 | Ga0495581_0001425_4184_5416 | 345 |
| 58 | 3300047673 | Ga0495593_0000567 | Ga0495593_0000567_15746_16978 | 345 |
| 59 | 3300048089 | Ga0495614_0003091 | Ga0495614_0003091_49_1281 | 345 |
| 60 | 3300048921 | Ga0496118_0042068 | Ga0496118_0042068_39_1250 | 345 |
| 61 | 3300053085 | Ga0495619_0004968 | Ga0495619_0004968_2969_4201 | 345 |
| 62 | 3300053093 | Ga0500651_0004361 | Ga0500651_0004361_4096_5298 | 345 |
| 63 | 3300005937 | Ga0081455_10013535 | Ga0081455_1001353510 | 346 |
| 64 | 3300014325 | Ga0163163_10158222 | Ga0163163_101582221 | 346 |
| 65 | 3300039437 | Ga0436365_1269767 | Ga0436365_1269767_7259_8587 | 346 |
| 66 | 3300048906 | Ga0496103_0037885 | Ga0496103_0037885_1839_2933 | 346 |
| 67 | 3300048911 | Ga0496108_0042515 | Ga0496108_0042515_1735_3042 | 346 |
| 68 | 3300005546 | Ga0070696_100024719 | Ga0070696_1000247194 | 347 |
| 69 | 3300006028 | Ga0070717_10033651 | Ga0070717_100336514 | 347 |
| 70 | 3300005983 | Ga0081540_1008398 | Ga0081540_10083988 | 348 |
| 71 | 3300005437 | Ga0070710_10134207 | Ga0070710_101342071 | 349 |
| 72 | 3300009545 | Ga0105237_10068809 | Ga0105237_100688092 | 349 |
| 73 | 3300025972 | Ga0207668_10000033 | Ga0207668_1000003318 | 349 |
| 74 | 3300025986 | Ga0207658_10001268 | Ga0207658_1000126816 | 349 |
| 75 | 3300035695 | Ga0373927_0035904 | Ga0373927_0035904_1129_2319 | 349 |
| 76 | 3300037068 | Ga0373925_0002792 | Ga0373925_0002792_1765_2955 | 349 |
| 77 | 3300046683 | Ga0495658_0018258 | Ga0495658_0018258_1022_2212 | 349 |
| 78 | 3300048903 | Ga0496100_0098409 | Ga0496100_0098409_729_1922 | 349 |
| 79 | 3300006852 | Ga0075433_10001633 | Ga0075433_1000163316 | 350 |
| 80 | 3300009094 | Ga0111539_10029217 | Ga0111539_100292177 | 350 |
| 81 | 3300027907 | Ga0207428_10024101 | Ga0207428_100241012 | 350 |
| 82 | 3300048909 | Ga0496106_0067734 | Ga0496106_0067734_451_1644 | 350 |
| 83 | 3300050511 | nmdc:mga08y16_22860_c1 | nmdc:mga08y16_22860_c1_3815_5128 | 350 |
| 84 | 3300050512 | nmdc:mga0n895_26094_c1 | nmdc:mga0n895_26094_c1_2934_4247 | 350 |
| 85 | 3300050515 | nmdc:mga0a205_961_c1 | nmdc:mga0a205_961_c1_7583_8896 | 350 |
| 86 | 3300006846 | Ga0075430_100139853 | Ga0075430_1001398531 | 351 |
| 87 | 3300050509 | nmdc:mga0qj67_214949_c1 | nmdc:mga0qj67_214949_c1_228_1430 | 351 |
| 88 | 3300053119 | Ga0500595_002369 | Ga0500595_002369_5172_6410 | 351 |
| 89 | 3300005617 | Ga0068859_100197207 | Ga0068859_1001972072 | 352 |
| 90 | 3300006931 | Ga0097620_100197210 | Ga0097620_1001972102 | 352 |
| 91 | 3300005467 | Ga0070706_100124731 | Ga0070706_1001247313 | 353 |
| 92 | 3300005616 | Ga0068852_100248147 | Ga0068852_1002481472 | 353 |
| 93 | 3300053731 | Ga0500609_002374 | Ga0500609_002374_1227_2429 | 353 |
| 94 | 3300010159 | Ga0099796_10007245 | Ga0099796_100072452 | 354 |
| 95 | 3300053156 | Ga0500622_0116574 | Ga0500622_0116574_18_1250 | 354 |
| 96 | 3300005548 | Ga0070665_100128801 | Ga0070665_1001288013 | 355 |
| 97 | 3300005844 | Ga0068862_100008935 | Ga0068862_1000089355 | 355 |
| 98 | 3300009553 | Ga0105249_10286132 | Ga0105249_102861322 | 355 |
| 99 | 3300028379 | Ga0268266_10039534 | Ga0268266_100395342 | 355 |
| 100 | 3300028380 | Ga0268265_10003494 | Ga0268265_100034946 | 355 |
| 101 | 3300035692 | Ga0373935_0042112 | Ga0373935_0042112_576_1757 | 355 |
| 102 | 3300039453 | Ga0436362_0601100 | Ga0436362_0601100_405_1622 | 355 |
| 103 | 3300049581 | Ga0501047_0020880 | Ga0501047_0020880_4438_5640 | 355 |
| 104 | 3300061734 | Ga0530510_0016203 | Ga0530510_0016203_2399_3637 | 355 |
| 105 | 3300005617 | Ga0068859_100364428 | Ga0068859_1003644282 | 356 |
| 106 | 3300006931 | Ga0097620_100364417 | Ga0097620_1003644172 | 356 |
| 107 | 3300010375 | Ga0105239_10268688 | Ga0105239_102686881 | 356 |
| 108 | 3300046539 | Ga0495621_0019410 | Ga0495621_0019410_454_1680 | 356 |
| 109 | 3300048907 | Ga0496104_0055220 | Ga0496104_0055220_231_1421 | 356 |
| 110 | 3300048917 | Ga0496114_0024532 | Ga0496114_0024532_2104_3294 | 356 |
| 111 | 3300050493 | nmdc:mga0k408_33663_c1 | nmdc:mga0k408_33663_c1_1408_2622 | 356 |
| 112 | 3300013297 | Ga0157378_10009779 | Ga0157378_100097799 | 357 |
| 113 | 3300025925 | Ga0207650_10026441 | Ga0207650_100264412 | 357 |
| 114 | 3300025926 | Ga0207659_10109687 | Ga0207659_101096872 | 357 |
| 115 | 3300039438 | Ga0436360_0806801 | Ga0436360_0806801_143_1381 | 357 |
| 116 | 3300046543 | Ga0495645_0157895 | Ga0495645_0157895_369_1550 | 357 |
| 117 | 3300048929 | Ga0496126_0016607 | Ga0496126_0016607_5831_7057 | 357 |
| 118 | 3300003215 | JGI25153J46596_10000884 | JGI25153J46596_100008847 | 358 |
| 119 | 3300005344 | Ga0070661_100116134 | Ga0070661_1001161342 | 358 |
| 120 | 3300005435 | Ga0070714_100169183 | Ga0070714_1001691832 | 358 |
| 121 | 3300005436 | Ga0070713_100019042 | Ga0070713_1000190423 | 358 |
| 122 | 3300005616 | Ga0068852_100045552 | Ga0068852_1000455522 | 358 |
| 123 | 3300005937 | Ga0081455_10022033 | Ga0081455_100220334 | 358 |
| 124 | 3300006178 | Ga0075367_10056354 | Ga0075367_100563542 | 358 |
| 125 | 3300009551 | Ga0105238_10073339 | Ga0105238_100733392 | 358 |
| 126 | 3300013105 | Ga0157369_10018062 | Ga0157369_100180624 | 358 |
| 127 | 3300025297 | Ga0209758_1000079 | Ga0209758_1000079235 | 358 |
| 128 | 3300025928 | Ga0207700_10160347 | Ga0207700_101603471 | 358 |
| 129 | 3300039450 | Ga0436363_1351751 | Ga0436363_1351751_4909_6132 | 358 |
| 130 | 3300049592 | Ga0501076_0222507 | Ga0501076_0222507_42_1280 | 358 |
| 131 | 3300050494 | nmdc:mga06z11_54958_c1 | nmdc:mga06z11_54958_c1_413_1609 | 358 |
| 132 | 3300050510 | nmdc:mga06r32_99566_c1 | nmdc:mga06r32_99566_c1_133_1368 | 358 |
| 133 | 3300053119 | Ga0500595_006016 | Ga0500595_006016_2675_3904 | 358 |
| 134 | 3300005330 | Ga0070690_100016506 | Ga0070690_1000165062 | 359 |
| 135 | 3300005354 | Ga0070675_100140491 | Ga0070675_1001404912 | 359 |
| 136 | 3300005355 | Ga0070671_100049175 | Ga0070671_1000491753 | 359 |
| 137 | 3300005356 | Ga0070674_100056827 | Ga0070674_1000568272 | 359 |
| 138 | 3300005364 | Ga0070673_100103631 | Ga0070673_1001036311 | 359 |
| 139 | 3300005458 | Ga0070681_10291672 | Ga0070681_102916722 | 359 |
| 140 | 3300005466 | Ga0070685_10069110 | Ga0070685_100691101 | 359 |
| 141 | 3300005539 | Ga0068853_100031588 | Ga0068853_1000315886 | 359 |
| 142 | 3300005543 | Ga0070672_100156434 | Ga0070672_1001564341 | 359 |
| 143 | 3300005617 | Ga0068859_100074094 | Ga0068859_1000740942 | 359 |
| 144 | 3300005618 | Ga0068864_100030673 | Ga0068864_1000306733 | 359 |
| 145 | 3300005841 | Ga0068863_100123046 | Ga0068863_1001230462 | 359 |
| 146 | 3300006931 | Ga0097620_100074094 | Ga0097620_1000740942 | 359 |
| 147 | 3300009545 | Ga0105237_10008317 | Ga0105237_100083179 | 359 |
| 148 | 3300009551 | Ga0105238_10003618 | Ga0105238_100036188 | 359 |
| 149 | 3300009553 | Ga0105249_10206766 | Ga0105249_102067661 | 359 |
| 150 | 3300010375 | Ga0105239_10061277 | Ga0105239_100612773 | 359 |
| 151 | 3300013306 | Ga0163162_10034244 | Ga0163162_100342442 | 359 |
| 152 | 3300013308 | Ga0157375_10197011 | Ga0157375_101970112 | 359 |
| 153 | 3300014325 | Ga0163163_10195679 | Ga0163163_101956792 | 359 |
| 154 | 3300025914 | Ga0207671_10012411 | Ga0207671_100124112 | 359 |
| 155 | 3300025924 | Ga0207694_10008420 | Ga0207694_100084204 | 359 |
| 156 | 3300025931 | Ga0207644_10083705 | Ga0207644_100837052 | 359 |
| 157 | 3300026095 | Ga0207676_10021519 | Ga0207676_100215193 | 359 |
| 158 | 3300035090 | Ga0373949_0019325 | Ga0373949_0019325_209_1402 | 359 |
| 159 | 3300035691 | Ga0373931_0002375 | Ga0373931_0002375_6226_7419 | 359 |
| 160 | 3300048915 | Ga0496112_0039611 | Ga0496112_0039611_636_1829 | 359 |
| 161 | 3300048916 | Ga0496113_0034090 | Ga0496113_0034090_1793_2986 | 359 |
| 162 | 3300048929 | Ga0496126_0075527 | Ga0496126_0075527_62_1264 | 359 |
| 163 | 3300053155 | Ga0500620_000219 | Ga0500620_000219_8112_9314 | 359 |
| 164 | 3300001979 | JGI24740J21852_10017985 | JGI24740J21852_100179853 | 360 |
| 165 | 3300001989 | JGI24739J22299_10011157 | JGI24739J22299_100111572 | 360 |
| 166 | 3300005563 | Ga0068855_100498275 | Ga0068855_1004982751 | 360 |
| 167 | 3300009545 | Ga0105237_10126084 | Ga0105237_101260842 | 360 |
| 168 | 3300010375 | Ga0105239_10065977 | Ga0105239_100659773 | 360 |
| 169 | 3300025297 | Ga0209758_1004588 | Ga0209758_100458810 | 360 |
| 170 | 3300025904 | Ga0207647_10058110 | Ga0207647_100581102 | 360 |
| 171 | 3300025949 | Ga0207667_10387321 | Ga0207667_103873211 | 360 |
| 172 | 3300025972 | Ga0207668_10092923 | Ga0207668_100929232 | 360 |
| 173 | 3300026023 | Ga0207677_10164440 | Ga0207677_101644402 | 360 |
| 174 | 3300037471 | Ga0395905_0098816 | Ga0395905_0098816_34_1236 | 360 |
| 175 | 3300042157 | Ga0439458_0007286 | Ga0439458_0007286_767_1969 | 360 |
| 176 | 3300046660 | Ga0495625_0054128 | Ga0495625_0054128_625_1827 | 360 |
| 177 | 3300047443 | Ga0495687_048053 | Ga0495687_048053_73_1275 | 360 |
| 178 | 3300049574 | Ga0501038_0067254 | Ga0501038_0067254_449_1660 | 360 |
| 179 | 3300049591 | Ga0501075_0078183 | Ga0501075_0078183_673_1884 | 360 |
| 180 | 3300049592 | Ga0501076_0234456 | Ga0501076_0234456_167_1378 | 360 |
| 181 | 3300050496 | nmdc:mga07m45_6030_c1 | nmdc:mga07m45_6030_c1_2598_3761 | 360 |
| 182 | 3300053130 | Ga0500642_0027689 | Ga0500642_0027689_711_1913 | 360 |
| 183 | 3300053130 | Ga0500642_0062954 | Ga0500642_0062954_380_1582 | 360 |
| 184 | 3300053151 | Ga0500604_0008026 | Ga0500604_0008026_865_2067 | 360 |
| 185 | 3300053151 | Ga0500604_0044376 | Ga0500604_0044376_61_1263 | 360 |
| 186 | 3300061734 | Ga0530510_0059231 | Ga0530510_0059231_1274_2485 | 360 |
| 187 | 3300005843 | Ga0068860_100022255 | Ga0068860_1000222553 | 361 |
| 188 | 3300006353 | Ga0075370_10018948 | Ga0075370_100189483 | 361 |
| 189 | 3300006358 | Ga0068871_100041919 | Ga0068871_1000419192 | 361 |
| 190 | 3300009174 | Ga0105241_10004292 | Ga0105241_100042927 | 361 |
| 191 | 3300028379 | Ga0268266_10220068 | Ga0268266_102200682 | 361 |
| 192 | 3300048915 | Ga0496112_0000018 | Ga0496112_0000018_37011_38216 | 361 |
| 193 | 3300048917 | Ga0496114_0081861 | Ga0496114_0081861_185_1378 | 361 |
| 194 | 3300048922 | Ga0496119_0071576 | Ga0496119_0071576_18_1166 | 361 |
| 195 | 3300048928 | Ga0496125_0162414 | Ga0496125_0162414_275_1501 | 361 |
| 196 | 3300049578 | Ga0501042_0029610 | Ga0501042_0029610_132_1343 | 361 |
| 197 | 3300005843 | Ga0068860_100179134 | Ga0068860_1001791342 | 362 |
| 198 | 3300005844 | Ga0068862_100015601 | Ga0068862_1000156016 | 362 |
| 199 | 3300005937 | Ga0081455_10011587 | Ga0081455_100115877 | 362 |
| 200 | 3300028380 | Ga0268265_10074523 | Ga0268265_100745232 | 362 |
| 201 | 3300039437 | Ga0436365_1361869 | Ga0436365_1361869_4257_5468 | 362 |
| 202 | 3300048909 | Ga0496106_0002346 | Ga0496106_0002346_1212_2432 | 362 |
| 203 | 3300048921 | Ga0496118_0003678 | Ga0496118_0003678_4377_5597 | 362 |
| 204 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_21036_22256 | 362 |
| 205 | 3300048927 | Ga0496124_0011558 | Ga0496124_0011558_7125_8345 | 362 |
| 206 | 3300048929 | Ga0496126_0022299 | Ga0496126_0022299_443_1663 | 362 |
| 207 | 3300050494 | nmdc:mga06z11_39059_c2 | nmdc:mga06z11_39059_c2_271_1473 | 362 |
| 208 | 3300005437 | Ga0070710_10006619 | Ga0070710_100066191 | 363 |
| 209 | 3300005439 | Ga0070711_100007381 | Ga0070711_1000073813 | 363 |
| 210 | 3300005614 | Ga0068856_100441838 | Ga0068856_1004418381 | 363 |
| 211 | 3300025898 | Ga0207692_10026144 | Ga0207692_100261443 | 363 |
| 212 | 3300025915 | Ga0207693_10012329 | Ga0207693_100123294 | 363 |
| 213 | 3300025916 | Ga0207663_10205555 | Ga0207663_102055551 | 363 |
| 214 | 3300048915 | Ga0496112_0121832 | Ga0496112_0121832_1342_2544 | 363 |
| 215 | 3300049584 | Ga0501068_0123833 | Ga0501068_0123833_19_1269 | 363 |
| 216 | 3300053727 | Ga0500611_007782 | Ga0500611_007782_23_1225 | 363 |
| 217 | 3300054114 | Ga0501084_0037509 | Ga0501084_0037509_2288_3499 | 363 |
| 218 | 3300005471 | Ga0070698_100356962 | Ga0070698_1003569621 | 364 |
| 219 | 3300006028 | Ga0070717_10040159 | Ga0070717_100401594 | 364 |
| 220 | 3300006195 | Ga0075366_10021583 | Ga0075366_100215833 | 364 |
| 221 | 3300037068 | Ga0373925_0203408 | Ga0373925_0203408_148_1317 | 364 |
| 222 | 3300041456 | Ga0451795_0980836 | Ga0451795_0980836_292_1413 | 364 |
| 223 | 3300049572 | Ga0501036_0061544 | Ga0501036_0061544_824_2038 | 364 |
| 224 | 3300049573 | Ga0501037_0060968 | Ga0501037_0060968_288_1502 | 364 |
| 225 | 3300049574 | Ga0501038_0091213 | Ga0501038_0091213_837_2051 | 364 |
| 226 | 3300049575 | Ga0501039_0004025 | Ga0501039_0004025_8093_9307 | 364 |
| 227 | 3300049576 | Ga0501040_0020464 | Ga0501040_0020464_583_1797 | 364 |
| 228 | 3300049577 | Ga0501041_0000986 | Ga0501041_0000986_12464_13678 | 364 |
| 229 | 3300049582 | Ga0501048_0001956 | Ga0501048_0001956_3130_4344 | 364 |
| 230 | 3300049588 | Ga0501072_0004083 | Ga0501072_0004083_4054_5268 | 364 |
| 231 | 3300049591 | Ga0501075_0005586 | Ga0501075_0005586_4392_5618 | 364 |
| 232 | 3300049592 | Ga0501076_0010701 | Ga0501076_0010701_278_1492 | 364 |
| 233 | 3300049593 | Ga0501077_0016581 | Ga0501077_0016581_2964_4178 | 364 |
| 234 | 3300049741 | Ga0501079_0000363 | Ga0501079_0000363_20731_21945 | 364 |
| 235 | 3300049741 | Ga0501079_0021433 | Ga0501079_0021433_1967_3193 | 364 |
| 236 | 3300049742 | Ga0501080_0001162 | Ga0501080_0001162_10642_11856 | 364 |
| 237 | 3300049743 | Ga0501081_0003993 | Ga0501081_0003993_7503_8717 | 364 |
| 238 | 3300049824 | Ga0501045_0007017 | Ga0501045_0007017_5179_6393 | 364 |
| 239 | 3300049824 | Ga0501045_0056643 | Ga0501045_0056643_725_1951 | 364 |
| 240 | 3300053139 | Ga0500568_0000211 | Ga0500568_0000211_41019_42230 | 364 |
| 241 | 3300053139 | Ga0500568_0006843 | Ga0500568_0006843_1619_2821 | 364 |
| 242 | 3300060353 | Ga0501082_0000476 | Ga0501082_0000476_7095_8309 | 364 |
| 243 | 3300061734 | Ga0530510_0000124 | Ga0530510_0000124_29583_30797 | 364 |
| 244 | 3300005347 | Ga0070668_100236870 | Ga0070668_1002368701 | 365 |
| 245 | 3300005353 | Ga0070669_100089650 | Ga0070669_1000896502 | 365 |
| 246 | 3300009148 | Ga0105243_10051407 | Ga0105243_100514073 | 365 |
| 247 | 3300010375 | Ga0105239_10344223 | Ga0105239_103442231 | 365 |
| 248 | 3300025986 | Ga0207658_10093958 | Ga0207658_100939582 | 365 |
| 249 | 3300035111 | Ga0373923_0003454 | Ga0373923_0003454_3151_4365 | 365 |
| 250 | 3300035117 | Ga0373953_0014930 | Ga0373953_0014930_76_1290 | 365 |
| 251 | 3300035118 | Ga0373954_0000600 | Ga0373954_0000600_425_1639 | 365 |
| 252 | 3300035120 | Ga0373957_0002034 | Ga0373957_0002034_917_2131 | 365 |
| 253 | 3300035724 | Ga0373933_0002820 | Ga0373933_0002820_339_1553 | 365 |
| 254 | 3300036401 | Ga0373937_0076740 | Ga0373937_0076740_1074_2288 | 365 |
| 255 | 3300046459 | Ga0495629_0006344 | Ga0495629_0006344_7359_8573 | 365 |
| 256 | 3300046463 | Ga0495653_0000404 | Ga0495653_0000404_32529_33743 | 365 |
| 257 | 3300046511 | Ga0495608_0013850 | Ga0495608_0013850_1272_2486 | 365 |
| 258 | 3300046516 | Ga0495628_0028560 | Ga0495628_0028560_2708_3922 | 365 |
| 259 | 3300046529 | Ga0495652_0010990 | Ga0495652_0010990_6481_7695 | 365 |
| 260 | 3300046533 | Ga0495640_0084696 | Ga0495640_0084696_295_1509 | 365 |
| 261 | 3300046663 | Ga0495635_0005996 | Ga0495635_0005996_202_1416 | 365 |
| 262 | 3300047317 | Ga0495604_0024989 | Ga0495604_0024989_53_1267 | 365 |
| 263 | 3300047319 | Ga0495674_0017430 | Ga0495674_0017430_1314_2528 | 365 |
| 264 | 3300047322 | Ga0495680_0013405 | Ga0495680_0013405_737_1951 | 365 |
| 265 | 3300048913 | Ga0496110_0005345 | Ga0496110_0005345_35_1165 | 365 |
| 266 | 3300048928 | Ga0496125_0092132 | Ga0496125_0092132_26_1246 | 365 |
| 267 | 3300049580 | Ga0501046_0238802 | Ga0501046_0238802_72_1274 | 365 |
| 268 | 3300050493 | nmdc:mga0k408_1654_c1 | nmdc:mga0k408_1654_c1_586_1764 | 365 |
| 269 | 3300053077 | Ga0495601_0038817 | Ga0495601_0038817_360_1574 | 365 |
| 270 | 3300053084 | Ga0495595_0002633 | Ga0495595_0002633_5384_6598 | 365 |
| 271 | 3300003323 | rootH1_10010522 | rootH1_100105222 | 366 |
| 272 | 3300005548 | Ga0070665_100207191 | Ga0070665_1002071913 | 366 |
| 273 | 3300009174 | Ga0105241_10036380 | Ga0105241_100363804 | 366 |
| 274 | 3300010375 | Ga0105239_10393554 | Ga0105239_103935542 | 366 |
| 275 | 3300013104 | Ga0157370_10037994 | Ga0157370_100379944 | 366 |
| 276 | 3300036401 | Ga0373937_0228637 | Ga0373937_0228637_459_1670 | 366 |
| 277 | iso_pu_bacteria | 8006964411 | 8006966894 | 366 |
| 278 | 3300003215 | JGI25153J46596_10000132 | JGI25153J46596_1000013218 | 367 |
| 279 | 3300025253 | Ga0209677_100746 | Ga0209677_1007466 | 367 |
| 280 | 3300025297 | Ga0209758_1000169 | Ga0209758_100016920 | 367 |
| 281 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030266 | 367 |
| 282 | 3300048924 | Ga0496121_0054782 | Ga0496121_0054782_1326_2531 | 367 |
| 283 | 3300049741 | Ga0501079_0134116 | Ga0501079_0134116_759_1898 | 367 |
| 284 | 3300061734 | Ga0530510_0057525 | Ga0530510_0057525_1652_2791 | 367 |
| 285 | 3300005331 | Ga0070670_100093365 | Ga0070670_1000933653 | 368 |
| 286 | 3300005445 | Ga0070708_100056305 | Ga0070708_1000563052 | 368 |
| 287 | 3300005467 | Ga0070706_100042684 | Ga0070706_1000426843 | 368 |
| 288 | 3300005518 | Ga0070699_100129129 | Ga0070699_1001291292 | 368 |
| 289 | 3300005548 | Ga0070665_100000767 | Ga0070665_10000076730 | 368 |
| 290 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022073 | 368 |
| 291 | 3300006871 | Ga0075434_100009598 | Ga0075434_1000095982 | 368 |
| 292 | 3300006871 | Ga0075434_100154603 | Ga0075434_1001546034 | 368 |
| 293 | 3300009101 | Ga0105247_10010363 | Ga0105247_100103635 | 368 |
| 294 | 3300010375 | Ga0105239_10088255 | Ga0105239_100882552 | 368 |
| 295 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001585 | 368 |
| 296 | 3300021321 | Ga0214542_1000606 | Ga0214542_100060633 | 368 |
| 297 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003176 | 368 |
| 298 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002589 | 368 |
| 299 | 3300025900 | Ga0207710_10020193 | Ga0207710_100201933 | 368 |
| 300 | 3300025910 | Ga0207684_10028224 | Ga0207684_100282242 | 368 |
| 301 | 3300026088 | Ga0207641_10063951 | Ga0207641_100639513 | 368 |
| 302 | 3300028379 | Ga0268266_10001064 | Ga0268266_1000106419 | 368 |
| 303 | 3300046642 | Ga0495634_0128297 | Ga0495634_0128297_168_1364 | 368 |
| 304 | 3300046690 | Ga0495624_0081568 | Ga0495624_0081568_15_1199 | 368 |
| 305 | 3300048924 | Ga0496121_0068548 | Ga0496121_0068548_36_1250 | 368 |
| 306 | 3300048929 | Ga0496126_0056273 | Ga0496126_0056273_1620_2828 | 368 |
| 307 | 3300049575 | Ga0501039_0150509 | Ga0501039_0150509_85_1281 | 368 |
| 308 | 3300049576 | Ga0501040_0020286 | Ga0501040_0020286_2679_3875 | 368 |
| 309 | 3300049577 | Ga0501041_0003213 | Ga0501041_0003213_3967_5163 | 368 |
| 310 | 3300049578 | Ga0501042_0005770 | Ga0501042_0005770_3534_4730 | 368 |
| 311 | 3300049824 | Ga0501045_0195591 | Ga0501045_0195591_28_1224 | 368 |
| 312 | 3300050512 | nmdc:mga0n895_234335_c1 | nmdc:mga0n895_234335_c1_495_1730 | 368 |
| 313 | 3300050512 | nmdc:mga0n895_41751_c1 | nmdc:mga0n895_41751_c1_1441_2682 | 368 |
| 314 | 3300053130 | Ga0500642_0000138 | Ga0500642_0000138_24618_25820 | 368 |
| 315 | 3300005536 | Ga0070697_100062643 | Ga0070697_1000626432 | 369 |
| 316 | 3300006038 | Ga0075365_10007353 | Ga0075365_100073533 | 370 |
| 317 | 3300006051 | Ga0075364_10002835 | Ga0075364_100028354 | 370 |
| 318 | 3300006178 | Ga0075367_10018665 | Ga0075367_100186653 | 370 |
| 319 | 3300006237 | Ga0097621_100067278 | Ga0097621_1000672781 | 370 |
| 320 | 3300009177 | Ga0105248_10030358 | Ga0105248_100303584 | 370 |
| 321 | 3300009551 | Ga0105238_10050080 | Ga0105238_100500801 | 370 |
| 322 | 3300014968 | Ga0157379_10129585 | Ga0157379_101295852 | 370 |
| 323 | 3300025941 | Ga0207711_10066838 | Ga0207711_100668383 | 370 |
| 324 | 3300030521 | Ga0307511_10074407 | Ga0307511_100744073 | 370 |
| 325 | 3300031456 | Ga0307513_10186349 | Ga0307513_101863491 | 370 |
| 326 | 3300035695 | Ga0373927_0066987 | Ga0373927_0066987_1002_2222 | 370 |
| 327 | 3300037068 | Ga0373925_0058587 | Ga0373925_0058587_485_1705 | 370 |
| 328 | 3300046460 | Ga0495638_0013934 | Ga0495638_0013934_207_1445 | 370 |
| 329 | 3300048918 | Ga0496115_0205737 | Ga0496115_0205737_336_1496 | 370 |
| 330 | 3300050489 | nmdc:mga03683_31637_c1 | nmdc:mga03683_31637_c1_28_1188 | 370 |
| 331 | 3300050490 | nmdc:mga03n38_22850_c1 | nmdc:mga03n38_22850_c1_736_1896 | 370 |
| 332 | 3300050491 | nmdc:mga00v17_2537_c1 | nmdc:mga00v17_2537_c1_2434_3594 | 370 |
| 333 | 3300050492 | nmdc:mga0yw44_2683_c1 | nmdc:mga0yw44_2683_c1_4197_5393 | 370 |
| 334 | 3300050494 | nmdc:mga06z11_11275_c1 | nmdc:mga06z11_11275_c1_1410_2570 | 370 |
| 335 | 3300050511 | nmdc:mga08y16_161240_c1 | nmdc:mga08y16_161240_c1_704_1882 | 370 |
| 336 | 3300053094 | Ga0500566_0023534 | Ga0500566_0023534_1891_3111 | 370 |
| 337 | 3300053148 | Ga0500590_103773 | Ga0500590_103773_88_1308 | 370 |
| 338 | 3300053153 | Ga0500616_0002878 | Ga0500616_0002878_12559_13761 | 370 |
| 339 | 3300053177 | Ga0500636_0090836 | Ga0500636_0090836_242_1462 | 370 |
| 340 | iso_pu_bacteria | 2545555834 | 2545675760 | 370 |
| 341 | iso_pu_bacteria | 641522639 | 641641638 | 370 |
| 342 | 3300005549 | Ga0070704_100105605 | Ga0070704_1001056052 | 371 |
| 343 | 3300005842 | Ga0068858_100217665 | Ga0068858_1002176652 | 371 |
| 344 | 3300009094 | Ga0111539_10026475 | Ga0111539_100264757 | 371 |
| 345 | 3300009101 | Ga0105247_10070391 | Ga0105247_100703913 | 371 |
| 346 | 3300010375 | Ga0105239_10019302 | Ga0105239_100193026 | 371 |
| 347 | 3300014325 | Ga0163163_10284851 | Ga0163163_102848511 | 371 |
| 348 | 3300025911 | Ga0207654_10134306 | Ga0207654_101343062 | 371 |
| 349 | 3300025933 | Ga0207706_10029359 | Ga0207706_100293593 | 371 |
| 350 | 3300026035 | Ga0207703_10160375 | Ga0207703_101603752 | 371 |
| 351 | 3300026095 | Ga0207676_10068846 | Ga0207676_100688462 | 371 |
| 352 | 3300026118 | Ga0207675_100231902 | Ga0207675_1002319022 | 371 |
| 353 | 3300028794 | Ga0307515_10000121 | Ga0307515_100001217 | 371 |
| 354 | 3300031251 | Ga0265327_10000359 | Ga0265327_100003595 | 371 |
| 355 | 3300048906 | Ga0496103_0015202 | Ga0496103_0015202_833_2125 | 371 |
| 356 | 3300048909 | Ga0496106_0193301 | Ga0496106_0193301_177_1415 | 371 |
| 357 | 3300048911 | Ga0496108_0100688 | Ga0496108_0100688_36_1214 | 371 |
| 358 | 3300048915 | Ga0496112_0096063 | Ga0496112_0096063_1232_2470 | 371 |
| 359 | 3300050492 | nmdc:mga0yw44_11924_c1 | nmdc:mga0yw44_11924_c1_198_1424 | 371 |
| 360 | 3300059493 | Ga0587077_002369 | Ga0587077_002369_712_1950 | 371 |
| 361 | 3300059645 | Ga0587076_000364 | Ga0587076_000364_234_1472 | 371 |
| 362 | iso_pu_bacteria | 2882912400 | 2882917659 | 371 |
| 363 | 3300009098 | Ga0105245_10067141 | Ga0105245_100671413 | 372 |
| 364 | 3300009177 | Ga0105248_10064482 | Ga0105248_100644823 | 372 |
| 365 | 3300010375 | Ga0105239_10020128 | Ga0105239_100201287 | 372 |
| 366 | 3300014969 | Ga0157376_10103217 | Ga0157376_101032172 | 372 |
| 367 | 3300025923 | Ga0207681_10165038 | Ga0207681_101650382 | 372 |
| 368 | 3300025924 | Ga0207694_10116421 | Ga0207694_101164211 | 372 |
| 369 | 3300025933 | Ga0207706_10176941 | Ga0207706_101769411 | 372 |
| 370 | 3300031548 | Ga0307408_100062279 | Ga0307408_1000622792 | 372 |
| 371 | 3300046537 | Ga0495598_0009037 | Ga0495598_0009037_706_1932 | 372 |
| 372 | 3300046615 | Ga0495656_0015466 | Ga0495656_0015466_627_1853 | 372 |
| 373 | 3300046664 | Ga0495659_0016606 | Ga0495659_0016606_579_1805 | 372 |
| 374 | 3300047318 | Ga0495636_0079051 | Ga0495636_0079051_17_1243 | 372 |
| 375 | 3300048910 | Ga0496107_0261401 | Ga0496107_0261401_35_1213 | 372 |
| 376 | iso_pu_bacteria | 2961127735 | 2961135084 | 372 |
| 377 | 3300031616 | Ga0307508_10014365 | Ga0307508_100143655 | 373 |
| 378 | 3300033442 | Ga0315911_1000015 | Ga0315911_100001585 | 373 |
| 379 | 3300049744 | Ga0501083_0091754 | Ga0501083_0091754_805_1992 | 373 |
| 380 | 3300053104 | Ga0500556_0000488 | Ga0500556_0000488_24571_25809 | 373 |
| 381 | 3300060353 | Ga0501082_0379979 | Ga0501082_0379979_34_1209 | 373 |
| 382 | 3300061734 | Ga0530510_0263898 | Ga0530510_0263898_26_1252 | 373 |
| 383 | iso_pu_bacteria | 2513237137 | 2513860769 | 373 |
| 384 | iso_pu_bacteria | 2513237139 | 2513878319 | 373 |
| 385 | iso_pu_bacteria | 2513237146 | 2513925969 | 373 |
| 386 | iso_pu_bacteria | 2802429603 | 2805920542 | 373 |
| 387 | iso_pu_bacteria | 2838661181 | 2838661801 | 373 |
| 388 | iso_pu_bacteria | 2842333319 | 2842338549 | 373 |
| 389 | 3300005548 | Ga0070665_100005441 | Ga0070665_1000054417 | 374 |
| 390 | 3300005937 | Ga0081455_10020968 | Ga0081455_100209686 | 374 |
| 391 | 3300005985 | Ga0081539_10004536 | Ga0081539_1000453617 | 374 |
| 392 | 3300006177 | Ga0075362_10000592 | Ga0075362_100005927 | 374 |
| 393 | 3300006186 | Ga0075369_10000268 | Ga0075369_100002687 | 374 |
| 394 | 3300006353 | Ga0075370_10029395 | Ga0075370_100293952 | 374 |
| 395 | 3300025906 | Ga0207699_10004981 | Ga0207699_100049813 | 374 |
| 396 | 3300028573 | Ga0265334_10014054 | Ga0265334_100140543 | 374 |
| 397 | 3300031247 | Ga0265340_10029401 | Ga0265340_100294013 | 374 |
| 398 | 3300035691 | Ga0373931_0054255 | Ga0373931_0054255_587_1807 | 374 |
| 399 | 3300042438 | Ga0439459_0018515 | Ga0439459_0018515_24_1244 | 374 |
| 400 | 3300049570 | Ga0501033_0122956 | Ga0501033_0122956_410_1576 | 374 |
| 401 | 3300049572 | Ga0501036_0217132 | Ga0501036_0217132_253_1419 | 374 |
| 402 | 3300049575 | Ga0501039_0109738 | Ga0501039_0109738_847_2013 | 374 |
| 403 | 3300049576 | Ga0501040_0112507 | Ga0501040_0112507_80_1246 | 374 |
| 404 | 3300049582 | Ga0501048_0014698 | Ga0501048_0014698_2316_3482 | 374 |
| 405 | 3300049591 | Ga0501075_0001740 | Ga0501075_0001740_7993_9159 | 374 |
| 406 | 3300049592 | Ga0501076_0003169 | Ga0501076_0003169_1556_2722 | 374 |
| 407 | 3300049741 | Ga0501079_0102110 | Ga0501079_0102110_829_1995 | 374 |
| 408 | 3300049743 | Ga0501081_0075352 | Ga0501081_0075352_941_2107 | 374 |
| 409 | 3300049824 | Ga0501045_0032680 | Ga0501045_0032680_518_1684 | 374 |
| 410 | 3300050489 | nmdc:mga03683_321_c2 | nmdc:mga03683_321_c2_4606_5847 | 374 |
| 411 | 3300050496 | nmdc:mga07m45_7056_c1 | nmdc:mga07m45_7056_c1_3112_4353 | 374 |
| 412 | 3300054114 | Ga0501084_0052699 | Ga0501084_0052699_761_1927 | 374 |
| 413 | 3300060353 | Ga0501082_0031517 | Ga0501082_0031517_19_1185 | 374 |
| 414 | iso_pu_bacteria | 2513237102 | 2513702678 | 374 |
| 415 | iso_pu_bacteria | 2515075009 | 2515110619 | 374 |
| 416 | iso_pu_bacteria | 2937822353 | 2937824196 | 374 |
| 417 | 3300005289 | Ga0065704_10119026 | Ga0065704_101190262 | 375 |
| 418 | 3300005336 | Ga0070680_100204894 | Ga0070680_1002048941 | 375 |
| 419 | 3300005338 | Ga0068868_100041625 | Ga0068868_1000416252 | 375 |
| 420 | 3300005435 | Ga0070714_100011902 | Ga0070714_1000119023 | 375 |
| 421 | 3300005455 | Ga0070663_100018999 | Ga0070663_1000189992 | 375 |
| 422 | 3300005456 | Ga0070678_100018567 | Ga0070678_1000185673 | 375 |
| 423 | 3300005457 | Ga0070662_100310017 | Ga0070662_1003100171 | 375 |
| 424 | 3300005535 | Ga0070684_100007310 | Ga0070684_1000073106 | 375 |
| 425 | 3300005563 | Ga0068855_100062964 | Ga0068855_1000629643 | 375 |
| 426 | 3300005615 | Ga0070702_100061499 | Ga0070702_1000614992 | 375 |
| 427 | 3300005719 | Ga0068861_100057800 | Ga0068861_1000578002 | 375 |
| 428 | 3300005842 | Ga0068858_100030613 | Ga0068858_1000306132 | 375 |
| 429 | 3300005937 | Ga0081455_10000597 | Ga0081455_1000059731 | 375 |
| 430 | 3300007265 | Ga0099794_10033208 | Ga0099794_100332081 | 375 |
| 431 | 3300009098 | Ga0105245_10033787 | Ga0105245_100337873 | 375 |
| 432 | 3300009148 | Ga0105243_10062079 | Ga0105243_100620792 | 375 |
| 433 | 3300009174 | Ga0105241_10013031 | Ga0105241_100130312 | 375 |
| 434 | 3300009174 | Ga0105241_10069409 | Ga0105241_100694092 | 375 |
| 435 | 3300009545 | Ga0105237_10126256 | Ga0105237_101262562 | 375 |
| 436 | 3300009553 | Ga0105249_10245812 | Ga0105249_102458122 | 375 |
| 437 | 3300010375 | Ga0105239_10155796 | Ga0105239_101557962 | 375 |
| 438 | 3300013308 | Ga0157375_10293625 | Ga0157375_102936252 | 375 |
| 439 | 3300025911 | Ga0207654_10012598 | Ga0207654_100125983 | 375 |
| 440 | 3300025929 | Ga0207664_10007341 | Ga0207664_100073414 | 375 |
| 441 | 3300025933 | Ga0207706_10025090 | Ga0207706_100250905 | 375 |
| 442 | 3300025941 | Ga0207711_10079519 | Ga0207711_100795193 | 375 |
| 443 | 3300025942 | Ga0207689_10021152 | Ga0207689_100211525 | 375 |
| 444 | 3300025961 | Ga0207712_10042142 | Ga0207712_100421421 | 375 |
| 445 | 3300025972 | Ga0207668_10294555 | Ga0207668_102945551 | 375 |
| 446 | 3300025981 | Ga0207640_10198155 | Ga0207640_101981551 | 375 |
| 447 | 3300025986 | Ga0207658_10052566 | Ga0207658_100525661 | 375 |
| 448 | 3300026067 | Ga0207678_10031887 | Ga0207678_100318875 | 375 |
| 449 | 3300026078 | Ga0207702_10049798 | Ga0207702_100497983 | 375 |
| 450 | 3300026118 | Ga0207675_100004262 | Ga0207675_10000426213 | 375 |
| 451 | 3300026118 | Ga0207675_100071196 | Ga0207675_1000711962 | 375 |
| 452 | 3300026121 | Ga0207683_10017904 | Ga0207683_100179043 | 375 |
| 453 | 3300027671 | Ga0209588_1001310 | Ga0209588_10013105 | 375 |
| 454 | 3300028380 | Ga0268265_10034906 | Ga0268265_100349062 | 375 |
| 455 | 3300028381 | Ga0268264_10172450 | Ga0268264_101724502 | 375 |
| 456 | 3300031616 | Ga0307508_10056557 | Ga0307508_100565572 | 375 |
| 457 | 3300038443 | Ga0395901_0008600 | Ga0395901_0008600_7199_8422 | 375 |
| 458 | 3300039453 | Ga0436362_0524297 | Ga0436362_0524297_2080_3348 | 375 |
| 459 | 3300048905 | Ga0496102_0171491 | Ga0496102_0171491_62_1288 | 375 |
| 460 | 3300048913 | Ga0496110_0137941 | Ga0496110_0137941_868_2094 | 375 |
| 461 | 3300050496 | nmdc:mga07m45_94345_c1 | nmdc:mga07m45_94345_c1_244_1470 | 375 |
| 462 | 3300054114 | Ga0501084_0350736 | Ga0501084_0350736_14_1228 | 375 |
| 463 | iso_pu_bacteria | 2824696289 | 2824697673 | 375 |
| 464 | iso_pu_bacteria | 2847939898 | 2847947923 | 375 |
| 465 | iso_pu_bacteria | 2856364286 | 2856365860 | 375 |
| 466 | iso_pu_bacteria | 2869285874 | 2869286747 | 375 |
| 467 | iso_pu_bacteria | 2871429161 | 2871434010 | 375 |
| 468 | iso_pu_bacteria | 2874146452 | 2874147668 | 375 |
| 469 | iso_pu_bacteria | 2874155637 | 2874156587 | 375 |
| 470 | iso_pu_bacteria | 2876413966 | 2876414840 | 375 |
| 471 | iso_pu_bacteria | 2878745973 | 2878746720 | 375 |
| 472 | iso_pu_bacteria | 2903492973 | 2903498162 | 375 |
| 473 | iso_pu_bacteria | 2906308376 | 2906309101 | 375 |
| 474 | iso_pu_bacteria | 2906321335 | 2906326707 | 375 |
| 475 | iso_pu_bacteria | 2937813078 | 2937814041 | 375 |
| 476 | iso_pu_bacteria | 2958130278 | 2958131150 | 375 |
| 477 | iso_pu_bacteria | 2958179912 | 2958180549 | 375 |
| 478 | iso_pu_bacteria | 2961077736 | 2961078384 | 375 |
| 479 | iso_pu_bacteria | 2977843712 | 2977845256 | 375 |
| 480 | iso_pu_bacteria | 3000135777 | 3000140847 | 375 |
| 481 | iso_pu_bacteria | 8004387939 | 8004388030 | 375 |
| 482 | iso_pu_bacteria | 8004714634 | 8004715358 | 375 |
| 483 | 3300005262 | Ga0065165_1013172 | Ga0065165_10131723 | 376 |
| 484 | 3300005456 | Ga0070678_100009926 | Ga0070678_1000099262 | 376 |
| 485 | 3300005543 | Ga0070672_100193010 | Ga0070672_1001930102 | 376 |
| 486 | 3300009174 | Ga0105241_10059230 | Ga0105241_100592303 | 376 |
| 487 | 3300025960 | Ga0207651_10268175 | Ga0207651_102681751 | 376 |
| 488 | 3300031616 | Ga0307508_10086954 | Ga0307508_100869542 | 376 |
| 489 | 3300046460 | Ga0495638_0016915 | Ga0495638_0016915_3422_4627 | 376 |
| 490 | 3300046506 | Ga0495583_0074913 | Ga0495583_0074913_15_1178 | 376 |
| 491 | 3300046660 | Ga0495625_0162567 | Ga0495625_0162567_153_1403 | 376 |
| 492 | iso_pu_bacteria | 2513237090 | 2513614097 | 376 |
| 493 | iso_pu_bacteria | 2513237305 | 2514421682 | 376 |
| 494 | iso_pu_bacteria | 2513237351 | 2514591822 | 376 |
| 495 | iso_pu_bacteria | 2597489875 | 2597811240 | 376 |
| 496 | iso_pu_bacteria | 2599185301 | 2599940682 | 376 |
| 497 | iso_pu_bacteria | 2643221595 | 2643987640 | 376 |
| 498 | iso_pu_bacteria | 2643221627 | 2644157838 | 376 |
| 499 | iso_pu_bacteria | 2693429783 | 2694629695 | 376 |
| 500 | iso_pu_bacteria | 2693429784 | 2694638097 | 376 |
| 501 | iso_pu_bacteria | 2721755686 | 2723578156 | 376 |
| 502 | iso_pu_bacteria | 2791355123 | 2792745437 | 376 |
| 503 | iso_pu_bacteria | 2847670302 | 2847672389 | 376 |
| 504 | iso_pu_bacteria | 2856314179 | 2856315084 | 376 |
| 505 | iso_pu_bacteria | 2856342000 | 2856344853 | 376 |
| 506 | iso_pu_bacteria | 2856349417 | 2856355241 | 376 |
| 507 | iso_pu_bacteria | 2857349434 | 2857353724 | 376 |
| 508 | iso_pu_bacteria | 2871488783 | 2871489509 | 376 |
| 509 | iso_pu_bacteria | 2871495908 | 2871496322 | 376 |
| 510 | iso_pu_bacteria | 2874123672 | 2874124402 | 376 |
| 511 | iso_pu_bacteria | 2876369609 | 2876374835 | 376 |
| 512 | iso_pu_bacteria | 2878035449 | 2878042057 | 376 |
| 513 | iso_pu_bacteria | 2878753008 | 2878754086 | 376 |
| 514 | iso_pu_bacteria | 2878760144 | 2878760551 | 376 |
| 515 | iso_pu_bacteria | 2878767105 | 2878767514 | 376 |
| 516 | iso_pu_bacteria | 2881147464 | 2881150964 | 376 |
| 517 | iso_pu_bacteria | 2881155292 | 2881158522 | 376 |
| 518 | iso_pu_bacteria | 2881161766 | 2881166664 | 376 |
| 519 | iso_pu_bacteria | 2881845957 | 2881851319 | 376 |
| 520 | iso_pu_bacteria | 2881853255 | 2881855394 | 376 |
| 521 | iso_pu_bacteria | 2881861095 | 2881864136 | 376 |
| 522 | iso_pu_bacteria | 2885305155 | 2885308751 | 376 |
| 523 | iso_pu_bacteria | 2885312484 | 2885318696 | 376 |
| 524 | iso_pu_bacteria | 2885318864 | 2885324410 | 376 |
| 525 | iso_pu_bacteria | 2885326080 | 2885326447 | 376 |
| 526 | iso_pu_bacteria | 2885334103 | 2885334807 | 376 |
| 527 | iso_pu_bacteria | 2885342637 | 2885347550 | 376 |
| 528 | iso_pu_bacteria | 2885350715 | 2885356755 | 376 |
| 529 | iso_pu_bacteria | 2888350351 | 2888353010 | 376 |
| 530 | iso_pu_bacteria | 2889016732 | 2889020163 | 376 |
| 531 | iso_pu_bacteria | 2903492973 | 2903494611 | 376 |
| 532 | iso_pu_bacteria | 2903540706 | 2903541116 | 376 |
| 533 | iso_pu_bacteria | 2906328253 | 2906329156 | 376 |
| 534 | iso_pu_bacteria | 2906354277 | 2906355413 | 376 |
| 535 | iso_pu_bacteria | 2906414383 | 2906415081 | 376 |
| 536 | iso_pu_bacteria | 2922130491 | 2922131783 | 376 |
| 537 | iso_pu_bacteria | 2922185730 | 2922194161 | 376 |
| 538 | iso_pu_bacteria | 2924762789 | 2924767139 | 376 |
| 539 | iso_pu_bacteria | 2924784321 | 2924788832 | 376 |
| 540 | iso_pu_bacteria | 2937848649 | 2937851177 | 376 |
| 541 | iso_pu_bacteria | 2937994558 | 2937994969 | 376 |
| 542 | iso_pu_bacteria | 2958165035 | 2958165449 | 376 |
| 543 | iso_pu_bacteria | 2958172287 | 2958174974 | 376 |
| 544 | iso_pu_bacteria | 2961163497 | 2961163907 | 376 |
| 545 | iso_pu_bacteria | 2961170736 | 2961171718 | 376 |
| 546 | iso_pu_bacteria | 2965018300 | 2965018712 | 376 |
| 547 | iso_pu_bacteria | 2965119406 | 2965120475 | 376 |
| 548 | iso_pu_bacteria | 2967996073 | 2967996577 | 376 |
| 549 | iso_pu_bacteria | 2968003550 | 2968010212 | 376 |
| 550 | iso_pu_bacteria | 2968117919 | 2968120407 | 376 |
| 551 | iso_pu_bacteria | 2968171901 | 2968172313 | 376 |
| 552 | iso_pu_bacteria | 2970503327 | 2970504314 | 376 |
| 553 | iso_pu_bacteria | 2970524798 | 2970527745 | 376 |
| 554 | iso_pu_bacteria | 2970554993 | 2970555403 | 376 |
| 555 | iso_pu_bacteria | 2977821940 | 2977823301 | 376 |
| 556 | iso_pu_bacteria | 2977828996 | 2977831937 | 376 |
| 557 | iso_pu_bacteria | 2977864932 | 2977870948 | 376 |
| 558 | iso_pu_bacteria | 2977922695 | 2977923513 | 376 |
| 559 | iso_pu_bacteria | 2977942078 | 2977949833 | 376 |
| 560 | iso_pu_bacteria | 2977971508 | 2977980133 | 376 |
| 561 | iso_pu_bacteria | 2977986579 | 2977993167 | 376 |
| 562 | iso_pu_bacteria | 2979710463 | 2979714549 | 376 |
| 563 | iso_pu_bacteria | 2979808191 | 2979808951 | 376 |
| 564 | iso_pu_bacteria | 2987636660 | 2987642863 | 376 |
| 565 | iso_pu_bacteria | 2987659509 | 2987659919 | 376 |
| 566 | iso_pu_bacteria | 2987666974 | 2987671116 | 376 |
| 567 | iso_pu_bacteria | 3004188549 | 3004188966 | 376 |
| 568 | iso_pu_bacteria | 3004203850 | 3004210656 | 376 |
| 569 | iso_pu_bacteria | 3004211236 | 3004212846 | 376 |
| 570 | iso_pu_bacteria | 3004218560 | 3004223054 | 376 |
| 571 | iso_pu_bacteria | 8004374579 | 8004375662 | 376 |
| 572 | 3300009551 | Ga0105238_10414624 | Ga0105238_104146241 | 377 |
| 573 | 3300035695 | Ga0373927_0011590 | Ga0373927_0011590_74_1270 | 377 |
| 574 | 3300036401 | Ga0373937_0013664 | Ga0373937_0013664_5738_6934 | 377 |
| 575 | 3300037068 | Ga0373925_0038208 | Ga0373925_0038208_2100_3296 | 377 |
| 576 | 3300046475 | Ga0495639_0016556 | Ga0495639_0016556_1663_2865 | 377 |
| 577 | 3300046514 | Ga0495618_0029855 | Ga0495618_0029855_554_1768 | 377 |
| 578 | 3300046663 | Ga0495635_0156185 | Ga0495635_0156185_185_1381 | 377 |
| 579 | 3300050492 | nmdc:mga0yw44_18940_c1 | nmdc:mga0yw44_18940_c1_1677_2873 | 377 |
| 580 | iso_pu_bacteria | 2524023205 | 2524436115 | 377 |
| 581 | 3300005436 | Ga0070713_100011978 | Ga0070713_1000119783 | 378 |
| 582 | 3300006028 | Ga0070717_10017426 | Ga0070717_100174263 | 378 |
| 583 | 3300009093 | Ga0105240_10019955 | Ga0105240_1001995510 | 378 |
| 584 | 3300009093 | Ga0105240_10273743 | Ga0105240_102737432 | 378 |
| 585 | 3300009174 | Ga0105241_10013273 | Ga0105241_100132732 | 378 |
| 586 | 3300009545 | Ga0105237_10159030 | Ga0105237_101590301 | 378 |
| 587 | 3300010375 | Ga0105239_10001550 | Ga0105239_1000155020 | 378 |
| 588 | 3300010375 | Ga0105239_10380867 | Ga0105239_103808672 | 378 |
| 589 | 3300014968 | Ga0157379_10000395 | Ga0157379_1000039513 | 378 |
| 590 | 3300025924 | Ga0207694_10177602 | Ga0207694_101776021 | 378 |
| 591 | 3300026142 | Ga0207698_10058457 | Ga0207698_100584573 | 378 |
| 592 | 3300035083 | Ga0373926_0059385 | Ga0373926_0059385_190_1374 | 378 |
| 593 | 3300044901 | Ga0466960_0078755 | Ga0466960_0078755_463_1629 | 378 |
| 594 | 3300046507 | Ga0495606_0024526 | Ga0495606_0024526_158_1324 | 378 |
| 595 | 3300046557 | Ga0495622_0001209 | Ga0495622_0001209_10429_11646 | 378 |
| 596 | 3300046557 | Ga0495622_0067945 | Ga0495622_0067945_107_1273 | 378 |
| 597 | 3300046559 | Ga0495667_0079624 | Ga0495667_0079624_13_1179 | 378 |
| 598 | 3300047471 | Ga0495684_0121630 | Ga0495684_0121630_33_1199 | 378 |
| 599 | 3300048916 | Ga0496113_0280867 | Ga0496113_0280867_146_1312 | 378 |
| 600 | 3300053086 | Ga0500578_0006822 | Ga0500578_0006822_3592_4824 | 378 |
| 601 | 3300053153 | Ga0500616_0005315 | Ga0500616_0005315_3471_4673 | 378 |
| 602 | iso_pu_bacteria | 2791355199 | 2793083942 | 378 |
| 603 | iso_pu_bacteria | 2889033259 | 2889037835 | 378 |
| 604 | iso_pu_bacteria | 643348564 | 643592613 | 378 |
| 605 | 3300003215 | JGI25153J46596_10010116 | JGI25153J46596_100101162 | 379 |
| 606 | 3300003659 | JGI25404J52841_10006470 | JGI25404J52841_100064702 | 379 |
| 607 | 3300005262 | Ga0065165_1020027 | Ga0065165_10200273 | 379 |
| 608 | 3300005327 | Ga0070658_10027153 | Ga0070658_100271532 | 379 |
| 609 | 3300005339 | Ga0070660_100111925 | Ga0070660_1001119253 | 379 |
| 610 | 3300005344 | Ga0070661_100136708 | Ga0070661_1001367081 | 379 |
| 611 | 3300005355 | Ga0070671_100019458 | Ga0070671_1000194585 | 379 |
| 612 | 3300005455 | Ga0070663_100166097 | Ga0070663_1001660972 | 379 |
| 613 | 3300005539 | Ga0068853_100346679 | Ga0068853_1003466791 | 379 |
| 614 | 3300005548 | Ga0070665_100194716 | Ga0070665_1001947162 | 379 |
| 615 | 3300005548 | Ga0070665_100300953 | Ga0070665_1003009531 | 379 |
| 616 | 3300005563 | Ga0068855_100000006 | Ga0068855_100000006242 | 379 |
| 617 | 3300005563 | Ga0068855_100312069 | Ga0068855_1003120693 | 379 |
| 618 | 3300005616 | Ga0068852_100001922 | Ga0068852_1000019225 | 379 |
| 619 | 3300005616 | Ga0068852_100031085 | Ga0068852_1000310857 | 379 |
| 620 | 3300005842 | Ga0068858_100380920 | Ga0068858_1003809202 | 379 |
| 621 | 3300005843 | Ga0068860_100160031 | Ga0068860_1001600312 | 379 |
| 622 | 3300005937 | Ga0081455_10001978 | Ga0081455_1000197816 | 379 |
| 623 | 3300005983 | Ga0081540_1005364 | Ga0081540_10053649 | 379 |
| 624 | 3300005983 | Ga0081540_1008775 | Ga0081540_10087757 | 379 |
| 625 | 3300005983 | Ga0081540_1031323 | Ga0081540_10313233 | 379 |
| 626 | 3300005983 | Ga0081540_1074391 | Ga0081540_10743912 | 379 |
| 627 | 3300006048 | Ga0075363_100105989 | Ga0075363_1001059892 | 379 |
| 628 | 3300006051 | Ga0075364_10078265 | Ga0075364_100782652 | 379 |
| 629 | 3300006844 | Ga0075428_100101489 | Ga0075428_1001014894 | 379 |
| 630 | 3300006846 | Ga0075430_100004132 | Ga0075430_1000041322 | 379 |
| 631 | 3300006847 | Ga0075431_100007365 | Ga0075431_10000736510 | 379 |
| 632 | 3300006852 | Ga0075433_10007265 | Ga0075433_100072656 | 379 |
| 633 | 3300006871 | Ga0075434_100001874 | Ga0075434_10000187415 | 379 |
| 634 | 3300006880 | Ga0075429_100020847 | Ga0075429_1000208475 | 379 |
| 635 | 3300006944 | Ga0099823_1056234 | Ga0099823_10562342 | 379 |
| 636 | 3300009093 | Ga0105240_10000080 | Ga0105240_1000008056 | 379 |
| 637 | 3300009094 | Ga0111539_10116263 | Ga0111539_101162632 | 379 |
| 638 | 3300009147 | Ga0114129_10008567 | Ga0114129_1000856710 | 379 |
| 639 | 3300009177 | Ga0105248_10027112 | Ga0105248_100271127 | 379 |
| 640 | 3300009551 | Ga0105238_10000677 | Ga0105238_1000067722 | 379 |
| 641 | 3300009553 | Ga0105249_10141900 | Ga0105249_101419003 | 379 |
| 642 | 3300010375 | Ga0105239_10217294 | Ga0105239_102172942 | 379 |
| 643 | 3300017792 | Ga0163161_10199605 | Ga0163161_101996052 | 379 |
| 644 | 3300021320 | Ga0214544_1016901 | Ga0214544_10169016 | 379 |
| 645 | 3300021321 | Ga0214542_1016862 | Ga0214542_10168622 | 379 |
| 646 | 3300021327 | Ga0214543_1024357 | Ga0214543_10243572 | 379 |
| 647 | 3300025295 | Ga0209564_1019793 | Ga0209564_10197933 | 379 |
| 648 | 3300025297 | Ga0209758_1000477 | Ga0209758_10004779 | 379 |
| 649 | 3300025297 | Ga0209758_1004503 | Ga0209758_10045033 | 379 |
| 650 | 3300025297 | Ga0209758_1005549 | Ga0209758_10055497 | 379 |
| 651 | 3300025299 | Ga0209256_1010598 | Ga0209256_10105985 | 379 |
| 652 | 3300025302 | Ga0207426_1000519 | Ga0207426_100051951 | 379 |
| 653 | 3300025302 | Ga0207426_1002865 | Ga0207426_10028652 | 379 |
| 654 | 3300025304 | Ga0209257_1004960 | Ga0209257_10049604 | 379 |
| 655 | 3300025904 | Ga0207647_10010287 | Ga0207647_100102876 | 379 |
| 656 | 3300025909 | Ga0207705_10033730 | Ga0207705_100337304 | 379 |
| 657 | 3300025913 | Ga0207695_10000004 | Ga0207695_10000004636 | 379 |
| 658 | 3300025919 | Ga0207657_10078838 | Ga0207657_100788383 | 379 |
| 659 | 3300025924 | Ga0207694_10000014 | Ga0207694_10000014310 | 379 |
| 660 | 3300025933 | Ga0207706_10140759 | Ga0207706_101407593 | 379 |
| 661 | 3300025941 | Ga0207711_10322564 | Ga0207711_103225641 | 379 |
| 662 | 3300025949 | Ga0207667_10000202 | Ga0207667_1000020237 | 379 |
| 663 | 3300026041 | Ga0207639_10103867 | Ga0207639_101038671 | 379 |
| 664 | 3300026116 | Ga0207674_10161731 | Ga0207674_101617312 | 379 |
| 665 | 3300026118 | Ga0207675_100212550 | Ga0207675_1002125502 | 379 |
| 666 | 3300026142 | Ga0207698_10003027 | Ga0207698_100030278 | 379 |
| 667 | 3300027296 | Ga0209389_1000014 | Ga0209389_10000148 | 379 |
| 668 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007747 | 379 |
| 669 | 3300027357 | Ga0209589_1000020 | Ga0209589_10000208 | 379 |
| 670 | 3300027361 | Ga0209489_100251 | Ga0209489_10025147 | 379 |
| 671 | 3300027361 | Ga0209489_102003 | Ga0209489_10200336 | 379 |
| 672 | 3300027363 | Ga0209700_100271 | Ga0209700_10027146 | 379 |
| 673 | 3300027907 | Ga0207428_10000141 | Ga0207428_1000014115 | 379 |
| 674 | 3300028379 | Ga0268266_10230442 | Ga0268266_102304422 | 379 |
| 675 | 3300031903 | Ga0307407_10124419 | Ga0307407_101244191 | 379 |
| 676 | 3300037471 | Ga0395905_0039141 | Ga0395905_0039141_1680_2882 | 379 |
| 677 | 3300044658 | Ga0466972_0000850 | Ga0466972_0000850_6724_7926 | 379 |
| 678 | 3300044658 | Ga0466972_0008407 | Ga0466972_0008407_2031_3242 | 379 |
| 679 | 3300046462 | Ga0495651_0030168 | Ga0495651_0030168_2352_3554 | 379 |
| 680 | 3300046477 | Ga0495664_0027419 | Ga0495664_0027419_330_1532 | 379 |
| 681 | 3300046511 | Ga0495608_0046826 | Ga0495608_0046826_1558_2760 | 379 |
| 682 | 3300046522 | Ga0495643_0030555 | Ga0495643_0030555_135_1337 | 379 |
| 683 | 3300046529 | Ga0495652_0072645 | Ga0495652_0072645_655_1857 | 379 |
| 684 | 3300046543 | Ga0495645_0046341 | Ga0495645_0046341_877_2079 | 379 |
| 685 | 3300046642 | Ga0495634_0038079 | Ga0495634_0038079_981_2183 | 379 |
| 686 | 3300046663 | Ga0495635_0003249 | Ga0495635_0003249_4635_5837 | 379 |
| 687 | 3300046675 | Ga0495657_0002292 | Ga0495657_0002292_11747_12949 | 379 |
| 688 | 3300046678 | Ga0495599_0008570 | Ga0495599_0008570_4300_5502 | 379 |
| 689 | 3300046680 | Ga0495646_0012566 | Ga0495646_0012566_3471_4673 | 379 |
| 690 | 3300046809 | Ga0495600_0002145 | Ga0495600_0002145_2066_3268 | 379 |
| 691 | 3300047317 | Ga0495604_0038331 | Ga0495604_0038331_2353_3555 | 379 |
| 692 | 3300047322 | Ga0495680_0000920 | Ga0495680_0000920_23167_24369 | 379 |
| 693 | 3300047443 | Ga0495687_017251 | Ga0495687_017251_2298_3500 | 379 |
| 694 | 3300048088 | Ga0495602_0003728 | Ga0495602_0003728_7825_9027 | 379 |
| 695 | 3300048906 | Ga0496103_0031264 | Ga0496103_0031264_1666_2868 | 379 |
| 696 | 3300048913 | Ga0496110_0339174 | Ga0496110_0339174_117_1319 | 379 |
| 697 | 3300048915 | Ga0496112_0025987 | Ga0496112_0025987_2472_3680 | 379 |
| 698 | 3300048926 | Ga0496123_0136243 | Ga0496123_0136243_49_1251 | 379 |
| 699 | 3300048926 | Ga0496123_0153368 | Ga0496123_0153368_16_1209 | 379 |
| 700 | 3300048928 | Ga0496125_0039946 | Ga0496125_0039946_958_2160 | 379 |
| 701 | 3300049460 | Ga0495682_0000505 | Ga0495682_0000505_2164_3387 | 379 |
| 702 | 3300050507 | nmdc:mga05p37_117995_c1 | nmdc:mga05p37_117995_c1_918_2105 | 379 |
| 703 | 3300050508 | nmdc:mga09592_2872_c1 | nmdc:mga09592_2872_c1_9979_11166 | 379 |
| 704 | 3300050509 | nmdc:mga0qj67_19636_c1 | nmdc:mga0qj67_19636_c1_918_2105 | 379 |
| 705 | 3300050510 | nmdc:mga06r32_131736_c1 | nmdc:mga06r32_131736_c1_918_2105 | 379 |
| 706 | 3300050511 | nmdc:mga08y16_7584_c1 | nmdc:mga08y16_7584_c1_1159_2346 | 379 |
| 707 | 3300050511 | nmdc:mga08y16_88510_c1 | nmdc:mga08y16_88510_c1_41_1249 | 379 |
| 708 | 3300050512 | nmdc:mga0n895_1857_c1 | nmdc:mga0n895_1857_c1_5958_7145 | 379 |
| 709 | 3300053087 | Ga0500643_000373 | Ga0500643_000373_5070_6272 | 379 |
| 710 | 3300053091 | Ga0500647_0017242 | Ga0500647_0017242_163_1365 | 379 |
| 711 | 3300053092 | Ga0500583_0057419 | Ga0500583_0057419_516_1718 | 379 |
| 712 | 3300053103 | Ga0500555_001336 | Ga0500555_001336_2010_3212 | 379 |
| 713 | 3300053105 | Ga0500557_000003 | Ga0500557_000003_220758_221960 | 379 |
| 714 | 3300053119 | Ga0500595_035470 | Ga0500595_035470_112_1314 | 379 |
| 715 | 3300053122 | Ga0500608_041016 | Ga0500608_041016_97_1347 | 379 |
| 716 | 3300053133 | Ga0500655_005677 | Ga0500655_005677_181_1404 | 379 |
| 717 | 3300053177 | Ga0500636_0000857 | Ga0500636_0000857_7586_8788 | 379 |
| 718 | 3300053729 | Ga0500625_004251 | Ga0500625_004251_1301_2503 | 379 |
| 719 | iso_pu_bacteria | 2507262055 | 2507507495 | 379 |
| 720 | iso_pu_bacteria | 2508501009 | 2508541611 | 379 |
| 721 | iso_pu_bacteria | 2508501042 | 2508692847 | 379 |
| 722 | iso_pu_bacteria | 2511231028 | 2511398121 | 379 |
| 723 | iso_pu_bacteria | 2513237092 | 2513621688 | 379 |
| 724 | iso_pu_bacteria | 2513237094 | 2513636862 | 379 |
| 725 | iso_pu_bacteria | 2513237095 | 2513651192 | 379 |
| 726 | iso_pu_bacteria | 2513237161 | 2514011753 | 379 |
| 727 | iso_pu_bacteria | 2515154112 | 2515626240 | 379 |
| 728 | iso_pu_bacteria | 2617270735 | 2617352755 | 379 |
| 729 | iso_pu_bacteria | 2816332527 | 2818236730 | 379 |
| 730 | iso_pu_bacteria | 2824600985 | 2824602958 | 379 |
| 731 | iso_pu_bacteria | 2824609381 | 2824611819 | 379 |
| 732 | iso_pu_bacteria | 2824671348 | 2824672285 | 379 |
| 733 | iso_pu_bacteria | 2824679649 | 2824682307 | 379 |
| 734 | iso_pu_bacteria | 2824687955 | 2824688832 | 379 |
| 735 | iso_pu_bacteria | 2824704595 | 2824707862 | 379 |
| 736 | iso_pu_bacteria | 2824732956 | 2824733988 | 379 |
| 737 | iso_pu_bacteria | 2824753945 | 2824757949 | 379 |
| 738 | iso_pu_bacteria | 2824763712 | 2824766516 | 379 |
| 739 | iso_pu_bacteria | 2824773399 | 2824776639 | 379 |
| 740 | iso_pu_bacteria | 2838122688 | 2838129396 | 379 |
| 741 | iso_pu_bacteria | 2841941048 | 2841946432 | 379 |
| 742 | iso_pu_bacteria | 2841949485 | 2841953653 | 379 |
| 743 | iso_pu_bacteria | 2841957949 | 2841962741 | 379 |
| 744 | iso_pu_bacteria | 2841966195 | 2841972942 | 379 |
| 745 | iso_pu_bacteria | 2841974524 | 2841978386 | 379 |
| 746 | iso_pu_bacteria | 2841983080 | 2841990601 | 379 |
| 747 | iso_pu_bacteria | 2842038055 | 2842040819 | 379 |
| 748 | iso_pu_bacteria | 2842045827 | 2842046236 | 379 |
| 749 | iso_pu_bacteria | 2847930680 | 2847937500 | 379 |
| 750 | iso_pu_bacteria | 2849076700 | 2849078230 | 379 |
| 751 | iso_pu_bacteria | 2874590934 | 2874598610 | 379 |
| 752 | iso_pu_bacteria | 2874612657 | 2874619237 | 379 |
| 753 | iso_pu_bacteria | 2874620515 | 2874628247 | 379 |
| 754 | iso_pu_bacteria | 2874645413 | 2874652064 | 379 |
| 755 | iso_pu_bacteria | 2876771140 | 2876778649 | 379 |
| 756 | iso_pu_bacteria | 2876818435 | 2876823453 | 379 |
| 757 | iso_pu_bacteria | 2879074833 | 2879082442 | 379 |
| 758 | iso_pu_bacteria | 2879083081 | 2879084913 | 379 |
| 759 | iso_pu_bacteria | 2879127579 | 2879131777 | 379 |
| 760 | iso_pu_bacteria | 2879142872 | 2879150113 | 379 |
| 761 | iso_pu_bacteria | 2881364244 | 2881370077 | 379 |
| 762 | iso_pu_bacteria | 2881665667 | 2881670093 | 379 |
| 763 | iso_pu_bacteria | 2883291878 | 2883293807 | 379 |
| 764 | iso_pu_bacteria | 2885366525 | 2885370137 | 379 |
| 765 | iso_pu_bacteria | 2888378607 | 2888385652 | 379 |
| 766 | iso_pu_bacteria | 2888388044 | 2888392616 | 379 |
| 767 | iso_pu_bacteria | 2888419890 | 2888425771 | 379 |
| 768 | iso_pu_bacteria | 2904666416 | 2904674134 | 379 |
| 769 | iso_pu_bacteria | 2904699407 | 2904707258 | 379 |
| 770 | iso_pu_bacteria | 2904711408 | 2904711786 | 379 |
| 771 | iso_pu_bacteria | 2906626472 | 2906627770 | 379 |
| 772 | iso_pu_bacteria | 2906643746 | 2906645545 | 379 |
| 773 | iso_pu_bacteria | 2908775508 | 2908781352 | 379 |
| 774 | iso_pu_bacteria | 2919450847 | 2919450849 | 379 |
| 775 | iso_pu_bacteria | 2922393267 | 2922396899 | 379 |
| 776 | iso_pu_bacteria | 2929615660 | 2929621212 | 379 |
| 777 | iso_pu_bacteria | 2929624759 | 2929625957 | 379 |
| 778 | iso_pu_bacteria | 2933577622 | 2933582919 | 379 |
| 779 | iso_pu_bacteria | 2935608549 | 2935609998 | 379 |
| 780 | iso_pu_bacteria | 2935630451 | 2935634883 | 379 |
| 781 | iso_pu_bacteria | 2935648319 | 2935651973 | 379 |
| 782 | iso_pu_bacteria | 2935656913 | 2935660054 | 379 |
| 783 | iso_pu_bacteria | 2935675223 | 2935680135 | 379 |
| 784 | iso_pu_bacteria | 2935760218 | 2935768657 | 379 |
| 785 | iso_pu_bacteria | 2935819856 | 2935823158 | 379 |
| 786 | iso_pu_bacteria | 2935847175 | 2935848740 | 379 |
| 787 | iso_pu_bacteria | 2935908558 | 2935909454 | 379 |
| 788 | iso_pu_bacteria | 2935916978 | 2935917178 | 379 |
| 789 | iso_pu_bacteria | 2935926038 | 2935926935 | 379 |
| 790 | iso_pu_bacteria | 2935934488 | 2935937221 | 379 |
| 791 | iso_pu_bacteria | 2935942939 | 2935944476 | 379 |
| 792 | iso_pu_bacteria | 2935951376 | 2935952913 | 379 |
| 793 | iso_pu_bacteria | 2935967501 | 2935969753 | 379 |
| 794 | iso_pu_bacteria | 2935975950 | 2935976352 | 379 |
| 795 | iso_pu_bacteria | 2935984226 | 2935987199 | 379 |
| 796 | iso_pu_bacteria | 2936011229 | 2936014470 | 379 |
| 797 | iso_pu_bacteria | 2936019824 | 2936023690 | 379 |
| 798 | iso_pu_bacteria | 2936028420 | 2936031333 | 379 |
| 799 | iso_pu_bacteria | 2936046547 | 2936049576 | 379 |
| 800 | iso_pu_bacteria | 2936055302 | 2936061209 | 379 |
| 801 | iso_pu_bacteria | 2941507105 | 2941511786 | 379 |
| 802 | iso_pu_bacteria | 2941515067 | 2941519488 | 379 |
| 803 | iso_pu_bacteria | 2941523033 | 2941527819 | 379 |
| 804 | iso_pu_bacteria | 3005483717 | 3005485570 | 379 |
| 805 | iso_pu_bacteria | 3005506211 | 3005508263 | 379 |
| 806 | iso_pu_bacteria | 3005587118 | 3005588233 | 379 |
| 807 | iso_pu_bacteria | 3005594810 | 3005600493 | 379 |
| 808 | iso_pu_bacteria | 3005710791 | 3005715967 | 379 |
| 809 | iso_pu_bacteria | 8006984368 | 8006991463 | 379 |
| 810 | iso_pu_bacteria | 8016583857 | 8016594552 | 379 |
| 811 | iso_pu_bacteria | 8016630954 | 8016638988 | 379 |
| 812 | iso_pu_bacteria | 8019638758 | 8019646782 | 379 |
| 813 | iso_pu_bacteria | 8019648815 | 8019649551 | 379 |
| 814 | iso_pu_bacteria | 8019659431 | 8019660989 | 379 |
| 815 | iso_pu_bacteria | 8019668869 | 8019670559 | 379 |
| 816 | iso_pu_bacteria | 8019678201 | 8019685675 | 379 |
| 817 | iso_pu_bacteria | 8019687851 | 8019691252 | 379 |
| 818 | iso_pu_bacteria | 8055742211 | 8055744926 | 379 |
| 819 | 3300003215 | JGI25153J46596_10001525 | JGI25153J46596_1000152513 | 380 |
| 820 | 3300003320 | rootH2_10089381 | rootH2_100893811 | 380 |
| 821 | 3300005436 | Ga0070713_100084740 | Ga0070713_1000847402 | 380 |
| 822 | 3300005437 | Ga0070710_10002383 | Ga0070710_100023835 | 380 |
| 823 | 3300005439 | Ga0070711_100004924 | Ga0070711_1000049244 | 380 |
| 824 | 3300005614 | Ga0068856_100029401 | Ga0068856_1000294015 | 380 |
| 825 | 3300005842 | Ga0068858_100261472 | Ga0068858_1002614722 | 380 |
| 826 | 3300005983 | Ga0081540_1000703 | Ga0081540_100070333 | 380 |
| 827 | 3300005983 | Ga0081540_1007737 | Ga0081540_10077376 | 380 |
| 828 | 3300005983 | Ga0081540_1017077 | Ga0081540_10170775 | 380 |
| 829 | 3300005983 | Ga0081540_1025914 | Ga0081540_10259143 | 380 |
| 830 | 3300005985 | Ga0081539_10065465 | Ga0081539_100654652 | 380 |
| 831 | 3300006173 | Ga0070716_100009774 | Ga0070716_1000097744 | 380 |
| 832 | 3300006175 | Ga0070712_100069405 | Ga0070712_1000694053 | 380 |
| 833 | 3300006195 | Ga0075366_10127288 | Ga0075366_101272881 | 380 |
| 834 | 3300009098 | Ga0105245_10025672 | Ga0105245_100256722 | 380 |
| 835 | 3300014325 | Ga0163163_10083737 | Ga0163163_100837372 | 380 |
| 836 | 3300014969 | Ga0157376_10273498 | Ga0157376_102734981 | 380 |
| 837 | 3300025297 | Ga0209758_1002906 | Ga0209758_10029064 | 380 |
| 838 | 3300025898 | Ga0207692_10003877 | Ga0207692_100038773 | 380 |
| 839 | 3300025915 | Ga0207693_10003098 | Ga0207693_1000309810 | 380 |
| 840 | 3300025915 | Ga0207693_10114171 | Ga0207693_101141712 | 380 |
| 841 | 3300025916 | Ga0207663_10010101 | Ga0207663_100101013 | 380 |
| 842 | 3300025927 | Ga0207687_10030267 | Ga0207687_100302674 | 380 |
| 843 | 3300025929 | Ga0207664_10012913 | Ga0207664_100129134 | 380 |
| 844 | 3300025939 | Ga0207665_10015031 | Ga0207665_100150314 | 380 |
| 845 | 3300025942 | Ga0207689_10087574 | Ga0207689_100875742 | 380 |
| 846 | 3300025944 | Ga0207661_10132653 | Ga0207661_101326532 | 380 |
| 847 | 3300031731 | Ga0307405_10138910 | Ga0307405_101389101 | 380 |
| 848 | 3300035171 | Ga0373946_0007217 | Ga0373946_0007217_1422_2648 | 380 |
| 849 | 3300035410 | Ga0373924_0022390 | Ga0373924_0022390_870_2093 | 380 |
| 850 | 3300035692 | Ga0373935_0006788 | Ga0373935_0006788_2030_3256 | 380 |
| 851 | 3300035695 | Ga0373927_0002771 | Ga0373927_0002771_10751_11977 | 380 |
| 852 | 3300035695 | Ga0373927_0030797 | Ga0373927_0030797_566_1768 | 380 |
| 853 | 3300035725 | Ga0373947_0001734 | Ga0373947_0001734_6180_7406 | 380 |
| 854 | 3300036401 | Ga0373937_0010847 | Ga0373937_0010847_3426_4649 | 380 |
| 855 | 3300036401 | Ga0373937_0035546 | Ga0373937_0035546_2803_4014 | 380 |
| 856 | 3300037068 | Ga0373925_0001112 | Ga0373925_0001112_6163_7389 | 380 |
| 857 | 3300037418 | Ga0395900_0108032 | Ga0395900_0108032_226_1455 | 380 |
| 858 | 3300037471 | Ga0395905_0020297 | Ga0395905_0020297_4209_5429 | 380 |
| 859 | 3300046454 | Ga0495592_0005289 | Ga0495592_0005289_4195_5421 | 380 |
| 860 | 3300046455 | Ga0495603_0015327 | Ga0495603_0015327_3131_4357 | 380 |
| 861 | 3300046455 | Ga0495603_0046067 | Ga0495603_0046067_1304_2530 | 380 |
| 862 | 3300046459 | Ga0495629_0000585 | Ga0495629_0000585_26045_27271 | 380 |
| 863 | 3300046459 | Ga0495629_0027490 | Ga0495629_0027490_2033_3259 | 380 |
| 864 | 3300046460 | Ga0495638_0004117 | Ga0495638_0004117_150_1361 | 380 |
| 865 | 3300046460 | Ga0495638_0007340 | Ga0495638_0007340_5328_6554 | 380 |
| 866 | 3300046461 | Ga0495641_0009829 | Ga0495641_0009829_1920_3146 | 380 |
| 867 | 3300046462 | Ga0495651_0031330 | Ga0495651_0031330_1131_2354 | 380 |
| 868 | 3300046463 | Ga0495653_0035602 | Ga0495653_0035602_1649_2875 | 380 |
| 869 | 3300046473 | Ga0495582_0002024 | Ga0495582_0002024_9360_10586 | 380 |
| 870 | 3300046475 | Ga0495639_0000075 | Ga0495639_0000075_25696_26922 | 380 |
| 871 | 3300046476 | Ga0495662_0012265 | Ga0495662_0012265_180_1406 | 380 |
| 872 | 3300046477 | Ga0495664_0001938 | Ga0495664_0001938_2486_3709 | 380 |
| 873 | 3300046477 | Ga0495664_0002309 | Ga0495664_0002309_1363_2589 | 380 |
| 874 | 3300046499 | Ga0495594_0000120 | Ga0495594_0000120_18589_19815 | 380 |
| 875 | 3300046516 | Ga0495628_0023196 | Ga0495628_0023196_3796_5022 | 380 |
| 876 | 3300046517 | Ga0495630_0006828 | Ga0495630_0006828_3144_4370 | 380 |
| 877 | 3300046518 | Ga0495631_0019215 | Ga0495631_0019215_685_1911 | 380 |
| 878 | 3300046528 | Ga0495642_0062124 | Ga0495642_0062124_95_1321 | 380 |
| 879 | 3300046531 | Ga0495665_0000085 | Ga0495665_0000085_26089_27315 | 380 |
| 880 | 3300046533 | Ga0495640_0000210 | Ga0495640_0000210_21474_22700 | 380 |
| 881 | 3300046533 | Ga0495640_0057745 | Ga0495640_0057745_1341_2564 | 380 |
| 882 | 3300046538 | Ga0495609_0073708 | Ga0495609_0073708_63_1289 | 380 |
| 883 | 3300046543 | Ga0495645_0006472 | Ga0495645_0006472_2892_4115 | 380 |
| 884 | 3300046557 | Ga0495622_0005529 | Ga0495622_0005529_3043_4269 | 380 |
| 885 | 3300046642 | Ga0495634_0000064 | Ga0495634_0000064_77536_78762 | 380 |
| 886 | 3300046663 | Ga0495635_0000316 | Ga0495635_0000316_26909_28135 | 380 |
| 887 | 3300046675 | Ga0495657_0078810 | Ga0495657_0078810_642_1865 | 380 |
| 888 | 3300046679 | Ga0495623_0033774 | Ga0495623_0033774_722_1945 | 380 |
| 889 | 3300046679 | Ga0495623_0122639 | Ga0495623_0122639_138_1364 | 380 |
| 890 | 3300046680 | Ga0495646_0027050 | Ga0495646_0027050_1998_3221 | 380 |
| 891 | 3300046681 | Ga0495647_0000458 | Ga0495647_0000458_6257_7483 | 380 |
| 892 | 3300046683 | Ga0495658_0012805 | Ga0495658_0012805_2307_3533 | 380 |
| 893 | 3300046689 | Ga0495613_0001871 | Ga0495613_0001871_7346_8572 | 380 |
| 894 | 3300046690 | Ga0495624_0001019 | Ga0495624_0001019_9171_10397 | 380 |
| 895 | 3300046794 | Ga0495589_0033890 | Ga0495589_0033890_1101_2327 | 380 |
| 896 | 3300047315 | Ga0495581_0000014 | Ga0495581_0000014_6879_8105 | 380 |
| 897 | 3300047315 | Ga0495581_0046986 | Ga0495581_0046986_962_2188 | 380 |
| 898 | 3300047317 | Ga0495604_0045111 | Ga0495604_0045111_217_1440 | 380 |
| 899 | 3300047319 | Ga0495674_0003302 | Ga0495674_0003302_1471_2697 | 380 |
| 900 | 3300047321 | Ga0495676_0035424 | Ga0495676_0035424_987_2213 | 380 |
| 901 | 3300047322 | Ga0495680_0008385 | Ga0495680_0008385_2061_3284 | 380 |
| 902 | 3300047322 | Ga0495680_0225335 | Ga0495680_0225335_15_1235 | 380 |
| 903 | 3300047444 | Ga0495675_0028151 | Ga0495675_0028151_2337_3560 | 380 |
| 904 | 3300047471 | Ga0495684_0064910 | Ga0495684_0064910_718_1941 | 380 |
| 905 | 3300047673 | Ga0495593_0000003 | Ga0495593_0000003_35661_36887 | 380 |
| 906 | 3300048088 | Ga0495602_0000619 | Ga0495602_0000619_24784_26007 | 380 |
| 907 | 3300048905 | Ga0496102_0012597 | Ga0496102_0012597_2908_4170 | 380 |
| 908 | 3300048907 | Ga0496104_0023289 | Ga0496104_0023289_3058_4320 | 380 |
| 909 | 3300048911 | Ga0496108_0031446 | Ga0496108_0031446_2467_3729 | 380 |
| 910 | 3300048912 | Ga0496109_0055081 | Ga0496109_0055081_2355_3617 | 380 |
| 911 | 3300048914 | Ga0496111_0094900 | Ga0496111_0094900_85_1347 | 380 |
| 912 | 3300048915 | Ga0496112_0001615 | Ga0496112_0001615_8395_9657 | 380 |
| 913 | 3300048927 | Ga0496124_0080696 | Ga0496124_0080696_1052_2278 | 380 |
| 914 | 3300048929 | Ga0496126_0003109 | Ga0496126_0003109_6458_7684 | 380 |
| 915 | 3300049568 | Ga0501031_0028352 | Ga0501031_0028352_2273_3481 | 380 |
| 916 | 3300049575 | Ga0501039_0140031 | Ga0501039_0140031_89_1297 | 380 |
| 917 | 3300049578 | Ga0501042_0105162 | Ga0501042_0105162_38_1246 | 380 |
| 918 | 3300049579 | Ga0501043_0084041 | Ga0501043_0084041_338_1546 | 380 |
| 919 | 3300049581 | Ga0501047_0009098 | Ga0501047_0009098_1612_2793 | 380 |
| 920 | 3300049583 | Ga0501067_0000469 | Ga0501067_0000469_9107_10288 | 380 |
| 921 | 3300049587 | Ga0501071_0027922 | Ga0501071_0027922_1590_2798 | 380 |
| 922 | 3300049588 | Ga0501072_0053029 | Ga0501072_0053029_324_1532 | 380 |
| 923 | 3300049588 | Ga0501072_0074758 | Ga0501072_0074758_648_1829 | 380 |
| 924 | 3300049589 | Ga0501073_0002098 | Ga0501073_0002098_11171_12352 | 380 |
| 925 | 3300049589 | Ga0501073_0180325 | Ga0501073_0180325_142_1350 | 380 |
| 926 | 3300049591 | Ga0501075_0041883 | Ga0501075_0041883_1584_2792 | 380 |
| 927 | 3300049591 | Ga0501075_0080380 | Ga0501075_0080380_1139_2437 | 380 |
| 928 | 3300049592 | Ga0501076_0058073 | Ga0501076_0058073_557_1855 | 380 |
| 929 | 3300049593 | Ga0501077_0010828 | Ga0501077_0010828_2526_3734 | 380 |
| 930 | 3300049741 | Ga0501079_0021691 | Ga0501079_0021691_1097_2401 | 380 |
| 931 | 3300049742 | Ga0501080_0084330 | Ga0501080_0084330_1432_2640 | 380 |
| 932 | 3300049742 | Ga0501080_0100705 | Ga0501080_0100705_1074_2255 | 380 |
| 933 | 3300049743 | Ga0501081_0040380 | Ga0501081_0040380_495_1793 | 380 |
| 934 | 3300049822 | Ga0501035_0118062 | Ga0501035_0118062_1014_2222 | 380 |
| 935 | 3300049824 | Ga0501045_0033401 | Ga0501045_0033401_2265_3473 | 380 |
| 936 | 3300050515 | nmdc:mga0a205_56157_c1 | nmdc:mga0a205_56157_c1_1934_3112 | 380 |
| 937 | 3300053077 | Ga0495601_0019745 | Ga0495601_0019745_1502_2725 | 380 |
| 938 | 3300053078 | Ga0495612_0001185 | Ga0495612_0001185_759_1982 | 380 |
| 939 | 3300053084 | Ga0495595_0046427 | Ga0495595_0046427_201_1424 | 380 |
| 940 | 3300053108 | Ga0500562_006314 | Ga0500562_006314_244_1455 | 380 |
| 941 | 3300053150 | Ga0500603_000522 | Ga0500603_000522_5214_6428 | 380 |
| 942 | 3300053156 | Ga0500622_0000277 | Ga0500622_0000277_27387_28598 | 380 |
| 943 | 3300054114 | Ga0501084_0072294 | Ga0501084_0072294_1113_2294 | 380 |
| 944 | 3300061734 | Ga0530510_0034130 | Ga0530510_0034130_792_2090 | 380 |
| 945 | iso_pu_bacteria | 2517093001 | 2517104349 | 380 |
| 946 | iso_pu_bacteria | 2667528175 | 2671118979 | 380 |
| 947 | iso_pu_bacteria | 2844315083 | 2844318697 | 380 |
| 948 | iso_pu_bacteria | 2876808645 | 2876813662 | 380 |
| 949 | iso_pu_bacteria | 2879110137 | 2879117416 | 380 |
| 950 | iso_pu_bacteria | 2903727486 | 2903728828 | 380 |
| 951 | iso_pu_bacteria | 2904690495 | 2904698913 | 380 |
| 952 | iso_pu_bacteria | 2906602504 | 2906604474 | 380 |
| 953 | iso_pu_bacteria | 2935675223 | 2935680068 | 380 |
| 954 | iso_pu_bacteria | 2935684952 | 2935693851 | 380 |
| 955 | iso_pu_bacteria | 2935694250 | 2935700708 | 380 |
| 956 | iso_pu_bacteria | 2935713505 | 2935721973 | 380 |
| 957 | iso_pu_bacteria | 2935722832 | 2935731382 | 380 |
| 958 | iso_pu_bacteria | 2935732158 | 2935741082 | 380 |
| 959 | iso_pu_bacteria | 2935741537 | 2935750458 | 380 |
| 960 | iso_pu_bacteria | 2935750917 | 2935759713 | 380 |
| 961 | iso_pu_bacteria | 2940556831 | 2940565618 | 380 |
| 962 | iso_pu_bacteria | 8006964411 | 8006973179 | 380 |
| 963 | iso_pu_bacteria | 8056967851 | 8056973105 | 380 |
| 964 | 3300001979 | JGI24740J21852_10005779 | JGI24740J21852_100057792 | 381 |
| 965 | 3300001990 | JGI24737J22298_10022085 | JGI24737J22298_100220852 | 381 |
| 966 | 3300002067 | JGI24735J21928_10018519 | JGI24735J21928_100185192 | 381 |
| 967 | 3300003203 | JGI25406J46586_10004853 | JGI25406J46586_100048535 | 381 |
| 968 | 3300005336 | Ga0070680_100103460 | Ga0070680_1001034603 | 381 |
| 969 | 3300005436 | Ga0070713_100107094 | Ga0070713_1001070941 | 381 |
| 970 | 3300005458 | Ga0070681_10016111 | Ga0070681_100161111 | 381 |
| 971 | 3300005530 | Ga0070679_100004347 | Ga0070679_1000043472 | 381 |
| 972 | 3300005563 | Ga0068855_100067922 | Ga0068855_1000679222 | 381 |
| 973 | 3300005563 | Ga0068855_100136732 | Ga0068855_1001367322 | 381 |
| 974 | 3300005578 | Ga0068854_100004568 | Ga0068854_1000045684 | 381 |
| 975 | 3300005834 | Ga0068851_10030723 | Ga0068851_100307232 | 381 |
| 976 | 3300005937 | Ga0081455_10005841 | Ga0081455_100058417 | 381 |
| 977 | 3300005983 | Ga0081540_1008055 | Ga0081540_10080552 | 381 |
| 978 | 3300005985 | Ga0081539_10002228 | Ga0081539_100022284 | 381 |
| 979 | 3300006852 | Ga0075433_10041337 | Ga0075433_100413374 | 381 |
| 980 | 3300006871 | Ga0075434_100039468 | Ga0075434_1000394684 | 381 |
| 981 | 3300006871 | Ga0075434_100127116 | Ga0075434_1001271162 | 381 |
| 982 | 3300007076 | Ga0075435_100053578 | Ga0075435_1000535782 | 381 |
| 983 | 3300009093 | Ga0105240_10236563 | Ga0105240_102365631 | 381 |
| 984 | 3300009101 | Ga0105247_10136163 | Ga0105247_101361632 | 381 |
| 985 | 3300009174 | Ga0105241_10002269 | Ga0105241_100022692 | 381 |
| 986 | 3300009545 | Ga0105237_10069211 | Ga0105237_100692112 | 381 |
| 987 | 3300009551 | Ga0105238_10153401 | Ga0105238_101534012 | 381 |
| 988 | 3300013307 | Ga0157372_10057946 | Ga0157372_100579463 | 381 |
| 989 | 3300014325 | Ga0163163_10077645 | Ga0163163_100776452 | 381 |
| 990 | 3300025254 | Ga0209148_1001164 | Ga0209148_100116412 | 381 |
| 991 | 3300025272 | Ga0209455_1003325 | Ga0209455_10033255 | 381 |
| 992 | 3300025321 | Ga0207656_10033315 | Ga0207656_100333151 | 381 |
| 993 | 3300025904 | Ga0207647_10017568 | Ga0207647_100175682 | 381 |
| 994 | 3300025911 | Ga0207654_10000362 | Ga0207654_1000036227 | 381 |
| 995 | 3300025912 | Ga0207707_10000962 | Ga0207707_1000096211 | 381 |
| 996 | 3300025913 | Ga0207695_10046839 | Ga0207695_100468392 | 381 |
| 997 | 3300025917 | Ga0207660_10096446 | Ga0207660_100964462 | 381 |
| 998 | 3300025921 | Ga0207652_10008084 | Ga0207652_100080844 | 381 |
| 999 | 3300025924 | Ga0207694_10003423 | Ga0207694_100034233 | 381 |
| 1000 | 3300025928 | Ga0207700_10043281 | Ga0207700_100432812 | 381 |
| 1001 | 3300025929 | Ga0207664_10226617 | Ga0207664_102266171 | 381 |
| 1002 | 3300025939 | Ga0207665_10012851 | Ga0207665_100128511 | 381 |
| 1003 | 3300025949 | Ga0207667_10090752 | Ga0207667_100907522 | 381 |
| 1004 | 3300025949 | Ga0207667_10189149 | Ga0207667_101891492 | 381 |
| 1005 | 3300026067 | Ga0207678_10050743 | Ga0207678_100507432 | 381 |
| 1006 | 3300026078 | Ga0207702_10006411 | Ga0207702_100064118 | 381 |
| 1007 | 3300037068 | Ga0373925_0157260 | Ga0373925_0157260_36_1265 | 381 |
| 1008 | 3300037471 | Ga0395905_0025863 | Ga0395905_0025863_2948_4198 | 381 |
| 1009 | 3300048907 | Ga0496104_0079256 | Ga0496104_0079256_647_1861 | 381 |
| 1010 | 3300048912 | Ga0496109_0037236 | Ga0496109_0037236_1062_2276 | 381 |
| 1011 | 3300048916 | Ga0496113_0041498 | Ga0496113_0041498_1110_2324 | 381 |
| 1012 | 3300049593 | Ga0501077_0177889 | Ga0501077_0177889_14_1201 | 381 |
| 1013 | 3300050512 | nmdc:mga0n895_67313_c1 | nmdc:mga0n895_67313_c1_2251_3465 | 381 |
| 1014 | 3300053077 | Ga0495601_0042137 | Ga0495601_0042137_1168_2388 | 381 |
| 1015 | iso_pu_bacteria | 2513237101 | 2513693703 | 381 |
| 1016 | iso_pu_bacteria | 2513237104 | 2513721476 | 381 |
| 1017 | iso_pu_bacteria | 2513237145 | 2513920829 | 381 |
| 1018 | iso_pu_bacteria | 2744054633 | 2745080929 | 381 |
| 1019 | iso_pu_bacteria | 2824617872 | 2824621547 | 381 |
| 1020 | iso_pu_bacteria | 2824626560 | 2824630659 | 381 |
| 1021 | iso_pu_bacteria | 2824635225 | 2824641095 | 381 |
| 1022 | iso_pu_bacteria | 2874604998 | 2874611565 | 381 |
| 1023 | iso_pu_bacteria | 2876761206 | 2876768259 | 381 |
| 1024 | iso_pu_bacteria | 2922361189 | 2922361780 | 381 |
| 1025 | iso_pu_bacteria | 2922386360 | 2922386978 | 381 |
| 1026 | iso_pu_bacteria | 3005718088 | 3005720197 | 381 |
| 1027 | iso_pu_bacteria | 8006926726 | 8006928605 | 381 |
| 1028 | iso_pu_bacteria | 8006994254 | 8006994598 | 381 |
| 1029 | iso_pu_bacteria | 8056673599 | 8056680936 | 381 |
| 1030 | 3300005336 | Ga0070680_100220727 | Ga0070680_1002207272 | 382 |
| 1031 | 3300005545 | Ga0070695_100092429 | Ga0070695_1000924293 | 382 |
| 1032 | 3300005546 | Ga0070696_100070185 | Ga0070696_1000701854 | 382 |
| 1033 | 3300005843 | Ga0068860_100312200 | Ga0068860_1003122002 | 382 |
| 1034 | 3300006847 | Ga0075431_100115054 | Ga0075431_1001150542 | 382 |
| 1035 | 3300009101 | Ga0105247_10031058 | Ga0105247_100310584 | 382 |
| 1036 | 3300009147 | Ga0114129_10046902 | Ga0114129_100469022 | 382 |
| 1037 | 3300010375 | Ga0105239_10127209 | Ga0105239_101272092 | 382 |
| 1038 | 3300010375 | Ga0105239_10286979 | Ga0105239_102869792 | 382 |
| 1039 | 3300013297 | Ga0157378_10162229 | Ga0157378_101622292 | 382 |
| 1040 | 3300013306 | Ga0163162_10414419 | Ga0163162_104144192 | 382 |
| 1041 | 3300013308 | Ga0157375_10288331 | Ga0157375_102883312 | 382 |
| 1042 | 3300026075 | Ga0207708_10078051 | Ga0207708_100780512 | 382 |
| 1043 | 3300036401 | Ga0373937_0028390 | Ga0373937_0028390_3585_4808 | 382 |
| 1044 | 3300046525 | Ga0495663_0024935 | Ga0495663_0024935_464_1702 | 382 |
| 1045 | 3300048912 | Ga0496109_0270154 | Ga0496109_0270154_252_1511 | 382 |
| 1046 | 3300049577 | Ga0501041_0043878 | Ga0501041_0043878_974_2212 | 382 |
| 1047 | 3300049584 | Ga0501068_0046997 | Ga0501068_0046997_1316_2554 | 382 |
| 1048 | 3300049588 | Ga0501072_0063405 | Ga0501072_0063405_848_2089 | 382 |
| 1049 | 3300049743 | Ga0501081_0030845 | Ga0501081_0030845_300_1541 | 382 |
| 1050 | 3300050510 | nmdc:mga06r32_146541_c1 | nmdc:mga06r32_146541_c1_596_1834 | 382 |
| 1051 | 3300053077 | Ga0495601_0006916 | Ga0495601_0006916_3034_4281 | 382 |
| 1052 | 3300053084 | Ga0495595_0018656 | Ga0495595_0018656_73_1326 | 382 |
| 1053 | 3300053085 | Ga0495619_0017008 | Ga0495619_0017008_476_1723 | 382 |
| 1054 | 3300060353 | Ga0501082_0030779 | Ga0501082_0030779_2304_3545 | 382 |
| 1055 | 3300060353 | Ga0501082_0231080 | Ga0501082_0231080_151_1389 | 382 |
| 1056 | 3300061734 | Ga0530510_0062640 | Ga0530510_0062640_506_1744 | 382 |
| 1057 | 3300061734 | Ga0530510_0184123 | Ga0530510_0184123_109_1341 | 382 |
| 1058 | 3300005335 | Ga0070666_10021842 | Ga0070666_100218422 | 383 |
| 1059 | 3300005338 | Ga0068868_100117797 | Ga0068868_1001177972 | 383 |
| 1060 | 3300005340 | Ga0070689_100037348 | Ga0070689_1000373481 | 383 |
| 1061 | 3300005355 | Ga0070671_100222670 | Ga0070671_1002226702 | 383 |
| 1062 | 3300005364 | Ga0070673_100099740 | Ga0070673_1000997402 | 383 |
| 1063 | 3300005366 | Ga0070659_100083201 | Ga0070659_1000832013 | 383 |
| 1064 | 3300005367 | Ga0070667_100051633 | Ga0070667_1000516332 | 383 |
| 1065 | 3300005434 | Ga0070709_10014253 | Ga0070709_100142533 | 383 |
| 1066 | 3300005436 | Ga0070713_100070534 | Ga0070713_1000705343 | 383 |
| 1067 | 3300005437 | Ga0070710_10011141 | Ga0070710_100111413 | 383 |
| 1068 | 3300005439 | Ga0070711_100018280 | Ga0070711_1000182803 | 383 |
| 1069 | 3300005440 | Ga0070705_100115440 | Ga0070705_1001154402 | 383 |
| 1070 | 3300005456 | Ga0070678_100007290 | Ga0070678_1000072903 | 383 |
| 1071 | 3300005544 | Ga0070686_100003943 | Ga0070686_1000039432 | 383 |
| 1072 | 3300005547 | Ga0070693_100040355 | Ga0070693_1000403554 | 383 |
| 1073 | 3300005618 | Ga0068864_100225316 | Ga0068864_1002253162 | 383 |
| 1074 | 3300005718 | Ga0068866_10071692 | Ga0068866_100716922 | 383 |
| 1075 | 3300005719 | Ga0068861_100202004 | Ga0068861_1002020042 | 383 |
| 1076 | 3300005841 | Ga0068863_100087457 | Ga0068863_1000874573 | 383 |
| 1077 | 3300005842 | Ga0068858_100215097 | Ga0068858_1002150971 | 383 |
| 1078 | 3300006028 | Ga0070717_10009288 | Ga0070717_100092883 | 383 |
| 1079 | 3300006175 | Ga0070712_100034943 | Ga0070712_1000349432 | 383 |
| 1080 | 3300006237 | Ga0097621_100120396 | Ga0097621_1001203963 | 383 |
| 1081 | 3300006358 | Ga0068871_100009687 | Ga0068871_1000096872 | 383 |
| 1082 | 3300006881 | Ga0068865_100014777 | Ga0068865_1000147772 | 383 |
| 1083 | 3300009011 | Ga0105251_10027458 | Ga0105251_100274583 | 383 |
| 1084 | 3300009101 | Ga0105247_10082847 | Ga0105247_100828472 | 383 |
| 1085 | 3300009148 | Ga0105243_10059810 | Ga0105243_100598104 | 383 |
| 1086 | 3300010375 | Ga0105239_10063147 | Ga0105239_100631472 | 383 |
| 1087 | 3300011119 | Ga0105246_10033761 | Ga0105246_100337612 | 383 |
| 1088 | 3300013296 | Ga0157374_10042893 | Ga0157374_100428932 | 383 |
| 1089 | 3300013297 | Ga0157378_10016311 | Ga0157378_100163113 | 383 |
| 1090 | 3300014325 | Ga0163163_10166764 | Ga0163163_101667643 | 383 |
| 1091 | 3300014968 | Ga0157379_10112274 | Ga0157379_101122742 | 383 |
| 1092 | 3300014969 | Ga0157376_10116919 | Ga0157376_101169193 | 383 |
| 1093 | 3300025898 | Ga0207692_10012613 | Ga0207692_100126133 | 383 |
| 1094 | 3300025900 | Ga0207710_10015843 | Ga0207710_100158433 | 383 |
| 1095 | 3300025903 | Ga0207680_10002857 | Ga0207680_100028575 | 383 |
| 1096 | 3300025906 | Ga0207699_10004401 | Ga0207699_100044013 | 383 |
| 1097 | 3300025907 | Ga0207645_10160148 | Ga0207645_101601482 | 383 |
| 1098 | 3300025915 | Ga0207693_10031616 | Ga0207693_100316163 | 383 |
| 1099 | 3300025919 | Ga0207657_10051755 | Ga0207657_100517552 | 383 |
| 1100 | 3300025927 | Ga0207687_10011239 | Ga0207687_100112392 | 383 |
| 1101 | 3300025928 | Ga0207700_10002297 | Ga0207700_100022974 | 383 |
| 1102 | 3300025931 | Ga0207644_10011173 | Ga0207644_100111734 | 383 |
| 1103 | 3300025933 | Ga0207706_10163887 | Ga0207706_101638872 | 383 |
| 1104 | 3300025934 | Ga0207686_10013343 | Ga0207686_100133435 | 383 |
| 1105 | 3300025936 | Ga0207670_10044000 | Ga0207670_100440002 | 383 |
| 1106 | 3300025938 | Ga0207704_10139348 | Ga0207704_101393481 | 383 |
| 1107 | 3300025941 | Ga0207711_10015827 | Ga0207711_100158275 | 383 |
| 1108 | 3300025942 | Ga0207689_10126797 | Ga0207689_101267971 | 383 |
| 1109 | 3300025960 | Ga0207651_10081661 | Ga0207651_100816612 | 383 |
| 1110 | 3300026023 | Ga0207677_10077257 | Ga0207677_100772572 | 383 |
| 1111 | 3300026035 | Ga0207703_10053636 | Ga0207703_100536361 | 383 |
| 1112 | 3300026067 | Ga0207678_10004265 | Ga0207678_100042651 | 383 |
| 1113 | 3300026095 | Ga0207676_10172743 | Ga0207676_101727432 | 383 |
| 1114 | 3300026121 | Ga0207683_10014300 | Ga0207683_100143007 | 383 |
| 1115 | 3300028379 | Ga0268266_10084516 | Ga0268266_100845162 | 383 |
| 1116 | 3300035111 | Ga0373923_0067501 | Ga0373923_0067501_242_1474 | 383 |
| 1117 | 3300035120 | Ga0373957_0035902 | Ga0373957_0035902_219_1451 | 383 |
| 1118 | 3300035692 | Ga0373935_0041660 | Ga0373935_0041660_487_1698 | 383 |
| 1119 | 3300035725 | Ga0373947_0007909 | Ga0373947_0007909_4175_5386 | 383 |
| 1120 | 3300036401 | Ga0373937_0096910 | Ga0373937_0096910_775_2007 | 383 |
| 1121 | 3300037068 | Ga0373925_0030889 | Ga0373925_0030889_2200_3411 | 383 |
| 1122 | 3300046459 | Ga0495629_0002289 | Ga0495629_0002289_4478_5689 | 383 |
| 1123 | 3300046461 | Ga0495641_0043522 | Ga0495641_0043522_398_1609 | 383 |
| 1124 | 3300046533 | Ga0495640_0144985 | Ga0495640_0144985_55_1287 | 383 |
| 1125 | 3300046683 | Ga0495658_0006005 | Ga0495658_0006005_3195_4406 | 383 |
| 1126 | 3300046689 | Ga0495613_0067259 | Ga0495613_0067259_1294_2505 | 383 |
| 1127 | 3300046809 | Ga0495600_0104438 | Ga0495600_0104438_587_1798 | 383 |
| 1128 | 3300047322 | Ga0495680_0004774 | Ga0495680_0004774_7474_8685 | 383 |
| 1129 | 3300048903 | Ga0496100_0024359 | Ga0496100_0024359_1203_2414 | 383 |
| 1130 | 3300048906 | Ga0496103_0013673 | Ga0496103_0013673_1278_2489 | 383 |
| 1131 | 3300048907 | Ga0496104_0115499 | Ga0496104_0115499_556_1767 | 383 |
| 1132 | 3300048909 | Ga0496106_0017681 | Ga0496106_0017681_2783_3994 | 383 |
| 1133 | 3300048910 | Ga0496107_0024125 | Ga0496107_0024125_1445_2656 | 383 |
| 1134 | 3300048913 | Ga0496110_0015600 | Ga0496110_0015600_2181_3392 | 383 |
| 1135 | 3300048914 | Ga0496111_0029072 | Ga0496111_0029072_449_1660 | 383 |
| 1136 | 3300048916 | Ga0496113_0014198 | Ga0496113_0014198_1584_2795 | 383 |
| 1137 | 3300048917 | Ga0496114_0002810 | Ga0496114_0002810_11584_12795 | 383 |
| 1138 | 3300053085 | Ga0495619_0000903 | Ga0495619_0000903_3167_4378 | 383 |
| 1139 | 3300005937 | Ga0081455_10002720 | Ga0081455_1000272023 | 384 |
| 1140 | 3300014497 | Ga0182008_10062630 | Ga0182008_100626302 | 384 |
| 1141 | 3300015262 | Ga0182007_10014866 | Ga0182007_100148662 | 384 |
| 1142 | 3300025927 | Ga0207687_10144333 | Ga0207687_101443332 | 384 |
| 1143 | 3300025961 | Ga0207712_10031760 | Ga0207712_100317603 | 384 |
| 1144 | 3300046663 | Ga0495635_0140531 | Ga0495635_0140531_314_1618 | 384 |
| 1145 | 3300048908 | Ga0496105_0022475 | Ga0496105_0022475_3027_4283 | 384 |
| 1146 | 3300048915 | Ga0496112_0038338 | Ga0496112_0038338_1844_3100 | 384 |
| 1147 | 3300048916 | Ga0496113_0038768 | Ga0496113_0038768_670_1926 | 384 |
| 1148 | 2209111006 | 2214770201 | 2213788963 | 385 |
| 1149 | 3300000043 | ARcpr5yngRDRAFT_c000153 | ARcpr5yngRDRAFT_0001531 | 385 |
| 1150 | 3300000044 | ARSoilOldRDRAFT_c000159 | ARSoilOldRDRAFT_0001592 | 385 |
| 1151 | 3300009174 | Ga0105241_10083649 | Ga0105241_100836492 | 385 |
| 1152 | 3300014325 | Ga0163163_10283800 | Ga0163163_102838002 | 385 |
| 1153 | 3300025912 | Ga0207707_10199037 | Ga0207707_101990372 | 385 |
| 1154 | 3300027907 | Ga0207428_10100379 | Ga0207428_101003791 | 385 |
| 1155 | 3300034957 | Ga0373938_0007345 | Ga0373938_0007345_692_1882 | 385 |
| 1156 | 3300035083 | Ga0373926_0000112 | Ga0373926_0000112_12542_13768 | 385 |
| 1157 | 3300035089 | Ga0373944_0000117 | Ga0373944_0000117_614_1831 | 385 |
| 1158 | 3300035092 | Ga0373952_0011540 | Ga0373952_0011540_380_1570 | 385 |
| 1159 | 3300035111 | Ga0373923_0000131 | Ga0373923_0000131_733_1959 | 385 |
| 1160 | 3300035113 | Ga0373936_0017475 | Ga0373936_0017475_1090_2307 | 385 |
| 1161 | 3300035116 | Ga0373945_0000318 | Ga0373945_0000318_446_1672 | 385 |
| 1162 | 3300035118 | Ga0373954_0004094 | Ga0373954_0004094_2625_3842 | 385 |
| 1163 | 3300035120 | Ga0373957_0022745 | Ga0373957_0022745_804_2021 | 385 |
| 1164 | 3300035170 | Ga0373943_0026878 | Ga0373943_0026878_526_1752 | 385 |
| 1165 | 3300035171 | Ga0373946_0000433 | Ga0373946_0000433_12215_13441 | 385 |
| 1166 | 3300035410 | Ga0373924_0003004 | Ga0373924_0003004_4488_5714 | 385 |
| 1167 | 3300035691 | Ga0373931_0001099 | Ga0373931_0001099_10121_11311 | 385 |
| 1168 | 3300035692 | Ga0373935_0031439 | Ga0373935_0031439_1892_3109 | 385 |
| 1169 | 3300035724 | Ga0373933_0010022 | Ga0373933_0010022_2774_4000 | 385 |
| 1170 | 3300036401 | Ga0373937_0095760 | Ga0373937_0095760_877_2103 | 385 |
| 1171 | 3300037471 | Ga0395905_0004064 | Ga0395905_0004064_1682_2947 | 385 |
| 1172 | 3300044901 | Ga0466960_0026844 | Ga0466960_0026844_244_1509 | 385 |
| 1173 | 3300046454 | Ga0495592_0001758 | Ga0495592_0001758_1306_2523 | 385 |
| 1174 | 3300046455 | Ga0495603_0014702 | Ga0495603_0014702_1402_2619 | 385 |
| 1175 | 3300046459 | Ga0495629_0010123 | Ga0495629_0010123_2824_4050 | 385 |
| 1176 | 3300046462 | Ga0495651_0003868 | Ga0495651_0003868_9454_10671 | 385 |
| 1177 | 3300046463 | Ga0495653_0004843 | Ga0495653_0004843_8217_9434 | 385 |
| 1178 | 3300046473 | Ga0495582_0012870 | Ga0495582_0012870_199_1416 | 385 |
| 1179 | 3300046475 | Ga0495639_0009632 | Ga0495639_0009632_2482_3699 | 385 |
| 1180 | 3300046476 | Ga0495662_0006110 | Ga0495662_0006110_3323_4540 | 385 |
| 1181 | 3300046477 | Ga0495664_0007514 | Ga0495664_0007514_467_1684 | 385 |
| 1182 | 3300046491 | Ga0495584_0008302 | Ga0495584_0008302_530_1747 | 385 |
| 1183 | 3300046492 | Ga0495585_0000943 | Ga0495585_0000943_5852_7069 | 385 |
| 1184 | 3300046501 | Ga0495607_0004889 | Ga0495607_0004889_27_1244 | 385 |
| 1185 | 3300046511 | Ga0495608_0019535 | Ga0495608_0019535_2783_4000 | 385 |
| 1186 | 3300046516 | Ga0495628_0038186 | Ga0495628_0038186_2364_3581 | 385 |
| 1187 | 3300046517 | Ga0495630_0001312 | Ga0495630_0001312_13425_14651 | 385 |
| 1188 | 3300046523 | Ga0495644_0000565 | Ga0495644_0000565_9417_10634 | 385 |
| 1189 | 3300046526 | Ga0495666_0005200 | Ga0495666_0005200_2832_4049 | 385 |
| 1190 | 3300046529 | Ga0495652_0055968 | Ga0495652_0055968_1892_3109 | 385 |
| 1191 | 3300046531 | Ga0495665_0001252 | Ga0495665_0001252_12079_13296 | 385 |
| 1192 | 3300046533 | Ga0495640_0026242 | Ga0495640_0026242_1104_2321 | 385 |
| 1193 | 3300046535 | Ga0495586_0006149 | Ga0495586_0006149_4951_6177 | 385 |
| 1194 | 3300046557 | Ga0495622_0020270 | Ga0495622_0020270_113_1330 | 385 |
| 1195 | 3300046558 | Ga0495633_0010513 | Ga0495633_0010513_3576_4802 | 385 |
| 1196 | 3300046559 | Ga0495667_0010297 | Ga0495667_0010297_233_1459 | 385 |
| 1197 | 3300046615 | Ga0495656_0000718 | Ga0495656_0000718_7757_8974 | 385 |
| 1198 | 3300046642 | Ga0495634_0029550 | Ga0495634_0029550_223_1440 | 385 |
| 1199 | 3300046648 | Ga0495611_0002127 | Ga0495611_0002127_2830_4047 | 385 |
| 1200 | 3300046664 | Ga0495659_0001109 | Ga0495659_0001109_7636_8853 | 385 |
| 1201 | 3300046665 | Ga0495661_0025457 | Ga0495661_0025457_1734_2951 | 385 |
| 1202 | 3300046674 | Ga0495588_0001783 | Ga0495588_0001783_3353_4570 | 385 |
| 1203 | 3300046678 | Ga0495599_0034703 | Ga0495599_0034703_455_1672 | 385 |
| 1204 | 3300046680 | Ga0495646_0012099 | Ga0495646_0012099_3053_4270 | 385 |
| 1205 | 3300046681 | Ga0495647_0009459 | Ga0495647_0009459_1631_2848 | 385 |
| 1206 | 3300046689 | Ga0495613_0029334 | Ga0495613_0029334_216_1433 | 385 |
| 1207 | 3300046690 | Ga0495624_0004102 | Ga0495624_0004102_1026_2243 | 385 |
| 1208 | 3300046691 | Ga0495670_0002874 | Ga0495670_0002874_3702_4919 | 385 |
| 1209 | 3300046809 | Ga0495600_0001374 | Ga0495600_0001374_13_1239 | 385 |
| 1210 | 3300047315 | Ga0495581_0008984 | Ga0495581_0008984_236_1453 | 385 |
| 1211 | 3300047317 | Ga0495604_0016273 | Ga0495604_0016273_1352_2569 | 385 |
| 1212 | 3300047319 | Ga0495674_0042848 | Ga0495674_0042848_2354_3571 | 385 |
| 1213 | 3300047322 | Ga0495680_0035330 | Ga0495680_0035330_2354_3571 | 385 |
| 1214 | 3300047446 | Ga0495679_029239 | Ga0495679_029239_284_1501 | 385 |
| 1215 | 3300047471 | Ga0495684_0003681 | Ga0495684_0003681_9632_10849 | 385 |
| 1216 | 3300048088 | Ga0495602_0134900 | Ga0495602_0134900_154_1371 | 385 |
| 1217 | 3300048089 | Ga0495614_0001621 | Ga0495614_0001621_8223_9440 | 385 |
| 1218 | 3300048915 | Ga0496112_0082009 | Ga0496112_0082009_1787_3001 | 385 |
| 1219 | 3300048916 | Ga0496113_0256887 | Ga0496113_0256887_105_1319 | 385 |
| 1220 | 3300053078 | Ga0495612_0003715 | Ga0495612_0003715_4755_5972 | 385 |
| 1221 | 3300053084 | Ga0495595_0008813 | Ga0495595_0008813_456_1673 | 385 |
| 1222 | 3300053085 | Ga0495619_0010588 | Ga0495619_0010588_1115_2332 | 385 |
| 1223 | iso_pu_bacteria | 2508501050 | 2508725748 | 385 |
| 1224 | iso_pu_bacteria | 2508501114 | 2509074737 | 385 |
| 1225 | iso_pu_bacteria | 2773857925 | 2774870215 | 385 |
| 1226 | iso_pu_bacteria | 2882456835 | 2882461015 | 385 |
| 1227 | iso_pu_bacteria | 2894232714 | 2894237075 | 385 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8797 | 13 | 379 |
| 6kkl-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) | 0.8697 | 13 | 379 |
| 6kki-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation | 0.8653 | 13 | 379 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.843 | 13 | 379 |
| 8jtc-assembly1.cif.gz_A | human vmat2 complex with reserpine | 0.8401 | 13 | 376 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AA80_9_209_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9129 | 14 | 189 | 1.20.1250.20 |
| af_Q7JWI7_52_243_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9125 | 13 | 185 | 1.20.1250.20 |
| af_E7FGJ9_71_276_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9117 | 13 | 184 | 1.20.1250.20 |
| af_F1QY19_12_199_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9104 | 13 | 184 | 1.20.1250.20 |
| af_P25744_10_204_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9083 | 10 | 190 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526RVM8-F1-model_v4 | MFS transporter | 0.9464 | 1 | 274 |
GO:0016020
GO:0022857 |
| AF-A0A537Q413-F1-model_v4 | MFS transporter | 0.9398 | 4 | 281 |
GO:0016020
GO:0022857 |
| AF-A0A536WNP4-F1-model_v4 | MFS transporter | 0.9364 | 1 | 264 |
GO:0016020
GO:0022857 |
| AF-A0A833D7C2-F1-model_v4 | MFS transporter | 0.931 | 1 | 305 |
GO:0016020
GO:0022857 |
| AF-A0A2P5LTP5-F1-model_v4 | MFS transporter | 0.9276 | 1 | 379 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar