F491941

General Info

Members Datasets Scaffolds Average Seq Length
1227 679 970 397

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000597|Ga0081455_1000059731
Length 458
Sequence VISPLPLPGGKTQRSPPLGSLGQTDVAPQIPACCPDTLRGVTSIFFSKGALTMSSLTDAQHVAPMTSYEVSHGAVLRSLIIGLTAFLTVVDLFATQAILPSLTKAYGVMPAAMGFAVNASTFGMAIAGLAVGFLSPKIDRRFGVLISLVALAIPTTLLASAPNLAVFTALRVAQGLCMASAFTLTLAYLGEQCSAMDAGGAFAAYITGNVASNLIGRLISAAVADTFGLAANFYFFAALNLSGAVLVYFTLRGVRPMAMVAEGDTPFAALRAHLRDPSLRAAFAIGFCILFAFIGTFTFVNFVLVREPLSLDRMQLGWVYLVFLPSIVTTLMAGRVVNRIGTRAAIGGSLALAGLGLVFLLMRELPLVLAGMVLVAVGTFFAQAVATGFVGQTAQQSRGIASGVYLACYFLGGLAGTAVLGRLFDSFGWTACVMGVAGSLAAAAGLAPRLRPSTPDRP

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501050 Microvirga lupini Lut6 Isolate Nodule
6 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
11 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
20 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
21 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
24 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
27 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
28 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
29 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
30 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
31 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
34 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
35 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
36 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
37 2773857925 Microvirga vignae BR3299 Isolate Unclassified
38 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
39 2791355199
40 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
41 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
42 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
43 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
44 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
45 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
46 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
73 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
74 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
75 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
76 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
77 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
78 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
79 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
80 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
81 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
82 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
83 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
84 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
85 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
86 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
87 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
88 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
89 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
90 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
91 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
92 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
93 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
94 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
95 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
96 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
97 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
98 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
99 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
100 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
101 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
102 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
103 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
104 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
105 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
106 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
107 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
108 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
109 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
110 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
111 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
112 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
113 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
114 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
115 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
116 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
117 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
118 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
119 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
120 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
121 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
122 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
123 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
124 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
125 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
126 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
127 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
128 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
129 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
130 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
131 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
132 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
133 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
134 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
135 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
136 2904699407
137 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
138 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
139 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
140 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
141 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
142 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
143 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
144 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
145 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
146 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
147 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
148 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
149 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
150 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
151 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
152 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
153 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
154 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
155 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
156 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
157 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
158 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
159 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
160 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
161 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
162 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
163 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
164 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
165 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
166 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
167 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
168 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
169 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
170 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
171 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
172 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
173 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
174 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
175 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
176 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
177 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
178 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
179 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
180 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
181 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
182 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
183 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
184 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
185 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
186 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
187 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
188 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
189 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
190 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
191 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
192 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
193 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
194 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
195 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
196 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
197 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
198 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
199 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
200 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
201 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
202 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
203 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
204 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
205 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
206 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
207 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
208 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
209 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
210 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
211 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
212 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
213 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
214 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
215 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
216 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
217 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
218 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
219 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
220 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
221 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
222 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
223 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
224 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
225 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
226 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
227 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
228 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
229 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
230 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
231 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
232 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
233 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
234 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
235 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
236 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
237 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
238 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
239 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
240 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
241 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
242 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
243 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
244 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
245 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
246 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
247 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
248 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
249 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
250 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
251 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
252 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
253 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
254 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
255 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
256 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
257 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
258 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
259 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
260 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
261 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
262 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
263 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
264 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
265 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
266 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
267 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
268 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
269 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
270 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
271 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
272 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
273 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
274 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
275 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
276 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
277 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
278 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
279 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
280 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
281 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
282 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
283 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
284 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
285 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
286 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
287 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
288 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
289 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
290 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
291 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
292 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
293 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
294 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
295 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
296 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
297 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
298 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
299 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
300 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
301 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
302 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
303 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
304 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
305 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
306 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
307 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
308 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
309 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
310 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
311 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
312 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
313 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
314 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
315 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
316 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
317 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
318 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
319 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
320 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
321 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
322 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
323 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
324 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
325 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
326 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
327 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
328 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
329 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
330 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
331 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
332 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
333 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
334 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
335 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
336 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
337 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
338 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
339 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
340 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
341 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
342 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
343 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
344 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
345 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
346 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
347 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
348 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
349 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
350 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
351 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
352 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
353 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
354 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
355 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
356 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
357 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
358 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
359 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
360 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
361 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
362 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
363 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
364 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
365 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
366 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
367 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
368 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
372 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
373 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
376 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
431 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
432 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
433 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
434 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
436 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
440 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
441 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
442 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
443 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
444 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
445 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
446 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
447 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
448 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
449 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
450 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
451 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
452 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
453 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
454 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
455 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
456 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
457 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
458 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
459 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
460 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
461 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
462 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
463 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
464 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
465 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
466 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
467 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
468 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
469 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
470 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
471 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
472 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
473 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
474 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
475 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
476 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
477 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
478 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
479 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
480 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
481 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
482 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
483 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
484 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
485 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
486 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
487 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
488 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
489 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
490 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
491 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
492 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
493 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
494 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
495 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
496 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
497 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
498 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
499 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
500 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
501 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
502 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
503 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
504 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
505 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
506 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
507 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
508 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
509 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
510 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
511 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
512 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
513 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
514 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
515 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
516 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
517 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
518 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
519 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
520 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
521 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
522 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
523 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
524 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
525 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
526 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
527 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
528 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
529 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
530 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
531 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
532 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
533 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
534 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
535 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
536 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
537 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
538 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
539 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
540 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
541 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
542 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
543 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
544 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
545 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
546 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
547 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
548 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
549 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
550 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
551 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
552 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
553 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
554 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
555 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
556 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
557 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
558 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
559 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
560 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
561 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
562 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
563 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
564 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
565 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
566 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
567 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
568 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
569 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
570 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
571 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
572 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
573 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
574 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
575 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
576 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
577 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
578 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
579 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
580 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
581 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
582 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
585 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
586 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
587 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
588 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
589 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
591 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
593 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
596 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
597 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
598 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
599 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
600 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
601 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
602 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
603 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
604 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
605 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
606 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
607 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
608 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
609 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
610 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
611 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
612 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
613 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
614 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
615 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
616 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
617 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
618 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
619 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
620 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
621 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
622 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
623 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
624 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
625 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
626 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
627 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
628 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
629 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
630 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
631 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
632 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
633 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
634 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
635 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
636 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
637 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
638 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
639 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
640 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
641 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
642 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
643 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
644 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
645 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
646 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
647 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
648 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
649 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
650 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
651 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
652 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
653 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
654 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
655 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
656 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
659 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
660 641522639 Methylobacterium sp. 4-46 Isolate Nodule
661 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
662 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
663 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
664 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
665 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
666 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
667 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
668 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
669 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
670 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
671 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
672 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
673 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
674 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
675 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
676 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
677 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
678 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
679 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.02
Metatranscriptomes 0.16
Isolates 20.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.58
Nodule 16.79
Rhizoplane 5.05
Rhizosphere 63.16
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214770201 2209111006 Bacteria 2717
2 ARcpr5yngRDRAFT_c000153 3300000043 Bacteria 11013
3 ARSoilOldRDRAFT_c000159 3300000044 Bacteria 11417
4 JGI24740J21852_10005779 3300001979 Bacteria 5197
5 JGI24740J21852_10017985 3300001979 Bacteria 2517
6 JGI24739J22299_10011157 3300001989 Bacteria 3320
7 JGI24737J22298_10022085 3300001990 Bacteria 2022
8 JGI24735J21928_10018519 3300002067 Bacteria 2146
9 JGI25406J46586_10004853 3300003203 Bacteria 6250
10 JGI25153J46596_10000132 3300003215 Bacteria 79600
11 JGI25153J46596_10000884 3300003215 Bacteria 18219
12 JGI25153J46596_10001525 3300003215 Bacteria 13779
13 JGI25153J46596_10010116 3300003215 Bacteria 4300
14 rootH2_10089381 3300003320 Bacteria 1929
15 rootH1_10010522 3300003323 Bacteria 1752
16 JGI25404J52841_10001159 3300003659 Bacteria 4478
17 JGI25404J52841_10006470 3300003659 Bacteria 2453
18 Ga0055531_10005753 3300003794 Bacteria 7182
19 Ga0065165_1013172 3300005262 Bacteria 3307
20 Ga0065165_1020027 3300005262 Bacteria 2370
21 Ga0065704_10119026 3300005289 Bacteria 1806
22 Ga0070658_10027153 3300005327 Bacteria 4596
23 Ga0070690_100016506 3300005330 Bacteria 4425
24 Ga0070670_100093365 3300005331 Bacteria 2588
25 Ga0070666_10021842 3300005335 Bacteria 4150
26 Ga0070680_100103460 3300005336 Bacteria 2366
27 Ga0070680_100204894 3300005336 Bacteria 1664
28 Ga0070680_100220727 3300005336 Bacteria 1600
29 Ga0068868_100041625 3300005338 Bacteria 3579
30 Ga0068868_100117797 3300005338 Bacteria 2164
31 Ga0070660_100111925 3300005339 Bacteria 2173
32 Ga0070689_100037348 3300005340 Bacteria 3714
33 Ga0070661_100116134 3300005344 Bacteria 2002
34 Ga0070661_100136708 3300005344 Bacteria 1845
35 Ga0070668_100236870 3300005347 Bacteria 1511
36 Ga0070669_100089650 3300005353 Bacteria 2304
37 Ga0070675_100140491 3300005354 Bacteria 2064
38 Ga0070671_100019458 3300005355 Bacteria 5526
39 Ga0070671_100049175 3300005355 Bacteria 3509
40 Ga0070671_100222670 3300005355 Bacteria 1600
41 Ga0070674_100056827 3300005356 Bacteria 2714
42 Ga0070673_100099740 3300005364 Bacteria 2389
43 Ga0070673_100103631 3300005364 Bacteria 2348
44 Ga0070659_100083201 3300005366 Bacteria 2558
45 Ga0070667_100051633 3300005367 Bacteria 3467
46 Ga0070709_10014253 3300005434 Bacteria 4494
47 Ga0070714_100011902 3300005435 Bacteria 6919
48 Ga0070714_100169183 3300005435 Bacteria 1982
49 Ga0070713_100011978 3300005436 Bacteria 6344
50 Ga0070713_100019042 3300005436 Bacteria 5229
51 Ga0070713_100070534 3300005436 Bacteria 2950
52 Ga0070713_100084740 3300005436 Bacteria 2713
53 Ga0070713_100107094 3300005436 Bacteria 2431
54 Ga0070710_10002383 3300005437 Bacteria 8899
55 Ga0070710_10006619 3300005437 Bacteria 5571
56 Ga0070710_10011141 3300005437 Bacteria 4436
57 Ga0070710_10134207 3300005437 Bacteria 1512
58 Ga0070711_100004924 3300005439 Bacteria 7928
59 Ga0070711_100007381 3300005439 Bacteria 6687
60 Ga0070711_100018280 3300005439 Bacteria 4472
61 Ga0070705_100115440 3300005440 Bacteria 1724
62 Ga0070708_100056305 3300005445 Bacteria 3497
63 Ga0070663_100018999 3300005455 Bacteria 4520
64 Ga0070663_100166097 3300005455 Bacteria 1702
65 Ga0070678_100007290 3300005456 Bacteria 6549
66 Ga0070678_100009926 3300005456 Bacteria 5788
67 Ga0070678_100018567 3300005456 Bacteria 4509
68 Ga0070662_100310017 3300005457 Bacteria 1284
69 Ga0070681_10016111 3300005458 Bacteria 7451
70 Ga0070681_10291672 3300005458 Bacteria 1541
71 Ga0070685_10069110 3300005466 Bacteria 2088
72 Ga0070706_100042684 3300005467 Bacteria 4190
73 Ga0070706_100124731 3300005467 Bacteria 2401
74 Ga0070698_100356962 3300005471 Bacteria 1393
75 Ga0070699_100129129 3300005518 Bacteria 2227
76 Ga0070679_100004347 3300005530 Bacteria 13087
77 Ga0070684_100007310 3300005535 Bacteria 8582
78 Ga0070697_100062643 3300005536 Bacteria 3036
79 Ga0068853_100031588 3300005539 Bacteria 4479
80 Ga0068853_100346679 3300005539 Bacteria 1381
81 Ga0070672_100156434 3300005543 Bacteria 1888
82 Ga0070672_100193010 3300005543 Bacteria 1701
83 Ga0070686_100003943 3300005544 Bacteria 8159
84 Ga0070695_100092429 3300005545 Bacteria 2023
85 Ga0070696_100024719 3300005546 Bacteria 4083
86 Ga0070696_100070185 3300005546 Bacteria 2464
87 Ga0070693_100040355 3300005547 Bacteria 2620
88 Ga0070665_100000767 3300005548 Bacteria 42433
89 Ga0070665_100005441 3300005548 Bacteria 13132
90 Ga0070665_100128801 3300005548 Bacteria 2533
91 Ga0070665_100177873 3300005548 Bacteria 2128
92 Ga0070665_100194716 3300005548 Bacteria 2028
93 Ga0070665_100207191 3300005548 Bacteria 1962
94 Ga0070665_100300953 3300005548 Bacteria 1607
95 Ga0070704_100105605 3300005549 Bacteria 2133
96 Ga0068855_100000006 3300005563 Bacteria 298092
97 Ga0068855_100062964 3300005563 Bacteria 4329
98 Ga0068855_100067922 3300005563 Bacteria 4151
99 Ga0068855_100136732 3300005563 Bacteria 2795
100 Ga0068855_100312069 3300005563 Bacteria 1740
101 Ga0068855_100498275 3300005563 Bacteria 1324
102 Ga0068854_100004568 3300005578 Bacteria 8728
103 Ga0068856_100029401 3300005614 Bacteria 5368
104 Ga0068856_100441838 3300005614 Bacteria 1321
105 Ga0070702_100061499 3300005615 Bacteria 2187
106 Ga0068852_100001922 3300005616 Bacteria 14156
107 Ga0068852_100031085 3300005616 Bacteria 4401
108 Ga0068852_100045552 3300005616 Bacteria 3732
109 Ga0068852_100248147 3300005616 Bacteria 1704
110 Ga0068859_100074094 3300005617 Bacteria 3443
111 Ga0068859_100197207 3300005617 Bacteria 2098
112 Ga0068859_100364428 3300005617 Bacteria 1540
113 Ga0068864_100030673 3300005618 Bacteria 4558
114 Ga0068864_100225316 3300005618 Bacteria 1731
115 Ga0068866_10071692 3300005718 Bacteria 1833
116 Ga0068861_100057800 3300005719 Bacteria 2963
117 Ga0068861_100202004 3300005719 Bacteria 1669
118 Ga0068851_10030723 3300005834 Bacteria 2665
119 Ga0068863_100087457 3300005841 Bacteria 2952
120 Ga0068863_100123046 3300005841 Bacteria 2475
121 Ga0068858_100030613 3300005842 Bacteria 4997
122 Ga0068858_100215097 3300005842 Bacteria 1819
123 Ga0068858_100217665 3300005842 Bacteria 1808
124 Ga0068858_100261472 3300005842 Bacteria 1645
125 Ga0068858_100380920 3300005842 Bacteria 1354
126 Ga0068860_100022255 3300005843 Bacteria 6134
127 Ga0068860_100160031 3300005843 Bacteria 2171
128 Ga0068860_100179134 3300005843 Bacteria 2049
129 Ga0068860_100312200 3300005843 Bacteria 1542
130 Ga0068862_100008935 3300005844 Bacteria 8295
131 Ga0068862_100015601 3300005844 Bacteria 6311
132 Ga0081455_10000479 3300005937 Bacteria 51768
133 Ga0081455_10000597 3300005937 Bacteria 46858
134 Ga0081455_10001978 3300005937 Bacteria 24467
135 Ga0081455_10002720 3300005937 Bacteria 20867
136 Ga0081455_10005841 3300005937 Bacteria 13387
137 Ga0081455_10011587 3300005937 Bacteria 8850
138 Ga0081455_10013535 3300005937 Bacteria 8045
139 Ga0081455_10020968 3300005937 Bacteria 6140
140 Ga0081455_10022033 3300005937 Bacteria 5965
141 Ga0081455_10108891 3300005937 Bacteria 2205
142 Ga0081455_10150556 3300005937 Bacteria 1795
143 Ga0081540_1000703 3300005983 Bacteria 31069
144 Ga0081540_1003793 3300005983 Bacteria 11827
145 Ga0081540_1005364 3300005983 Bacteria 9592
146 Ga0081540_1007737 3300005983 Bacteria 7610
147 Ga0081540_1008055 3300005983 Bacteria 7409
148 Ga0081540_1008398 3300005983 Bacteria 7218
149 Ga0081540_1008775 3300005983 Bacteria 7026
150 Ga0081540_1017077 3300005983 Bacteria 4509
151 Ga0081540_1025914 3300005983 Bacteria 3361
152 Ga0081540_1031323 3300005983 Bacteria 2927
153 Ga0081540_1067510 3300005983 Bacteria 1671
154 Ga0081540_1074391 3300005983 Bacteria 1557
155 Ga0081539_10000220 3300005985 Bacteria 133834
156 Ga0081539_10002228 3300005985 Bacteria 28275
157 Ga0081539_10004536 3300005985 Bacteria 15239
158 Ga0081539_10065465 3300005985 Bacteria 1974
159 Ga0070717_10009288 3300006028 Bacteria 7391
160 Ga0070717_10017426 3300006028 Bacteria 5589
161 Ga0070717_10033651 3300006028 Bacteria 4135
162 Ga0070717_10040159 3300006028 Bacteria 3811
163 Ga0075365_10007353 3300006038 Bacteria 6160
164 Ga0075368_10028132 3300006042 Bacteria 2171
165 Ga0075363_100105989 3300006048 Bacteria 1559
166 Ga0075364_10002835 3300006051 Bacteria 9762
167 Ga0075364_10078265 3300006051 Bacteria 2183
168 Ga0070716_100009774 3300006173 Bacteria 4793
169 Ga0070712_100034943 3300006175 Bacteria 3409
170 Ga0070712_100069405 3300006175 Bacteria 2514
171 Ga0075362_10000592 3300006177 Bacteria 10626
172 Ga0075367_10018665 3300006178 Bacteria 3832
173 Ga0075367_10056354 3300006178 Bacteria 2334
174 Ga0075369_10000268 3300006186 Bacteria 15479
175 Ga0075366_10021583 3300006195 Bacteria 3743
176 Ga0075366_10127288 3300006195 Bacteria 1536
177 Ga0097621_100067278 3300006237 Bacteria 2953
178 Ga0097621_100120396 3300006237 Bacteria 2226
179 Ga0075370_10018948 3300006353 Bacteria 3738
180 Ga0075370_10029395 3300006353 Bacteria 3061
181 Ga0068871_100009687 3300006358 Bacteria 6994
182 Ga0068871_100041919 3300006358 Bacteria 3672
183 Ga0075428_100101489 3300006844 Bacteria 3136
184 Ga0075430_100004132 3300006846 Bacteria 12251
185 Ga0075430_100139853 3300006846 Bacteria 2016
186 Ga0075431_100007365 3300006847 Bacteria 10959
187 Ga0075431_100115054 3300006847 Bacteria 2776
188 Ga0075433_10001633 3300006852 Bacteria 16644
189 Ga0075433_10007265 3300006852 Bacteria 8779
190 Ga0075433_10041337 3300006852 Bacteria 3994
191 Ga0075434_100001874 3300006871 Bacteria 18197
192 Ga0075434_100009598 3300006871 Bacteria 9034
193 Ga0075434_100039468 3300006871 Bacteria 4678
194 Ga0075434_100127116 3300006871 Bacteria 2566
195 Ga0075434_100154603 3300006871 Bacteria 2313
196 Ga0075429_100020847 3300006880 Bacteria 5688
197 Ga0068865_100014777 3300006881 Bacteria 4968
198 Ga0097620_100074094 3300006931 Bacteria 3443
199 Ga0097620_100197210 3300006931 Bacteria 2098
200 Ga0097620_100364417 3300006931 Bacteria 1540
201 Ga0099823_1056234 3300006944 Bacteria 2203
202 Ga0075435_100053578 3300007076 Bacteria 3253
203 Ga0099794_10033208 3300007265 Bacteria 2426
204 Ga0105251_10027458 3300009011 Bacteria 2886
205 Ga0105240_10000080 3300009093 Bacteria 195633
206 Ga0105240_10019955 3300009093 Bacteria 8950
207 Ga0105240_10236563 3300009093 Unclassified 2119
208 Ga0105240_10273743 3300009093 Bacteria 1943
209 Ga0111539_10026475 3300009094 Bacteria 7090
210 Ga0111539_10029217 3300009094 Bacteria 6718
211 Ga0111539_10116263 3300009094 Bacteria 3136
212 Ga0105245_10025672 3300009098 Bacteria 5181
213 Ga0105245_10033787 3300009098 Bacteria 4533
214 Ga0105245_10067141 3300009098 Bacteria 3248
215 Ga0105247_10010363 3300009101 Bacteria 5637
216 Ga0105247_10031058 3300009101 Bacteria 3240
217 Ga0105247_10070391 3300009101 Bacteria 2185
218 Ga0105247_10082847 3300009101 Bacteria 2025
219 Ga0105247_10136163 3300009101 Bacteria 1605
220 Ga0114129_10008567 3300009147 Bacteria 14580
221 Ga0114129_10046902 3300009147 Bacteria 6073
222 Ga0105243_10051407 3300009148 Bacteria 3260
223 Ga0105243_10059810 3300009148 Bacteria 3042
224 Ga0105243_10062079 3300009148 Bacteria 2991
225 Ga0105241_10002269 3300009174 Bacteria 14448
226 Ga0105241_10004292 3300009174 Bacteria 10545
227 Ga0105241_10013031 3300009174 Bacteria 6096
228 Ga0105241_10013273 3300009174 Bacteria 6038
229 Ga0105241_10036380 3300009174 Bacteria 3704
230 Ga0105241_10059230 3300009174 Bacteria 2944
231 Ga0105241_10069409 3300009174 Bacteria 2732
232 Ga0105241_10083649 3300009174 Bacteria 2504
233 Ga0105248_10027112 3300009177 Bacteria 6374
234 Ga0105248_10030358 3300009177 Bacteria 6034
235 Ga0105248_10064482 3300009177 Bacteria 4113
236 Ga0105237_10008317 3300009545 Bacteria 11257
237 Ga0105237_10068809 3300009545 Bacteria 3534
238 Ga0105237_10069211 3300009545 Bacteria 3525
239 Ga0105237_10126084 3300009545 Bacteria 2554
240 Ga0105237_10126256 3300009545 Bacteria 2553
241 Ga0105237_10159030 3300009545 Bacteria 2257
242 Ga0105238_10000677 3300009551 Bacteria 35835
243 Ga0105238_10003618 3300009551 Bacteria 15406
244 Ga0105238_10050080 3300009551 Bacteria 4205
245 Ga0105238_10073339 3300009551 Bacteria 3418
246 Ga0105238_10153401 3300009551 Bacteria 2278
247 Ga0105238_10414624 3300009551 Bacteria 1341
248 Ga0105249_10141900 3300009553 Bacteria 2304
249 Ga0105249_10206766 3300009553 Bacteria 1924
250 Ga0105249_10245812 3300009553 Bacteria 1771
251 Ga0105249_10286132 3300009553 Bacteria 1648
252 Ga0099796_10007245 3300010159 Bacteria 2890
253 Ga0105239_10001550 3300010375 Bacteria 30371
254 Ga0105239_10019302 3300010375 Bacteria 7530
255 Ga0105239_10020128 3300010375 Bacteria 7362
256 Ga0105239_10061277 3300010375 Bacteria 4129
257 Ga0105239_10063147 3300010375 Bacteria 4066
258 Ga0105239_10065977 3300010375 Bacteria 3977
259 Ga0105239_10088255 3300010375 Bacteria 3420
260 Ga0105239_10127209 3300010375 Bacteria 2833
261 Ga0105239_10155796 3300010375 Bacteria 2551
262 Ga0105239_10217294 3300010375 Bacteria 2143
263 Ga0105239_10268688 3300010375 Bacteria 1918
264 Ga0105239_10286979 3300010375 Bacteria 1853
265 Ga0105239_10344223 3300010375 Bacteria 1683
266 Ga0105239_10380867 3300010375 Bacteria 1595
267 Ga0105239_10393554 3300010375 Bacteria 1568
268 Ga0105246_10033761 3300011119 Bacteria 3403
269 Ga0157370_10037994 3300013104 Bacteria 4660
270 Ga0157369_10018062 3300013105 Bacteria 7911
271 Ga0157374_10042893 3300013296 Bacteria 4176
272 Ga0157378_10009779 3300013297 Bacteria 8358
273 Ga0157378_10016311 3300013297 Bacteria 6506
274 Ga0157378_10162229 3300013297 Bacteria 2091
275 Ga0163162_10034244 3300013306 Bacteria 5054
276 Ga0163162_10414419 3300013306 Bacteria 1479
277 Ga0157372_10057946 3300013307 Bacteria 4330
278 Ga0157375_10197011 3300013308 Bacteria 2169
279 Ga0157375_10288331 3300013308 Bacteria 1804
280 Ga0157375_10293625 3300013308 Bacteria 1789
281 Ga0163163_10077645 3300014325 Bacteria 3316
282 Ga0163163_10083737 3300014325 Bacteria 3195
283 Ga0163163_10158222 3300014325 Bacteria 2310
284 Ga0163163_10163606 3300014325 Bacteria 2271
285 Ga0163163_10166764 3300014325 Bacteria 2249
286 Ga0163163_10195679 3300014325 Bacteria 2069
287 Ga0163163_10283800 3300014325 Bacteria 1707
288 Ga0163163_10284851 3300014325 Bacteria 1704
289 Ga0182008_10062630 3300014497 Bacteria 1833
290 Ga0157379_10000395 3300014968 Bacteria 35355
291 Ga0157379_10112274 3300014968 Bacteria 2449
292 Ga0157379_10129585 3300014968 Bacteria 2270
293 Ga0157376_10103217 3300014969 Bacteria 2496
294 Ga0157376_10116919 3300014969 Bacteria 2357
295 Ga0157376_10273498 3300014969 Bacteria 1588
296 Ga0182007_10014866 3300015262 Bacteria 2919
297 Ga0163161_10199605 3300017792 Bacteria 1541
298 Ga0214544_1000001 3300021320 Bacteria 783667
299 Ga0214544_1016901 3300021320 Bacteria 6824
300 Ga0214542_1000606 3300021321 Bacteria 66272
301 Ga0214542_1016862 3300021321 Bacteria 6884
302 Ga0214545_1000003 3300021324 Bacteria 720274
303 Ga0214543_1000002 3300021327 Bacteria 712733
304 Ga0214543_1024357 3300021327 Bacteria 3765
305 Ga0213876_10016173 3300021384 Bacteria 3943
306 Ga0209677_100746 3300025253 Bacteria 16488
307 Ga0209148_1001164 3300025254 Bacteria 15296
308 Ga0209455_1003325 3300025272 Bacteria 5756
309 Ga0209564_1019793 3300025295 Bacteria 2498
310 Ga0209758_1000079 3300025297 Bacteria 262874
311 Ga0209758_1000169 3300025297 Bacteria 149782
312 Ga0209758_1000477 3300025297 Bacteria 66111
313 Ga0209758_1002906 3300025297 Bacteria 16534
314 Ga0209758_1004503 3300025297 Bacteria 11559
315 Ga0209758_1004588 3300025297 Bacteria 11382
316 Ga0209758_1005549 3300025297 Bacteria 9621
317 Ga0209050_1008734 3300025298 Bacteria 5336
318 Ga0209256_1010598 3300025299 Bacteria 3831
319 Ga0207426_1000519 3300025302 Bacteria 56155
320 Ga0207426_1002865 3300025302 Bacteria 10232
321 Ga0209257_1001891 3300025304 Bacteria 22638
322 Ga0209257_1004960 3300025304 Bacteria 9758
323 Ga0207656_10033315 3300025321 Unclassified 2145
324 Ga0207692_10003877 3300025898 Bacteria 5877
325 Ga0207692_10012613 3300025898 Bacteria 3635
326 Ga0207692_10026144 3300025898 Bacteria 2736
327 Ga0207710_10015843 3300025900 Bacteria 3189
328 Ga0207710_10020193 3300025900 Bacteria 2847
329 Ga0207680_10002857 3300025903 Bacteria 8083
330 Ga0207647_10010287 3300025904 Bacteria 6608
331 Ga0207647_10017568 3300025904 Bacteria 4861
332 Ga0207647_10058110 3300025904 Bacteria 2369
333 Ga0207699_10004401 3300025906 Bacteria 6738
334 Ga0207699_10004981 3300025906 Bacteria 6350
335 Ga0207645_10160148 3300025907 Bacteria 1472
336 Ga0207705_10033730 3300025909 Bacteria 3657
337 Ga0207684_10028224 3300025910 Bacteria 4780
338 Ga0207654_10000362 3300025911 Bacteria 26747
339 Ga0207654_10012598 3300025911 Bacteria 4335
340 Ga0207654_10134306 3300025911 Bacteria 1570
341 Ga0207707_10000962 3300025912 Bacteria 27734
342 Ga0207707_10199037 3300025912 Bacteria 1747
343 Ga0207695_10000004 3300025913 Bacteria 1288665
344 Ga0207695_10046839 3300025913 Bacteria 4581
345 Ga0207671_10012411 3300025914 Bacteria 6851
346 Ga0207693_10003098 3300025915 Bacteria 14323
347 Ga0207693_10012329 3300025915 Bacteria 6906
348 Ga0207693_10031616 3300025915 Bacteria 4182
349 Ga0207693_10114171 3300025915 Bacteria 2119
350 Ga0207663_10010101 3300025916 Bacteria 5008
351 Ga0207663_10205555 3300025916 Bacteria 1423
352 Ga0207660_10096446 3300025917 Bacteria 2202
353 Ga0207657_10051755 3300025919 Bacteria 3569
354 Ga0207657_10078838 3300025919 Bacteria 2772
355 Ga0207652_10008084 3300025921 Bacteria 8444
356 Ga0207681_10165038 3300025923 Bacteria 1674
357 Ga0207694_10000014 3300025924 Bacteria 374435
358 Ga0207694_10003423 3300025924 Bacteria 12628
359 Ga0207694_10008420 3300025924 Bacteria 7783
360 Ga0207694_10116421 3300025924 Bacteria 2130
361 Ga0207694_10177602 3300025924 Bacteria 1725
362 Ga0207650_10026441 3300025925 Bacteria 4140
363 Ga0207659_10109687 3300025926 Bacteria 2095
364 Ga0207687_10011239 3300025927 Bacteria 5847
365 Ga0207687_10030267 3300025927 Bacteria 3649
366 Ga0207687_10144333 3300025927 Bacteria 1809
367 Ga0207687_10269329 3300025927 Bacteria 1361
368 Ga0207700_10002297 3300025928 Bacteria 10968
369 Ga0207700_10043281 3300025928 Bacteria 3307
370 Ga0207700_10160347 3300025928 Bacteria 1867
371 Ga0207664_10007341 3300025929 Bacteria 7639
372 Ga0207664_10012913 3300025929 Bacteria 5985
373 Ga0207664_10226617 3300025929 Bacteria 1623
374 Ga0207644_10011173 3300025931 Bacteria 5933
375 Ga0207644_10083705 3300025931 Bacteria 2363
376 Ga0207706_10025090 3300025933 Bacteria 5344
377 Ga0207706_10029359 3300025933 Bacteria 4909
378 Ga0207706_10140759 3300025933 Bacteria 2122
379 Ga0207706_10163887 3300025933 Bacteria 1954
380 Ga0207706_10176941 3300025933 Bacteria 1874
381 Ga0207686_10013343 3300025934 Bacteria 4543
382 Ga0207670_10044000 3300025936 Bacteria 2952
383 Ga0207704_10139348 3300025938 Bacteria 1694
384 Ga0207665_10012851 3300025939 Bacteria 5507
385 Ga0207665_10015031 3300025939 Bacteria 5082
386 Ga0207691_10152405 3300025940 Bacteria 2032
387 Ga0207711_10015827 3300025941 Bacteria 6256
388 Ga0207711_10066838 3300025941 Bacteria 3110
389 Ga0207711_10079519 3300025941 Bacteria 2862
390 Ga0207711_10322564 3300025941 Bacteria 1427
391 Ga0207689_10021152 3300025942 Bacteria 5469
392 Ga0207689_10087574 3300025942 Bacteria 2558
393 Ga0207689_10126797 3300025942 Bacteria 2099
394 Ga0207661_10132653 3300025944 Bacteria 2136
395 Ga0207667_10000202 3300025949 Bacteria 86408
396 Ga0207667_10090752 3300025949 Bacteria 3157
397 Ga0207667_10189149 3300025949 Bacteria 2112
398 Ga0207667_10387321 3300025949 Bacteria 1424
399 Ga0207651_10081661 3300025960 Bacteria 2330
400 Ga0207651_10268175 3300025960 Bacteria 1405
401 Ga0207712_10031760 3300025961 Bacteria 3559
402 Ga0207712_10042142 3300025961 Bacteria 3142
403 Ga0207668_10000033 3300025972 Bacteria 121080
404 Ga0207668_10092923 3300025972 Bacteria 2222
405 Ga0207668_10294555 3300025972 Bacteria 1336
406 Ga0207640_10198155 3300025981 Bacteria 1519
407 Ga0207658_10001268 3300025986 Bacteria 19958
408 Ga0207658_10052566 3300025986 Bacteria 3007
409 Ga0207658_10093958 3300025986 Bacteria 2333
410 Ga0207677_10077257 3300026023 Bacteria 2374
411 Ga0207677_10164440 3300026023 Bacteria 1728
412 Ga0207703_10053636 3300026035 Bacteria 3278
413 Ga0207703_10160375 3300026035 Bacteria 1969
414 Ga0207639_10103867 3300026041 Bacteria 2303
415 Ga0207678_10004265 3300026067 Bacteria 12822
416 Ga0207678_10031887 3300026067 Bacteria 4594
417 Ga0207678_10050743 3300026067 Bacteria 3584
418 Ga0207708_10078051 3300026075 Bacteria 2542
419 Ga0207702_10006411 3300026078 Bacteria 10149
420 Ga0207702_10049798 3300026078 Bacteria 3535
421 Ga0207641_10063951 3300026088 Bacteria 3144
422 Ga0207676_10021519 3300026095 Bacteria 4731
423 Ga0207676_10068846 3300026095 Bacteria 2832
424 Ga0207676_10172743 3300026095 Bacteria 1884
425 Ga0207674_10161731 3300026116 Bacteria 2193
426 Ga0207675_100004262 3300026118 Bacteria 13835
427 Ga0207675_100071196 3300026118 Bacteria 3250
428 Ga0207675_100212550 3300026118 Bacteria 1861
429 Ga0207675_100231902 3300026118 Bacteria 1781
430 Ga0207683_10014300 3300026121 Bacteria 6761
431 Ga0207683_10017904 3300026121 Bacteria 6041
432 Ga0207698_10003027 3300026142 Bacteria 10076
433 Ga0207698_10058457 3300026142 Bacteria 2988
434 Ga0209389_1000014 3300027296 Bacteria 188621
435 Ga0209389_1000077 3300027296 Bacteria 91273
436 Ga0209589_1000020 3300027357 Bacteria 188617
437 Ga0209489_100251 3300027361 Bacteria 91273
438 Ga0209489_102003 3300027361 Bacteria 41928
439 Ga0209700_100271 3300027363 Bacteria 91215
440 Ga0209588_1001310 3300027671 Bacteria 6471
441 Ga0207428_10000141 3300027907 Bacteria 97064
442 Ga0207428_10024101 3300027907 Bacteria 5110
443 Ga0207428_10100379 3300027907 Bacteria 2237
444 Ga0268266_10001064 3300028379 Bacteria 34416
445 Ga0268266_10039534 3300028379 Bacteria 4018
446 Ga0268266_10084516 3300028379 Bacteria 2771
447 Ga0268266_10220068 3300028379 Bacteria 1745
448 Ga0268266_10230442 3300028379 Bacteria 1706
449 Ga0268265_10003494 3300028380 Bacteria 11255
450 Ga0268265_10034906 3300028380 Bacteria 3669
451 Ga0268265_10074523 3300028380 Bacteria 2655
452 Ga0268264_10000030 3300028381 Bacteria 418542
453 Ga0268264_10172450 3300028381 Bacteria 1957
454 Ga0265334_10014054 3300028573 Bacteria 3343
455 Ga0307515_10000121 3300028794 Bacteria 188657
456 Ga0307511_10074407 3300030521 Bacteria 2448
457 Ga0265340_10029401 3300031247 Bacteria 2760
458 Ga0265327_10000359 3300031251 Bacteria 86745
459 Ga0307513_10186349 3300031456 Bacteria 1932
460 Ga0307408_100062279 3300031548 Bacteria 2726
461 Ga0307508_10014365 3300031616 Bacteria 7224
462 Ga0307508_10056557 3300031616 Bacteria 3473
463 Ga0307508_10086954 3300031616 Bacteria 2710
464 Ga0307405_10138910 3300031731 Bacteria 1691
465 Ga0307407_10124419 3300031903 Bacteria 1640
466 Ga0315911_1000015 3300033442 Bacteria 185247
467 Ga0373938_0007345 3300034957 Bacteria 1935
468 Ga0373926_0000112 3300035083 Bacteria 16360
469 Ga0373926_0059385 3300035083 Bacteria 1392
470 Ga0373944_0000117 3300035089 Bacteria 14831
471 Ga0373949_0019325 3300035090 Bacteria 1551
472 Ga0373952_0011540 3300035092 Bacteria 1725
473 Ga0373923_0000131 3300035111 Bacteria 13932
474 Ga0373923_0003454 3300035111 Bacteria 5067
475 Ga0373923_0067501 3300035111 Bacteria 1530
476 Ga0373936_0017475 3300035113 Bacteria 2762
477 Ga0373945_0000318 3300035116 Bacteria 13708
478 Ga0373953_0014930 3300035117 Bacteria 2803
479 Ga0373954_0000600 3300035118 Bacteria 13674
480 Ga0373954_0004094 3300035118 Bacteria 6249
481 Ga0373957_0002034 3300035120 Bacteria 5661
482 Ga0373957_0022745 3300035120 Bacteria 2236
483 Ga0373957_0035902 3300035120 Bacteria 1844
484 Ga0373943_0026878 3300035170 Bacteria 2699
485 Ga0373946_0000433 3300035171 Bacteria 13673
486 Ga0373946_0007217 3300035171 Bacteria 4056
487 Ga0373924_0003004 3300035410 Bacteria 5739
488 Ga0373924_0022390 3300035410 Bacteria 2471
489 Ga0373931_0001099 3300035691 Bacteria 11481
490 Ga0373931_0002375 3300035691 Bacteria 8328
491 Ga0373931_0054255 3300035691 Bacteria 2142
492 Ga0373935_0006788 3300035692 Bacteria 6838
493 Ga0373935_0031439 3300035692 Bacteria 3294
494 Ga0373935_0041660 3300035692 Bacteria 2886
495 Ga0373935_0042112 3300035692 Bacteria 2871
496 Ga0373927_0002771 3300035695 Bacteria 12795
497 Ga0373927_0011590 3300035695 Bacteria 5872
498 Ga0373927_0030797 3300035695 Bacteria 3500
499 Ga0373927_0035904 3300035695 Bacteria 3225
500 Ga0373927_0066987 3300035695 Bacteria 2323
501 Ga0373927_0238209 3300035695 Bacteria 1196
502 Ga0373933_0002820 3300035724 Bacteria 9707
503 Ga0373933_0010022 3300035724 Bacteria 5187
504 Ga0373947_0001734 3300035725 Bacteria 13338
505 Ga0373947_0002867 3300035725 Bacteria 10303
506 Ga0373947_0007909 3300035725 Bacteria 6130
507 Ga0373937_0010847 3300036401 Bacteria 7975
508 Ga0373937_0013664 3300036401 Bacteria 7154
509 Ga0373937_0028390 3300036401 Bacteria 5063
510 Ga0373937_0035546 3300036401 Bacteria 4536
511 Ga0373937_0076740 3300036401 Bacteria 3086
512 Ga0373937_0095760 3300036401 Bacteria 2752
513 Ga0373937_0096910 3300036401 Bacteria 2735
514 Ga0373937_0228637 3300036401 Bacteria 1751
515 Ga0373937_0355813 3300036401 Bacteria 1387
516 Ga0373925_0001112 3300037068 Bacteria 23957
517 Ga0373925_0002792 3300037068 Bacteria 13797
518 Ga0373925_0030889 3300037068 Bacteria 3934
519 Ga0373925_0038208 3300037068 Bacteria 3548
520 Ga0373925_0058587 3300037068 Bacteria 2888
521 Ga0373925_0157260 3300037068 Bacteria 1788
522 Ga0373925_0203408 3300037068 Bacteria 1575
523 Ga0395900_0108032 3300037418 Bacteria 2859
524 Ga0395905_0004064 3300037471 Bacteria 15340
525 Ga0395905_0020297 3300037471 Bacteria 6295
526 Ga0395905_0025863 3300037471 Bacteria 5532
527 Ga0395905_0039141 3300037471 Bacteria 4448
528 Ga0395905_0098816 3300037471 Bacteria 2741
529 Ga0395901_0008600 3300038443 Bacteria 10318
530 Ga0436365_1269767 3300039437 Bacteria 15018
531 Ga0436365_1361869 3300039437 Bacteria 9721
532 Ga0436360_0251089 3300039438 Bacteria 4507
533 Ga0436360_0806801 3300039438 Bacteria 1669
534 Ga0436361_0820451 3300039447 Bacteria 3335
535 Ga0436363_1351751 3300039450 Bacteria 9321
536 Ga0436362_0524297 3300039453 Bacteria 4315
537 Ga0436362_0601100 3300039453 Bacteria 4202
538 Ga0451795_0980836 3300041456 Bacteria 1424
539 Ga0439458_0007286 3300042157 Bacteria 2462
540 Ga0439459_0018515 3300042438 Bacteria 1309
541 Ga0466972_0000850 3300044658 Bacteria 14632
542 Ga0466972_0008407 3300044658 Bacteria 5175
543 Ga0466960_0026844 3300044901 Bacteria 2620
544 Ga0466960_0078755 3300044901 Bacteria 1655
545 Ga0451576_0121035 3300045051 Bacteria 2725
546 Ga0466967_0003126 3300045976 Bacteria 10658
547 Ga0495592_0001758 3300046454 Bacteria 15240
548 Ga0495592_0005289 3300046454 Bacteria 9514
549 Ga0495603_0000183 3300046455 Bacteria 32300
550 Ga0495603_0014702 3300046455 Bacteria 4732
551 Ga0495603_0015327 3300046455 Bacteria 4638
552 Ga0495603_0046067 3300046455 Bacteria 2599
553 Ga0495629_0000585 3300046459 Bacteria 29571
554 Ga0495629_0002289 3300046459 Bacteria 14763
555 Ga0495629_0002778 3300046459 Bacteria 13377
556 Ga0495629_0006344 3300046459 Bacteria 8773
557 Ga0495629_0010123 3300046459 Bacteria 6876
558 Ga0495629_0027490 3300046459 Bacteria 4039
559 Ga0495638_0004117 3300046460 Bacteria 11125
560 Ga0495638_0007340 3300046460 Bacteria 7912
561 Ga0495638_0013934 3300046460 Bacteria 5454
562 Ga0495638_0016915 3300046460 Bacteria 4875
563 Ga0495641_0009829 3300046461 Bacteria 5635
564 Ga0495641_0043522 3300046461 Bacteria 2076
565 Ga0495651_0003868 3300046462 Bacteria 11450
566 Ga0495651_0030168 3300046462 Bacteria 4228
567 Ga0495651_0031330 3300046462 Bacteria 4147
568 Ga0495653_0000404 3300046463 Bacteria 34649
569 Ga0495653_0004843 3300046463 Bacteria 10913
570 Ga0495653_0035602 3300046463 Bacteria 3927
571 Ga0495580_0001167 3300046472 Bacteria 23111
572 Ga0495582_0000625 3300046473 Bacteria 19484
573 Ga0495582_0002024 3300046473 Bacteria 11363
574 Ga0495582_0012870 3300046473 Bacteria 4609
575 Ga0495639_0000075 3300046475 Bacteria 46617
576 Ga0495639_0002778 3300046475 Bacteria 7608
577 Ga0495639_0009632 3300046475 Bacteria 4145
578 Ga0495639_0016556 3300046475 Bacteria 3201
579 Ga0495662_0006110 3300046476 Bacteria 6019
580 Ga0495662_0012265 3300046476 Bacteria 4185
581 Ga0495664_0001938 3300046477 Bacteria 11029
582 Ga0495664_0002309 3300046477 Bacteria 10221
583 Ga0495664_0007514 3300046477 Bacteria 6059
584 Ga0495664_0027419 3300046477 Bacteria 3321
585 Ga0495584_0008302 3300046491 Bacteria 5379
586 Ga0495585_0000943 3300046492 Bacteria 24521
587 Ga0495594_0000120 3300046499 Bacteria 36823
588 Ga0495594_0002491 3300046499 Bacteria 9593
589 Ga0495607_0004889 3300046501 Bacteria 9750
590 Ga0495583_0074913 3300046506 Unclassified 1481
591 Ga0495606_0024526 3300046507 Bacteria 4343
592 Ga0495608_0013850 3300046511 Bacteria 5596
593 Ga0495608_0019535 3300046511 Bacteria 4662
594 Ga0495608_0046826 3300046511 Bacteria 2876
595 Ga0495618_0029855 3300046514 Bacteria 3403
596 Ga0495628_0023196 3300046516 Bacteria 5095
597 Ga0495628_0028560 3300046516 Bacteria 4530
598 Ga0495628_0038186 3300046516 Bacteria 3845
599 Ga0495630_0001312 3300046517 Bacteria 17112
600 Ga0495630_0006828 3300046517 Bacteria 8138
601 Ga0495631_0019215 3300046518 Bacteria 3206
602 Ga0495643_0030555 3300046522 Bacteria 3007
603 Ga0495644_0000565 3300046523 Bacteria 15558
604 Ga0495663_0024935 3300046525 Bacteria 1741
605 Ga0495666_0005200 3300046526 Bacteria 6568
606 Ga0495642_0062124 3300046528 Bacteria 1551
607 Ga0495652_0010990 3300046529 Bacteria 8204
608 Ga0495652_0055968 3300046529 Bacteria 3352
609 Ga0495652_0072645 3300046529 Bacteria 2866
610 Ga0495665_0000085 3300046531 Bacteria 41455
611 Ga0495665_0001252 3300046531 Bacteria 13525
612 Ga0495640_0000210 3300046533 Bacteria 38945
613 Ga0495640_0026242 3300046533 Bacteria 4212
614 Ga0495640_0057745 3300046533 Bacteria 2648
615 Ga0495640_0084696 3300046533 Bacteria 2102
616 Ga0495640_0144985 3300046533 Bacteria 1528
617 Ga0495586_0006149 3300046535 Bacteria 6417
618 Ga0495598_0009037 3300046537 Bacteria 2341
619 Ga0495609_0073708 3300046538 Bacteria 1497
620 Ga0495621_0019410 3300046539 Bacteria 2219
621 Ga0495645_0006472 3300046543 Bacteria 8128
622 Ga0495645_0046341 3300046543 Bacteria 3169
623 Ga0495645_0157895 3300046543 Bacteria 1570
624 Ga0495622_0001140 3300046557 Bacteria 13849
625 Ga0495622_0001209 3300046557 Bacteria 13287
626 Ga0495622_0005529 3300046557 Bacteria 5859
627 Ga0495622_0020270 3300046557 Bacteria 3096
628 Ga0495622_0067945 3300046557 Bacteria 1646
629 Ga0495633_0010513 3300046558 Bacteria 5045
630 Ga0495667_0010297 3300046559 Bacteria 6326
631 Ga0495667_0079624 3300046559 Bacteria 2130
632 Ga0495656_0000718 3300046615 Bacteria 10695
633 Ga0495656_0015466 3300046615 Bacteria 2880
634 Ga0495634_0000064 3300046642 Bacteria 85710
635 Ga0495634_0029550 3300046642 Bacteria 3793
636 Ga0495634_0038079 3300046642 Bacteria 3280
637 Ga0495634_0062139 3300046642 Bacteria 2481
638 Ga0495634_0128297 3300046642 Bacteria 1619
639 Ga0495611_0002127 3300046648 Bacteria 9265
640 Ga0495625_0054128 3300046660 Bacteria 2867
641 Ga0495625_0162567 3300046660 Bacteria 1495
642 Ga0495635_0000316 3300046663 Bacteria 31407
643 Ga0495635_0003249 3300046663 Bacteria 11213
644 Ga0495635_0005996 3300046663 Bacteria 8479
645 Ga0495635_0140531 3300046663 Bacteria 1645
646 Ga0495635_0156185 3300046663 Bacteria 1553
647 Ga0495659_0001109 3300046664 Bacteria 9377
648 Ga0495659_0016606 3300046664 Bacteria 2431
649 Ga0495661_0025457 3300046665 Bacteria 3821
650 Ga0495588_0001783 3300046674 Bacteria 9172
651 Ga0495588_0037158 3300046674 Bacteria 2473
652 Ga0495657_0002292 3300046675 Bacteria 16171
653 Ga0495657_0078810 3300046675 Bacteria 2134
654 Ga0495599_0008570 3300046678 Bacteria 6225
655 Ga0495599_0034703 3300046678 Bacteria 3168
656 Ga0495623_0033774 3300046679 Bacteria 3283
657 Ga0495623_0122639 3300046679 Bacteria 1563
658 Ga0495646_0012099 3300046680 Bacteria 5487
659 Ga0495646_0012566 3300046680 Bacteria 5380
660 Ga0495646_0027050 3300046680 Bacteria 3600
661 Ga0495647_0000458 3300046681 Bacteria 11752
662 Ga0495647_0001656 3300046681 Bacteria 6898
663 Ga0495647_0009459 3300046681 Bacteria 3303
664 Ga0495658_0006005 3300046683 Bacteria 5961
665 Ga0495658_0012805 3300046683 Bacteria 4258
666 Ga0495658_0018258 3300046683 Bacteria 3643
667 Ga0495613_0000290 3300046689 Bacteria 46122
668 Ga0495613_0001871 3300046689 Bacteria 15980
669 Ga0495613_0029334 3300046689 Bacteria 4090
670 Ga0495613_0067259 3300046689 Bacteria 2616
671 Ga0495624_0001019 3300046690 Bacteria 22166
672 Ga0495624_0004102 3300046690 Bacteria 10715
673 Ga0495624_0081568 3300046690 Bacteria 2003
674 Ga0495670_0002874 3300046691 Bacteria 8503
675 Ga0495589_0033890 3300046794 Bacteria 2563
676 Ga0495600_0001374 3300046809 Bacteria 13435
677 Ga0495600_0002145 3300046809 Bacteria 11183
678 Ga0495600_0104438 3300046809 Bacteria 1846
679 Ga0495581_0000014 3300047315 Bacteria 60735
680 Ga0495581_0001425 3300047315 Bacteria 13268
681 Ga0495581_0008984 3300047315 Bacteria 5782
682 Ga0495581_0046986 3300047315 Bacteria 2495
683 Ga0495604_0016273 3300047317 Bacteria 5943
684 Ga0495604_0024989 3300047317 Bacteria 4762
685 Ga0495604_0038331 3300047317 Bacteria 3770
686 Ga0495604_0045111 3300047317 Bacteria 3441
687 Ga0495636_0079051 3300047318 Bacteria 1414
688 Ga0495674_0003302 3300047319 Bacteria 15671
689 Ga0495674_0017430 3300047319 Bacteria 6681
690 Ga0495674_0042848 3300047319 Bacteria 4033
691 Ga0495676_0035424 3300047321 Bacteria 4174
692 Ga0495680_0000920 3300047322 Bacteria 32673
693 Ga0495680_0004774 3300047322 Bacteria 12866
694 Ga0495680_0008385 3300047322 Bacteria 9400
695 Ga0495680_0013405 3300047322 Bacteria 7152
696 Ga0495680_0035330 3300047322 Bacteria 4026
697 Ga0495680_0225335 3300047322 Bacteria 1337
698 Ga0495687_017251 3300047443 Bacteria 3607
699 Ga0495687_048053 3300047443 Bacteria 1833
700 Ga0495675_0028151 3300047444 Bacteria 3582
701 Ga0495679_029239 3300047446 Bacteria 1799
702 Ga0495684_0003681 3300047471 Bacteria 11952
703 Ga0495684_0064910 3300047471 Bacteria 2775
704 Ga0495684_0121630 3300047471 Bacteria 1965
705 Ga0495593_0000003 3300047673 Bacteria 120744
706 Ga0495593_0000567 3300047673 Bacteria 21016
707 Ga0495602_0000619 3300048088 Bacteria 33402
708 Ga0495602_0003728 3300048088 Bacteria 15826
709 Ga0495602_0134900 3300048088 Bacteria 1963
710 Ga0495614_0001621 3300048089 Bacteria 9805
711 Ga0495614_0003091 3300048089 Bacteria 7417
712 Ga0496100_0024359 3300048903 Bacteria 3691
713 Ga0496100_0098409 3300048903 Bacteria 2011
714 Ga0496101_0146657 3300048904 Bacteria 1802
715 Ga0496102_0012597 3300048905 Bacteria 7326
716 Ga0496102_0171491 3300048905 Bacteria 2042
717 Ga0496103_0013673 3300048906 Bacteria 4815
718 Ga0496103_0015202 3300048906 Bacteria 4576
719 Ga0496103_0031264 3300048906 Bacteria 3242
720 Ga0496103_0037885 3300048906 Bacteria 2957
721 Ga0496104_0017710 3300048907 Bacteria 6494
722 Ga0496104_0023289 3300048907 Bacteria 5693
723 Ga0496104_0055220 3300048907 Bacteria 3755
724 Ga0496104_0079256 3300048907 Bacteria 3130
725 Ga0496104_0092644 3300048907 Bacteria 2889
726 Ga0496104_0115499 3300048907 Bacteria 2575
727 Ga0496105_0022475 3300048908 Bacteria 5108
728 Ga0496106_0002346 3300048909 Bacteria 14105
729 Ga0496106_0017681 3300048909 Bacteria 5273
730 Ga0496106_0067734 3300048909 Bacteria 2722
731 Ga0496106_0193301 3300048909 Bacteria 1618
732 Ga0496107_0024125 3300048910 Bacteria 4301
733 Ga0496107_0261401 3300048910 Bacteria 1288
734 Ga0496108_0031446 3300048911 Bacteria 4405
735 Ga0496108_0042515 3300048911 Bacteria 3794
736 Ga0496108_0100688 3300048911 Bacteria 2465
737 Ga0496109_0037236 3300048912 Bacteria 4395
738 Ga0496109_0041700 3300048912 Bacteria 4157
739 Ga0496109_0055081 3300048912 Bacteria 3628
740 Ga0496109_0270154 3300048912 Bacteria 1602
741 Ga0496110_0005345 3300048913 Bacteria 10062
742 Ga0496110_0015600 3300048913 Bacteria 6326
743 Ga0496110_0074582 3300048913 Bacteria 3013
744 Ga0496110_0104702 3300048913 Bacteria 2538
745 Ga0496110_0137941 3300048913 Bacteria 2205
746 Ga0496110_0339174 3300048913 Bacteria 1369
747 Ga0496111_0029072 3300048914 Bacteria 3922
748 Ga0496111_0094900 3300048914 Bacteria 2188
749 Ga0496111_0108637 3300048914 Bacteria 2042
750 Ga0496112_0000018 3300048915 Bacteria 188820
751 Ga0496112_0001615 3300048915 Bacteria 17438
752 Ga0496112_0008849 3300048915 Bacteria 9033
753 Ga0496112_0025987 3300048915 Bacteria 5628
754 Ga0496112_0038338 3300048915 Bacteria 4678
755 Ga0496112_0039611 3300048915 Bacteria 4606
756 Ga0496112_0082009 3300048915 Bacteria 3190
757 Ga0496112_0096063 3300048915 Bacteria 2934
758 Ga0496112_0121832 3300048915 Bacteria 2578
759 Ga0496113_0014198 3300048916 Bacteria 5425
760 Ga0496113_0034090 3300048916 Bacteria 3712
761 Ga0496113_0038768 3300048916 Bacteria 3504
762 Ga0496113_0041498 3300048916 Bacteria 3396
763 Ga0496113_0049675 3300048916 Bacteria 3124
764 Ga0496113_0256887 3300048916 Bacteria 1396
765 Ga0496113_0280867 3300048916 Bacteria 1331
766 Ga0496114_0002810 3300048917 Bacteria 13341
767 Ga0496114_0024532 3300048917 Bacteria 4924
768 Ga0496114_0081861 3300048917 Bacteria 2728
769 Ga0496115_0183672 3300048918 Bacteria 1728
770 Ga0496115_0205737 3300048918 Bacteria 1626
771 Ga0496118_0003678 3300048921 Bacteria 19028
772 Ga0496118_0042068 3300048921 Bacteria 3609
773 Ga0496119_0071576 3300048922 Bacteria 2029
774 Ga0496121_0000041 3300048924 Bacteria 346686
775 Ga0496121_0054782 3300048924 Bacteria 3329
776 Ga0496121_0068548 3300048924 Bacteria 2869
777 Ga0496122_0001094 3300048925 Bacteria 46993
778 Ga0496123_0001198 3300048926 Bacteria 38067
779 Ga0496123_0136243 3300048926 Bacteria 1351
780 Ga0496123_0153368 3300048926 Bacteria 1239
781 Ga0496124_0011558 3300048927 Bacteria 8810
782 Ga0496124_0080696 3300048927 Bacteria 2676
783 Ga0496125_0039946 3300048928 Bacteria 4032
784 Ga0496125_0092132 3300048928 Bacteria 2267
785 Ga0496125_0162414 3300048928 Bacteria 1515
786 Ga0496126_0003109 3300048929 Bacteria 21428
787 Ga0496126_0016607 3300048929 Bacteria 7357
788 Ga0496126_0022299 3300048929 Bacteria 6164
789 Ga0496126_0056273 3300048929 Bacteria 3556
790 Ga0496126_0075527 3300048929 Bacteria 2991
791 Ga0495682_0000505 3300049460 Bacteria 27003
792 Ga0501031_0028352 3300049568 Plasmid 3650
793 Ga0501033_0122956 3300049570 Unclassified 1882
794 Ga0501036_0061544 3300049572 Bacteria 3179
795 Ga0501036_0217132 3300049572 Unclassified 1606
796 Ga0501037_0060968 3300049573 Bacteria 2751
797 Ga0501038_0067254 3300049574 Bacteria 3049
798 Ga0501038_0091213 3300049574 Bacteria 2553
799 Ga0501039_0004025 3300049575 Bacteria 11043
800 Ga0501039_0109738 3300049575 Unclassified 2157
801 Ga0501039_0140031 3300049575 Bacteria 1900
802 Ga0501039_0150509 3300049575 Bacteria 1828
803 Ga0501040_0020286 3300049576 Bacteria 4429
804 Ga0501040_0020464 3300049576 Bacteria 4409
805 Ga0501040_0112507 3300049576 Unclassified 1904
806 Ga0501041_0000986 3300049577 Bacteria 15550
807 Ga0501041_0003213 3300049577 Bacteria 9392
808 Ga0501041_0043878 3300049577 Bacteria 2718
809 Ga0501042_0005770 3300049578 Bacteria 7994
810 Ga0501042_0029610 3300049578 Bacteria 3862
811 Ga0501042_0105162 3300049578 Bacteria 2031
812 Ga0501043_0084041 3300049579 Plasmid 2502
813 Ga0501046_0238802 3300049580 Bacteria 1341
814 Ga0501047_0009098 3300049581 Bacteria 9379
815 Ga0501047_0020880 3300049581 Bacteria 6290
816 Ga0501048_0001956 3300049582 Bacteria 15664
817 Ga0501048_0014698 3300049582 Bacteria 5791
818 Ga0501067_0000469 3300049583 Bacteria 21964
819 Ga0501068_0046997 3300049584 Bacteria 2603
820 Ga0501068_0123833 3300049584 Bacteria 1613
821 Ga0501071_0027922 3300049587 Bacteria 3972
822 Ga0501072_0004083 3300049588 Bacteria 11048
823 Ga0501072_0053029 3300049588 Bacteria 3193
824 Ga0501072_0063405 3300049588 Bacteria 2915
825 Ga0501072_0074758 3300049588 Bacteria 2679
826 Ga0501073_0002098 3300049589 Bacteria 14941
827 Ga0501073_0180325 3300049589 Bacteria 1462
828 Ga0501075_0001740 3300049591 Bacteria 14312
829 Ga0501075_0005586 3300049591 Bacteria 8601
830 Ga0501075_0041883 3300049591 Bacteria 3432
831 Ga0501075_0078183 3300049591 Bacteria 2504
832 Ga0501075_0080380 3300049591 Bacteria 2467
833 Ga0501076_0003169 3300049592 Bacteria 11472
834 Ga0501076_0010701 3300049592 Bacteria 6818
835 Ga0501076_0058073 3300049592 Bacteria 3074
836 Ga0501076_0222507 3300049592 Bacteria 1542
837 Ga0501076_0234456 3300049592 Bacteria 1500
838 Ga0501076_0279265 3300049592 Bacteria 1368
839 Ga0501077_0010828 3300049593 Bacteria 5682
840 Ga0501077_0016581 3300049593 Bacteria 4642
841 Ga0501077_0177889 3300049593 Bacteria 1352
842 Ga0501079_0000363 3300049741 Bacteria 29190
843 Ga0501079_0021433 3300049741 Bacteria 4943
844 Ga0501079_0021691 3300049741 Bacteria 4916
845 Ga0501079_0102110 3300049741 Unclassified 2224
846 Ga0501079_0134116 3300049741 Bacteria 1927
847 Ga0501080_0001162 3300049742 Bacteria 21747
848 Ga0501080_0084330 3300049742 Bacteria 2952
849 Ga0501080_0100705 3300049742 Bacteria 2680
850 Ga0501081_0003993 3300049743 Bacteria 9454
851 Ga0501081_0030845 3300049743 Bacteria 3632
852 Ga0501081_0040380 3300049743 Bacteria 3195
853 Ga0501081_0075352 3300049743 Unclassified 2355
854 Ga0501083_0091754 3300049744 Unclassified 2005
855 Ga0501035_0118062 3300049822 Bacteria 2321
856 Ga0501045_0007017 3300049824 Bacteria 7811
857 Ga0501045_0032680 3300049824 Unclassified 3771
858 Ga0501045_0033401 3300049824 Bacteria 3730
859 Ga0501045_0056643 3300049824 Bacteria 2867
860 Ga0501045_0195591 3300049824 Bacteria 1507
861 nmdc:mga03683_31637_c1 3300050489 Bacteria 2124
862 nmdc:mga03683_321_c2 3300050489 Bacteria 8139
863 nmdc:mga03n38_22850_c1 3300050490 Bacteria 2537
864 nmdc:mga00v17_2537_c1 3300050491 Bacteria 9348
865 nmdc:mga00v17_83131_c1 3300050491 Bacteria 2002
866 nmdc:mga0yw44_11924_c1 3300050492 Bacteria 4511
867 nmdc:mga0yw44_18940_c1 3300050492 Bacteria 3784
868 nmdc:mga0yw44_2683_c1 3300050492 Bacteria 7675
869 nmdc:mga0k408_1654_c1 3300050493 Bacteria 12039
870 nmdc:mga0k408_33663_c1 3300050493 Bacteria 2931
871 nmdc:mga06z11_11275_c1 3300050494 Bacteria 3849
872 nmdc:mga06z11_31985_c1 3300050494 Bacteria 2562
873 nmdc:mga06z11_39059_c2 3300050494 Bacteria 1631
874 nmdc:mga06z11_54958_c1 3300050494 Bacteria 2054
875 nmdc:mga04h51_10605_c2 3300050495 Bacteria 2123
876 nmdc:mga07m45_6030_c1 3300050496 Bacteria 6099
877 nmdc:mga07m45_7056_c1 3300050496 Bacteria 5718
878 nmdc:mga07m45_94345_c1 3300050496 Bacteria 1716
879 nmdc:mga05p37_117995_c1 3300050507 Bacteria 3261
880 nmdc:mga09592_2872_c1 3300050508 Bacteria 13969
881 nmdc:mga0qj67_19636_c1 3300050509 Bacteria 5166
882 nmdc:mga0qj67_214949_c1 3300050509 Bacteria 1561
883 nmdc:mga06r32_131736_c1 3300050510 Bacteria 2473
884 nmdc:mga06r32_146541_c1 3300050510 Bacteria 2338
885 nmdc:mga06r32_299270_c1 3300050510 Bacteria 1595
886 nmdc:mga06r32_99566_c1 3300050510 Bacteria 2851
887 nmdc:mga08y16_161240_c1 3300050511 Bacteria 2330
888 nmdc:mga08y16_22860_c1 3300050511 Bacteria 6599
889 nmdc:mga08y16_7584_c1 3300050511 Bacteria 11358
890 nmdc:mga08y16_88510_c1 3300050511 Bacteria 3227
891 nmdc:mga0n895_1857_c1 3300050512 Bacteria 16116
892 nmdc:mga0n895_234335_c1 3300050512 Bacteria 1863
893 nmdc:mga0n895_26094_c1 3300050512 Bacteria 5528
894 nmdc:mga0n895_416443_c1 3300050512 Bacteria 1358
895 nmdc:mga0n895_41751_c1 3300050512 Bacteria 4460
896 nmdc:mga0n895_67313_c1 3300050512 Bacteria 3547
897 nmdc:mga0a205_56157_c1 3300050515 Bacteria 3802
898 nmdc:mga0a205_961_c1 3300050515 Bacteria 23815
899 Ga0495601_0006916 3300053077 Bacteria 6645
900 Ga0495601_0019745 3300053077 Bacteria 4112
901 Ga0495601_0038817 3300053077 Bacteria 2979
902 Ga0495601_0042137 3300053077 Bacteria 2863
903 Ga0495612_0001185 3300053078 Bacteria 10746
904 Ga0495612_0003715 3300053078 Bacteria 6337
905 Ga0495595_0002633 3300053084 Bacteria 7041
906 Ga0495595_0008813 3300053084 Bacteria 4154
907 Ga0495595_0018656 3300053084 Bacteria 3001
908 Ga0495595_0046427 3300053084 Bacteria 2001
909 Ga0495619_0000903 3300053085 Bacteria 19439
910 Ga0495619_0004968 3300053085 Bacteria 8450
911 Ga0495619_0010588 3300053085 Bacteria 5801
912 Ga0495619_0017008 3300053085 Bacteria 4609
913 Ga0500578_0006822 3300053086 Bacteria 7586
914 Ga0500643_000373 3300053087 Bacteria 35007
915 Ga0500644_0051611 3300053088 Bacteria 1413
916 Ga0500647_0017242 3300053091 Bacteria 3327
917 Ga0500583_0057419 3300053092 Bacteria 1827
918 Ga0500651_0004361 3300053093 Bacteria 7909
919 Ga0500566_0023534 3300053094 Bacteria 3617
920 Ga0500555_001336 3300053103 Bacteria 7741
921 Ga0500556_0000488 3300053104 Bacteria 27556
922 Ga0500557_000003 3300053105 Bacteria 228429
923 Ga0500562_006314 3300053108 Bacteria 2989
924 Ga0500595_002369 3300053119 Bacteria 9417
925 Ga0500595_006016 3300053119 Bacteria 5212
926 Ga0500595_035470 3300053119 Bacteria 1642
927 Ga0500608_041016 3300053122 Bacteria 2219
928 Ga0500642_0000138 3300053130 Bacteria 32489
929 Ga0500642_0027689 3300053130 Bacteria 2329
930 Ga0500642_0062954 3300053130 Bacteria 1670
931 Ga0500655_005677 3300053133 Bacteria 2245
932 Ga0500568_0000211 3300053139 Bacteria 50486
933 Ga0500568_0006843 3300053139 Bacteria 5678
934 Ga0500588_0000191 3300053146 Bacteria 8554
935 Ga0500588_0037457 3300053146 Bacteria 1440
936 Ga0500590_103773 3300053148 Bacteria 1361
937 Ga0500603_000522 3300053150 Bacteria 9717
938 Ga0500604_0008026 3300053151 Bacteria 2800
939 Ga0500604_0044376 3300053151 Bacteria 1353
940 Ga0500616_0001014 3300053153 Bacteria 29976
941 Ga0500616_0002878 3300053153 Bacteria 13806
942 Ga0500616_0005315 3300053153 Bacteria 8779
943 Ga0500620_000219 3300053155 Bacteria 11314
944 Ga0500622_0000277 3300053156 Bacteria 52401
945 Ga0500622_0116574 3300053156 Bacteria 1299
946 Ga0500636_0000857 3300053177 Bacteria 16345
947 Ga0500636_0090836 3300053177 Bacteria 1748
948 Ga0500611_007782 3300053727 Bacteria 1628
949 Ga0500625_004251 3300053729 Bacteria 5814
950 Ga0500609_002374 3300053731 Bacteria 2690
951 Ga0501084_0037509 3300054114 Bacteria 4049
952 Ga0501084_0052699 3300054114 Unclassified 3403
953 Ga0501084_0072294 3300054114 Bacteria 2889
954 Ga0501084_0350736 3300054114 Bacteria 1247
955 Ga0587077_002369 3300059493 Bacteria 2222
956 Ga0587076_000364 3300059645 Bacteria 3539
957 Ga0501082_0000476 3300060353 Bacteria 35465
958 Ga0501082_0030779 3300060353 Bacteria 4626
959 Ga0501082_0031517 3300060353 Unclassified 4572
960 Ga0501082_0231080 3300060353 Bacteria 1609
961 Ga0501082_0379979 3300060353 Bacteria 1232
962 Ga0530510_0000124 3300061734 Bacteria 44414
963 Ga0530510_0016203 3300061734 Bacteria 5270
964 Ga0530510_0034130 3300061734 Bacteria 3664
965 Ga0530510_0057525 3300061734 Bacteria 2809
966 Ga0530510_0059231 3300061734 Bacteria 2770
967 Ga0530510_0062640 3300061734 Bacteria 2692
968 Ga0530510_0184123 3300061734 Bacteria 1549
969 Ga0530510_0243445 3300061734 Bacteria 1339
970 Ga0530510_0263898 3300061734 Bacteria 1285

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10108891 Ga0081455_101088914 289
2 3300025940 Ga0207691_10152405 Ga0207691_101524053 295
3 3300006042 Ga0075368_10028132 Ga0075368_100281322 313
4 3300053146 Ga0500588_0037457 Ga0500588_0037457_434_1426 314
5 3300053146 Ga0500588_0000191 Ga0500588_0000191_2735_3943 319
6 3300050510 nmdc:mga06r32_299270_c1 nmdc:mga06r32_299270_c1_516_1562 324
7 3300050491 nmdc:mga00v17_83131_c1 nmdc:mga00v17_83131_c1_743_1951 325
8 3300050495 nmdc:mga04h51_10605_c2 nmdc:mga04h51_10605_c2_444_1652 325
9 3300050494 nmdc:mga06z11_31985_c1 nmdc:mga06z11_31985_c1_1061_2281 326
10 3300005937 Ga0081455_10000479 Ga0081455_1000047919 329
11 3300003794 Ga0055531_10005753 Ga0055531_100057533 332
12 3300025298 Ga0209050_1008734 Ga0209050_10087343 332
13 3300025304 Ga0209257_1001891 Ga0209257_100189122 332
14 3300005548 Ga0070665_100177873 Ga0070665_1001778732 333
15 3300021384 Ga0213876_10016173 Ga0213876_100161735 334
16 3300036401 Ga0373937_0355813 Ga0373937_0355813_38_1096 334
17 3300050512 nmdc:mga0n895_416443_c1 nmdc:mga0n895_416443_c1_274_1329 334
18 3300035695 Ga0373927_0238209 Ga0373927_0238209_23_1123 337
19 3300039438 Ga0436360_0251089 Ga0436360_0251089_681_1886 337
20 3300039447 Ga0436361_0820451 Ga0436361_0820451_486_1691 337
21 3300045051 Ga0451576_0121035 Ga0451576_0121035_121_1416 338
22 3300048904 Ga0496101_0146657 Ga0496101_0146657_221_1492 338
23 3300048907 Ga0496104_0017710 Ga0496104_0017710_762_2033 338
24 3300048913 Ga0496110_0074582 Ga0496110_0074582_1242_2513 338
25 3300048914 Ga0496111_0108637 Ga0496111_0108637_146_1417 338
26 3300048915 Ga0496112_0008849 Ga0496112_0008849_247_1518 338
27 3300048916 Ga0496113_0049675 Ga0496113_0049675_369_1640 338
28 3300048918 Ga0496115_0183672 Ga0496115_0183672_181_1452 338
29 3300049592 Ga0501076_0279265 Ga0501076_0279265_35_1261 338
30 3300053088 Ga0500644_0051611 Ga0500644_0051611_27_1247 338
31 3300061734 Ga0530510_0243445 Ga0530510_0243445_42_1268 338
32 3300014325 Ga0163163_10163606 Ga0163163_101636062 339
33 3300048925 Ga0496122_0001094 Ga0496122_0001094_9527_10762 339
34 3300048926 Ga0496123_0001198 Ga0496123_0001198_36183_37418 339
35 3300005937 Ga0081455_10150556 Ga0081455_101505562 340
36 3300003659 JGI25404J52841_10001159 JGI25404J52841_100011596 341
37 3300005983 Ga0081540_1003793 Ga0081540_10037935 341
38 3300005983 Ga0081540_1067510 Ga0081540_10675101 341
39 3300053153 Ga0500616_0001014 Ga0500616_0001014_20776_21999 342
40 3300025927 Ga0207687_10269329 Ga0207687_102693291 343
41 3300048907 Ga0496104_0092644 Ga0496104_0092644_1370_2629 343
42 3300048912 Ga0496109_0041700 Ga0496109_0041700_1192_2451 343
43 3300048913 Ga0496110_0104702 Ga0496110_0104702_1247_2506 343
44 3300035725 Ga0373947_0002867 Ga0373947_0002867_6141_7373 345
45 3300045976 Ga0466967_0003126 Ga0466967_0003126_687_1895 345
46 3300046455 Ga0495603_0000183 Ga0495603_0000183_18804_20036 345
47 3300046459 Ga0495629_0002778 Ga0495629_0002778_7314_8546 345
48 3300046472 Ga0495580_0001167 Ga0495580_0001167_18828_20060 345
49 3300046473 Ga0495582_0000625 Ga0495582_0000625_16353_17585 345
50 3300046475 Ga0495639_0002778 Ga0495639_0002778_3161_4393 345
51 3300046499 Ga0495594_0002491 Ga0495594_0002491_5189_6421 345
52 3300046557 Ga0495622_0001140 Ga0495622_0001140_1179_2411 345
53 3300046642 Ga0495634_0062139 Ga0495634_0062139_933_2165 345
54 3300046674 Ga0495588_0037158 Ga0495588_0037158_337_1569 345
55 3300046681 Ga0495647_0001656 Ga0495647_0001656_5385_6617 345
56 3300046689 Ga0495613_0000290 Ga0495613_0000290_42574_43806 345
57 3300047315 Ga0495581_0001425 Ga0495581_0001425_4184_5416 345
58 3300047673 Ga0495593_0000567 Ga0495593_0000567_15746_16978 345
59 3300048089 Ga0495614_0003091 Ga0495614_0003091_49_1281 345
60 3300048921 Ga0496118_0042068 Ga0496118_0042068_39_1250 345
61 3300053085 Ga0495619_0004968 Ga0495619_0004968_2969_4201 345
62 3300053093 Ga0500651_0004361 Ga0500651_0004361_4096_5298 345
63 3300005937 Ga0081455_10013535 Ga0081455_1001353510 346
64 3300014325 Ga0163163_10158222 Ga0163163_101582221 346
65 3300039437 Ga0436365_1269767 Ga0436365_1269767_7259_8587 346
66 3300048906 Ga0496103_0037885 Ga0496103_0037885_1839_2933 346
67 3300048911 Ga0496108_0042515 Ga0496108_0042515_1735_3042 346
68 3300005546 Ga0070696_100024719 Ga0070696_1000247194 347
69 3300006028 Ga0070717_10033651 Ga0070717_100336514 347
70 3300005983 Ga0081540_1008398 Ga0081540_10083988 348
71 3300005437 Ga0070710_10134207 Ga0070710_101342071 349
72 3300009545 Ga0105237_10068809 Ga0105237_100688092 349
73 3300025972 Ga0207668_10000033 Ga0207668_1000003318 349
74 3300025986 Ga0207658_10001268 Ga0207658_1000126816 349
75 3300035695 Ga0373927_0035904 Ga0373927_0035904_1129_2319 349
76 3300037068 Ga0373925_0002792 Ga0373925_0002792_1765_2955 349
77 3300046683 Ga0495658_0018258 Ga0495658_0018258_1022_2212 349
78 3300048903 Ga0496100_0098409 Ga0496100_0098409_729_1922 349
79 3300006852 Ga0075433_10001633 Ga0075433_1000163316 350
80 3300009094 Ga0111539_10029217 Ga0111539_100292177 350
81 3300027907 Ga0207428_10024101 Ga0207428_100241012 350
82 3300048909 Ga0496106_0067734 Ga0496106_0067734_451_1644 350
83 3300050511 nmdc:mga08y16_22860_c1 nmdc:mga08y16_22860_c1_3815_5128 350
84 3300050512 nmdc:mga0n895_26094_c1 nmdc:mga0n895_26094_c1_2934_4247 350
85 3300050515 nmdc:mga0a205_961_c1 nmdc:mga0a205_961_c1_7583_8896 350
86 3300006846 Ga0075430_100139853 Ga0075430_1001398531 351
87 3300050509 nmdc:mga0qj67_214949_c1 nmdc:mga0qj67_214949_c1_228_1430 351
88 3300053119 Ga0500595_002369 Ga0500595_002369_5172_6410 351
89 3300005617 Ga0068859_100197207 Ga0068859_1001972072 352
90 3300006931 Ga0097620_100197210 Ga0097620_1001972102 352
91 3300005467 Ga0070706_100124731 Ga0070706_1001247313 353
92 3300005616 Ga0068852_100248147 Ga0068852_1002481472 353
93 3300053731 Ga0500609_002374 Ga0500609_002374_1227_2429 353
94 3300010159 Ga0099796_10007245 Ga0099796_100072452 354
95 3300053156 Ga0500622_0116574 Ga0500622_0116574_18_1250 354
96 3300005548 Ga0070665_100128801 Ga0070665_1001288013 355
97 3300005844 Ga0068862_100008935 Ga0068862_1000089355 355
98 3300009553 Ga0105249_10286132 Ga0105249_102861322 355
99 3300028379 Ga0268266_10039534 Ga0268266_100395342 355
100 3300028380 Ga0268265_10003494 Ga0268265_100034946 355
101 3300035692 Ga0373935_0042112 Ga0373935_0042112_576_1757 355
102 3300039453 Ga0436362_0601100 Ga0436362_0601100_405_1622 355
103 3300049581 Ga0501047_0020880 Ga0501047_0020880_4438_5640 355
104 3300061734 Ga0530510_0016203 Ga0530510_0016203_2399_3637 355
105 3300005617 Ga0068859_100364428 Ga0068859_1003644282 356
106 3300006931 Ga0097620_100364417 Ga0097620_1003644172 356
107 3300010375 Ga0105239_10268688 Ga0105239_102686881 356
108 3300046539 Ga0495621_0019410 Ga0495621_0019410_454_1680 356
109 3300048907 Ga0496104_0055220 Ga0496104_0055220_231_1421 356
110 3300048917 Ga0496114_0024532 Ga0496114_0024532_2104_3294 356
111 3300050493 nmdc:mga0k408_33663_c1 nmdc:mga0k408_33663_c1_1408_2622 356
112 3300013297 Ga0157378_10009779 Ga0157378_100097799 357
113 3300025925 Ga0207650_10026441 Ga0207650_100264412 357
114 3300025926 Ga0207659_10109687 Ga0207659_101096872 357
115 3300039438 Ga0436360_0806801 Ga0436360_0806801_143_1381 357
116 3300046543 Ga0495645_0157895 Ga0495645_0157895_369_1550 357
117 3300048929 Ga0496126_0016607 Ga0496126_0016607_5831_7057 357
118 3300003215 JGI25153J46596_10000884 JGI25153J46596_100008847 358
119 3300005344 Ga0070661_100116134 Ga0070661_1001161342 358
120 3300005435 Ga0070714_100169183 Ga0070714_1001691832 358
121 3300005436 Ga0070713_100019042 Ga0070713_1000190423 358
122 3300005616 Ga0068852_100045552 Ga0068852_1000455522 358
123 3300005937 Ga0081455_10022033 Ga0081455_100220334 358
124 3300006178 Ga0075367_10056354 Ga0075367_100563542 358
125 3300009551 Ga0105238_10073339 Ga0105238_100733392 358
126 3300013105 Ga0157369_10018062 Ga0157369_100180624 358
127 3300025297 Ga0209758_1000079 Ga0209758_1000079235 358
128 3300025928 Ga0207700_10160347 Ga0207700_101603471 358
129 3300039450 Ga0436363_1351751 Ga0436363_1351751_4909_6132 358
130 3300049592 Ga0501076_0222507 Ga0501076_0222507_42_1280 358
131 3300050494 nmdc:mga06z11_54958_c1 nmdc:mga06z11_54958_c1_413_1609 358
132 3300050510 nmdc:mga06r32_99566_c1 nmdc:mga06r32_99566_c1_133_1368 358
133 3300053119 Ga0500595_006016 Ga0500595_006016_2675_3904 358
134 3300005330 Ga0070690_100016506 Ga0070690_1000165062 359
135 3300005354 Ga0070675_100140491 Ga0070675_1001404912 359
136 3300005355 Ga0070671_100049175 Ga0070671_1000491753 359
137 3300005356 Ga0070674_100056827 Ga0070674_1000568272 359
138 3300005364 Ga0070673_100103631 Ga0070673_1001036311 359
139 3300005458 Ga0070681_10291672 Ga0070681_102916722 359
140 3300005466 Ga0070685_10069110 Ga0070685_100691101 359
141 3300005539 Ga0068853_100031588 Ga0068853_1000315886 359
142 3300005543 Ga0070672_100156434 Ga0070672_1001564341 359
143 3300005617 Ga0068859_100074094 Ga0068859_1000740942 359
144 3300005618 Ga0068864_100030673 Ga0068864_1000306733 359
145 3300005841 Ga0068863_100123046 Ga0068863_1001230462 359
146 3300006931 Ga0097620_100074094 Ga0097620_1000740942 359
147 3300009545 Ga0105237_10008317 Ga0105237_100083179 359
148 3300009551 Ga0105238_10003618 Ga0105238_100036188 359
149 3300009553 Ga0105249_10206766 Ga0105249_102067661 359
150 3300010375 Ga0105239_10061277 Ga0105239_100612773 359
151 3300013306 Ga0163162_10034244 Ga0163162_100342442 359
152 3300013308 Ga0157375_10197011 Ga0157375_101970112 359
153 3300014325 Ga0163163_10195679 Ga0163163_101956792 359
154 3300025914 Ga0207671_10012411 Ga0207671_100124112 359
155 3300025924 Ga0207694_10008420 Ga0207694_100084204 359
156 3300025931 Ga0207644_10083705 Ga0207644_100837052 359
157 3300026095 Ga0207676_10021519 Ga0207676_100215193 359
158 3300035090 Ga0373949_0019325 Ga0373949_0019325_209_1402 359
159 3300035691 Ga0373931_0002375 Ga0373931_0002375_6226_7419 359
160 3300048915 Ga0496112_0039611 Ga0496112_0039611_636_1829 359
161 3300048916 Ga0496113_0034090 Ga0496113_0034090_1793_2986 359
162 3300048929 Ga0496126_0075527 Ga0496126_0075527_62_1264 359
163 3300053155 Ga0500620_000219 Ga0500620_000219_8112_9314 359
164 3300001979 JGI24740J21852_10017985 JGI24740J21852_100179853 360
165 3300001989 JGI24739J22299_10011157 JGI24739J22299_100111572 360
166 3300005563 Ga0068855_100498275 Ga0068855_1004982751 360
167 3300009545 Ga0105237_10126084 Ga0105237_101260842 360
168 3300010375 Ga0105239_10065977 Ga0105239_100659773 360
169 3300025297 Ga0209758_1004588 Ga0209758_100458810 360
170 3300025904 Ga0207647_10058110 Ga0207647_100581102 360
171 3300025949 Ga0207667_10387321 Ga0207667_103873211 360
172 3300025972 Ga0207668_10092923 Ga0207668_100929232 360
173 3300026023 Ga0207677_10164440 Ga0207677_101644402 360
174 3300037471 Ga0395905_0098816 Ga0395905_0098816_34_1236 360
175 3300042157 Ga0439458_0007286 Ga0439458_0007286_767_1969 360
176 3300046660 Ga0495625_0054128 Ga0495625_0054128_625_1827 360
177 3300047443 Ga0495687_048053 Ga0495687_048053_73_1275 360
178 3300049574 Ga0501038_0067254 Ga0501038_0067254_449_1660 360
179 3300049591 Ga0501075_0078183 Ga0501075_0078183_673_1884 360
180 3300049592 Ga0501076_0234456 Ga0501076_0234456_167_1378 360
181 3300050496 nmdc:mga07m45_6030_c1 nmdc:mga07m45_6030_c1_2598_3761 360
182 3300053130 Ga0500642_0027689 Ga0500642_0027689_711_1913 360
183 3300053130 Ga0500642_0062954 Ga0500642_0062954_380_1582 360
184 3300053151 Ga0500604_0008026 Ga0500604_0008026_865_2067 360
185 3300053151 Ga0500604_0044376 Ga0500604_0044376_61_1263 360
186 3300061734 Ga0530510_0059231 Ga0530510_0059231_1274_2485 360
187 3300005843 Ga0068860_100022255 Ga0068860_1000222553 361
188 3300006353 Ga0075370_10018948 Ga0075370_100189483 361
189 3300006358 Ga0068871_100041919 Ga0068871_1000419192 361
190 3300009174 Ga0105241_10004292 Ga0105241_100042927 361
191 3300028379 Ga0268266_10220068 Ga0268266_102200682 361
192 3300048915 Ga0496112_0000018 Ga0496112_0000018_37011_38216 361
193 3300048917 Ga0496114_0081861 Ga0496114_0081861_185_1378 361
194 3300048922 Ga0496119_0071576 Ga0496119_0071576_18_1166 361
195 3300048928 Ga0496125_0162414 Ga0496125_0162414_275_1501 361
196 3300049578 Ga0501042_0029610 Ga0501042_0029610_132_1343 361
197 3300005843 Ga0068860_100179134 Ga0068860_1001791342 362
198 3300005844 Ga0068862_100015601 Ga0068862_1000156016 362
199 3300005937 Ga0081455_10011587 Ga0081455_100115877 362
200 3300028380 Ga0268265_10074523 Ga0268265_100745232 362
201 3300039437 Ga0436365_1361869 Ga0436365_1361869_4257_5468 362
202 3300048909 Ga0496106_0002346 Ga0496106_0002346_1212_2432 362
203 3300048921 Ga0496118_0003678 Ga0496118_0003678_4377_5597 362
204 3300048924 Ga0496121_0000041 Ga0496121_0000041_21036_22256 362
205 3300048927 Ga0496124_0011558 Ga0496124_0011558_7125_8345 362
206 3300048929 Ga0496126_0022299 Ga0496126_0022299_443_1663 362
207 3300050494 nmdc:mga06z11_39059_c2 nmdc:mga06z11_39059_c2_271_1473 362
208 3300005437 Ga0070710_10006619 Ga0070710_100066191 363
209 3300005439 Ga0070711_100007381 Ga0070711_1000073813 363
210 3300005614 Ga0068856_100441838 Ga0068856_1004418381 363
211 3300025898 Ga0207692_10026144 Ga0207692_100261443 363
212 3300025915 Ga0207693_10012329 Ga0207693_100123294 363
213 3300025916 Ga0207663_10205555 Ga0207663_102055551 363
214 3300048915 Ga0496112_0121832 Ga0496112_0121832_1342_2544 363
215 3300049584 Ga0501068_0123833 Ga0501068_0123833_19_1269 363
216 3300053727 Ga0500611_007782 Ga0500611_007782_23_1225 363
217 3300054114 Ga0501084_0037509 Ga0501084_0037509_2288_3499 363
218 3300005471 Ga0070698_100356962 Ga0070698_1003569621 364
219 3300006028 Ga0070717_10040159 Ga0070717_100401594 364
220 3300006195 Ga0075366_10021583 Ga0075366_100215833 364
221 3300037068 Ga0373925_0203408 Ga0373925_0203408_148_1317 364
222 3300041456 Ga0451795_0980836 Ga0451795_0980836_292_1413 364
223 3300049572 Ga0501036_0061544 Ga0501036_0061544_824_2038 364
224 3300049573 Ga0501037_0060968 Ga0501037_0060968_288_1502 364
225 3300049574 Ga0501038_0091213 Ga0501038_0091213_837_2051 364
226 3300049575 Ga0501039_0004025 Ga0501039_0004025_8093_9307 364
227 3300049576 Ga0501040_0020464 Ga0501040_0020464_583_1797 364
228 3300049577 Ga0501041_0000986 Ga0501041_0000986_12464_13678 364
229 3300049582 Ga0501048_0001956 Ga0501048_0001956_3130_4344 364
230 3300049588 Ga0501072_0004083 Ga0501072_0004083_4054_5268 364
231 3300049591 Ga0501075_0005586 Ga0501075_0005586_4392_5618 364
232 3300049592 Ga0501076_0010701 Ga0501076_0010701_278_1492 364
233 3300049593 Ga0501077_0016581 Ga0501077_0016581_2964_4178 364
234 3300049741 Ga0501079_0000363 Ga0501079_0000363_20731_21945 364
235 3300049741 Ga0501079_0021433 Ga0501079_0021433_1967_3193 364
236 3300049742 Ga0501080_0001162 Ga0501080_0001162_10642_11856 364
237 3300049743 Ga0501081_0003993 Ga0501081_0003993_7503_8717 364
238 3300049824 Ga0501045_0007017 Ga0501045_0007017_5179_6393 364
239 3300049824 Ga0501045_0056643 Ga0501045_0056643_725_1951 364
240 3300053139 Ga0500568_0000211 Ga0500568_0000211_41019_42230 364
241 3300053139 Ga0500568_0006843 Ga0500568_0006843_1619_2821 364
242 3300060353 Ga0501082_0000476 Ga0501082_0000476_7095_8309 364
243 3300061734 Ga0530510_0000124 Ga0530510_0000124_29583_30797 364
244 3300005347 Ga0070668_100236870 Ga0070668_1002368701 365
245 3300005353 Ga0070669_100089650 Ga0070669_1000896502 365
246 3300009148 Ga0105243_10051407 Ga0105243_100514073 365
247 3300010375 Ga0105239_10344223 Ga0105239_103442231 365
248 3300025986 Ga0207658_10093958 Ga0207658_100939582 365
249 3300035111 Ga0373923_0003454 Ga0373923_0003454_3151_4365 365
250 3300035117 Ga0373953_0014930 Ga0373953_0014930_76_1290 365
251 3300035118 Ga0373954_0000600 Ga0373954_0000600_425_1639 365
252 3300035120 Ga0373957_0002034 Ga0373957_0002034_917_2131 365
253 3300035724 Ga0373933_0002820 Ga0373933_0002820_339_1553 365
254 3300036401 Ga0373937_0076740 Ga0373937_0076740_1074_2288 365
255 3300046459 Ga0495629_0006344 Ga0495629_0006344_7359_8573 365
256 3300046463 Ga0495653_0000404 Ga0495653_0000404_32529_33743 365
257 3300046511 Ga0495608_0013850 Ga0495608_0013850_1272_2486 365
258 3300046516 Ga0495628_0028560 Ga0495628_0028560_2708_3922 365
259 3300046529 Ga0495652_0010990 Ga0495652_0010990_6481_7695 365
260 3300046533 Ga0495640_0084696 Ga0495640_0084696_295_1509 365
261 3300046663 Ga0495635_0005996 Ga0495635_0005996_202_1416 365
262 3300047317 Ga0495604_0024989 Ga0495604_0024989_53_1267 365
263 3300047319 Ga0495674_0017430 Ga0495674_0017430_1314_2528 365
264 3300047322 Ga0495680_0013405 Ga0495680_0013405_737_1951 365
265 3300048913 Ga0496110_0005345 Ga0496110_0005345_35_1165 365
266 3300048928 Ga0496125_0092132 Ga0496125_0092132_26_1246 365
267 3300049580 Ga0501046_0238802 Ga0501046_0238802_72_1274 365
268 3300050493 nmdc:mga0k408_1654_c1 nmdc:mga0k408_1654_c1_586_1764 365
269 3300053077 Ga0495601_0038817 Ga0495601_0038817_360_1574 365
270 3300053084 Ga0495595_0002633 Ga0495595_0002633_5384_6598 365
271 3300003323 rootH1_10010522 rootH1_100105222 366
272 3300005548 Ga0070665_100207191 Ga0070665_1002071913 366
273 3300009174 Ga0105241_10036380 Ga0105241_100363804 366
274 3300010375 Ga0105239_10393554 Ga0105239_103935542 366
275 3300013104 Ga0157370_10037994 Ga0157370_100379944 366
276 3300036401 Ga0373937_0228637 Ga0373937_0228637_459_1670 366
277 iso_pu_bacteria 8006964411 8006966894 366
278 3300003215 JGI25153J46596_10000132 JGI25153J46596_1000013218 367
279 3300025253 Ga0209677_100746 Ga0209677_1007466 367
280 3300025297 Ga0209758_1000169 Ga0209758_100016920 367
281 3300028381 Ga0268264_10000030 Ga0268264_10000030266 367
282 3300048924 Ga0496121_0054782 Ga0496121_0054782_1326_2531 367
283 3300049741 Ga0501079_0134116 Ga0501079_0134116_759_1898 367
284 3300061734 Ga0530510_0057525 Ga0530510_0057525_1652_2791 367
285 3300005331 Ga0070670_100093365 Ga0070670_1000933653 368
286 3300005445 Ga0070708_100056305 Ga0070708_1000563052 368
287 3300005467 Ga0070706_100042684 Ga0070706_1000426843 368
288 3300005518 Ga0070699_100129129 Ga0070699_1001291292 368
289 3300005548 Ga0070665_100000767 Ga0070665_10000076730 368
290 3300005985 Ga0081539_10000220 Ga0081539_1000022073 368
291 3300006871 Ga0075434_100009598 Ga0075434_1000095982 368
292 3300006871 Ga0075434_100154603 Ga0075434_1001546034 368
293 3300009101 Ga0105247_10010363 Ga0105247_100103635 368
294 3300010375 Ga0105239_10088255 Ga0105239_100882552 368
295 3300021320 Ga0214544_1000001 Ga0214544_1000001585 368
296 3300021321 Ga0214542_1000606 Ga0214542_100060633 368
297 3300021324 Ga0214545_1000003 Ga0214545_1000003176 368
298 3300021327 Ga0214543_1000002 Ga0214543_1000002589 368
299 3300025900 Ga0207710_10020193 Ga0207710_100201933 368
300 3300025910 Ga0207684_10028224 Ga0207684_100282242 368
301 3300026088 Ga0207641_10063951 Ga0207641_100639513 368
302 3300028379 Ga0268266_10001064 Ga0268266_1000106419 368
303 3300046642 Ga0495634_0128297 Ga0495634_0128297_168_1364 368
304 3300046690 Ga0495624_0081568 Ga0495624_0081568_15_1199 368
305 3300048924 Ga0496121_0068548 Ga0496121_0068548_36_1250 368
306 3300048929 Ga0496126_0056273 Ga0496126_0056273_1620_2828 368
307 3300049575 Ga0501039_0150509 Ga0501039_0150509_85_1281 368
308 3300049576 Ga0501040_0020286 Ga0501040_0020286_2679_3875 368
309 3300049577 Ga0501041_0003213 Ga0501041_0003213_3967_5163 368
310 3300049578 Ga0501042_0005770 Ga0501042_0005770_3534_4730 368
311 3300049824 Ga0501045_0195591 Ga0501045_0195591_28_1224 368
312 3300050512 nmdc:mga0n895_234335_c1 nmdc:mga0n895_234335_c1_495_1730 368
313 3300050512 nmdc:mga0n895_41751_c1 nmdc:mga0n895_41751_c1_1441_2682 368
314 3300053130 Ga0500642_0000138 Ga0500642_0000138_24618_25820 368
315 3300005536 Ga0070697_100062643 Ga0070697_1000626432 369
316 3300006038 Ga0075365_10007353 Ga0075365_100073533 370
317 3300006051 Ga0075364_10002835 Ga0075364_100028354 370
318 3300006178 Ga0075367_10018665 Ga0075367_100186653 370
319 3300006237 Ga0097621_100067278 Ga0097621_1000672781 370
320 3300009177 Ga0105248_10030358 Ga0105248_100303584 370
321 3300009551 Ga0105238_10050080 Ga0105238_100500801 370
322 3300014968 Ga0157379_10129585 Ga0157379_101295852 370
323 3300025941 Ga0207711_10066838 Ga0207711_100668383 370
324 3300030521 Ga0307511_10074407 Ga0307511_100744073 370
325 3300031456 Ga0307513_10186349 Ga0307513_101863491 370
326 3300035695 Ga0373927_0066987 Ga0373927_0066987_1002_2222 370
327 3300037068 Ga0373925_0058587 Ga0373925_0058587_485_1705 370
328 3300046460 Ga0495638_0013934 Ga0495638_0013934_207_1445 370
329 3300048918 Ga0496115_0205737 Ga0496115_0205737_336_1496 370
330 3300050489 nmdc:mga03683_31637_c1 nmdc:mga03683_31637_c1_28_1188 370
331 3300050490 nmdc:mga03n38_22850_c1 nmdc:mga03n38_22850_c1_736_1896 370
332 3300050491 nmdc:mga00v17_2537_c1 nmdc:mga00v17_2537_c1_2434_3594 370
333 3300050492 nmdc:mga0yw44_2683_c1 nmdc:mga0yw44_2683_c1_4197_5393 370
334 3300050494 nmdc:mga06z11_11275_c1 nmdc:mga06z11_11275_c1_1410_2570 370
335 3300050511 nmdc:mga08y16_161240_c1 nmdc:mga08y16_161240_c1_704_1882 370
336 3300053094 Ga0500566_0023534 Ga0500566_0023534_1891_3111 370
337 3300053148 Ga0500590_103773 Ga0500590_103773_88_1308 370
338 3300053153 Ga0500616_0002878 Ga0500616_0002878_12559_13761 370
339 3300053177 Ga0500636_0090836 Ga0500636_0090836_242_1462 370
340 iso_pu_bacteria 2545555834 2545675760 370
341 iso_pu_bacteria 641522639 641641638 370
342 3300005549 Ga0070704_100105605 Ga0070704_1001056052 371
343 3300005842 Ga0068858_100217665 Ga0068858_1002176652 371
344 3300009094 Ga0111539_10026475 Ga0111539_100264757 371
345 3300009101 Ga0105247_10070391 Ga0105247_100703913 371
346 3300010375 Ga0105239_10019302 Ga0105239_100193026 371
347 3300014325 Ga0163163_10284851 Ga0163163_102848511 371
348 3300025911 Ga0207654_10134306 Ga0207654_101343062 371
349 3300025933 Ga0207706_10029359 Ga0207706_100293593 371
350 3300026035 Ga0207703_10160375 Ga0207703_101603752 371
351 3300026095 Ga0207676_10068846 Ga0207676_100688462 371
352 3300026118 Ga0207675_100231902 Ga0207675_1002319022 371
353 3300028794 Ga0307515_10000121 Ga0307515_100001217 371
354 3300031251 Ga0265327_10000359 Ga0265327_100003595 371
355 3300048906 Ga0496103_0015202 Ga0496103_0015202_833_2125 371
356 3300048909 Ga0496106_0193301 Ga0496106_0193301_177_1415 371
357 3300048911 Ga0496108_0100688 Ga0496108_0100688_36_1214 371
358 3300048915 Ga0496112_0096063 Ga0496112_0096063_1232_2470 371
359 3300050492 nmdc:mga0yw44_11924_c1 nmdc:mga0yw44_11924_c1_198_1424 371
360 3300059493 Ga0587077_002369 Ga0587077_002369_712_1950 371
361 3300059645 Ga0587076_000364 Ga0587076_000364_234_1472 371
362 iso_pu_bacteria 2882912400 2882917659 371
363 3300009098 Ga0105245_10067141 Ga0105245_100671413 372
364 3300009177 Ga0105248_10064482 Ga0105248_100644823 372
365 3300010375 Ga0105239_10020128 Ga0105239_100201287 372
366 3300014969 Ga0157376_10103217 Ga0157376_101032172 372
367 3300025923 Ga0207681_10165038 Ga0207681_101650382 372
368 3300025924 Ga0207694_10116421 Ga0207694_101164211 372
369 3300025933 Ga0207706_10176941 Ga0207706_101769411 372
370 3300031548 Ga0307408_100062279 Ga0307408_1000622792 372
371 3300046537 Ga0495598_0009037 Ga0495598_0009037_706_1932 372
372 3300046615 Ga0495656_0015466 Ga0495656_0015466_627_1853 372
373 3300046664 Ga0495659_0016606 Ga0495659_0016606_579_1805 372
374 3300047318 Ga0495636_0079051 Ga0495636_0079051_17_1243 372
375 3300048910 Ga0496107_0261401 Ga0496107_0261401_35_1213 372
376 iso_pu_bacteria 2961127735 2961135084 372
377 3300031616 Ga0307508_10014365 Ga0307508_100143655 373
378 3300033442 Ga0315911_1000015 Ga0315911_100001585 373
379 3300049744 Ga0501083_0091754 Ga0501083_0091754_805_1992 373
380 3300053104 Ga0500556_0000488 Ga0500556_0000488_24571_25809 373
381 3300060353 Ga0501082_0379979 Ga0501082_0379979_34_1209 373
382 3300061734 Ga0530510_0263898 Ga0530510_0263898_26_1252 373
383 iso_pu_bacteria 2513237137 2513860769 373
384 iso_pu_bacteria 2513237139 2513878319 373
385 iso_pu_bacteria 2513237146 2513925969 373
386 iso_pu_bacteria 2802429603 2805920542 373
387 iso_pu_bacteria 2838661181 2838661801 373
388 iso_pu_bacteria 2842333319 2842338549 373
389 3300005548 Ga0070665_100005441 Ga0070665_1000054417 374
390 3300005937 Ga0081455_10020968 Ga0081455_100209686 374
391 3300005985 Ga0081539_10004536 Ga0081539_1000453617 374
392 3300006177 Ga0075362_10000592 Ga0075362_100005927 374
393 3300006186 Ga0075369_10000268 Ga0075369_100002687 374
394 3300006353 Ga0075370_10029395 Ga0075370_100293952 374
395 3300025906 Ga0207699_10004981 Ga0207699_100049813 374
396 3300028573 Ga0265334_10014054 Ga0265334_100140543 374
397 3300031247 Ga0265340_10029401 Ga0265340_100294013 374
398 3300035691 Ga0373931_0054255 Ga0373931_0054255_587_1807 374
399 3300042438 Ga0439459_0018515 Ga0439459_0018515_24_1244 374
400 3300049570 Ga0501033_0122956 Ga0501033_0122956_410_1576 374
401 3300049572 Ga0501036_0217132 Ga0501036_0217132_253_1419 374
402 3300049575 Ga0501039_0109738 Ga0501039_0109738_847_2013 374
403 3300049576 Ga0501040_0112507 Ga0501040_0112507_80_1246 374
404 3300049582 Ga0501048_0014698 Ga0501048_0014698_2316_3482 374
405 3300049591 Ga0501075_0001740 Ga0501075_0001740_7993_9159 374
406 3300049592 Ga0501076_0003169 Ga0501076_0003169_1556_2722 374
407 3300049741 Ga0501079_0102110 Ga0501079_0102110_829_1995 374
408 3300049743 Ga0501081_0075352 Ga0501081_0075352_941_2107 374
409 3300049824 Ga0501045_0032680 Ga0501045_0032680_518_1684 374
410 3300050489 nmdc:mga03683_321_c2 nmdc:mga03683_321_c2_4606_5847 374
411 3300050496 nmdc:mga07m45_7056_c1 nmdc:mga07m45_7056_c1_3112_4353 374
412 3300054114 Ga0501084_0052699 Ga0501084_0052699_761_1927 374
413 3300060353 Ga0501082_0031517 Ga0501082_0031517_19_1185 374
414 iso_pu_bacteria 2513237102 2513702678 374
415 iso_pu_bacteria 2515075009 2515110619 374
416 iso_pu_bacteria 2937822353 2937824196 374
417 3300005289 Ga0065704_10119026 Ga0065704_101190262 375
418 3300005336 Ga0070680_100204894 Ga0070680_1002048941 375
419 3300005338 Ga0068868_100041625 Ga0068868_1000416252 375
420 3300005435 Ga0070714_100011902 Ga0070714_1000119023 375
421 3300005455 Ga0070663_100018999 Ga0070663_1000189992 375
422 3300005456 Ga0070678_100018567 Ga0070678_1000185673 375
423 3300005457 Ga0070662_100310017 Ga0070662_1003100171 375
424 3300005535 Ga0070684_100007310 Ga0070684_1000073106 375
425 3300005563 Ga0068855_100062964 Ga0068855_1000629643 375
426 3300005615 Ga0070702_100061499 Ga0070702_1000614992 375
427 3300005719 Ga0068861_100057800 Ga0068861_1000578002 375
428 3300005842 Ga0068858_100030613 Ga0068858_1000306132 375
429 3300005937 Ga0081455_10000597 Ga0081455_1000059731 375
430 3300007265 Ga0099794_10033208 Ga0099794_100332081 375
431 3300009098 Ga0105245_10033787 Ga0105245_100337873 375
432 3300009148 Ga0105243_10062079 Ga0105243_100620792 375
433 3300009174 Ga0105241_10013031 Ga0105241_100130312 375
434 3300009174 Ga0105241_10069409 Ga0105241_100694092 375
435 3300009545 Ga0105237_10126256 Ga0105237_101262562 375
436 3300009553 Ga0105249_10245812 Ga0105249_102458122 375
437 3300010375 Ga0105239_10155796 Ga0105239_101557962 375
438 3300013308 Ga0157375_10293625 Ga0157375_102936252 375
439 3300025911 Ga0207654_10012598 Ga0207654_100125983 375
440 3300025929 Ga0207664_10007341 Ga0207664_100073414 375
441 3300025933 Ga0207706_10025090 Ga0207706_100250905 375
442 3300025941 Ga0207711_10079519 Ga0207711_100795193 375
443 3300025942 Ga0207689_10021152 Ga0207689_100211525 375
444 3300025961 Ga0207712_10042142 Ga0207712_100421421 375
445 3300025972 Ga0207668_10294555 Ga0207668_102945551 375
446 3300025981 Ga0207640_10198155 Ga0207640_101981551 375
447 3300025986 Ga0207658_10052566 Ga0207658_100525661 375
448 3300026067 Ga0207678_10031887 Ga0207678_100318875 375
449 3300026078 Ga0207702_10049798 Ga0207702_100497983 375
450 3300026118 Ga0207675_100004262 Ga0207675_10000426213 375
451 3300026118 Ga0207675_100071196 Ga0207675_1000711962 375
452 3300026121 Ga0207683_10017904 Ga0207683_100179043 375
453 3300027671 Ga0209588_1001310 Ga0209588_10013105 375
454 3300028380 Ga0268265_10034906 Ga0268265_100349062 375
455 3300028381 Ga0268264_10172450 Ga0268264_101724502 375
456 3300031616 Ga0307508_10056557 Ga0307508_100565572 375
457 3300038443 Ga0395901_0008600 Ga0395901_0008600_7199_8422 375
458 3300039453 Ga0436362_0524297 Ga0436362_0524297_2080_3348 375
459 3300048905 Ga0496102_0171491 Ga0496102_0171491_62_1288 375
460 3300048913 Ga0496110_0137941 Ga0496110_0137941_868_2094 375
461 3300050496 nmdc:mga07m45_94345_c1 nmdc:mga07m45_94345_c1_244_1470 375
462 3300054114 Ga0501084_0350736 Ga0501084_0350736_14_1228 375
463 iso_pu_bacteria 2824696289 2824697673 375
464 iso_pu_bacteria 2847939898 2847947923 375
465 iso_pu_bacteria 2856364286 2856365860 375
466 iso_pu_bacteria 2869285874 2869286747 375
467 iso_pu_bacteria 2871429161 2871434010 375
468 iso_pu_bacteria 2874146452 2874147668 375
469 iso_pu_bacteria 2874155637 2874156587 375
470 iso_pu_bacteria 2876413966 2876414840 375
471 iso_pu_bacteria 2878745973 2878746720 375
472 iso_pu_bacteria 2903492973 2903498162 375
473 iso_pu_bacteria 2906308376 2906309101 375
474 iso_pu_bacteria 2906321335 2906326707 375
475 iso_pu_bacteria 2937813078 2937814041 375
476 iso_pu_bacteria 2958130278 2958131150 375
477 iso_pu_bacteria 2958179912 2958180549 375
478 iso_pu_bacteria 2961077736 2961078384 375
479 iso_pu_bacteria 2977843712 2977845256 375
480 iso_pu_bacteria 3000135777 3000140847 375
481 iso_pu_bacteria 8004387939 8004388030 375
482 iso_pu_bacteria 8004714634 8004715358 375
483 3300005262 Ga0065165_1013172 Ga0065165_10131723 376
484 3300005456 Ga0070678_100009926 Ga0070678_1000099262 376
485 3300005543 Ga0070672_100193010 Ga0070672_1001930102 376
486 3300009174 Ga0105241_10059230 Ga0105241_100592303 376
487 3300025960 Ga0207651_10268175 Ga0207651_102681751 376
488 3300031616 Ga0307508_10086954 Ga0307508_100869542 376
489 3300046460 Ga0495638_0016915 Ga0495638_0016915_3422_4627 376
490 3300046506 Ga0495583_0074913 Ga0495583_0074913_15_1178 376
491 3300046660 Ga0495625_0162567 Ga0495625_0162567_153_1403 376
492 iso_pu_bacteria 2513237090 2513614097 376
493 iso_pu_bacteria 2513237305 2514421682 376
494 iso_pu_bacteria 2513237351 2514591822 376
495 iso_pu_bacteria 2597489875 2597811240 376
496 iso_pu_bacteria 2599185301 2599940682 376
497 iso_pu_bacteria 2643221595 2643987640 376
498 iso_pu_bacteria 2643221627 2644157838 376
499 iso_pu_bacteria 2693429783 2694629695 376
500 iso_pu_bacteria 2693429784 2694638097 376
501 iso_pu_bacteria 2721755686 2723578156 376
502 iso_pu_bacteria 2791355123 2792745437 376
503 iso_pu_bacteria 2847670302 2847672389 376
504 iso_pu_bacteria 2856314179 2856315084 376
505 iso_pu_bacteria 2856342000 2856344853 376
506 iso_pu_bacteria 2856349417 2856355241 376
507 iso_pu_bacteria 2857349434 2857353724 376
508 iso_pu_bacteria 2871488783 2871489509 376
509 iso_pu_bacteria 2871495908 2871496322 376
510 iso_pu_bacteria 2874123672 2874124402 376
511 iso_pu_bacteria 2876369609 2876374835 376
512 iso_pu_bacteria 2878035449 2878042057 376
513 iso_pu_bacteria 2878753008 2878754086 376
514 iso_pu_bacteria 2878760144 2878760551 376
515 iso_pu_bacteria 2878767105 2878767514 376
516 iso_pu_bacteria 2881147464 2881150964 376
517 iso_pu_bacteria 2881155292 2881158522 376
518 iso_pu_bacteria 2881161766 2881166664 376
519 iso_pu_bacteria 2881845957 2881851319 376
520 iso_pu_bacteria 2881853255 2881855394 376
521 iso_pu_bacteria 2881861095 2881864136 376
522 iso_pu_bacteria 2885305155 2885308751 376
523 iso_pu_bacteria 2885312484 2885318696 376
524 iso_pu_bacteria 2885318864 2885324410 376
525 iso_pu_bacteria 2885326080 2885326447 376
526 iso_pu_bacteria 2885334103 2885334807 376
527 iso_pu_bacteria 2885342637 2885347550 376
528 iso_pu_bacteria 2885350715 2885356755 376
529 iso_pu_bacteria 2888350351 2888353010 376
530 iso_pu_bacteria 2889016732 2889020163 376
531 iso_pu_bacteria 2903492973 2903494611 376
532 iso_pu_bacteria 2903540706 2903541116 376
533 iso_pu_bacteria 2906328253 2906329156 376
534 iso_pu_bacteria 2906354277 2906355413 376
535 iso_pu_bacteria 2906414383 2906415081 376
536 iso_pu_bacteria 2922130491 2922131783 376
537 iso_pu_bacteria 2922185730 2922194161 376
538 iso_pu_bacteria 2924762789 2924767139 376
539 iso_pu_bacteria 2924784321 2924788832 376
540 iso_pu_bacteria 2937848649 2937851177 376
541 iso_pu_bacteria 2937994558 2937994969 376
542 iso_pu_bacteria 2958165035 2958165449 376
543 iso_pu_bacteria 2958172287 2958174974 376
544 iso_pu_bacteria 2961163497 2961163907 376
545 iso_pu_bacteria 2961170736 2961171718 376
546 iso_pu_bacteria 2965018300 2965018712 376
547 iso_pu_bacteria 2965119406 2965120475 376
548 iso_pu_bacteria 2967996073 2967996577 376
549 iso_pu_bacteria 2968003550 2968010212 376
550 iso_pu_bacteria 2968117919 2968120407 376
551 iso_pu_bacteria 2968171901 2968172313 376
552 iso_pu_bacteria 2970503327 2970504314 376
553 iso_pu_bacteria 2970524798 2970527745 376
554 iso_pu_bacteria 2970554993 2970555403 376
555 iso_pu_bacteria 2977821940 2977823301 376
556 iso_pu_bacteria 2977828996 2977831937 376
557 iso_pu_bacteria 2977864932 2977870948 376
558 iso_pu_bacteria 2977922695 2977923513 376
559 iso_pu_bacteria 2977942078 2977949833 376
560 iso_pu_bacteria 2977971508 2977980133 376
561 iso_pu_bacteria 2977986579 2977993167 376
562 iso_pu_bacteria 2979710463 2979714549 376
563 iso_pu_bacteria 2979808191 2979808951 376
564 iso_pu_bacteria 2987636660 2987642863 376
565 iso_pu_bacteria 2987659509 2987659919 376
566 iso_pu_bacteria 2987666974 2987671116 376
567 iso_pu_bacteria 3004188549 3004188966 376
568 iso_pu_bacteria 3004203850 3004210656 376
569 iso_pu_bacteria 3004211236 3004212846 376
570 iso_pu_bacteria 3004218560 3004223054 376
571 iso_pu_bacteria 8004374579 8004375662 376
572 3300009551 Ga0105238_10414624 Ga0105238_104146241 377
573 3300035695 Ga0373927_0011590 Ga0373927_0011590_74_1270 377
574 3300036401 Ga0373937_0013664 Ga0373937_0013664_5738_6934 377
575 3300037068 Ga0373925_0038208 Ga0373925_0038208_2100_3296 377
576 3300046475 Ga0495639_0016556 Ga0495639_0016556_1663_2865 377
577 3300046514 Ga0495618_0029855 Ga0495618_0029855_554_1768 377
578 3300046663 Ga0495635_0156185 Ga0495635_0156185_185_1381 377
579 3300050492 nmdc:mga0yw44_18940_c1 nmdc:mga0yw44_18940_c1_1677_2873 377
580 iso_pu_bacteria 2524023205 2524436115 377
581 3300005436 Ga0070713_100011978 Ga0070713_1000119783 378
582 3300006028 Ga0070717_10017426 Ga0070717_100174263 378
583 3300009093 Ga0105240_10019955 Ga0105240_1001995510 378
584 3300009093 Ga0105240_10273743 Ga0105240_102737432 378
585 3300009174 Ga0105241_10013273 Ga0105241_100132732 378
586 3300009545 Ga0105237_10159030 Ga0105237_101590301 378
587 3300010375 Ga0105239_10001550 Ga0105239_1000155020 378
588 3300010375 Ga0105239_10380867 Ga0105239_103808672 378
589 3300014968 Ga0157379_10000395 Ga0157379_1000039513 378
590 3300025924 Ga0207694_10177602 Ga0207694_101776021 378
591 3300026142 Ga0207698_10058457 Ga0207698_100584573 378
592 3300035083 Ga0373926_0059385 Ga0373926_0059385_190_1374 378
593 3300044901 Ga0466960_0078755 Ga0466960_0078755_463_1629 378
594 3300046507 Ga0495606_0024526 Ga0495606_0024526_158_1324 378
595 3300046557 Ga0495622_0001209 Ga0495622_0001209_10429_11646 378
596 3300046557 Ga0495622_0067945 Ga0495622_0067945_107_1273 378
597 3300046559 Ga0495667_0079624 Ga0495667_0079624_13_1179 378
598 3300047471 Ga0495684_0121630 Ga0495684_0121630_33_1199 378
599 3300048916 Ga0496113_0280867 Ga0496113_0280867_146_1312 378
600 3300053086 Ga0500578_0006822 Ga0500578_0006822_3592_4824 378
601 3300053153 Ga0500616_0005315 Ga0500616_0005315_3471_4673 378
602 iso_pu_bacteria 2791355199 2793083942 378
603 iso_pu_bacteria 2889033259 2889037835 378
604 iso_pu_bacteria 643348564 643592613 378
605 3300003215 JGI25153J46596_10010116 JGI25153J46596_100101162 379
606 3300003659 JGI25404J52841_10006470 JGI25404J52841_100064702 379
607 3300005262 Ga0065165_1020027 Ga0065165_10200273 379
608 3300005327 Ga0070658_10027153 Ga0070658_100271532 379
609 3300005339 Ga0070660_100111925 Ga0070660_1001119253 379
610 3300005344 Ga0070661_100136708 Ga0070661_1001367081 379
611 3300005355 Ga0070671_100019458 Ga0070671_1000194585 379
612 3300005455 Ga0070663_100166097 Ga0070663_1001660972 379
613 3300005539 Ga0068853_100346679 Ga0068853_1003466791 379
614 3300005548 Ga0070665_100194716 Ga0070665_1001947162 379
615 3300005548 Ga0070665_100300953 Ga0070665_1003009531 379
616 3300005563 Ga0068855_100000006 Ga0068855_100000006242 379
617 3300005563 Ga0068855_100312069 Ga0068855_1003120693 379
618 3300005616 Ga0068852_100001922 Ga0068852_1000019225 379
619 3300005616 Ga0068852_100031085 Ga0068852_1000310857 379
620 3300005842 Ga0068858_100380920 Ga0068858_1003809202 379
621 3300005843 Ga0068860_100160031 Ga0068860_1001600312 379
622 3300005937 Ga0081455_10001978 Ga0081455_1000197816 379
623 3300005983 Ga0081540_1005364 Ga0081540_10053649 379
624 3300005983 Ga0081540_1008775 Ga0081540_10087757 379
625 3300005983 Ga0081540_1031323 Ga0081540_10313233 379
626 3300005983 Ga0081540_1074391 Ga0081540_10743912 379
627 3300006048 Ga0075363_100105989 Ga0075363_1001059892 379
628 3300006051 Ga0075364_10078265 Ga0075364_100782652 379
629 3300006844 Ga0075428_100101489 Ga0075428_1001014894 379
630 3300006846 Ga0075430_100004132 Ga0075430_1000041322 379
631 3300006847 Ga0075431_100007365 Ga0075431_10000736510 379
632 3300006852 Ga0075433_10007265 Ga0075433_100072656 379
633 3300006871 Ga0075434_100001874 Ga0075434_10000187415 379
634 3300006880 Ga0075429_100020847 Ga0075429_1000208475 379
635 3300006944 Ga0099823_1056234 Ga0099823_10562342 379
636 3300009093 Ga0105240_10000080 Ga0105240_1000008056 379
637 3300009094 Ga0111539_10116263 Ga0111539_101162632 379
638 3300009147 Ga0114129_10008567 Ga0114129_1000856710 379
639 3300009177 Ga0105248_10027112 Ga0105248_100271127 379
640 3300009551 Ga0105238_10000677 Ga0105238_1000067722 379
641 3300009553 Ga0105249_10141900 Ga0105249_101419003 379
642 3300010375 Ga0105239_10217294 Ga0105239_102172942 379
643 3300017792 Ga0163161_10199605 Ga0163161_101996052 379
644 3300021320 Ga0214544_1016901 Ga0214544_10169016 379
645 3300021321 Ga0214542_1016862 Ga0214542_10168622 379
646 3300021327 Ga0214543_1024357 Ga0214543_10243572 379
647 3300025295 Ga0209564_1019793 Ga0209564_10197933 379
648 3300025297 Ga0209758_1000477 Ga0209758_10004779 379
649 3300025297 Ga0209758_1004503 Ga0209758_10045033 379
650 3300025297 Ga0209758_1005549 Ga0209758_10055497 379
651 3300025299 Ga0209256_1010598 Ga0209256_10105985 379
652 3300025302 Ga0207426_1000519 Ga0207426_100051951 379
653 3300025302 Ga0207426_1002865 Ga0207426_10028652 379
654 3300025304 Ga0209257_1004960 Ga0209257_10049604 379
655 3300025904 Ga0207647_10010287 Ga0207647_100102876 379
656 3300025909 Ga0207705_10033730 Ga0207705_100337304 379
657 3300025913 Ga0207695_10000004 Ga0207695_10000004636 379
658 3300025919 Ga0207657_10078838 Ga0207657_100788383 379
659 3300025924 Ga0207694_10000014 Ga0207694_10000014310 379
660 3300025933 Ga0207706_10140759 Ga0207706_101407593 379
661 3300025941 Ga0207711_10322564 Ga0207711_103225641 379
662 3300025949 Ga0207667_10000202 Ga0207667_1000020237 379
663 3300026041 Ga0207639_10103867 Ga0207639_101038671 379
664 3300026116 Ga0207674_10161731 Ga0207674_101617312 379
665 3300026118 Ga0207675_100212550 Ga0207675_1002125502 379
666 3300026142 Ga0207698_10003027 Ga0207698_100030278 379
667 3300027296 Ga0209389_1000014 Ga0209389_10000148 379
668 3300027296 Ga0209389_1000077 Ga0209389_100007747 379
669 3300027357 Ga0209589_1000020 Ga0209589_10000208 379
670 3300027361 Ga0209489_100251 Ga0209489_10025147 379
671 3300027361 Ga0209489_102003 Ga0209489_10200336 379
672 3300027363 Ga0209700_100271 Ga0209700_10027146 379
673 3300027907 Ga0207428_10000141 Ga0207428_1000014115 379
674 3300028379 Ga0268266_10230442 Ga0268266_102304422 379
675 3300031903 Ga0307407_10124419 Ga0307407_101244191 379
676 3300037471 Ga0395905_0039141 Ga0395905_0039141_1680_2882 379
677 3300044658 Ga0466972_0000850 Ga0466972_0000850_6724_7926 379
678 3300044658 Ga0466972_0008407 Ga0466972_0008407_2031_3242 379
679 3300046462 Ga0495651_0030168 Ga0495651_0030168_2352_3554 379
680 3300046477 Ga0495664_0027419 Ga0495664_0027419_330_1532 379
681 3300046511 Ga0495608_0046826 Ga0495608_0046826_1558_2760 379
682 3300046522 Ga0495643_0030555 Ga0495643_0030555_135_1337 379
683 3300046529 Ga0495652_0072645 Ga0495652_0072645_655_1857 379
684 3300046543 Ga0495645_0046341 Ga0495645_0046341_877_2079 379
685 3300046642 Ga0495634_0038079 Ga0495634_0038079_981_2183 379
686 3300046663 Ga0495635_0003249 Ga0495635_0003249_4635_5837 379
687 3300046675 Ga0495657_0002292 Ga0495657_0002292_11747_12949 379
688 3300046678 Ga0495599_0008570 Ga0495599_0008570_4300_5502 379
689 3300046680 Ga0495646_0012566 Ga0495646_0012566_3471_4673 379
690 3300046809 Ga0495600_0002145 Ga0495600_0002145_2066_3268 379
691 3300047317 Ga0495604_0038331 Ga0495604_0038331_2353_3555 379
692 3300047322 Ga0495680_0000920 Ga0495680_0000920_23167_24369 379
693 3300047443 Ga0495687_017251 Ga0495687_017251_2298_3500 379
694 3300048088 Ga0495602_0003728 Ga0495602_0003728_7825_9027 379
695 3300048906 Ga0496103_0031264 Ga0496103_0031264_1666_2868 379
696 3300048913 Ga0496110_0339174 Ga0496110_0339174_117_1319 379
697 3300048915 Ga0496112_0025987 Ga0496112_0025987_2472_3680 379
698 3300048926 Ga0496123_0136243 Ga0496123_0136243_49_1251 379
699 3300048926 Ga0496123_0153368 Ga0496123_0153368_16_1209 379
700 3300048928 Ga0496125_0039946 Ga0496125_0039946_958_2160 379
701 3300049460 Ga0495682_0000505 Ga0495682_0000505_2164_3387 379
702 3300050507 nmdc:mga05p37_117995_c1 nmdc:mga05p37_117995_c1_918_2105 379
703 3300050508 nmdc:mga09592_2872_c1 nmdc:mga09592_2872_c1_9979_11166 379
704 3300050509 nmdc:mga0qj67_19636_c1 nmdc:mga0qj67_19636_c1_918_2105 379
705 3300050510 nmdc:mga06r32_131736_c1 nmdc:mga06r32_131736_c1_918_2105 379
706 3300050511 nmdc:mga08y16_7584_c1 nmdc:mga08y16_7584_c1_1159_2346 379
707 3300050511 nmdc:mga08y16_88510_c1 nmdc:mga08y16_88510_c1_41_1249 379
708 3300050512 nmdc:mga0n895_1857_c1 nmdc:mga0n895_1857_c1_5958_7145 379
709 3300053087 Ga0500643_000373 Ga0500643_000373_5070_6272 379
710 3300053091 Ga0500647_0017242 Ga0500647_0017242_163_1365 379
711 3300053092 Ga0500583_0057419 Ga0500583_0057419_516_1718 379
712 3300053103 Ga0500555_001336 Ga0500555_001336_2010_3212 379
713 3300053105 Ga0500557_000003 Ga0500557_000003_220758_221960 379
714 3300053119 Ga0500595_035470 Ga0500595_035470_112_1314 379
715 3300053122 Ga0500608_041016 Ga0500608_041016_97_1347 379
716 3300053133 Ga0500655_005677 Ga0500655_005677_181_1404 379
717 3300053177 Ga0500636_0000857 Ga0500636_0000857_7586_8788 379
718 3300053729 Ga0500625_004251 Ga0500625_004251_1301_2503 379
719 iso_pu_bacteria 2507262055 2507507495 379
720 iso_pu_bacteria 2508501009 2508541611 379
721 iso_pu_bacteria 2508501042 2508692847 379
722 iso_pu_bacteria 2511231028 2511398121 379
723 iso_pu_bacteria 2513237092 2513621688 379
724 iso_pu_bacteria 2513237094 2513636862 379
725 iso_pu_bacteria 2513237095 2513651192 379
726 iso_pu_bacteria 2513237161 2514011753 379
727 iso_pu_bacteria 2515154112 2515626240 379
728 iso_pu_bacteria 2617270735 2617352755 379
729 iso_pu_bacteria 2816332527 2818236730 379
730 iso_pu_bacteria 2824600985 2824602958 379
731 iso_pu_bacteria 2824609381 2824611819 379
732 iso_pu_bacteria 2824671348 2824672285 379
733 iso_pu_bacteria 2824679649 2824682307 379
734 iso_pu_bacteria 2824687955 2824688832 379
735 iso_pu_bacteria 2824704595 2824707862 379
736 iso_pu_bacteria 2824732956 2824733988 379
737 iso_pu_bacteria 2824753945 2824757949 379
738 iso_pu_bacteria 2824763712 2824766516 379
739 iso_pu_bacteria 2824773399 2824776639 379
740 iso_pu_bacteria 2838122688 2838129396 379
741 iso_pu_bacteria 2841941048 2841946432 379
742 iso_pu_bacteria 2841949485 2841953653 379
743 iso_pu_bacteria 2841957949 2841962741 379
744 iso_pu_bacteria 2841966195 2841972942 379
745 iso_pu_bacteria 2841974524 2841978386 379
746 iso_pu_bacteria 2841983080 2841990601 379
747 iso_pu_bacteria 2842038055 2842040819 379
748 iso_pu_bacteria 2842045827 2842046236 379
749 iso_pu_bacteria 2847930680 2847937500 379
750 iso_pu_bacteria 2849076700 2849078230 379
751 iso_pu_bacteria 2874590934 2874598610 379
752 iso_pu_bacteria 2874612657 2874619237 379
753 iso_pu_bacteria 2874620515 2874628247 379
754 iso_pu_bacteria 2874645413 2874652064 379
755 iso_pu_bacteria 2876771140 2876778649 379
756 iso_pu_bacteria 2876818435 2876823453 379
757 iso_pu_bacteria 2879074833 2879082442 379
758 iso_pu_bacteria 2879083081 2879084913 379
759 iso_pu_bacteria 2879127579 2879131777 379
760 iso_pu_bacteria 2879142872 2879150113 379
761 iso_pu_bacteria 2881364244 2881370077 379
762 iso_pu_bacteria 2881665667 2881670093 379
763 iso_pu_bacteria 2883291878 2883293807 379
764 iso_pu_bacteria 2885366525 2885370137 379
765 iso_pu_bacteria 2888378607 2888385652 379
766 iso_pu_bacteria 2888388044 2888392616 379
767 iso_pu_bacteria 2888419890 2888425771 379
768 iso_pu_bacteria 2904666416 2904674134 379
769 iso_pu_bacteria 2904699407 2904707258 379
770 iso_pu_bacteria 2904711408 2904711786 379
771 iso_pu_bacteria 2906626472 2906627770 379
772 iso_pu_bacteria 2906643746 2906645545 379
773 iso_pu_bacteria 2908775508 2908781352 379
774 iso_pu_bacteria 2919450847 2919450849 379
775 iso_pu_bacteria 2922393267 2922396899 379
776 iso_pu_bacteria 2929615660 2929621212 379
777 iso_pu_bacteria 2929624759 2929625957 379
778 iso_pu_bacteria 2933577622 2933582919 379
779 iso_pu_bacteria 2935608549 2935609998 379
780 iso_pu_bacteria 2935630451 2935634883 379
781 iso_pu_bacteria 2935648319 2935651973 379
782 iso_pu_bacteria 2935656913 2935660054 379
783 iso_pu_bacteria 2935675223 2935680135 379
784 iso_pu_bacteria 2935760218 2935768657 379
785 iso_pu_bacteria 2935819856 2935823158 379
786 iso_pu_bacteria 2935847175 2935848740 379
787 iso_pu_bacteria 2935908558 2935909454 379
788 iso_pu_bacteria 2935916978 2935917178 379
789 iso_pu_bacteria 2935926038 2935926935 379
790 iso_pu_bacteria 2935934488 2935937221 379
791 iso_pu_bacteria 2935942939 2935944476 379
792 iso_pu_bacteria 2935951376 2935952913 379
793 iso_pu_bacteria 2935967501 2935969753 379
794 iso_pu_bacteria 2935975950 2935976352 379
795 iso_pu_bacteria 2935984226 2935987199 379
796 iso_pu_bacteria 2936011229 2936014470 379
797 iso_pu_bacteria 2936019824 2936023690 379
798 iso_pu_bacteria 2936028420 2936031333 379
799 iso_pu_bacteria 2936046547 2936049576 379
800 iso_pu_bacteria 2936055302 2936061209 379
801 iso_pu_bacteria 2941507105 2941511786 379
802 iso_pu_bacteria 2941515067 2941519488 379
803 iso_pu_bacteria 2941523033 2941527819 379
804 iso_pu_bacteria 3005483717 3005485570 379
805 iso_pu_bacteria 3005506211 3005508263 379
806 iso_pu_bacteria 3005587118 3005588233 379
807 iso_pu_bacteria 3005594810 3005600493 379
808 iso_pu_bacteria 3005710791 3005715967 379
809 iso_pu_bacteria 8006984368 8006991463 379
810 iso_pu_bacteria 8016583857 8016594552 379
811 iso_pu_bacteria 8016630954 8016638988 379
812 iso_pu_bacteria 8019638758 8019646782 379
813 iso_pu_bacteria 8019648815 8019649551 379
814 iso_pu_bacteria 8019659431 8019660989 379
815 iso_pu_bacteria 8019668869 8019670559 379
816 iso_pu_bacteria 8019678201 8019685675 379
817 iso_pu_bacteria 8019687851 8019691252 379
818 iso_pu_bacteria 8055742211 8055744926 379
819 3300003215 JGI25153J46596_10001525 JGI25153J46596_1000152513 380
820 3300003320 rootH2_10089381 rootH2_100893811 380
821 3300005436 Ga0070713_100084740 Ga0070713_1000847402 380
822 3300005437 Ga0070710_10002383 Ga0070710_100023835 380
823 3300005439 Ga0070711_100004924 Ga0070711_1000049244 380
824 3300005614 Ga0068856_100029401 Ga0068856_1000294015 380
825 3300005842 Ga0068858_100261472 Ga0068858_1002614722 380
826 3300005983 Ga0081540_1000703 Ga0081540_100070333 380
827 3300005983 Ga0081540_1007737 Ga0081540_10077376 380
828 3300005983 Ga0081540_1017077 Ga0081540_10170775 380
829 3300005983 Ga0081540_1025914 Ga0081540_10259143 380
830 3300005985 Ga0081539_10065465 Ga0081539_100654652 380
831 3300006173 Ga0070716_100009774 Ga0070716_1000097744 380
832 3300006175 Ga0070712_100069405 Ga0070712_1000694053 380
833 3300006195 Ga0075366_10127288 Ga0075366_101272881 380
834 3300009098 Ga0105245_10025672 Ga0105245_100256722 380
835 3300014325 Ga0163163_10083737 Ga0163163_100837372 380
836 3300014969 Ga0157376_10273498 Ga0157376_102734981 380
837 3300025297 Ga0209758_1002906 Ga0209758_10029064 380
838 3300025898 Ga0207692_10003877 Ga0207692_100038773 380
839 3300025915 Ga0207693_10003098 Ga0207693_1000309810 380
840 3300025915 Ga0207693_10114171 Ga0207693_101141712 380
841 3300025916 Ga0207663_10010101 Ga0207663_100101013 380
842 3300025927 Ga0207687_10030267 Ga0207687_100302674 380
843 3300025929 Ga0207664_10012913 Ga0207664_100129134 380
844 3300025939 Ga0207665_10015031 Ga0207665_100150314 380
845 3300025942 Ga0207689_10087574 Ga0207689_100875742 380
846 3300025944 Ga0207661_10132653 Ga0207661_101326532 380
847 3300031731 Ga0307405_10138910 Ga0307405_101389101 380
848 3300035171 Ga0373946_0007217 Ga0373946_0007217_1422_2648 380
849 3300035410 Ga0373924_0022390 Ga0373924_0022390_870_2093 380
850 3300035692 Ga0373935_0006788 Ga0373935_0006788_2030_3256 380
851 3300035695 Ga0373927_0002771 Ga0373927_0002771_10751_11977 380
852 3300035695 Ga0373927_0030797 Ga0373927_0030797_566_1768 380
853 3300035725 Ga0373947_0001734 Ga0373947_0001734_6180_7406 380
854 3300036401 Ga0373937_0010847 Ga0373937_0010847_3426_4649 380
855 3300036401 Ga0373937_0035546 Ga0373937_0035546_2803_4014 380
856 3300037068 Ga0373925_0001112 Ga0373925_0001112_6163_7389 380
857 3300037418 Ga0395900_0108032 Ga0395900_0108032_226_1455 380
858 3300037471 Ga0395905_0020297 Ga0395905_0020297_4209_5429 380
859 3300046454 Ga0495592_0005289 Ga0495592_0005289_4195_5421 380
860 3300046455 Ga0495603_0015327 Ga0495603_0015327_3131_4357 380
861 3300046455 Ga0495603_0046067 Ga0495603_0046067_1304_2530 380
862 3300046459 Ga0495629_0000585 Ga0495629_0000585_26045_27271 380
863 3300046459 Ga0495629_0027490 Ga0495629_0027490_2033_3259 380
864 3300046460 Ga0495638_0004117 Ga0495638_0004117_150_1361 380
865 3300046460 Ga0495638_0007340 Ga0495638_0007340_5328_6554 380
866 3300046461 Ga0495641_0009829 Ga0495641_0009829_1920_3146 380
867 3300046462 Ga0495651_0031330 Ga0495651_0031330_1131_2354 380
868 3300046463 Ga0495653_0035602 Ga0495653_0035602_1649_2875 380
869 3300046473 Ga0495582_0002024 Ga0495582_0002024_9360_10586 380
870 3300046475 Ga0495639_0000075 Ga0495639_0000075_25696_26922 380
871 3300046476 Ga0495662_0012265 Ga0495662_0012265_180_1406 380
872 3300046477 Ga0495664_0001938 Ga0495664_0001938_2486_3709 380
873 3300046477 Ga0495664_0002309 Ga0495664_0002309_1363_2589 380
874 3300046499 Ga0495594_0000120 Ga0495594_0000120_18589_19815 380
875 3300046516 Ga0495628_0023196 Ga0495628_0023196_3796_5022 380
876 3300046517 Ga0495630_0006828 Ga0495630_0006828_3144_4370 380
877 3300046518 Ga0495631_0019215 Ga0495631_0019215_685_1911 380
878 3300046528 Ga0495642_0062124 Ga0495642_0062124_95_1321 380
879 3300046531 Ga0495665_0000085 Ga0495665_0000085_26089_27315 380
880 3300046533 Ga0495640_0000210 Ga0495640_0000210_21474_22700 380
881 3300046533 Ga0495640_0057745 Ga0495640_0057745_1341_2564 380
882 3300046538 Ga0495609_0073708 Ga0495609_0073708_63_1289 380
883 3300046543 Ga0495645_0006472 Ga0495645_0006472_2892_4115 380
884 3300046557 Ga0495622_0005529 Ga0495622_0005529_3043_4269 380
885 3300046642 Ga0495634_0000064 Ga0495634_0000064_77536_78762 380
886 3300046663 Ga0495635_0000316 Ga0495635_0000316_26909_28135 380
887 3300046675 Ga0495657_0078810 Ga0495657_0078810_642_1865 380
888 3300046679 Ga0495623_0033774 Ga0495623_0033774_722_1945 380
889 3300046679 Ga0495623_0122639 Ga0495623_0122639_138_1364 380
890 3300046680 Ga0495646_0027050 Ga0495646_0027050_1998_3221 380
891 3300046681 Ga0495647_0000458 Ga0495647_0000458_6257_7483 380
892 3300046683 Ga0495658_0012805 Ga0495658_0012805_2307_3533 380
893 3300046689 Ga0495613_0001871 Ga0495613_0001871_7346_8572 380
894 3300046690 Ga0495624_0001019 Ga0495624_0001019_9171_10397 380
895 3300046794 Ga0495589_0033890 Ga0495589_0033890_1101_2327 380
896 3300047315 Ga0495581_0000014 Ga0495581_0000014_6879_8105 380
897 3300047315 Ga0495581_0046986 Ga0495581_0046986_962_2188 380
898 3300047317 Ga0495604_0045111 Ga0495604_0045111_217_1440 380
899 3300047319 Ga0495674_0003302 Ga0495674_0003302_1471_2697 380
900 3300047321 Ga0495676_0035424 Ga0495676_0035424_987_2213 380
901 3300047322 Ga0495680_0008385 Ga0495680_0008385_2061_3284 380
902 3300047322 Ga0495680_0225335 Ga0495680_0225335_15_1235 380
903 3300047444 Ga0495675_0028151 Ga0495675_0028151_2337_3560 380
904 3300047471 Ga0495684_0064910 Ga0495684_0064910_718_1941 380
905 3300047673 Ga0495593_0000003 Ga0495593_0000003_35661_36887 380
906 3300048088 Ga0495602_0000619 Ga0495602_0000619_24784_26007 380
907 3300048905 Ga0496102_0012597 Ga0496102_0012597_2908_4170 380
908 3300048907 Ga0496104_0023289 Ga0496104_0023289_3058_4320 380
909 3300048911 Ga0496108_0031446 Ga0496108_0031446_2467_3729 380
910 3300048912 Ga0496109_0055081 Ga0496109_0055081_2355_3617 380
911 3300048914 Ga0496111_0094900 Ga0496111_0094900_85_1347 380
912 3300048915 Ga0496112_0001615 Ga0496112_0001615_8395_9657 380
913 3300048927 Ga0496124_0080696 Ga0496124_0080696_1052_2278 380
914 3300048929 Ga0496126_0003109 Ga0496126_0003109_6458_7684 380
915 3300049568 Ga0501031_0028352 Ga0501031_0028352_2273_3481 380
916 3300049575 Ga0501039_0140031 Ga0501039_0140031_89_1297 380
917 3300049578 Ga0501042_0105162 Ga0501042_0105162_38_1246 380
918 3300049579 Ga0501043_0084041 Ga0501043_0084041_338_1546 380
919 3300049581 Ga0501047_0009098 Ga0501047_0009098_1612_2793 380
920 3300049583 Ga0501067_0000469 Ga0501067_0000469_9107_10288 380
921 3300049587 Ga0501071_0027922 Ga0501071_0027922_1590_2798 380
922 3300049588 Ga0501072_0053029 Ga0501072_0053029_324_1532 380
923 3300049588 Ga0501072_0074758 Ga0501072_0074758_648_1829 380
924 3300049589 Ga0501073_0002098 Ga0501073_0002098_11171_12352 380
925 3300049589 Ga0501073_0180325 Ga0501073_0180325_142_1350 380
926 3300049591 Ga0501075_0041883 Ga0501075_0041883_1584_2792 380
927 3300049591 Ga0501075_0080380 Ga0501075_0080380_1139_2437 380
928 3300049592 Ga0501076_0058073 Ga0501076_0058073_557_1855 380
929 3300049593 Ga0501077_0010828 Ga0501077_0010828_2526_3734 380
930 3300049741 Ga0501079_0021691 Ga0501079_0021691_1097_2401 380
931 3300049742 Ga0501080_0084330 Ga0501080_0084330_1432_2640 380
932 3300049742 Ga0501080_0100705 Ga0501080_0100705_1074_2255 380
933 3300049743 Ga0501081_0040380 Ga0501081_0040380_495_1793 380
934 3300049822 Ga0501035_0118062 Ga0501035_0118062_1014_2222 380
935 3300049824 Ga0501045_0033401 Ga0501045_0033401_2265_3473 380
936 3300050515 nmdc:mga0a205_56157_c1 nmdc:mga0a205_56157_c1_1934_3112 380
937 3300053077 Ga0495601_0019745 Ga0495601_0019745_1502_2725 380
938 3300053078 Ga0495612_0001185 Ga0495612_0001185_759_1982 380
939 3300053084 Ga0495595_0046427 Ga0495595_0046427_201_1424 380
940 3300053108 Ga0500562_006314 Ga0500562_006314_244_1455 380
941 3300053150 Ga0500603_000522 Ga0500603_000522_5214_6428 380
942 3300053156 Ga0500622_0000277 Ga0500622_0000277_27387_28598 380
943 3300054114 Ga0501084_0072294 Ga0501084_0072294_1113_2294 380
944 3300061734 Ga0530510_0034130 Ga0530510_0034130_792_2090 380
945 iso_pu_bacteria 2517093001 2517104349 380
946 iso_pu_bacteria 2667528175 2671118979 380
947 iso_pu_bacteria 2844315083 2844318697 380
948 iso_pu_bacteria 2876808645 2876813662 380
949 iso_pu_bacteria 2879110137 2879117416 380
950 iso_pu_bacteria 2903727486 2903728828 380
951 iso_pu_bacteria 2904690495 2904698913 380
952 iso_pu_bacteria 2906602504 2906604474 380
953 iso_pu_bacteria 2935675223 2935680068 380
954 iso_pu_bacteria 2935684952 2935693851 380
955 iso_pu_bacteria 2935694250 2935700708 380
956 iso_pu_bacteria 2935713505 2935721973 380
957 iso_pu_bacteria 2935722832 2935731382 380
958 iso_pu_bacteria 2935732158 2935741082 380
959 iso_pu_bacteria 2935741537 2935750458 380
960 iso_pu_bacteria 2935750917 2935759713 380
961 iso_pu_bacteria 2940556831 2940565618 380
962 iso_pu_bacteria 8006964411 8006973179 380
963 iso_pu_bacteria 8056967851 8056973105 380
964 3300001979 JGI24740J21852_10005779 JGI24740J21852_100057792 381
965 3300001990 JGI24737J22298_10022085 JGI24737J22298_100220852 381
966 3300002067 JGI24735J21928_10018519 JGI24735J21928_100185192 381
967 3300003203 JGI25406J46586_10004853 JGI25406J46586_100048535 381
968 3300005336 Ga0070680_100103460 Ga0070680_1001034603 381
969 3300005436 Ga0070713_100107094 Ga0070713_1001070941 381
970 3300005458 Ga0070681_10016111 Ga0070681_100161111 381
971 3300005530 Ga0070679_100004347 Ga0070679_1000043472 381
972 3300005563 Ga0068855_100067922 Ga0068855_1000679222 381
973 3300005563 Ga0068855_100136732 Ga0068855_1001367322 381
974 3300005578 Ga0068854_100004568 Ga0068854_1000045684 381
975 3300005834 Ga0068851_10030723 Ga0068851_100307232 381
976 3300005937 Ga0081455_10005841 Ga0081455_100058417 381
977 3300005983 Ga0081540_1008055 Ga0081540_10080552 381
978 3300005985 Ga0081539_10002228 Ga0081539_100022284 381
979 3300006852 Ga0075433_10041337 Ga0075433_100413374 381
980 3300006871 Ga0075434_100039468 Ga0075434_1000394684 381
981 3300006871 Ga0075434_100127116 Ga0075434_1001271162 381
982 3300007076 Ga0075435_100053578 Ga0075435_1000535782 381
983 3300009093 Ga0105240_10236563 Ga0105240_102365631 381
984 3300009101 Ga0105247_10136163 Ga0105247_101361632 381
985 3300009174 Ga0105241_10002269 Ga0105241_100022692 381
986 3300009545 Ga0105237_10069211 Ga0105237_100692112 381
987 3300009551 Ga0105238_10153401 Ga0105238_101534012 381
988 3300013307 Ga0157372_10057946 Ga0157372_100579463 381
989 3300014325 Ga0163163_10077645 Ga0163163_100776452 381
990 3300025254 Ga0209148_1001164 Ga0209148_100116412 381
991 3300025272 Ga0209455_1003325 Ga0209455_10033255 381
992 3300025321 Ga0207656_10033315 Ga0207656_100333151 381
993 3300025904 Ga0207647_10017568 Ga0207647_100175682 381
994 3300025911 Ga0207654_10000362 Ga0207654_1000036227 381
995 3300025912 Ga0207707_10000962 Ga0207707_1000096211 381
996 3300025913 Ga0207695_10046839 Ga0207695_100468392 381
997 3300025917 Ga0207660_10096446 Ga0207660_100964462 381
998 3300025921 Ga0207652_10008084 Ga0207652_100080844 381
999 3300025924 Ga0207694_10003423 Ga0207694_100034233 381
1000 3300025928 Ga0207700_10043281 Ga0207700_100432812 381
1001 3300025929 Ga0207664_10226617 Ga0207664_102266171 381
1002 3300025939 Ga0207665_10012851 Ga0207665_100128511 381
1003 3300025949 Ga0207667_10090752 Ga0207667_100907522 381
1004 3300025949 Ga0207667_10189149 Ga0207667_101891492 381
1005 3300026067 Ga0207678_10050743 Ga0207678_100507432 381
1006 3300026078 Ga0207702_10006411 Ga0207702_100064118 381
1007 3300037068 Ga0373925_0157260 Ga0373925_0157260_36_1265 381
1008 3300037471 Ga0395905_0025863 Ga0395905_0025863_2948_4198 381
1009 3300048907 Ga0496104_0079256 Ga0496104_0079256_647_1861 381
1010 3300048912 Ga0496109_0037236 Ga0496109_0037236_1062_2276 381
1011 3300048916 Ga0496113_0041498 Ga0496113_0041498_1110_2324 381
1012 3300049593 Ga0501077_0177889 Ga0501077_0177889_14_1201 381
1013 3300050512 nmdc:mga0n895_67313_c1 nmdc:mga0n895_67313_c1_2251_3465 381
1014 3300053077 Ga0495601_0042137 Ga0495601_0042137_1168_2388 381
1015 iso_pu_bacteria 2513237101 2513693703 381
1016 iso_pu_bacteria 2513237104 2513721476 381
1017 iso_pu_bacteria 2513237145 2513920829 381
1018 iso_pu_bacteria 2744054633 2745080929 381
1019 iso_pu_bacteria 2824617872 2824621547 381
1020 iso_pu_bacteria 2824626560 2824630659 381
1021 iso_pu_bacteria 2824635225 2824641095 381
1022 iso_pu_bacteria 2874604998 2874611565 381
1023 iso_pu_bacteria 2876761206 2876768259 381
1024 iso_pu_bacteria 2922361189 2922361780 381
1025 iso_pu_bacteria 2922386360 2922386978 381
1026 iso_pu_bacteria 3005718088 3005720197 381
1027 iso_pu_bacteria 8006926726 8006928605 381
1028 iso_pu_bacteria 8006994254 8006994598 381
1029 iso_pu_bacteria 8056673599 8056680936 381
1030 3300005336 Ga0070680_100220727 Ga0070680_1002207272 382
1031 3300005545 Ga0070695_100092429 Ga0070695_1000924293 382
1032 3300005546 Ga0070696_100070185 Ga0070696_1000701854 382
1033 3300005843 Ga0068860_100312200 Ga0068860_1003122002 382
1034 3300006847 Ga0075431_100115054 Ga0075431_1001150542 382
1035 3300009101 Ga0105247_10031058 Ga0105247_100310584 382
1036 3300009147 Ga0114129_10046902 Ga0114129_100469022 382
1037 3300010375 Ga0105239_10127209 Ga0105239_101272092 382
1038 3300010375 Ga0105239_10286979 Ga0105239_102869792 382
1039 3300013297 Ga0157378_10162229 Ga0157378_101622292 382
1040 3300013306 Ga0163162_10414419 Ga0163162_104144192 382
1041 3300013308 Ga0157375_10288331 Ga0157375_102883312 382
1042 3300026075 Ga0207708_10078051 Ga0207708_100780512 382
1043 3300036401 Ga0373937_0028390 Ga0373937_0028390_3585_4808 382
1044 3300046525 Ga0495663_0024935 Ga0495663_0024935_464_1702 382
1045 3300048912 Ga0496109_0270154 Ga0496109_0270154_252_1511 382
1046 3300049577 Ga0501041_0043878 Ga0501041_0043878_974_2212 382
1047 3300049584 Ga0501068_0046997 Ga0501068_0046997_1316_2554 382
1048 3300049588 Ga0501072_0063405 Ga0501072_0063405_848_2089 382
1049 3300049743 Ga0501081_0030845 Ga0501081_0030845_300_1541 382
1050 3300050510 nmdc:mga06r32_146541_c1 nmdc:mga06r32_146541_c1_596_1834 382
1051 3300053077 Ga0495601_0006916 Ga0495601_0006916_3034_4281 382
1052 3300053084 Ga0495595_0018656 Ga0495595_0018656_73_1326 382
1053 3300053085 Ga0495619_0017008 Ga0495619_0017008_476_1723 382
1054 3300060353 Ga0501082_0030779 Ga0501082_0030779_2304_3545 382
1055 3300060353 Ga0501082_0231080 Ga0501082_0231080_151_1389 382
1056 3300061734 Ga0530510_0062640 Ga0530510_0062640_506_1744 382
1057 3300061734 Ga0530510_0184123 Ga0530510_0184123_109_1341 382
1058 3300005335 Ga0070666_10021842 Ga0070666_100218422 383
1059 3300005338 Ga0068868_100117797 Ga0068868_1001177972 383
1060 3300005340 Ga0070689_100037348 Ga0070689_1000373481 383
1061 3300005355 Ga0070671_100222670 Ga0070671_1002226702 383
1062 3300005364 Ga0070673_100099740 Ga0070673_1000997402 383
1063 3300005366 Ga0070659_100083201 Ga0070659_1000832013 383
1064 3300005367 Ga0070667_100051633 Ga0070667_1000516332 383
1065 3300005434 Ga0070709_10014253 Ga0070709_100142533 383
1066 3300005436 Ga0070713_100070534 Ga0070713_1000705343 383
1067 3300005437 Ga0070710_10011141 Ga0070710_100111413 383
1068 3300005439 Ga0070711_100018280 Ga0070711_1000182803 383
1069 3300005440 Ga0070705_100115440 Ga0070705_1001154402 383
1070 3300005456 Ga0070678_100007290 Ga0070678_1000072903 383
1071 3300005544 Ga0070686_100003943 Ga0070686_1000039432 383
1072 3300005547 Ga0070693_100040355 Ga0070693_1000403554 383
1073 3300005618 Ga0068864_100225316 Ga0068864_1002253162 383
1074 3300005718 Ga0068866_10071692 Ga0068866_100716922 383
1075 3300005719 Ga0068861_100202004 Ga0068861_1002020042 383
1076 3300005841 Ga0068863_100087457 Ga0068863_1000874573 383
1077 3300005842 Ga0068858_100215097 Ga0068858_1002150971 383
1078 3300006028 Ga0070717_10009288 Ga0070717_100092883 383
1079 3300006175 Ga0070712_100034943 Ga0070712_1000349432 383
1080 3300006237 Ga0097621_100120396 Ga0097621_1001203963 383
1081 3300006358 Ga0068871_100009687 Ga0068871_1000096872 383
1082 3300006881 Ga0068865_100014777 Ga0068865_1000147772 383
1083 3300009011 Ga0105251_10027458 Ga0105251_100274583 383
1084 3300009101 Ga0105247_10082847 Ga0105247_100828472 383
1085 3300009148 Ga0105243_10059810 Ga0105243_100598104 383
1086 3300010375 Ga0105239_10063147 Ga0105239_100631472 383
1087 3300011119 Ga0105246_10033761 Ga0105246_100337612 383
1088 3300013296 Ga0157374_10042893 Ga0157374_100428932 383
1089 3300013297 Ga0157378_10016311 Ga0157378_100163113 383
1090 3300014325 Ga0163163_10166764 Ga0163163_101667643 383
1091 3300014968 Ga0157379_10112274 Ga0157379_101122742 383
1092 3300014969 Ga0157376_10116919 Ga0157376_101169193 383
1093 3300025898 Ga0207692_10012613 Ga0207692_100126133 383
1094 3300025900 Ga0207710_10015843 Ga0207710_100158433 383
1095 3300025903 Ga0207680_10002857 Ga0207680_100028575 383
1096 3300025906 Ga0207699_10004401 Ga0207699_100044013 383
1097 3300025907 Ga0207645_10160148 Ga0207645_101601482 383
1098 3300025915 Ga0207693_10031616 Ga0207693_100316163 383
1099 3300025919 Ga0207657_10051755 Ga0207657_100517552 383
1100 3300025927 Ga0207687_10011239 Ga0207687_100112392 383
1101 3300025928 Ga0207700_10002297 Ga0207700_100022974 383
1102 3300025931 Ga0207644_10011173 Ga0207644_100111734 383
1103 3300025933 Ga0207706_10163887 Ga0207706_101638872 383
1104 3300025934 Ga0207686_10013343 Ga0207686_100133435 383
1105 3300025936 Ga0207670_10044000 Ga0207670_100440002 383
1106 3300025938 Ga0207704_10139348 Ga0207704_101393481 383
1107 3300025941 Ga0207711_10015827 Ga0207711_100158275 383
1108 3300025942 Ga0207689_10126797 Ga0207689_101267971 383
1109 3300025960 Ga0207651_10081661 Ga0207651_100816612 383
1110 3300026023 Ga0207677_10077257 Ga0207677_100772572 383
1111 3300026035 Ga0207703_10053636 Ga0207703_100536361 383
1112 3300026067 Ga0207678_10004265 Ga0207678_100042651 383
1113 3300026095 Ga0207676_10172743 Ga0207676_101727432 383
1114 3300026121 Ga0207683_10014300 Ga0207683_100143007 383
1115 3300028379 Ga0268266_10084516 Ga0268266_100845162 383
1116 3300035111 Ga0373923_0067501 Ga0373923_0067501_242_1474 383
1117 3300035120 Ga0373957_0035902 Ga0373957_0035902_219_1451 383
1118 3300035692 Ga0373935_0041660 Ga0373935_0041660_487_1698 383
1119 3300035725 Ga0373947_0007909 Ga0373947_0007909_4175_5386 383
1120 3300036401 Ga0373937_0096910 Ga0373937_0096910_775_2007 383
1121 3300037068 Ga0373925_0030889 Ga0373925_0030889_2200_3411 383
1122 3300046459 Ga0495629_0002289 Ga0495629_0002289_4478_5689 383
1123 3300046461 Ga0495641_0043522 Ga0495641_0043522_398_1609 383
1124 3300046533 Ga0495640_0144985 Ga0495640_0144985_55_1287 383
1125 3300046683 Ga0495658_0006005 Ga0495658_0006005_3195_4406 383
1126 3300046689 Ga0495613_0067259 Ga0495613_0067259_1294_2505 383
1127 3300046809 Ga0495600_0104438 Ga0495600_0104438_587_1798 383
1128 3300047322 Ga0495680_0004774 Ga0495680_0004774_7474_8685 383
1129 3300048903 Ga0496100_0024359 Ga0496100_0024359_1203_2414 383
1130 3300048906 Ga0496103_0013673 Ga0496103_0013673_1278_2489 383
1131 3300048907 Ga0496104_0115499 Ga0496104_0115499_556_1767 383
1132 3300048909 Ga0496106_0017681 Ga0496106_0017681_2783_3994 383
1133 3300048910 Ga0496107_0024125 Ga0496107_0024125_1445_2656 383
1134 3300048913 Ga0496110_0015600 Ga0496110_0015600_2181_3392 383
1135 3300048914 Ga0496111_0029072 Ga0496111_0029072_449_1660 383
1136 3300048916 Ga0496113_0014198 Ga0496113_0014198_1584_2795 383
1137 3300048917 Ga0496114_0002810 Ga0496114_0002810_11584_12795 383
1138 3300053085 Ga0495619_0000903 Ga0495619_0000903_3167_4378 383
1139 3300005937 Ga0081455_10002720 Ga0081455_1000272023 384
1140 3300014497 Ga0182008_10062630 Ga0182008_100626302 384
1141 3300015262 Ga0182007_10014866 Ga0182007_100148662 384
1142 3300025927 Ga0207687_10144333 Ga0207687_101443332 384
1143 3300025961 Ga0207712_10031760 Ga0207712_100317603 384
1144 3300046663 Ga0495635_0140531 Ga0495635_0140531_314_1618 384
1145 3300048908 Ga0496105_0022475 Ga0496105_0022475_3027_4283 384
1146 3300048915 Ga0496112_0038338 Ga0496112_0038338_1844_3100 384
1147 3300048916 Ga0496113_0038768 Ga0496113_0038768_670_1926 384
1148 2209111006 2214770201 2213788963 385
1149 3300000043 ARcpr5yngRDRAFT_c000153 ARcpr5yngRDRAFT_0001531 385
1150 3300000044 ARSoilOldRDRAFT_c000159 ARSoilOldRDRAFT_0001592 385
1151 3300009174 Ga0105241_10083649 Ga0105241_100836492 385
1152 3300014325 Ga0163163_10283800 Ga0163163_102838002 385
1153 3300025912 Ga0207707_10199037 Ga0207707_101990372 385
1154 3300027907 Ga0207428_10100379 Ga0207428_101003791 385
1155 3300034957 Ga0373938_0007345 Ga0373938_0007345_692_1882 385
1156 3300035083 Ga0373926_0000112 Ga0373926_0000112_12542_13768 385
1157 3300035089 Ga0373944_0000117 Ga0373944_0000117_614_1831 385
1158 3300035092 Ga0373952_0011540 Ga0373952_0011540_380_1570 385
1159 3300035111 Ga0373923_0000131 Ga0373923_0000131_733_1959 385
1160 3300035113 Ga0373936_0017475 Ga0373936_0017475_1090_2307 385
1161 3300035116 Ga0373945_0000318 Ga0373945_0000318_446_1672 385
1162 3300035118 Ga0373954_0004094 Ga0373954_0004094_2625_3842 385
1163 3300035120 Ga0373957_0022745 Ga0373957_0022745_804_2021 385
1164 3300035170 Ga0373943_0026878 Ga0373943_0026878_526_1752 385
1165 3300035171 Ga0373946_0000433 Ga0373946_0000433_12215_13441 385
1166 3300035410 Ga0373924_0003004 Ga0373924_0003004_4488_5714 385
1167 3300035691 Ga0373931_0001099 Ga0373931_0001099_10121_11311 385
1168 3300035692 Ga0373935_0031439 Ga0373935_0031439_1892_3109 385
1169 3300035724 Ga0373933_0010022 Ga0373933_0010022_2774_4000 385
1170 3300036401 Ga0373937_0095760 Ga0373937_0095760_877_2103 385
1171 3300037471 Ga0395905_0004064 Ga0395905_0004064_1682_2947 385
1172 3300044901 Ga0466960_0026844 Ga0466960_0026844_244_1509 385
1173 3300046454 Ga0495592_0001758 Ga0495592_0001758_1306_2523 385
1174 3300046455 Ga0495603_0014702 Ga0495603_0014702_1402_2619 385
1175 3300046459 Ga0495629_0010123 Ga0495629_0010123_2824_4050 385
1176 3300046462 Ga0495651_0003868 Ga0495651_0003868_9454_10671 385
1177 3300046463 Ga0495653_0004843 Ga0495653_0004843_8217_9434 385
1178 3300046473 Ga0495582_0012870 Ga0495582_0012870_199_1416 385
1179 3300046475 Ga0495639_0009632 Ga0495639_0009632_2482_3699 385
1180 3300046476 Ga0495662_0006110 Ga0495662_0006110_3323_4540 385
1181 3300046477 Ga0495664_0007514 Ga0495664_0007514_467_1684 385
1182 3300046491 Ga0495584_0008302 Ga0495584_0008302_530_1747 385
1183 3300046492 Ga0495585_0000943 Ga0495585_0000943_5852_7069 385
1184 3300046501 Ga0495607_0004889 Ga0495607_0004889_27_1244 385
1185 3300046511 Ga0495608_0019535 Ga0495608_0019535_2783_4000 385
1186 3300046516 Ga0495628_0038186 Ga0495628_0038186_2364_3581 385
1187 3300046517 Ga0495630_0001312 Ga0495630_0001312_13425_14651 385
1188 3300046523 Ga0495644_0000565 Ga0495644_0000565_9417_10634 385
1189 3300046526 Ga0495666_0005200 Ga0495666_0005200_2832_4049 385
1190 3300046529 Ga0495652_0055968 Ga0495652_0055968_1892_3109 385
1191 3300046531 Ga0495665_0001252 Ga0495665_0001252_12079_13296 385
1192 3300046533 Ga0495640_0026242 Ga0495640_0026242_1104_2321 385
1193 3300046535 Ga0495586_0006149 Ga0495586_0006149_4951_6177 385
1194 3300046557 Ga0495622_0020270 Ga0495622_0020270_113_1330 385
1195 3300046558 Ga0495633_0010513 Ga0495633_0010513_3576_4802 385
1196 3300046559 Ga0495667_0010297 Ga0495667_0010297_233_1459 385
1197 3300046615 Ga0495656_0000718 Ga0495656_0000718_7757_8974 385
1198 3300046642 Ga0495634_0029550 Ga0495634_0029550_223_1440 385
1199 3300046648 Ga0495611_0002127 Ga0495611_0002127_2830_4047 385
1200 3300046664 Ga0495659_0001109 Ga0495659_0001109_7636_8853 385
1201 3300046665 Ga0495661_0025457 Ga0495661_0025457_1734_2951 385
1202 3300046674 Ga0495588_0001783 Ga0495588_0001783_3353_4570 385
1203 3300046678 Ga0495599_0034703 Ga0495599_0034703_455_1672 385
1204 3300046680 Ga0495646_0012099 Ga0495646_0012099_3053_4270 385
1205 3300046681 Ga0495647_0009459 Ga0495647_0009459_1631_2848 385
1206 3300046689 Ga0495613_0029334 Ga0495613_0029334_216_1433 385
1207 3300046690 Ga0495624_0004102 Ga0495624_0004102_1026_2243 385
1208 3300046691 Ga0495670_0002874 Ga0495670_0002874_3702_4919 385
1209 3300046809 Ga0495600_0001374 Ga0495600_0001374_13_1239 385
1210 3300047315 Ga0495581_0008984 Ga0495581_0008984_236_1453 385
1211 3300047317 Ga0495604_0016273 Ga0495604_0016273_1352_2569 385
1212 3300047319 Ga0495674_0042848 Ga0495674_0042848_2354_3571 385
1213 3300047322 Ga0495680_0035330 Ga0495680_0035330_2354_3571 385
1214 3300047446 Ga0495679_029239 Ga0495679_029239_284_1501 385
1215 3300047471 Ga0495684_0003681 Ga0495684_0003681_9632_10849 385
1216 3300048088 Ga0495602_0134900 Ga0495602_0134900_154_1371 385
1217 3300048089 Ga0495614_0001621 Ga0495614_0001621_8223_9440 385
1218 3300048915 Ga0496112_0082009 Ga0496112_0082009_1787_3001 385
1219 3300048916 Ga0496113_0256887 Ga0496113_0256887_105_1319 385
1220 3300053078 Ga0495612_0003715 Ga0495612_0003715_4755_5972 385
1221 3300053084 Ga0495595_0008813 Ga0495595_0008813_456_1673 385
1222 3300053085 Ga0495619_0010588 Ga0495619_0010588_1115_2332 385
1223 iso_pu_bacteria 2508501050 2508725748 385
1224 iso_pu_bacteria 2508501114 2509074737 385
1225 iso_pu_bacteria 2773857925 2774870215 385
1226 iso_pu_bacteria 2882456835 2882461015 385
1227 iso_pu_bacteria 2894232714 2894237075 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

81

307

0.87

PF07690

MFS_1

Major Facilitator Superfamily

287

458

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8797 13 379
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8697 13 379
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8653 13 379
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.843 13 379
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8401 13 376
ID Description Score Start End Superfamily
af_P0AA80_9_209_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9129 14 189 1.20.1250.20
af_Q7JWI7_52_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9125 13 185 1.20.1250.20
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9117 13 184 1.20.1250.20
af_F1QY19_12_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9104 13 184 1.20.1250.20
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9083 10 190 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A526RVM8-F1-model_v4 MFS transporter 0.9464 1 274 GO:0016020
GO:0022857
AF-A0A537Q413-F1-model_v4 MFS transporter 0.9398 4 281 GO:0016020
GO:0022857
AF-A0A536WNP4-F1-model_v4 MFS transporter 0.9364 1 264 GO:0016020
GO:0022857
AF-A0A833D7C2-F1-model_v4 MFS transporter 0.931 1 305 GO:0016020
GO:0022857
AF-A0A2P5LTP5-F1-model_v4 MFS transporter 0.9276 1 379 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map