F491866
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1222 | 439 | 1191 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100565967|Ga0068867_1005659672 |
| Length | 149 |
| Sequence | MRSSLPDSNPDFTEDPDMHSLLHHPTLMDCRRLFLRNYEVMINIGVHDFEKKGEQRVLINVDLYVPLAISTPRDDQLREVLDYDFIRSTIAQRMAKGHVHLQETLCDDVLALMLAHPNVRAARVSTEKPDVYPDCEAVGVEVFGLKEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 2 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 6 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 9 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 10 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 11 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 12 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 13 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 14 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 15 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 16 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 17 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 18 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 19 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 20 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 21 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 22 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 23 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 24 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 25 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 26 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 27 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 28 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 29 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 30 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 31 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 34 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 35 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 36 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 37 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 39 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 44 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 45 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 46 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 205 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 206 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 207 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 208 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 209 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 210 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 211 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 215 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 237 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 238 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 246 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 247 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 250 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 253 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 254 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 255 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 256 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 257 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 258 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 259 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 260 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 261 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 262 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 386 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 387 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 388 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 389 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 390 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 391 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 394 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 395 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 396 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 397 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 398 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 399 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 400 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 401 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 402 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 404 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 405 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 406 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 407 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 408 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 409 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 410 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 411 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 412 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 413 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 414 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 417 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 418 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 419 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 420 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 421 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 422 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 424 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 427 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 428 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 429 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 430 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 432 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 433 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 434 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 438 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.38 |
| Metatranscriptomes | 0.08 |
| Isolates | 2.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.11 |
| Nodule | 0.41 |
| Rhizoplane | 4.5 |
| Rhizosphere | 75.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004822 | 3300001979 | Bacteria | 5749 |
| 2 | JGI25156J39149_1000273 | 3300002705 | Bacteria | 35022 |
| 3 | JGI25156J39149_1013037 | 3300002705 | Bacteria | 1789 |
| 4 | JGI25154J39366_1002162 | 3300002738 | Bacteria | 5495 |
| 5 | JGI25154J39366_1002357 | 3300002738 | Bacteria | 4992 |
| 6 | JGI25158J39367_1005137 | 3300002739 | Bacteria | 1931 |
| 7 | JGI25158J39367_1017004 | 3300002739 | Bacteria | 915 |
| 8 | JGI25157J39369_1000141 | 3300002741 | Bacteria | 61029 |
| 9 | JGI25157J39369_1027814 | 3300002741 | Bacteria | 653 |
| 10 | JGI25164J39214_1003350 | 3300002772 | Bacteria | 2062 |
| 11 | JGI25150J39212_1005651 | 3300002774 | Bacteria | 2652 |
| 12 | JGI25159J45721_1001262 | 3300002987 | Bacteria | 10675 |
| 13 | JGI25159J45721_1010443 | 3300002987 | Bacteria | 2362 |
| 14 | JGI25159J45721_1028315 | 3300002987 | Bacteria | 937 |
| 15 | JGI25153J46596_10004468 | 3300003215 | Bacteria | 7539 |
| 16 | rootH1_10009326 | 3300003316 | Bacteria | 7939 |
| 17 | rootH1_10023151 | 3300003316 | Bacteria | 2036 |
| 18 | rootH1_10035022 | 3300003316 | Bacteria | 1560 |
| 19 | rootH1_10059043 | 3300003316 | Bacteria | 1527 |
| 20 | rootH2_10067644 | 3300003320 | Bacteria | 2572 |
| 21 | rootL2_10028173 | 3300003322 | Bacteria | 4458 |
| 22 | rootH1_10044102 | 3300003323 | Bacteria | 1586 |
| 23 | rootH1_10044115 | 3300003323 | Bacteria | 1613 |
| 24 | rootH1_10061481 | 3300003323 | Bacteria | 1088 |
| 25 | JGI25160J50197_1014774 | 3300003354 | Bacteria | 2595 |
| 26 | JGI25161J50226_1000863 | 3300003374 | Bacteria | 11197 |
| 27 | JGI25161J50226_1007369 | 3300003374 | Bacteria | 1852 |
| 28 | Ga0055539_1000219 | 3300003752 | Bacteria | 40919 |
| 29 | Ga0055539_1001852 | 3300003752 | Bacteria | 3569 |
| 30 | Ga0055539_1031411 | 3300003752 | Bacteria | 600 |
| 31 | Ga0055533_1000008 | 3300003756 | Bacteria | 575861 |
| 32 | Ga0055533_1010344 | 3300003756 | Bacteria | 1062 |
| 33 | Ga0055525_1000786 | 3300003759 | Bacteria | 10183 |
| 34 | Ga0055542_1001394 | 3300003762 | Bacteria | 12265 |
| 35 | Ga0055526_1000030 | 3300003771 | Bacteria | 143833 |
| 36 | Ga0055526_1000530 | 3300003771 | Bacteria | 30204 |
| 37 | Ga0055526_1005310 | 3300003771 | Bacteria | 7461 |
| 38 | Ga0055526_1007526 | 3300003771 | Bacteria | 5635 |
| 39 | Ga0055526_1086230 | 3300003771 | Bacteria | 601 |
| 40 | Ga0055537_1000352 | 3300003773 | Bacteria | 31239 |
| 41 | Ga0055537_1000446 | 3300003773 | Bacteria | 26368 |
| 42 | Ga0055524_1000140 | 3300003775 | Bacteria | 85990 |
| 43 | Ga0055524_1000304 | 3300003775 | Bacteria | 46903 |
| 44 | Ga0055524_1001384 | 3300003775 | Bacteria | 14015 |
| 45 | Ga0055534_1000454 | 3300003784 | Bacteria | 23833 |
| 46 | Ga0055534_1003949 | 3300003784 | Bacteria | 4472 |
| 47 | Ga0055528_1000059 | 3300003790 | Bacteria | 87695 |
| 48 | Ga0055528_1015918 | 3300003790 | Bacteria | 2688 |
| 49 | Ga0055530_10009065 | 3300003791 | Bacteria | 3875 |
| 50 | Ga0055530_10034530 | 3300003791 | Bacteria | 1291 |
| 51 | Ga0055530_10054163 | 3300003791 | Bacteria | 918 |
| 52 | Ga0055540_1000133 | 3300003792 | Bacteria | 75104 |
| 53 | Ga0055540_1000280 | 3300003792 | Bacteria | 45825 |
| 54 | Ga0055531_10007365 | 3300003794 | Bacteria | 6028 |
| 55 | Ga0055541_1001153 | 3300003841 | Bacteria | 5918 |
| 56 | Ga0055543_1019746 | 3300004625 | Bacteria | 1244 |
| 57 | Ga0055543_1041575 | 3300004625 | Bacteria | 774 |
| 58 | Ga0065165_1000161 | 3300005262 | Bacteria | 116828 |
| 59 | Ga0065165_1001544 | 3300005262 | Bacteria | 24046 |
| 60 | Ga0065165_1057916 | 3300005262 | Bacteria | 1072 |
| 61 | Ga0065165_1071099 | 3300005262 | Bacteria | 924 |
| 62 | Ga0065715_10022803 | 3300005293 | Bacteria | 1911 |
| 63 | Ga0070658_10647796 | 3300005327 | Bacteria | 916 |
| 64 | Ga0070676_10076477 | 3300005328 | Bacteria | 2021 |
| 65 | Ga0070683_101642099 | 3300005329 | Bacteria | 618 |
| 66 | Ga0070683_101974559 | 3300005329 | Bacteria | 561 |
| 67 | Ga0070690_100022858 | 3300005330 | Bacteria | 3830 |
| 68 | Ga0070677_10346951 | 3300005333 | Bacteria | 768 |
| 69 | Ga0068869_100023504 | 3300005334 | Bacteria | 4258 |
| 70 | Ga0068869_100632189 | 3300005334 | Bacteria | 907 |
| 71 | Ga0070680_101114718 | 3300005336 | Bacteria | 682 |
| 72 | Ga0068868_100729158 | 3300005338 | Bacteria | 889 |
| 73 | Ga0070660_100868976 | 3300005339 | Bacteria | 760 |
| 74 | Ga0070661_100003569 | 3300005344 | Bacteria | 10708 |
| 75 | Ga0070669_101053963 | 3300005353 | Bacteria | 699 |
| 76 | Ga0070671_100650311 | 3300005355 | Bacteria | 913 |
| 77 | Ga0070671_101827910 | 3300005355 | Bacteria | 540 |
| 78 | Ga0070674_100012364 | 3300005356 | Bacteria | 5241 |
| 79 | Ga0070674_100202757 | 3300005356 | Bacteria | 1533 |
| 80 | Ga0070674_100751799 | 3300005356 | Bacteria | 838 |
| 81 | Ga0070659_100003315 | 3300005366 | Bacteria | 11463 |
| 82 | Ga0070659_100186471 | 3300005366 | Bacteria | 1704 |
| 83 | Ga0070667_100365329 | 3300005367 | Bacteria | 1309 |
| 84 | Ga0070663_100001739 | 3300005455 | Bacteria | 12103 |
| 85 | Ga0070663_100449539 | 3300005455 | Bacteria | 1062 |
| 86 | Ga0070663_101555659 | 3300005455 | Bacteria | 589 |
| 87 | Ga0070662_100421026 | 3300005457 | Bacteria | 1105 |
| 88 | Ga0070662_101132263 | 3300005457 | Bacteria | 672 |
| 89 | Ga0068867_100000245 | 3300005459 | Bacteria | 35758 |
| 90 | Ga0068867_100565967 | 3300005459 | Bacteria | 986 |
| 91 | Ga0068867_100793706 | 3300005459 | Bacteria | 844 |
| 92 | Ga0070699_100651170 | 3300005518 | Bacteria | 962 |
| 93 | Ga0070686_100272213 | 3300005544 | Bacteria | 1245 |
| 94 | Ga0070665_100008237 | 3300005548 | Bacteria | 10552 |
| 95 | Ga0070665_100912531 | 3300005548 | Bacteria | 891 |
| 96 | Ga0068855_100012249 | 3300005563 | Bacteria | 10364 |
| 97 | Ga0068855_100448950 | 3300005563 | Bacteria | 1407 |
| 98 | Ga0070664_100031413 | 3300005564 | Bacteria | 4437 |
| 99 | Ga0070664_100090576 | 3300005564 | Bacteria | 2647 |
| 100 | Ga0070664_100127696 | 3300005564 | Bacteria | 2232 |
| 101 | Ga0068857_100004434 | 3300005577 | Bacteria | 11872 |
| 102 | Ga0068857_100667216 | 3300005577 | Bacteria | 986 |
| 103 | Ga0068854_100014961 | 3300005578 | Bacteria | 5126 |
| 104 | Ga0068854_100199890 | 3300005578 | Bacteria | 1570 |
| 105 | Ga0068854_100584124 | 3300005578 | Bacteria | 952 |
| 106 | Ga0068856_100000135 | 3300005614 | Bacteria | 74419 |
| 107 | Ga0068852_100788054 | 3300005616 | Bacteria | 964 |
| 108 | Ga0068852_101174060 | 3300005616 | Bacteria | 788 |
| 109 | Ga0068852_101738163 | 3300005616 | Bacteria | 646 |
| 110 | Ga0068852_102461952 | 3300005616 | Bacteria | 541 |
| 111 | Ga0068866_10112810 | 3300005718 | Bacteria | 1520 |
| 112 | Ga0068866_10242759 | 3300005718 | Bacteria | 1098 |
| 113 | Ga0068851_10449593 | 3300005834 | Bacteria | 765 |
| 114 | Ga0068860_101630392 | 3300005843 | Bacteria | 667 |
| 115 | Ga0070717_11830976 | 3300006028 | Bacteria | 548 |
| 116 | Ga0075368_10340535 | 3300006042 | Bacteria | 652 |
| 117 | Ga0075364_10716092 | 3300006051 | Bacteria | 683 |
| 118 | Ga0075362_10096834 | 3300006177 | Bacteria | 1376 |
| 119 | Ga0075362_10108318 | 3300006177 | Bacteria | 1306 |
| 120 | Ga0075367_10029166 | 3300006178 | Bacteria | 3153 |
| 121 | Ga0075367_10089911 | 3300006178 | Bacteria | 1867 |
| 122 | Ga0075366_10048533 | 3300006195 | Bacteria | 2518 |
| 123 | Ga0075366_10138544 | 3300006195 | Bacteria | 1470 |
| 124 | Ga0075366_10365870 | 3300006195 | Bacteria | 886 |
| 125 | Ga0075366_10731970 | 3300006195 | Bacteria | 614 |
| 126 | Ga0097621_100507689 | 3300006237 | Bacteria | 1093 |
| 127 | Ga0075370_10035840 | 3300006353 | Bacteria | 2786 |
| 128 | Ga0075370_10152081 | 3300006353 | Bacteria | 1356 |
| 129 | Ga0068865_100351186 | 3300006881 | Bacteria | 1195 |
| 130 | Ga0079104_1000053 | 3300006946 | Bacteria | 168604 |
| 131 | Ga0099826_10000033 | 3300006948 | Bacteria | 120668 |
| 132 | Ga0105244_10000853 | 3300009036 | Bacteria | 25698 |
| 133 | Ga0105240_10095969 | 3300009093 | Bacteria | 3614 |
| 134 | Ga0105240_11799056 | 3300009093 | Bacteria | 638 |
| 135 | Ga0105247_10867759 | 3300009101 | Bacteria | 694 |
| 136 | Ga0114129_10738875 | 3300009147 | Bacteria | 1261 |
| 137 | Ga0105243_10056545 | 3300009148 | Bacteria | 3121 |
| 138 | Ga0105241_10066961 | 3300009174 | Bacteria | 2779 |
| 139 | Ga0105242_10193009 | 3300009176 | Bacteria | 1804 |
| 140 | Ga0105242_10683781 | 3300009176 | Bacteria | 1002 |
| 141 | Ga0105248_10724831 | 3300009177 | Bacteria | 1122 |
| 142 | Ga0105248_11106216 | 3300009177 | Bacteria | 896 |
| 143 | Ga0105248_11642312 | 3300009177 | Bacteria | 728 |
| 144 | Ga0105237_10187801 | 3300009545 | Bacteria | 2066 |
| 145 | Ga0105237_10423025 | 3300009545 | Bacteria | 1338 |
| 146 | Ga0105237_11097568 | 3300009545 | Bacteria | 802 |
| 147 | Ga0105238_10001082 | 3300009551 | Bacteria | 27474 |
| 148 | Ga0105249_10341264 | 3300009553 | Bacteria | 1515 |
| 149 | Ga0105239_10000303 | 3300010375 | Bacteria | 72769 |
| 150 | Ga0105239_10072363 | 3300010375 | Bacteria | 3789 |
| 151 | Ga0105239_10830340 | 3300010375 | Bacteria | 1059 |
| 152 | Ga0105239_13514734 | 3300010375 | Bacteria | 509 |
| 153 | Ga0105246_11070476 | 3300011119 | Bacteria | 734 |
| 154 | Ga0157313_1023714 | 3300012503 | Bacteria | 647 |
| 155 | Ga0157369_10331339 | 3300013105 | Bacteria | 1582 |
| 156 | Ga0157374_10017239 | 3300013296 | Bacteria | 6359 |
| 157 | Ga0157378_10058726 | 3300013297 | Bacteria | 3431 |
| 158 | Ga0163162_11288023 | 3300013306 | Bacteria | 830 |
| 159 | Ga0157372_10346002 | 3300013307 | Bacteria | 1732 |
| 160 | Ga0157375_11035515 | 3300013308 | Bacteria | 959 |
| 161 | Ga0157375_12111675 | 3300013308 | Bacteria | 670 |
| 162 | Ga0157380_10168190 | 3300014326 | Bacteria | 1913 |
| 163 | Ga0182008_10010463 | 3300014497 | Bacteria | 4963 |
| 164 | Ga0157377_10000034 | 3300014745 | Bacteria | 117744 |
| 165 | Ga0157379_10055804 | 3300014968 | Bacteria | 3529 |
| 166 | Ga0182006_1019835 | 3300015261 | Bacteria | 2825 |
| 167 | Ga0182007_10074214 | 3300015262 | Bacteria | 1115 |
| 168 | Ga0163161_11103356 | 3300017792 | Bacteria | 682 |
| 169 | Ga0163161_11221296 | 3300017792 | Bacteria | 651 |
| 170 | Ga0213872_10100278 | 3300021361 | Bacteria | 1291 |
| 171 | Ga0209436_102824 | 3300025208 | Bacteria | 4932 |
| 172 | Ga0209436_103498 | 3300025208 | Bacteria | 4156 |
| 173 | Ga0209784_100512 | 3300025224 | Bacteria | 14878 |
| 174 | Ga0209566_100827 | 3300025225 | Bacteria | 15671 |
| 175 | Ga0209674_100015 | 3300025226 | Bacteria | 697299 |
| 176 | Ga0209674_100098 | 3300025226 | Bacteria | 167037 |
| 177 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 178 | Ga0209563_102484 | 3300025230 | Bacteria | 4149 |
| 179 | Ga0207427_101011 | 3300025231 | Bacteria | 11765 |
| 180 | Ga0209258_100726 | 3300025242 | Bacteria | 21958 |
| 181 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 182 | Ga0207425_1000408 | 3300025245 | Bacteria | 28971 |
| 183 | Ga0207425_1001300 | 3300025245 | Bacteria | 10779 |
| 184 | Ga0209646_1000082 | 3300025246 | Bacteria | 200645 |
| 185 | Ga0209646_1000229 | 3300025246 | Bacteria | 59524 |
| 186 | Ga0209646_1000613 | 3300025246 | Bacteria | 13729 |
| 187 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 188 | Ga0209026_1002611 | 3300025250 | Bacteria | 6602 |
| 189 | Ga0209677_100037 | 3300025253 | Bacteria | 286702 |
| 190 | Ga0209677_100113 | 3300025253 | Bacteria | 84174 |
| 191 | Ga0209677_101552 | 3300025253 | Bacteria | 9778 |
| 192 | Ga0209677_102386 | 3300025253 | Bacteria | 7157 |
| 193 | Ga0209148_1000190 | 3300025254 | Bacteria | 116621 |
| 194 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 195 | Ga0209759_1005745 | 3300025256 | Bacteria | 4275 |
| 196 | Ga0209759_1011309 | 3300025256 | Bacteria | 2546 |
| 197 | Ga0209759_1013572 | 3300025256 | Bacteria | 2197 |
| 198 | Ga0209129_1000061 | 3300025258 | Bacteria | 246061 |
| 199 | Ga0209129_1008102 | 3300025258 | Bacteria | 2983 |
| 200 | Ga0209565_1000184 | 3300025263 | Bacteria | 76638 |
| 201 | Ga0209565_1000684 | 3300025263 | Bacteria | 21085 |
| 202 | Ga0209565_1000730 | 3300025263 | Bacteria | 19659 |
| 203 | Ga0209565_1039075 | 3300025263 | Bacteria | 891 |
| 204 | Ga0209673_1000029 | 3300025273 | Bacteria | 351978 |
| 205 | Ga0209673_1005549 | 3300025273 | Bacteria | 6312 |
| 206 | Ga0209673_1010062 | 3300025273 | Bacteria | 4023 |
| 207 | Ga0209130_1000175 | 3300025284 | Bacteria | 91205 |
| 208 | Ga0209130_1004816 | 3300025284 | Bacteria | 4946 |
| 209 | Ga0209130_1011650 | 3300025284 | Bacteria | 2344 |
| 210 | Ga0209675_1000019 | 3300025291 | Bacteria | 351950 |
| 211 | Ga0209675_1001539 | 3300025291 | Bacteria | 13139 |
| 212 | Ga0209675_1004599 | 3300025291 | Bacteria | 6075 |
| 213 | Ga0209025_1001479 | 3300025294 | Bacteria | 30558 |
| 214 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 215 | Ga0209564_1000315 | 3300025295 | Bacteria | 95095 |
| 216 | Ga0209564_1000635 | 3300025295 | Bacteria | 53379 |
| 217 | Ga0209564_1000889 | 3300025295 | Bacteria | 39484 |
| 218 | Ga0209564_1020345 | 3300025295 | Bacteria | 2434 |
| 219 | Ga0209564_1028784 | 3300025295 | Bacteria | 1765 |
| 220 | Ga0209758_1000101 | 3300025297 | Bacteria | 225913 |
| 221 | Ga0209758_1003320 | 3300025297 | Bacteria | 14817 |
| 222 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 223 | Ga0209050_1000805 | 3300025298 | Bacteria | 44138 |
| 224 | Ga0209050_1000863 | 3300025298 | Bacteria | 40926 |
| 225 | Ga0209050_1000996 | 3300025298 | Bacteria | 35727 |
| 226 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 227 | Ga0209256_1000045 | 3300025299 | Bacteria | 325506 |
| 228 | Ga0209256_1000944 | 3300025299 | Bacteria | 35230 |
| 229 | Ga0209256_1001504 | 3300025299 | Bacteria | 23632 |
| 230 | Ga0209256_1002911 | 3300025299 | Bacteria | 12900 |
| 231 | Ga0209256_1031413 | 3300025299 | Bacteria | 1453 |
| 232 | Ga0207426_1002734 | 3300025302 | Bacteria | 10704 |
| 233 | Ga0207426_1028162 | 3300025302 | Bacteria | 1865 |
| 234 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 235 | Ga0209051_1005569 | 3300025303 | Bacteria | 7319 |
| 236 | Ga0209051_1006384 | 3300025303 | Bacteria | 6662 |
| 237 | Ga0209051_1046307 | 3300025303 | Bacteria | 1497 |
| 238 | Ga0209051_1096538 | 3300025303 | Bacteria | 806 |
| 239 | Ga0209257_1000315 | 3300025304 | Bacteria | 102293 |
| 240 | Ga0209257_1000556 | 3300025304 | Bacteria | 63959 |
| 241 | Ga0209257_1001266 | 3300025304 | Bacteria | 31042 |
| 242 | Ga0209257_1040930 | 3300025304 | Bacteria | 1378 |
| 243 | Ga0207656_10036623 | 3300025321 | Bacteria | 2060 |
| 244 | Ga0207655_1011085 | 3300025728 | Bacteria | 5403 |
| 245 | Ga0207642_10385191 | 3300025899 | Bacteria | 835 |
| 246 | Ga0207645_10080044 | 3300025907 | Bacteria | 2094 |
| 247 | Ga0207695_10002990 | 3300025913 | Bacteria | 24306 |
| 248 | Ga0207695_10047967 | 3300025913 | Bacteria | 4514 |
| 249 | Ga0207671_10027218 | 3300025914 | Bacteria | 4275 |
| 250 | Ga0207671_10185309 | 3300025914 | Bacteria | 1621 |
| 251 | Ga0207671_10817493 | 3300025914 | Bacteria | 739 |
| 252 | Ga0207671_11160125 | 3300025914 | Bacteria | 605 |
| 253 | Ga0207663_10560511 | 3300025916 | Bacteria | 894 |
| 254 | Ga0207660_10527724 | 3300025917 | Bacteria | 959 |
| 255 | Ga0207657_10045803 | 3300025919 | Bacteria | 3835 |
| 256 | Ga0207657_10565729 | 3300025919 | Bacteria | 888 |
| 257 | Ga0207657_10700128 | 3300025919 | Bacteria | 787 |
| 258 | Ga0207649_10001730 | 3300025920 | Bacteria | 12539 |
| 259 | Ga0207681_11678452 | 3300025923 | Bacteria | 531 |
| 260 | Ga0207694_10000126 | 3300025924 | Bacteria | 79243 |
| 261 | Ga0207694_10254309 | 3300025924 | Bacteria | 1438 |
| 262 | Ga0207687_10245896 | 3300025927 | Bacteria | 1420 |
| 263 | Ga0207644_11450761 | 3300025931 | Bacteria | 576 |
| 264 | Ga0207690_10008290 | 3300025932 | Bacteria | 6164 |
| 265 | Ga0207706_10314233 | 3300025933 | Bacteria | 1364 |
| 266 | Ga0207706_10911513 | 3300025933 | Bacteria | 742 |
| 267 | Ga0207686_10246915 | 3300025934 | Bacteria | 1302 |
| 268 | Ga0207686_10412081 | 3300025934 | Bacteria | 1032 |
| 269 | Ga0207709_10000838 | 3300025935 | Bacteria | 23593 |
| 270 | Ga0207709_10065576 | 3300025935 | Bacteria | 2284 |
| 271 | Ga0207709_11166778 | 3300025935 | Bacteria | 634 |
| 272 | Ga0207669_10037240 | 3300025937 | Bacteria | 2789 |
| 273 | Ga0207669_10218569 | 3300025937 | Bacteria | 1397 |
| 274 | Ga0207669_11194253 | 3300025937 | Bacteria | 644 |
| 275 | Ga0207704_11201993 | 3300025938 | Bacteria | 646 |
| 276 | Ga0207691_10987388 | 3300025940 | Bacteria | 703 |
| 277 | Ga0207711_10905668 | 3300025941 | Bacteria | 820 |
| 278 | Ga0207711_11712024 | 3300025941 | Bacteria | 572 |
| 279 | Ga0207689_10030365 | 3300025942 | Bacteria | 4504 |
| 280 | Ga0207661_11221163 | 3300025944 | Bacteria | 692 |
| 281 | Ga0207679_10000077 | 3300025945 | Bacteria | 86432 |
| 282 | Ga0207679_10095553 | 3300025945 | Bacteria | 2310 |
| 283 | Ga0207679_10677720 | 3300025945 | Bacteria | 934 |
| 284 | Ga0207667_10000044 | 3300025949 | Bacteria | 248251 |
| 285 | Ga0207667_10003517 | 3300025949 | Bacteria | 19368 |
| 286 | Ga0207667_10991572 | 3300025949 | Bacteria | 828 |
| 287 | Ga0207712_10418216 | 3300025961 | Bacteria | 1130 |
| 288 | Ga0207668_11186443 | 3300025972 | Bacteria | 686 |
| 289 | Ga0207640_10185792 | 3300025981 | Bacteria | 1563 |
| 290 | Ga0207640_10429604 | 3300025981 | Bacteria | 1083 |
| 291 | Ga0207640_10953415 | 3300025981 | Bacteria | 752 |
| 292 | Ga0207640_11104250 | 3300025981 | Bacteria | 702 |
| 293 | Ga0207658_10447842 | 3300025986 | Bacteria | 1143 |
| 294 | Ga0207703_11240056 | 3300026035 | Bacteria | 717 |
| 295 | Ga0207678_10003990 | 3300026067 | Bacteria | 13276 |
| 296 | Ga0207678_10185435 | 3300026067 | Bacteria | 1777 |
| 297 | Ga0207702_10001523 | 3300026078 | Bacteria | 22929 |
| 298 | Ga0207641_10584012 | 3300026088 | Bacteria | 1092 |
| 299 | Ga0207648_10000054 | 3300026089 | Bacteria | 106684 |
| 300 | Ga0207648_10065351 | 3300026089 | Bacteria | 3172 |
| 301 | Ga0207648_10260088 | 3300026089 | Bacteria | 1549 |
| 302 | Ga0207674_10032801 | 3300026116 | Bacteria | 5444 |
| 303 | Ga0207674_10427609 | 3300026116 | Bacteria | 1280 |
| 304 | Ga0207674_10443650 | 3300026116 | Bacteria | 1254 |
| 305 | Ga0207675_100008767 | 3300026118 | Bacteria | 9497 |
| 306 | Ga0207675_101631286 | 3300026118 | Bacteria | 665 |
| 307 | Ga0207683_10113650 | 3300026121 | Bacteria | 2425 |
| 308 | Ga0207698_10051544 | 3300026142 | Bacteria | 3147 |
| 309 | Ga0207698_10289205 | 3300026142 | Bacteria | 1520 |
| 310 | Ga0207698_10638661 | 3300026142 | Bacteria | 1053 |
| 311 | Ga0209281_1000147 | 3300027111 | Bacteria | 168586 |
| 312 | Ga0209282_1000014 | 3300027666 | Bacteria | 207318 |
| 313 | Ga0209971_1036579 | 3300027682 | Bacteria | 1182 |
| 314 | Ga0209813_10281771 | 3300027866 | Bacteria | 640 |
| 315 | Ga0209974_10011530 | 3300027876 | Bacteria | 2966 |
| 316 | Ga0268264_11229288 | 3300028381 | Bacteria | 759 |
| 317 | Ga0307517_10259012 | 3300028786 | Bacteria | 1012 |
| 318 | Ga0307515_10000089 | 3300028794 | Bacteria | 215736 |
| 319 | Ga0307515_10000096 | 3300028794 | Bacteria | 206366 |
| 320 | Ga0307515_10000139 | 3300028794 | Bacteria | 173074 |
| 321 | Ga0307515_10004133 | 3300028794 | Bacteria | 30223 |
| 322 | Ga0307515_10007786 | 3300028794 | Bacteria | 21078 |
| 323 | Ga0307515_10249686 | 3300028794 | Bacteria | 1529 |
| 324 | Ga0307515_10349371 | 3300028794 | Bacteria | 1126 |
| 325 | Ga0307515_10735133 | 3300028794 | Bacteria | 605 |
| 326 | Ga0307511_10084567 | 3300030521 | Bacteria | 2201 |
| 327 | Ga0307512_10029829 | 3300030522 | Bacteria | 4755 |
| 328 | Ga0307512_10167904 | 3300030522 | Bacteria | 1266 |
| 329 | Ga0316178_1120510 | 3300030735 | Bacteria | 583 |
| 330 | Ga0316178_1168385 | 3300030735 | Bacteria | 1310 |
| 331 | Ga0316180_1011172 | 3300030736 | Bacteria | 3094 |
| 332 | Ga0316181_1058384 | 3300030744 | Bacteria | 1801 |
| 333 | Ga0316181_1092164 | 3300030744 | Bacteria | 760 |
| 334 | Ga0316182_1205408 | 3300030745 | Bacteria | 3630 |
| 335 | Ga0316182_1300998 | 3300030745 | Bacteria | 720 |
| 336 | Ga0316182_1307621 | 3300030745 | Bacteria | 633 |
| 337 | Ga0307513_10004973 | 3300031456 | Bacteria | 17620 |
| 338 | Ga0307513_10550034 | 3300031456 | Bacteria | 867 |
| 339 | Ga0307509_10018962 | 3300031507 | Bacteria | 7873 |
| 340 | Ga0307408_100001390 | 3300031548 | Bacteria | 18001 |
| 341 | Ga0307408_100490532 | 3300031548 | Bacteria | 1073 |
| 342 | Ga0307508_10000504 | 3300031616 | Bacteria | 46711 |
| 343 | Ga0307508_10243361 | 3300031616 | Bacteria | 1396 |
| 344 | Ga0307514_10000369 | 3300031649 | Bacteria | 102951 |
| 345 | Ga0307514_10006668 | 3300031649 | Bacteria | 10009 |
| 346 | Ga0307514_10146339 | 3300031649 | Bacteria | 1596 |
| 347 | Ga0307516_10012514 | 3300031730 | Bacteria | 9135 |
| 348 | Ga0307516_10060830 | 3300031730 | Bacteria | 3668 |
| 349 | Ga0307516_10350472 | 3300031730 | Bacteria | 1142 |
| 350 | Ga0307405_11907321 | 3300031731 | Bacteria | 530 |
| 351 | Ga0307518_10067586 | 3300031838 | Bacteria | 2591 |
| 352 | Ga0307410_10450029 | 3300031852 | Bacteria | 1050 |
| 353 | Ga0307406_11752555 | 3300031901 | Bacteria | 551 |
| 354 | Ga0307412_10250078 | 3300031911 | Bacteria | 1376 |
| 355 | Ga0307412_10264803 | 3300031911 | Bacteria | 1342 |
| 356 | Ga0307412_11438353 | 3300031911 | Bacteria | 625 |
| 357 | Ga0307416_100011722 | 3300032002 | Bacteria | 5869 |
| 358 | Ga0307416_100443359 | 3300032002 | Bacteria | 1349 |
| 359 | Ga0307416_100471319 | 3300032002 | Bacteria | 1313 |
| 360 | Ga0307416_100699709 | 3300032002 | Bacteria | 1102 |
| 361 | Ga0307416_101040746 | 3300032002 | Bacteria | 922 |
| 362 | Ga0307416_103787841 | 3300032002 | Bacteria | 506 |
| 363 | Ga0307414_10310755 | 3300032004 | Bacteria | 1338 |
| 364 | Ga0307414_10928519 | 3300032004 | Bacteria | 799 |
| 365 | Ga0307411_10108435 | 3300032005 | Bacteria | 1981 |
| 366 | Ga0307411_10224307 | 3300032005 | Bacteria | 1460 |
| 367 | Ga0307507_10078572 | 3300033179 | Bacteria | 2924 |
| 368 | Ga0373959_0185722 | 3300034820 | Bacteria | 543 |
| 369 | Ga0373938_0011822 | 3300034957 | Bacteria | 1630 |
| 370 | Ga0373931_0058502 | 3300035691 | Bacteria | 2070 |
| 371 | Ga0373933_0439546 | 3300035724 | Bacteria | 853 |
| 372 | Ga0395900_0016334 | 3300037418 | Bacteria | 7567 |
| 373 | Ga0395900_0194521 | 3300037418 | Bacteria | 2055 |
| 374 | Ga0395900_1030042 | 3300037418 | Bacteria | 742 |
| 375 | Ga0395898_0027813 | 3300037466 | Bacteria | 5670 |
| 376 | Ga0395898_0218355 | 3300037466 | Bacteria | 1819 |
| 377 | Ga0395898_1906528 | 3300037466 | Bacteria | 514 |
| 378 | Ga0395905_0009387 | 3300037471 | Bacteria | 9568 |
| 379 | Ga0395905_0027659 | 3300037471 | Bacteria | 5348 |
| 380 | Ga0395905_0053794 | 3300037471 | Bacteria | 3767 |
| 381 | Ga0395905_0092537 | 3300037471 | Bacteria | 2835 |
| 382 | Ga0395905_0136564 | 3300037471 | Bacteria | 2307 |
| 383 | Ga0395905_0176670 | 3300037471 | Bacteria | 2005 |
| 384 | Ga0395905_0348711 | 3300037471 | Bacteria | 1372 |
| 385 | Ga0395905_0374447 | 3300037471 | Bacteria | 1317 |
| 386 | Ga0395905_0835546 | 3300037471 | Bacteria | 824 |
| 387 | Ga0395901_0010306 | 3300038443 | Bacteria | 9467 |
| 388 | Ga0395901_0134832 | 3300038443 | Bacteria | 2595 |
| 389 | Ga0395901_0243301 | 3300038443 | Bacteria | 1876 |
| 390 | Ga0436365_0201553 | 3300039437 | Bacteria | 1013 |
| 391 | Ga0436361_0115505 | 3300039447 | Bacteria | 12136 |
| 392 | Ga0436361_0446649 | 3300039447 | Bacteria | 2351 |
| 393 | Ga0436361_0538417 | 3300039447 | Bacteria | 1040 |
| 394 | Ga0436361_1116803 | 3300039447 | Bacteria | 2141 |
| 395 | Ga0439439_0019142 | 3300041406 | Bacteria | 1697 |
| 396 | Ga0439461_0222592 | 3300041410 | Bacteria | 515 |
| 397 | Ga0451789_0703010 | 3300041443 | Bacteria | 1416 |
| 398 | Ga0451791_0324143 | 3300041451 | Bacteria | 891 |
| 399 | Ga0451791_1953326 | 3300041451 | Bacteria | 633 |
| 400 | Ga0451793_1670211 | 3300041452 | Bacteria | 938 |
| 401 | Ga0451797_0170929 | 3300041453 | Bacteria | 1083 |
| 402 | Ga0451798_0566612 | 3300041458 | Bacteria | 648 |
| 403 | Ga0451800_0372506 | 3300041459 | Bacteria | 931 |
| 404 | Ga0451804_0066188 | 3300041463 | Bacteria | 876 |
| 405 | Ga0451835_0199638 | 3300041492 | Bacteria | 898 |
| 406 | Ga0451841_0987551 | 3300041498 | Bacteria | 813 |
| 407 | Ga0451849_1215121 | 3300041505 | Bacteria | 743 |
| 408 | Ga0451853_0241869 | 3300041512 | Bacteria | 1695 |
| 409 | Ga0451853_1496167 | 3300041512 | Bacteria | 633 |
| 410 | Ga0439431_0021427 | 3300041997 | Bacteria | 1551 |
| 411 | Ga0439442_024379 | 3300042002 | Bacteria | 1259 |
| 412 | Ga0439448_0001678 | 3300042005 | Bacteria | 5817 |
| 413 | Ga0439448_0235285 | 3300042005 | Bacteria | 645 |
| 414 | Ga0439455_0074493 | 3300042012 | Bacteria | 916 |
| 415 | Ga0439457_034722 | 3300042014 | Bacteria | 1121 |
| 416 | Ga0450919_001225 | 3300042121 | Bacteria | 3350 |
| 417 | Ga0450920_026671 | 3300042122 | Bacteria | 1128 |
| 418 | Ga0450890_017311 | 3300042127 | Bacteria | 959 |
| 419 | Ga0450904_000068 | 3300042139 | Bacteria | 23099 |
| 420 | Ga0450889_050460 | 3300042144 | Bacteria | 511 |
| 421 | Ga0450906_026519 | 3300042145 | Bacteria | 1029 |
| 422 | Ga0439434_0109150 | 3300042435 | Bacteria | 895 |
| 423 | Ga0450918_000992 | 3300042531 | Bacteria | 5888 |
| 424 | Ga0450893_0019769 | 3300042532 | Bacteria | 1154 |
| 425 | Ga0451577_0001738 | 3300042876 | Bacteria | 28073 |
| 426 | Ga0451577_0080821 | 3300042876 | Bacteria | 2898 |
| 427 | Ga0451577_0332678 | 3300042876 | Bacteria | 1378 |
| 428 | Ga0451577_0597512 | 3300042876 | Bacteria | 1001 |
| 429 | Ga0466969_0000018 | 3300044656 | Bacteria | 102911 |
| 430 | Ga0466969_0029967 | 3300044656 | Bacteria | 2774 |
| 431 | Ga0466969_0062955 | 3300044656 | Bacteria | 1798 |
| 432 | Ga0466972_0000566 | 3300044658 | Bacteria | 18064 |
| 433 | Ga0466982_0069393 | 3300044672 | Bacteria | 2175 |
| 434 | Ga0466965_0029883 | 3300044683 | Bacteria | 2653 |
| 435 | Ga0466965_0112987 | 3300044683 | Bacteria | 1397 |
| 436 | Ga0466965_0144568 | 3300044683 | Bacteria | 1240 |
| 437 | Ga0466965_0175665 | 3300044683 | Bacteria | 1128 |
| 438 | Ga0466966_0001081 | 3300044684 | Bacteria | 17423 |
| 439 | Ga0466966_0043326 | 3300044684 | Bacteria | 2885 |
| 440 | Ga0466961_0012706 | 3300044693 | Bacteria | 5394 |
| 441 | Ga0466961_0031470 | 3300044693 | Bacteria | 3411 |
| 442 | Ga0466963_0030051 | 3300044694 | Bacteria | 3502 |
| 443 | Ga0466963_0692604 | 3300044694 | Bacteria | 719 |
| 444 | Ga0466964_0016862 | 3300044706 | Bacteria | 2793 |
| 445 | Ga0466964_0253732 | 3300044706 | Bacteria | 868 |
| 446 | Ga0453684_0108145 | 3300044712 | Bacteria | 3385 |
| 447 | Ga0453684_0490675 | 3300044712 | Bacteria | 1361 |
| 448 | Ga0466971_0017750 | 3300044719 | Bacteria | 3151 |
| 449 | Ga0466971_0018485 | 3300044719 | Bacteria | 3087 |
| 450 | Ga0466968_0068501 | 3300044735 | Bacteria | 1541 |
| 451 | Ga0466968_0395131 | 3300044735 | Bacteria | 677 |
| 452 | Ga0466970_0034391 | 3300044765 | Bacteria | 2682 |
| 453 | Ga0466970_0156284 | 3300044765 | Bacteria | 1260 |
| 454 | Ga0466970_0253802 | 3300044765 | Bacteria | 986 |
| 455 | Ga0466957_0015162 | 3300044842 | Bacteria | 4499 |
| 456 | Ga0466957_0107420 | 3300044842 | Bacteria | 1766 |
| 457 | Ga0466960_0137850 | 3300044901 | Bacteria | 1293 |
| 458 | Ga0466960_0370621 | 3300044901 | Bacteria | 820 |
| 459 | Ga0466959_0000632 | 3300045049 | Bacteria | 20411 |
| 460 | Ga0466959_0022006 | 3300045049 | Bacteria | 4709 |
| 461 | Ga0466959_0051638 | 3300045049 | Bacteria | 3014 |
| 462 | Ga0466959_0216219 | 3300045049 | Bacteria | 1330 |
| 463 | Ga0451576_0011749 | 3300045051 | Bacteria | 9916 |
| 464 | Ga0451576_0132583 | 3300045051 | Bacteria | 2597 |
| 465 | Ga0451576_0763803 | 3300045051 | Bacteria | 1015 |
| 466 | Ga0466958_0021542 | 3300045836 | Bacteria | 3768 |
| 467 | Ga0466967_0164017 | 3300045976 | Bacteria | 2087 |
| 468 | Ga0466967_0463586 | 3300045976 | Bacteria | 1240 |
| 469 | Ga0495617_000017 | 3300046452 | Bacteria | 253066 |
| 470 | Ga0495617_001215 | 3300046452 | Bacteria | 11606 |
| 471 | Ga0495617_002243 | 3300046452 | Bacteria | 7843 |
| 472 | Ga0495627_001838 | 3300046453 | Bacteria | 11284 |
| 473 | Ga0495627_018346 | 3300046453 | Bacteria | 2361 |
| 474 | Ga0495603_0025604 | 3300046455 | Bacteria | 3568 |
| 475 | Ga0495603_0032373 | 3300046455 | Bacteria | 3146 |
| 476 | Ga0495590_0000014 | 3300046457 | Bacteria | 258314 |
| 477 | Ga0495590_0000118 | 3300046457 | Bacteria | 47657 |
| 478 | Ga0495590_0000718 | 3300046457 | Bacteria | 15138 |
| 479 | Ga0495590_0002122 | 3300046457 | Bacteria | 8316 |
| 480 | Ga0495590_0047192 | 3300046457 | Bacteria | 1502 |
| 481 | Ga0495590_0110196 | 3300046457 | Bacteria | 982 |
| 482 | Ga0495591_094810 | 3300046458 | Bacteria | 745 |
| 483 | Ga0495638_0000064 | 3300046460 | Bacteria | 180807 |
| 484 | Ga0495638_0000408 | 3300046460 | Bacteria | 52490 |
| 485 | Ga0495638_0004398 | 3300046460 | Bacteria | 10665 |
| 486 | Ga0495638_0018992 | 3300046460 | Bacteria | 4553 |
| 487 | Ga0495638_0071341 | 3300046460 | Bacteria | 2125 |
| 488 | Ga0495638_0094733 | 3300046460 | Bacteria | 1794 |
| 489 | Ga0495638_0141567 | 3300046460 | Bacteria | 1403 |
| 490 | Ga0495638_0224794 | 3300046460 | Bacteria | 1047 |
| 491 | Ga0495638_0271689 | 3300046460 | Bacteria | 925 |
| 492 | Ga0495653_0019706 | 3300046463 | Bacteria | 5470 |
| 493 | Ga0495653_0064314 | 3300046463 | Bacteria | 2764 |
| 494 | Ga0495650_0000084 | 3300046471 | Bacteria | 235690 |
| 495 | Ga0495650_0013827 | 3300046471 | Bacteria | 4242 |
| 496 | Ga0495650_0117706 | 3300046471 | Bacteria | 980 |
| 497 | Ga0495650_0132386 | 3300046471 | Bacteria | 908 |
| 498 | Ga0495580_0012124 | 3300046472 | Bacteria | 6631 |
| 499 | Ga0495580_0097708 | 3300046472 | Bacteria | 2042 |
| 500 | Ga0495582_0002100 | 3300046473 | Bacteria | 11145 |
| 501 | Ga0495582_0005956 | 3300046473 | Bacteria | 6796 |
| 502 | Ga0495582_0306419 | 3300046473 | Bacteria | 913 |
| 503 | Ga0495582_0359856 | 3300046473 | Bacteria | 838 |
| 504 | Ga0495605_0000520 | 3300046474 | Bacteria | 32767 |
| 505 | Ga0495605_0001968 | 3300046474 | Bacteria | 13017 |
| 506 | Ga0495605_0003392 | 3300046474 | Bacteria | 9503 |
| 507 | Ga0495605_0020160 | 3300046474 | Bacteria | 3546 |
| 508 | Ga0495605_0126174 | 3300046474 | Bacteria | 1157 |
| 509 | Ga0495605_0129569 | 3300046474 | Bacteria | 1138 |
| 510 | Ga0495605_0130913 | 3300046474 | Bacteria | 1131 |
| 511 | Ga0495605_0240955 | 3300046474 | Bacteria | 776 |
| 512 | Ga0495605_0247567 | 3300046474 | Bacteria | 763 |
| 513 | Ga0495605_0400708 | 3300046474 | Bacteria | 571 |
| 514 | Ga0495639_0108220 | 3300046475 | Bacteria | 1317 |
| 515 | Ga0495664_0539629 | 3300046477 | Bacteria | 695 |
| 516 | Ga0495584_0000040 | 3300046491 | Bacteria | 91797 |
| 517 | Ga0495584_0000482 | 3300046491 | Bacteria | 27407 |
| 518 | Ga0495584_0000609 | 3300046491 | Bacteria | 23950 |
| 519 | Ga0495584_0001576 | 3300046491 | Bacteria | 13473 |
| 520 | Ga0495584_0004417 | 3300046491 | Bacteria | 7574 |
| 521 | Ga0495584_0006265 | 3300046491 | Bacteria | 6240 |
| 522 | Ga0495584_0012735 | 3300046491 | Bacteria | 4292 |
| 523 | Ga0495584_0018120 | 3300046491 | Bacteria | 3579 |
| 524 | Ga0495584_0057071 | 3300046491 | Bacteria | 1964 |
| 525 | Ga0495584_0170189 | 3300046491 | Bacteria | 1107 |
| 526 | Ga0495584_0225443 | 3300046491 | Bacteria | 952 |
| 527 | Ga0495584_0422894 | 3300046491 | Bacteria | 677 |
| 528 | Ga0495584_0634973 | 3300046491 | Bacteria | 544 |
| 529 | Ga0495585_0000404 | 3300046492 | Bacteria | 41829 |
| 530 | Ga0495585_0000524 | 3300046492 | Bacteria | 36254 |
| 531 | Ga0495585_0001008 | 3300046492 | Bacteria | 23482 |
| 532 | Ga0495585_0001486 | 3300046492 | Bacteria | 18318 |
| 533 | Ga0495585_0001735 | 3300046492 | Bacteria | 16596 |
| 534 | Ga0495585_0003717 | 3300046492 | Bacteria | 10202 |
| 535 | Ga0495585_0005445 | 3300046492 | Bacteria | 8022 |
| 536 | Ga0495585_0008951 | 3300046492 | Bacteria | 6037 |
| 537 | Ga0495585_0010535 | 3300046492 | Bacteria | 5498 |
| 538 | Ga0495585_0035388 | 3300046492 | Bacteria | 2822 |
| 539 | Ga0495585_0041147 | 3300046492 | Bacteria | 2592 |
| 540 | Ga0495585_0052286 | 3300046492 | Bacteria | 2261 |
| 541 | Ga0495585_0079437 | 3300046492 | Bacteria | 1779 |
| 542 | Ga0495585_0082560 | 3300046492 | Bacteria | 1739 |
| 543 | Ga0495585_0103944 | 3300046492 | Bacteria | 1516 |
| 544 | Ga0495585_0178082 | 3300046492 | Bacteria | 1094 |
| 545 | Ga0495585_0179155 | 3300046492 | Bacteria | 1090 |
| 546 | Ga0495585_0187607 | 3300046492 | Bacteria | 1059 |
| 547 | Ga0495585_0210848 | 3300046492 | Bacteria | 984 |
| 548 | Ga0495585_0211531 | 3300046492 | Bacteria | 982 |
| 549 | Ga0495585_0229553 | 3300046492 | Bacteria | 933 |
| 550 | Ga0495585_0293096 | 3300046492 | Bacteria | 801 |
| 551 | Ga0495594_0003237 | 3300046499 | Bacteria | 8433 |
| 552 | Ga0495594_0024536 | 3300046499 | Bacteria | 3239 |
| 553 | Ga0495594_0040406 | 3300046499 | Bacteria | 2552 |
| 554 | Ga0495594_0246222 | 3300046499 | Bacteria | 1018 |
| 555 | Ga0495596_0000199 | 3300046500 | Bacteria | 41142 |
| 556 | Ga0495596_0001436 | 3300046500 | Bacteria | 13648 |
| 557 | Ga0495596_0002255 | 3300046500 | Bacteria | 10492 |
| 558 | Ga0495596_0014034 | 3300046500 | Bacteria | 3380 |
| 559 | Ga0495596_0014475 | 3300046500 | Bacteria | 3325 |
| 560 | Ga0495596_0018989 | 3300046500 | Bacteria | 2828 |
| 561 | Ga0495596_0022085 | 3300046500 | Bacteria | 2592 |
| 562 | Ga0495596_0036371 | 3300046500 | Bacteria | 1950 |
| 563 | Ga0495596_0039490 | 3300046500 | Bacteria | 1864 |
| 564 | Ga0495596_0211835 | 3300046500 | Bacteria | 752 |
| 565 | Ga0495596_0320859 | 3300046500 | Bacteria | 602 |
| 566 | Ga0495607_0001141 | 3300046501 | Bacteria | 24051 |
| 567 | Ga0495607_0002847 | 3300046501 | Bacteria | 13713 |
| 568 | Ga0495607_0003861 | 3300046501 | Bacteria | 11290 |
| 569 | Ga0495607_0004084 | 3300046501 | Bacteria | 10913 |
| 570 | Ga0495607_0029492 | 3300046501 | Bacteria | 3375 |
| 571 | Ga0495607_0038470 | 3300046501 | Bacteria | 2865 |
| 572 | Ga0495607_0040484 | 3300046501 | Bacteria | 2774 |
| 573 | Ga0495607_0042076 | 3300046501 | Bacteria | 2710 |
| 574 | Ga0495607_0080073 | 3300046501 | Bacteria | 1797 |
| 575 | Ga0495607_0138980 | 3300046501 | Bacteria | 1255 |
| 576 | Ga0495607_0196990 | 3300046501 | Bacteria | 999 |
| 577 | Ga0495607_0204936 | 3300046501 | Bacteria | 973 |
| 578 | Ga0495583_0000137 | 3300046506 | Bacteria | 123815 |
| 579 | Ga0495583_0000231 | 3300046506 | Bacteria | 93091 |
| 580 | Ga0495583_0000428 | 3300046506 | Bacteria | 63526 |
| 581 | Ga0495583_0000446 | 3300046506 | Bacteria | 61891 |
| 582 | Ga0495583_0000502 | 3300046506 | Bacteria | 56607 |
| 583 | Ga0495583_0001074 | 3300046506 | Bacteria | 30538 |
| 584 | Ga0495583_0001094 | 3300046506 | Bacteria | 29993 |
| 585 | Ga0495583_0002471 | 3300046506 | Bacteria | 15743 |
| 586 | Ga0495583_0003032 | 3300046506 | Bacteria | 13386 |
| 587 | Ga0495583_0010646 | 3300046506 | Bacteria | 5346 |
| 588 | Ga0495583_0037907 | 3300046506 | Bacteria | 2282 |
| 589 | Ga0495583_0059635 | 3300046506 | Bacteria | 1709 |
| 590 | Ga0495583_0071658 | 3300046506 | Bacteria | 1521 |
| 591 | Ga0495583_0122128 | 3300046506 | Bacteria | 1095 |
| 592 | Ga0495606_0000353 | 3300046507 | Bacteria | 78700 |
| 593 | Ga0495606_0000400 | 3300046507 | Bacteria | 73341 |
| 594 | Ga0495606_0000821 | 3300046507 | Bacteria | 47099 |
| 595 | Ga0495606_0001004 | 3300046507 | Bacteria | 41149 |
| 596 | Ga0495606_0001694 | 3300046507 | Bacteria | 28468 |
| 597 | Ga0495606_0007181 | 3300046507 | Bacteria | 10052 |
| 598 | Ga0495606_0012914 | 3300046507 | Bacteria | 6647 |
| 599 | Ga0495606_0018252 | 3300046507 | Bacteria | 5269 |
| 600 | Ga0495606_0027360 | 3300046507 | Bacteria | 4046 |
| 601 | Ga0495606_0086025 | 3300046507 | Bacteria | 1944 |
| 602 | Ga0495606_0106018 | 3300046507 | Bacteria | 1702 |
| 603 | Ga0495606_0127170 | 3300046507 | Bacteria | 1518 |
| 604 | Ga0495606_0291668 | 3300046507 | Bacteria | 887 |
| 605 | Ga0495606_0413773 | 3300046507 | Bacteria | 699 |
| 606 | Ga0495606_0441467 | 3300046507 | Bacteria | 668 |
| 607 | Ga0495606_0511302 | 3300046507 | Bacteria | 604 |
| 608 | Ga0495606_0523469 | 3300046507 | Bacteria | 595 |
| 609 | Ga0495606_0581267 | 3300046507 | Bacteria | 552 |
| 610 | Ga0495610_0001351 | 3300046512 | Bacteria | 21769 |
| 611 | Ga0495610_0001490 | 3300046512 | Bacteria | 20605 |
| 612 | Ga0495610_0003715 | 3300046512 | Bacteria | 11690 |
| 613 | Ga0495610_0006638 | 3300046512 | Bacteria | 7897 |
| 614 | Ga0495610_0022573 | 3300046512 | Bacteria | 3438 |
| 615 | Ga0495610_0049988 | 3300046512 | Bacteria | 2043 |
| 616 | Ga0495610_0078247 | 3300046512 | Bacteria | 1525 |
| 617 | Ga0495610_0083118 | 3300046512 | Bacteria | 1466 |
| 618 | Ga0495616_0000072 | 3300046513 | Bacteria | 87767 |
| 619 | Ga0495616_0000106 | 3300046513 | Bacteria | 72335 |
| 620 | Ga0495616_0000324 | 3300046513 | Bacteria | 38102 |
| 621 | Ga0495616_0001789 | 3300046513 | Bacteria | 14612 |
| 622 | Ga0495616_0002097 | 3300046513 | Bacteria | 13399 |
| 623 | Ga0495616_0020868 | 3300046513 | Bacteria | 3557 |
| 624 | Ga0495616_0021450 | 3300046513 | Bacteria | 3498 |
| 625 | Ga0495616_0024185 | 3300046513 | Bacteria | 3260 |
| 626 | Ga0495616_0056239 | 3300046513 | Bacteria | 1943 |
| 627 | Ga0495616_0164792 | 3300046513 | Bacteria | 994 |
| 628 | Ga0495616_0224513 | 3300046513 | Bacteria | 816 |
| 629 | Ga0495616_0396744 | 3300046513 | Bacteria | 567 |
| 630 | Ga0495616_0408100 | 3300046513 | Bacteria | 557 |
| 631 | Ga0495618_0299255 | 3300046514 | Bacteria | 1000 |
| 632 | Ga0495620_0004824 | 3300046515 | Bacteria | 7580 |
| 633 | Ga0495620_0082992 | 3300046515 | Bacteria | 1294 |
| 634 | Ga0495628_0326947 | 3300046516 | Bacteria | 1131 |
| 635 | Ga0495630_0007235 | 3300046517 | Bacteria | 7919 |
| 636 | Ga0495630_0180401 | 3300046517 | Bacteria | 1610 |
| 637 | Ga0495631_0000349 | 3300046518 | Bacteria | 31928 |
| 638 | Ga0495631_0000452 | 3300046518 | Bacteria | 27992 |
| 639 | Ga0495631_0022820 | 3300046518 | Bacteria | 2908 |
| 640 | Ga0495631_0033083 | 3300046518 | Bacteria | 2324 |
| 641 | Ga0495631_0044250 | 3300046518 | Bacteria | 1962 |
| 642 | Ga0495631_0083720 | 3300046518 | Bacteria | 1374 |
| 643 | Ga0495631_0120854 | 3300046518 | Bacteria | 1126 |
| 644 | Ga0495631_0123277 | 3300046518 | Bacteria | 1114 |
| 645 | Ga0495631_0292300 | 3300046518 | Bacteria | 693 |
| 646 | Ga0495631_0372815 | 3300046518 | Bacteria | 607 |
| 647 | Ga0495632_0000025 | 3300046519 | Bacteria | 176815 |
| 648 | Ga0495632_0000342 | 3300046519 | Bacteria | 44311 |
| 649 | Ga0495632_0000566 | 3300046519 | Bacteria | 34383 |
| 650 | Ga0495632_0010866 | 3300046519 | Bacteria | 5355 |
| 651 | Ga0495632_0020918 | 3300046519 | Bacteria | 3535 |
| 652 | Ga0495632_0022704 | 3300046519 | Bacteria | 3359 |
| 653 | Ga0495632_0054276 | 3300046519 | Bacteria | 1965 |
| 654 | Ga0495632_0059315 | 3300046519 | Bacteria | 1862 |
| 655 | Ga0495632_0270231 | 3300046519 | Bacteria | 759 |
| 656 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 657 | Ga0495637_0000240 | 3300046520 | Bacteria | 42746 |
| 658 | Ga0495637_0000634 | 3300046520 | Bacteria | 24740 |
| 659 | Ga0495637_0022590 | 3300046520 | Bacteria | 2867 |
| 660 | Ga0495637_0189922 | 3300046520 | Bacteria | 758 |
| 661 | Ga0495643_0000108 | 3300046522 | Bacteria | 136032 |
| 662 | Ga0495643_0000471 | 3300046522 | Bacteria | 51325 |
| 663 | Ga0495643_0000906 | 3300046522 | Bacteria | 31248 |
| 664 | Ga0495643_0003125 | 3300046522 | Bacteria | 12363 |
| 665 | Ga0495643_0005227 | 3300046522 | Bacteria | 8834 |
| 666 | Ga0495643_0009950 | 3300046522 | Bacteria | 5875 |
| 667 | Ga0495643_0030273 | 3300046522 | Bacteria | 3024 |
| 668 | Ga0495643_0036192 | 3300046522 | Bacteria | 2713 |
| 669 | Ga0495643_0049434 | 3300046522 | Bacteria | 2268 |
| 670 | Ga0495643_0074329 | 3300046522 | Bacteria | 1780 |
| 671 | Ga0495643_0098558 | 3300046522 | Bacteria | 1500 |
| 672 | Ga0495643_0235281 | 3300046522 | Bacteria | 862 |
| 673 | Ga0495643_0318034 | 3300046522 | Bacteria | 704 |
| 674 | Ga0495644_0001043 | 3300046523 | Bacteria | 11545 |
| 675 | Ga0495644_0001784 | 3300046523 | Bacteria | 8681 |
| 676 | Ga0495644_0010246 | 3300046523 | Bacteria | 3611 |
| 677 | Ga0495644_0010507 | 3300046523 | Bacteria | 3569 |
| 678 | Ga0495644_0014447 | 3300046523 | Bacteria | 3024 |
| 679 | Ga0495644_0045983 | 3300046523 | Bacteria | 1640 |
| 680 | Ga0495644_0113539 | 3300046523 | Bacteria | 1028 |
| 681 | Ga0495644_0138408 | 3300046523 | Bacteria | 929 |
| 682 | Ga0495644_0336127 | 3300046523 | Bacteria | 593 |
| 683 | Ga0495648_0000006 | 3300046524 | Bacteria | 361208 |
| 684 | Ga0495648_0000134 | 3300046524 | Bacteria | 87750 |
| 685 | Ga0495648_0000464 | 3300046524 | Bacteria | 43552 |
| 686 | Ga0495648_0004553 | 3300046524 | Bacteria | 11811 |
| 687 | Ga0495648_0007917 | 3300046524 | Bacteria | 8431 |
| 688 | Ga0495648_0011923 | 3300046524 | Bacteria | 6520 |
| 689 | Ga0495648_0016240 | 3300046524 | Bacteria | 5371 |
| 690 | Ga0495648_0016351 | 3300046524 | Bacteria | 5352 |
| 691 | Ga0495648_0020374 | 3300046524 | Bacteria | 4625 |
| 692 | Ga0495648_0225968 | 3300046524 | Bacteria | 920 |
| 693 | Ga0495648_0508397 | 3300046524 | Bacteria | 515 |
| 694 | Ga0495648_0513936 | 3300046524 | Bacteria | 511 |
| 695 | Ga0495663_0018267 | 3300046525 | Bacteria | 1996 |
| 696 | Ga0495663_0018697 | 3300046525 | Bacteria | 1974 |
| 697 | Ga0495663_0021524 | 3300046525 | Bacteria | 1857 |
| 698 | Ga0495663_0147630 | 3300046525 | Bacteria | 801 |
| 699 | Ga0495666_0001620 | 3300046526 | Bacteria | 11091 |
| 700 | Ga0495666_0003104 | 3300046526 | Bacteria | 8348 |
| 701 | Ga0495666_0077453 | 3300046526 | Bacteria | 1575 |
| 702 | Ga0495666_0206238 | 3300046526 | Bacteria | 902 |
| 703 | Ga0495666_0243317 | 3300046526 | Bacteria | 820 |
| 704 | Ga0495642_0000052 | 3300046528 | Bacteria | 70857 |
| 705 | Ga0495642_0000740 | 3300046528 | Bacteria | 16183 |
| 706 | Ga0495642_0001769 | 3300046528 | Bacteria | 9314 |
| 707 | Ga0495642_0020737 | 3300046528 | Bacteria | 2583 |
| 708 | Ga0495642_0026741 | 3300046528 | Bacteria | 2293 |
| 709 | Ga0495642_0026883 | 3300046528 | Bacteria | 2287 |
| 710 | Ga0495642_0029677 | 3300046528 | Bacteria | 2185 |
| 711 | Ga0495642_0030446 | 3300046528 | Bacteria | 2158 |
| 712 | Ga0495642_0045118 | 3300046528 | Bacteria | 1801 |
| 713 | Ga0495642_0125385 | 3300046528 | Bacteria | 1103 |
| 714 | Ga0495652_0005509 | 3300046529 | Bacteria | 11916 |
| 715 | Ga0495652_0471504 | 3300046529 | Bacteria | 875 |
| 716 | Ga0495654_0000131 | 3300046530 | Bacteria | 80339 |
| 717 | Ga0495654_0011979 | 3300046530 | Bacteria | 4675 |
| 718 | Ga0495654_0013625 | 3300046530 | Bacteria | 4347 |
| 719 | Ga0495654_0018546 | 3300046530 | Bacteria | 3644 |
| 720 | Ga0495654_0030584 | 3300046530 | Bacteria | 2738 |
| 721 | Ga0495654_0061407 | 3300046530 | Bacteria | 1804 |
| 722 | Ga0495654_0330550 | 3300046530 | Bacteria | 616 |
| 723 | Ga0495665_0006428 | 3300046531 | Bacteria | 6344 |
| 724 | Ga0495665_0010647 | 3300046531 | Bacteria | 4980 |
| 725 | Ga0495665_0026437 | 3300046531 | Bacteria | 3117 |
| 726 | Ga0495665_0038501 | 3300046531 | Bacteria | 2549 |
| 727 | Ga0495665_0133325 | 3300046531 | Bacteria | 1300 |
| 728 | Ga0495665_0645579 | 3300046531 | Bacteria | 527 |
| 729 | Ga0495640_0034668 | 3300046533 | Bacteria | 3575 |
| 730 | Ga0495586_0015127 | 3300046535 | Bacteria | 4105 |
| 731 | Ga0495586_0015424 | 3300046535 | Bacteria | 4065 |
| 732 | Ga0495586_0015542 | 3300046535 | Bacteria | 4050 |
| 733 | Ga0495586_0265468 | 3300046535 | Bacteria | 980 |
| 734 | Ga0495587_0082289 | 3300046536 | Bacteria | 1865 |
| 735 | Ga0495587_0436849 | 3300046536 | Bacteria | 726 |
| 736 | Ga0495609_0000616 | 3300046538 | Bacteria | 27691 |
| 737 | Ga0495609_0000908 | 3300046538 | Bacteria | 21503 |
| 738 | Ga0495609_0001364 | 3300046538 | Bacteria | 16436 |
| 739 | Ga0495609_0004228 | 3300046538 | Bacteria | 7935 |
| 740 | Ga0495609_0005236 | 3300046538 | Bacteria | 6900 |
| 741 | Ga0495609_0013898 | 3300046538 | Bacteria | 3795 |
| 742 | Ga0495609_0036536 | 3300046538 | Bacteria | 2217 |
| 743 | Ga0495609_0042714 | 3300046538 | Bacteria | 2036 |
| 744 | Ga0495609_0066996 | 3300046538 | Bacteria | 1581 |
| 745 | Ga0495609_0130333 | 3300046538 | Bacteria | 1077 |
| 746 | Ga0495609_0416555 | 3300046538 | Bacteria | 536 |
| 747 | Ga0495597_0000340 | 3300046542 | Bacteria | 41815 |
| 748 | Ga0495597_0000415 | 3300046542 | Bacteria | 36751 |
| 749 | Ga0495597_0000648 | 3300046542 | Bacteria | 28260 |
| 750 | Ga0495597_0001867 | 3300046542 | Bacteria | 14395 |
| 751 | Ga0495597_0002686 | 3300046542 | Bacteria | 10986 |
| 752 | Ga0495597_0002986 | 3300046542 | Bacteria | 10222 |
| 753 | Ga0495597_0004079 | 3300046542 | Bacteria | 8159 |
| 754 | Ga0495597_0007712 | 3300046542 | Bacteria | 5441 |
| 755 | Ga0495597_0010859 | 3300046542 | Bacteria | 4433 |
| 756 | Ga0495597_0027736 | 3300046542 | Bacteria | 2595 |
| 757 | Ga0495597_0039449 | 3300046542 | Bacteria | 2115 |
| 758 | Ga0495597_0054015 | 3300046542 | Bacteria | 1765 |
| 759 | Ga0495597_0075255 | 3300046542 | Bacteria | 1449 |
| 760 | Ga0495597_0190385 | 3300046542 | Bacteria | 825 |
| 761 | Ga0495597_0366321 | 3300046542 | Bacteria | 551 |
| 762 | Ga0495645_0181519 | 3300046543 | Bacteria | 1442 |
| 763 | Ga0495622_0000208 | 3300046557 | Bacteria | 46373 |
| 764 | Ga0495622_0050265 | 3300046557 | Bacteria | 1934 |
| 765 | Ga0495622_0081367 | 3300046557 | Bacteria | 1490 |
| 766 | Ga0495622_0308813 | 3300046557 | Bacteria | 688 |
| 767 | Ga0495633_0000469 | 3300046558 | Bacteria | 41254 |
| 768 | Ga0495633_0001267 | 3300046558 | Bacteria | 20125 |
| 769 | Ga0495633_0002386 | 3300046558 | Bacteria | 13295 |
| 770 | Ga0495633_0006514 | 3300046558 | Bacteria | 6901 |
| 771 | Ga0495633_0011104 | 3300046558 | Bacteria | 4882 |
| 772 | Ga0495633_0017396 | 3300046558 | Bacteria | 3678 |
| 773 | Ga0495633_0037642 | 3300046558 | Bacteria | 2314 |
| 774 | Ga0495633_0076506 | 3300046558 | Bacteria | 1558 |
| 775 | Ga0495633_0128887 | 3300046558 | Bacteria | 1170 |
| 776 | Ga0495633_0132044 | 3300046558 | Bacteria | 1155 |
| 777 | Ga0495633_0190268 | 3300046558 | Bacteria | 943 |
| 778 | Ga0495633_0198421 | 3300046558 | Bacteria | 921 |
| 779 | Ga0495633_0333648 | 3300046558 | Bacteria | 687 |
| 780 | Ga0495633_0439312 | 3300046558 | Bacteria | 589 |
| 781 | Ga0495633_0581509 | 3300046558 | Bacteria | 504 |
| 782 | Ga0495667_0072864 | 3300046559 | Bacteria | 2238 |
| 783 | Ga0495656_0002559 | 3300046615 | Bacteria | 6064 |
| 784 | Ga0495656_0229163 | 3300046615 | Bacteria | 931 |
| 785 | Ga0495656_0260687 | 3300046615 | Bacteria | 878 |
| 786 | Ga0495656_0367995 | 3300046615 | Bacteria | 747 |
| 787 | Ga0495656_0371261 | 3300046615 | Bacteria | 744 |
| 788 | Ga0495656_0374879 | 3300046615 | Bacteria | 741 |
| 789 | Ga0495656_0529990 | 3300046615 | Bacteria | 626 |
| 790 | Ga0495668_0000029 | 3300046616 | Bacteria | 279128 |
| 791 | Ga0495668_0000119 | 3300046616 | Bacteria | 118812 |
| 792 | Ga0495668_0000209 | 3300046616 | Bacteria | 84817 |
| 793 | Ga0495668_0000611 | 3300046616 | Bacteria | 43129 |
| 794 | Ga0495668_0000938 | 3300046616 | Bacteria | 32545 |
| 795 | Ga0495668_0001212 | 3300046616 | Bacteria | 26091 |
| 796 | Ga0495668_0002631 | 3300046616 | Bacteria | 14437 |
| 797 | Ga0495668_0005764 | 3300046616 | Bacteria | 8279 |
| 798 | Ga0495668_0008987 | 3300046616 | Bacteria | 6170 |
| 799 | Ga0495668_0014170 | 3300046616 | Bacteria | 4684 |
| 800 | Ga0495668_0025842 | 3300046616 | Bacteria | 3334 |
| 801 | Ga0495668_0031839 | 3300046616 | Bacteria | 2970 |
| 802 | Ga0495668_0035132 | 3300046616 | Bacteria | 2809 |
| 803 | Ga0495668_0039612 | 3300046616 | Bacteria | 2630 |
| 804 | Ga0495668_0040722 | 3300046616 | Bacteria | 2590 |
| 805 | Ga0495668_0072257 | 3300046616 | Bacteria | 1895 |
| 806 | Ga0495668_0131624 | 3300046616 | Bacteria | 1369 |
| 807 | Ga0495668_0218858 | 3300046616 | Bacteria | 1043 |
| 808 | Ga0495668_0453923 | 3300046616 | Bacteria | 705 |
| 809 | Ga0495634_0001509 | 3300046642 | Bacteria | 20601 |
| 810 | Ga0495634_0363619 | 3300046642 | Bacteria | 864 |
| 811 | Ga0495611_0000370 | 3300046648 | Bacteria | 28963 |
| 812 | Ga0495611_0001926 | 3300046648 | Bacteria | 9864 |
| 813 | Ga0495611_0007671 | 3300046648 | Bacteria | 4582 |
| 814 | Ga0495611_0013636 | 3300046648 | Bacteria | 3462 |
| 815 | Ga0495611_0017119 | 3300046648 | Bacteria | 3098 |
| 816 | Ga0495611_0033943 | 3300046648 | Bacteria | 2253 |
| 817 | Ga0495611_0047579 | 3300046648 | Bacteria | 1925 |
| 818 | Ga0495611_0067998 | 3300046648 | Bacteria | 1625 |
| 819 | Ga0495611_0072063 | 3300046648 | Bacteria | 1580 |
| 820 | Ga0495625_0000780 | 3300046660 | Bacteria | 44247 |
| 821 | Ga0495625_0001523 | 3300046660 | Bacteria | 27723 |
| 822 | Ga0495625_0010304 | 3300046660 | Bacteria | 7749 |
| 823 | Ga0495625_0016339 | 3300046660 | Bacteria | 5844 |
| 824 | Ga0495625_0018403 | 3300046660 | Bacteria | 5456 |
| 825 | Ga0495625_0019735 | 3300046660 | Bacteria | 5219 |
| 826 | Ga0495625_0024430 | 3300046660 | Bacteria | 4599 |
| 827 | Ga0495625_0027278 | 3300046660 | Bacteria | 4302 |
| 828 | Ga0495625_0029299 | 3300046660 | Bacteria | 4119 |
| 829 | Ga0495625_0050583 | 3300046660 | Bacteria | 2981 |
| 830 | Ga0495625_0051383 | 3300046660 | Bacteria | 2955 |
| 831 | Ga0495625_0148276 | 3300046660 | Bacteria | 1578 |
| 832 | Ga0495625_0185140 | 3300046660 | Bacteria | 1382 |
| 833 | Ga0495625_0326176 | 3300046660 | Bacteria | 976 |
| 834 | Ga0495625_0652437 | 3300046660 | Bacteria | 626 |
| 835 | Ga0495635_0040957 | 3300046663 | Bacteria | 3200 |
| 836 | Ga0495635_0356568 | 3300046663 | Bacteria | 975 |
| 837 | Ga0495635_0879350 | 3300046663 | Bacteria | 574 |
| 838 | Ga0495659_0000131 | 3300046664 | Bacteria | 32964 |
| 839 | Ga0495659_0003174 | 3300046664 | Bacteria | 5272 |
| 840 | Ga0495659_0004375 | 3300046664 | Bacteria | 4444 |
| 841 | Ga0495659_0069767 | 3300046664 | Bacteria | 1315 |
| 842 | Ga0495659_0078709 | 3300046664 | Bacteria | 1248 |
| 843 | Ga0495659_0101622 | 3300046664 | Bacteria | 1114 |
| 844 | Ga0495659_0410978 | 3300046664 | Bacteria | 585 |
| 845 | Ga0495661_0000735 | 3300046665 | Bacteria | 32041 |
| 846 | Ga0495661_0005799 | 3300046665 | Bacteria | 8730 |
| 847 | Ga0495661_0019967 | 3300046665 | Bacteria | 4382 |
| 848 | Ga0495661_0023662 | 3300046665 | Bacteria | 3983 |
| 849 | Ga0495661_0041137 | 3300046665 | Bacteria | 2861 |
| 850 | Ga0495661_0112338 | 3300046665 | Bacteria | 1516 |
| 851 | Ga0495661_0114071 | 3300046665 | Bacteria | 1502 |
| 852 | Ga0495661_0121833 | 3300046665 | Bacteria | 1439 |
| 853 | Ga0495661_0149751 | 3300046665 | Bacteria | 1261 |
| 854 | Ga0495661_0172975 | 3300046665 | Bacteria | 1150 |
| 855 | Ga0495661_0179116 | 3300046665 | Bacteria | 1124 |
| 856 | Ga0495661_0193834 | 3300046665 | Bacteria | 1068 |
| 857 | Ga0495661_0211605 | 3300046665 | Bacteria | 1009 |
| 858 | Ga0495661_0259493 | 3300046665 | Bacteria | 883 |
| 859 | Ga0495661_0295969 | 3300046665 | Bacteria | 811 |
| 860 | Ga0495661_0347819 | 3300046665 | Bacteria | 730 |
| 861 | Ga0495661_0489643 | 3300046665 | Bacteria | 587 |
| 862 | Ga0495661_0605979 | 3300046665 | Bacteria | 514 |
| 863 | Ga0495588_0001307 | 3300046674 | Bacteria | 10657 |
| 864 | Ga0495588_0018147 | 3300046674 | Bacteria | 3426 |
| 865 | Ga0495588_0023088 | 3300046674 | Bacteria | 3076 |
| 866 | Ga0495588_0026542 | 3300046674 | Bacteria | 2893 |
| 867 | Ga0495588_0103688 | 3300046674 | Bacteria | 1495 |
| 868 | Ga0495588_0318725 | 3300046674 | Bacteria | 818 |
| 869 | Ga0495588_0608483 | 3300046674 | Bacteria | 572 |
| 870 | Ga0495588_0627666 | 3300046674 | Bacteria | 562 |
| 871 | Ga0495623_0073538 | 3300046679 | Bacteria | 2124 |
| 872 | Ga0495623_0248424 | 3300046679 | Bacteria | 1002 |
| 873 | Ga0495623_0347767 | 3300046679 | Bacteria | 808 |
| 874 | Ga0495623_0631909 | 3300046679 | Bacteria | 553 |
| 875 | Ga0495646_0055084 | 3300046680 | Bacteria | 2390 |
| 876 | Ga0495646_0055444 | 3300046680 | Bacteria | 2380 |
| 877 | Ga0495669_0000252 | 3300046684 | Bacteria | 31128 |
| 878 | Ga0495669_0001124 | 3300046684 | Bacteria | 11080 |
| 879 | Ga0495669_0018087 | 3300046684 | Bacteria | 3027 |
| 880 | Ga0495669_0052302 | 3300046684 | Bacteria | 1834 |
| 881 | Ga0495669_0076559 | 3300046684 | Bacteria | 1531 |
| 882 | Ga0495669_0339888 | 3300046684 | Bacteria | 725 |
| 883 | Ga0495613_0023417 | 3300046689 | Bacteria | 4601 |
| 884 | Ga0495613_0092671 | 3300046689 | Bacteria | 2187 |
| 885 | Ga0495624_0026941 | 3300046690 | Bacteria | 3765 |
| 886 | Ga0495624_0227971 | 3300046690 | Bacteria | 1129 |
| 887 | Ga0495670_0001054 | 3300046691 | Bacteria | 13359 |
| 888 | Ga0495670_0001812 | 3300046691 | Bacteria | 10504 |
| 889 | Ga0495670_0005293 | 3300046691 | Bacteria | 6348 |
| 890 | Ga0495670_0009606 | 3300046691 | Bacteria | 4752 |
| 891 | Ga0495670_0017049 | 3300046691 | Bacteria | 3571 |
| 892 | Ga0495670_0020504 | 3300046691 | Bacteria | 3260 |
| 893 | Ga0495670_0052475 | 3300046691 | Bacteria | 2041 |
| 894 | Ga0495670_0054543 | 3300046691 | Bacteria | 2003 |
| 895 | Ga0495670_0078626 | 3300046691 | Bacteria | 1678 |
| 896 | Ga0495670_0149937 | 3300046691 | Bacteria | 1223 |
| 897 | Ga0495670_0254286 | 3300046691 | Bacteria | 937 |
| 898 | Ga0495670_0319471 | 3300046691 | Bacteria | 833 |
| 899 | Ga0495671_0000424 | 3300046692 | Bacteria | 33646 |
| 900 | Ga0495671_0001320 | 3300046692 | Bacteria | 16842 |
| 901 | Ga0495671_0016501 | 3300046692 | Bacteria | 3942 |
| 902 | Ga0495671_0026566 | 3300046692 | Bacteria | 3000 |
| 903 | Ga0495671_0029853 | 3300046692 | Bacteria | 2796 |
| 904 | Ga0495671_0102556 | 3300046692 | Bacteria | 1398 |
| 905 | Ga0495671_0464693 | 3300046692 | Bacteria | 604 |
| 906 | Ga0495649_0000523 | 3300046694 | Bacteria | 32634 |
| 907 | Ga0495649_0002046 | 3300046694 | Bacteria | 14554 |
| 908 | Ga0495649_0016799 | 3300046694 | Bacteria | 4143 |
| 909 | Ga0495649_0023389 | 3300046694 | Bacteria | 3453 |
| 910 | Ga0495649_0045174 | 3300046694 | Bacteria | 2402 |
| 911 | Ga0495649_0129521 | 3300046694 | Bacteria | 1331 |
| 912 | Ga0495649_0167356 | 3300046694 | Bacteria | 1151 |
| 913 | Ga0495649_0225544 | 3300046694 | Bacteria | 968 |
| 914 | Ga0495649_0259378 | 3300046694 | Bacteria | 891 |
| 915 | Ga0495649_0271590 | 3300046694 | Bacteria | 867 |
| 916 | Ga0495649_0419509 | 3300046694 | Bacteria | 670 |
| 917 | Ga0495589_0000287 | 3300046794 | Bacteria | 40912 |
| 918 | Ga0495589_0001294 | 3300046794 | Bacteria | 14757 |
| 919 | Ga0495589_0002319 | 3300046794 | Bacteria | 10700 |
| 920 | Ga0495589_0002781 | 3300046794 | Bacteria | 9683 |
| 921 | Ga0495589_0004277 | 3300046794 | Bacteria | 7633 |
| 922 | Ga0495589_0021087 | 3300046794 | Bacteria | 3330 |
| 923 | Ga0495589_0076113 | 3300046794 | Bacteria | 1636 |
| 924 | Ga0495589_0103629 | 3300046794 | Bacteria | 1375 |
| 925 | Ga0495589_0127280 | 3300046794 | Bacteria | 1224 |
| 926 | Ga0495589_0135326 | 3300046794 | Bacteria | 1182 |
| 927 | Ga0495589_0192920 | 3300046794 | Bacteria | 963 |
| 928 | Ga0495589_0357350 | 3300046794 | Bacteria | 672 |
| 929 | Ga0495600_0008955 | 3300046809 | Bacteria | 6166 |
| 930 | Ga0495600_0021038 | 3300046809 | Bacteria | 4175 |
| 931 | Ga0495660_0000854 | 3300046810 | Bacteria | 22501 |
| 932 | Ga0495660_0003129 | 3300046810 | Bacteria | 10308 |
| 933 | Ga0495660_0004100 | 3300046810 | Bacteria | 8895 |
| 934 | Ga0495660_0004487 | 3300046810 | Bacteria | 8442 |
| 935 | Ga0495660_0007612 | 3300046810 | Bacteria | 6360 |
| 936 | Ga0495660_0012236 | 3300046810 | Bacteria | 4978 |
| 937 | Ga0495660_0018978 | 3300046810 | Bacteria | 3948 |
| 938 | Ga0495660_0052346 | 3300046810 | Bacteria | 2218 |
| 939 | Ga0495660_0087187 | 3300046810 | Bacteria | 1628 |
| 940 | Ga0495581_0034695 | 3300047315 | Bacteria | 2918 |
| 941 | Ga0495581_0119507 | 3300047315 | Bacteria | 1533 |
| 942 | Ga0495581_0356603 | 3300047315 | Bacteria | 854 |
| 943 | Ga0495604_0005346 | 3300047317 | Bacteria | 10181 |
| 944 | Ga0495604_0019809 | 3300047317 | Bacteria | 5381 |
| 945 | Ga0495604_0040951 | 3300047317 | Bacteria | 3635 |
| 946 | Ga0495636_0000144 | 3300047318 | Bacteria | 28781 |
| 947 | Ga0495636_0016357 | 3300047318 | Bacteria | 2962 |
| 948 | Ga0495636_0032030 | 3300047318 | Bacteria | 2155 |
| 949 | Ga0495636_0054377 | 3300047318 | Bacteria | 1682 |
| 950 | Ga0495636_0068536 | 3300047318 | Bacteria | 1510 |
| 951 | Ga0495636_0514888 | 3300047318 | Bacteria | 579 |
| 952 | Ga0495674_0079766 | 3300047319 | Bacteria | 2810 |
| 953 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 954 | Ga0495672_0000399 | 3300047320 | Bacteria | 52911 |
| 955 | Ga0495672_0000678 | 3300047320 | Bacteria | 37915 |
| 956 | Ga0495672_0000786 | 3300047320 | Bacteria | 34407 |
| 957 | Ga0495672_0000973 | 3300047320 | Bacteria | 29705 |
| 958 | Ga0495672_0011821 | 3300047320 | Bacteria | 6131 |
| 959 | Ga0495672_0130239 | 3300047320 | Bacteria | 1324 |
| 960 | Ga0495672_0186864 | 3300047320 | Bacteria | 1045 |
| 961 | Ga0495676_0000097 | 3300047321 | Bacteria | 65781 |
| 962 | Ga0495676_0020339 | 3300047321 | Bacteria | 5824 |
| 963 | Ga0495676_0069415 | 3300047321 | Bacteria | 2719 |
| 964 | Ga0495676_0233306 | 3300047321 | Bacteria | 1263 |
| 965 | Ga0495676_0479370 | 3300047321 | Bacteria | 818 |
| 966 | Ga0495680_0022418 | 3300047322 | Bacteria | 5262 |
| 967 | Ga0495680_0055476 | 3300047322 | Bacteria | 3073 |
| 968 | Ga0495683_0000336 | 3300047323 | Bacteria | 39214 |
| 969 | Ga0495683_0001078 | 3300047323 | Bacteria | 18893 |
| 970 | Ga0495683_0002603 | 3300047323 | Bacteria | 10831 |
| 971 | Ga0495683_0017527 | 3300047323 | Bacteria | 3711 |
| 972 | Ga0495683_0022140 | 3300047323 | Bacteria | 3269 |
| 973 | Ga0495683_0038369 | 3300047323 | Bacteria | 2425 |
| 974 | Ga0495683_0077960 | 3300047323 | Bacteria | 1619 |
| 975 | Ga0495683_0131427 | 3300047323 | Bacteria | 1180 |
| 976 | Ga0495683_0344091 | 3300047323 | Bacteria | 631 |
| 977 | Ga0495683_0344331 | 3300047323 | Bacteria | 630 |
| 978 | Ga0495683_0485074 | 3300047323 | Bacteria | 503 |
| 979 | Ga0495687_000042 | 3300047443 | Bacteria | 218868 |
| 980 | Ga0495687_000115 | 3300047443 | Bacteria | 122883 |
| 981 | Ga0495687_000462 | 3300047443 | Bacteria | 49713 |
| 982 | Ga0495687_011298 | 3300047443 | Bacteria | 4813 |
| 983 | Ga0495687_140466 | 3300047443 | Bacteria | 840 |
| 984 | Ga0495687_175701 | 3300047443 | Bacteria | 704 |
| 985 | Ga0495675_0134216 | 3300047444 | Bacteria | 1537 |
| 986 | Ga0495675_0194612 | 3300047444 | Bacteria | 1236 |
| 987 | Ga0495677_0000657 | 3300047445 | Bacteria | 13960 |
| 988 | Ga0495677_0000678 | 3300047445 | Bacteria | 13776 |
| 989 | Ga0495677_0001177 | 3300047445 | Bacteria | 10471 |
| 990 | Ga0495677_0002717 | 3300047445 | Bacteria | 6916 |
| 991 | Ga0495677_0011353 | 3300047445 | Bacteria | 3260 |
| 992 | Ga0495677_0033250 | 3300047445 | Bacteria | 1879 |
| 993 | Ga0495677_0034593 | 3300047445 | Bacteria | 1843 |
| 994 | Ga0495677_0076338 | 3300047445 | Bacteria | 1252 |
| 995 | Ga0495677_0101941 | 3300047445 | Bacteria | 1087 |
| 996 | Ga0495677_0126009 | 3300047445 | Bacteria | 978 |
| 997 | Ga0495677_0207366 | 3300047445 | Bacteria | 763 |
| 998 | Ga0495677_0237942 | 3300047445 | Bacteria | 711 |
| 999 | Ga0495679_005865 | 3300047446 | Bacteria | 5387 |
| 1000 | Ga0495679_006199 | 3300047446 | Bacteria | 5188 |
| 1001 | Ga0495679_006853 | 3300047446 | Bacteria | 4839 |
| 1002 | Ga0495679_009483 | 3300047446 | Bacteria | 3894 |
| 1003 | Ga0495679_018891 | 3300047446 | Bacteria | 2435 |
| 1004 | Ga0495685_000583 | 3300047447 | Bacteria | 11242 |
| 1005 | Ga0495685_001534 | 3300047447 | Bacteria | 7087 |
| 1006 | Ga0495685_001869 | 3300047447 | Bacteria | 6506 |
| 1007 | Ga0495685_024558 | 3300047447 | Bacteria | 2074 |
| 1008 | Ga0495685_056289 | 3300047447 | Bacteria | 1329 |
| 1009 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 1010 | Ga0495673_0019469 | 3300047469 | Bacteria | 3399 |
| 1011 | Ga0495681_0000256 | 3300047470 | Bacteria | 43302 |
| 1012 | Ga0495681_0000817 | 3300047470 | Bacteria | 23946 |
| 1013 | Ga0495681_0002980 | 3300047470 | Bacteria | 11924 |
| 1014 | Ga0495681_0005891 | 3300047470 | Bacteria | 8136 |
| 1015 | Ga0495681_0015219 | 3300047470 | Bacteria | 4361 |
| 1016 | Ga0495681_0015958 | 3300047470 | Bacteria | 4235 |
| 1017 | Ga0495681_0036382 | 3300047470 | Bacteria | 2434 |
| 1018 | Ga0495681_0040178 | 3300047470 | Bacteria | 2279 |
| 1019 | Ga0495681_0041351 | 3300047470 | Bacteria | 2238 |
| 1020 | Ga0495681_0144828 | 3300047470 | Bacteria | 1001 |
| 1021 | Ga0495681_0169332 | 3300047470 | Bacteria | 905 |
| 1022 | Ga0495681_0306584 | 3300047470 | Bacteria | 613 |
| 1023 | Ga0495686_0000381 | 3300047472 | Bacteria | 70993 |
| 1024 | Ga0495686_0000728 | 3300047472 | Bacteria | 44006 |
| 1025 | Ga0495686_0000790 | 3300047472 | Bacteria | 41267 |
| 1026 | Ga0495686_0010013 | 3300047472 | Bacteria | 6773 |
| 1027 | Ga0495686_0010126 | 3300047472 | Bacteria | 6729 |
| 1028 | Ga0495686_0011743 | 3300047472 | Bacteria | 6166 |
| 1029 | Ga0495686_0019102 | 3300047472 | Bacteria | 4583 |
| 1030 | Ga0495686_0138098 | 3300047472 | Bacteria | 1440 |
| 1031 | Ga0495686_0266223 | 3300047472 | Bacteria | 957 |
| 1032 | Ga0495593_0006881 | 3300047673 | Bacteria | 6660 |
| 1033 | Ga0495593_0032559 | 3300047673 | Bacteria | 2841 |
| 1034 | Ga0495593_0039950 | 3300047673 | Bacteria | 2527 |
| 1035 | Ga0495602_0014183 | 3300048088 | Bacteria | 8100 |
| 1036 | Ga0495602_0350550 | 3300048088 | Bacteria | 1065 |
| 1037 | Ga0495614_0001960 | 3300048089 | Bacteria | 9051 |
| 1038 | Ga0495614_0043778 | 3300048089 | Bacteria | 1920 |
| 1039 | Ga0495614_0268861 | 3300048089 | Bacteria | 783 |
| 1040 | Ga0495615_0001225 | 3300048090 | Bacteria | 3739 |
| 1041 | Ga0495615_0002308 | 3300048090 | Bacteria | 3041 |
| 1042 | Ga0495626_0000043 | 3300048091 | Bacteria | 168109 |
| 1043 | Ga0495626_0003681 | 3300048091 | Bacteria | 9711 |
| 1044 | Ga0495626_0005800 | 3300048091 | Bacteria | 7123 |
| 1045 | Ga0495626_0005864 | 3300048091 | Bacteria | 7079 |
| 1046 | Ga0495626_0007150 | 3300048091 | Bacteria | 6242 |
| 1047 | Ga0495626_0007568 | 3300048091 | Bacteria | 6026 |
| 1048 | Ga0495626_0008641 | 3300048091 | Bacteria | 5565 |
| 1049 | Ga0495626_0013229 | 3300048091 | Bacteria | 4293 |
| 1050 | Ga0495626_0022977 | 3300048091 | Bacteria | 3075 |
| 1051 | Ga0495626_0031119 | 3300048091 | Bacteria | 2569 |
| 1052 | Ga0495626_0034465 | 3300048091 | Bacteria | 2421 |
| 1053 | Ga0495626_0038564 | 3300048091 | Bacteria | 2264 |
| 1054 | Ga0495626_0056037 | 3300048091 | Bacteria | 1806 |
| 1055 | Ga0495626_0071056 | 3300048091 | Bacteria | 1565 |
| 1056 | Ga0495626_0074360 | 3300048091 | Bacteria | 1520 |
| 1057 | Ga0495626_0090512 | 3300048091 | Bacteria | 1345 |
| 1058 | Ga0496100_0030576 | 3300048903 | Bacteria | 3341 |
| 1059 | Ga0496100_0164220 | 3300048903 | Bacteria | 1594 |
| 1060 | Ga0496100_0706574 | 3300048903 | Bacteria | 787 |
| 1061 | Ga0496100_1241066 | 3300048903 | Bacteria | 588 |
| 1062 | Ga0496101_0074104 | 3300048904 | Bacteria | 2503 |
| 1063 | Ga0496102_0000611 | 3300048905 | Bacteria | 37080 |
| 1064 | Ga0496102_0000872 | 3300048905 | Bacteria | 28839 |
| 1065 | Ga0496102_0001976 | 3300048905 | Bacteria | 17703 |
| 1066 | Ga0496102_0004929 | 3300048905 | Bacteria | 11311 |
| 1067 | Ga0496102_0063145 | 3300048905 | Bacteria | 3391 |
| 1068 | Ga0496102_0387678 | 3300048905 | Bacteria | 1314 |
| 1069 | Ga0496102_0603355 | 3300048905 | Bacteria | 1021 |
| 1070 | Ga0496102_0681437 | 3300048905 | Bacteria | 951 |
| 1071 | Ga0496102_1178735 | 3300048905 | Bacteria | 685 |
| 1072 | Ga0496103_0003038 | 3300048906 | Bacteria | 10335 |
| 1073 | Ga0496103_0015907 | 3300048906 | Bacteria | 4485 |
| 1074 | Ga0496103_0028550 | 3300048906 | Bacteria | 3386 |
| 1075 | Ga0496103_0217923 | 3300048906 | Bacteria | 1227 |
| 1076 | Ga0496103_0797080 | 3300048906 | Bacteria | 596 |
| 1077 | Ga0496104_0628709 | 3300048907 | Bacteria | 983 |
| 1078 | Ga0496104_1211695 | 3300048907 | Bacteria | 658 |
| 1079 | Ga0496105_0131174 | 3300048908 | Bacteria | 2066 |
| 1080 | Ga0496106_0312966 | 3300048909 | Bacteria | 1260 |
| 1081 | Ga0496106_1272618 | 3300048909 | Bacteria | 572 |
| 1082 | Ga0496107_0085649 | 3300048910 | Bacteria | 2299 |
| 1083 | Ga0496107_0744344 | 3300048910 | Bacteria | 719 |
| 1084 | Ga0496108_0292477 | 3300048911 | Bacteria | 1418 |
| 1085 | Ga0496108_1459396 | 3300048911 | Bacteria | 570 |
| 1086 | Ga0496109_0263546 | 3300048912 | Bacteria | 1623 |
| 1087 | Ga0496109_1407039 | 3300048912 | Bacteria | 633 |
| 1088 | Ga0496110_0004109 | 3300048913 | Bacteria | 11242 |
| 1089 | Ga0496110_0471218 | 3300048913 | Bacteria | 1144 |
| 1090 | Ga0496110_0677317 | 3300048913 | Bacteria | 932 |
| 1091 | Ga0496110_0804326 | 3300048913 | Bacteria | 844 |
| 1092 | Ga0496111_0650486 | 3300048914 | Bacteria | 769 |
| 1093 | Ga0496111_0758914 | 3300048914 | Bacteria | 703 |
| 1094 | Ga0496111_0761840 | 3300048914 | Bacteria | 702 |
| 1095 | Ga0496112_0392590 | 3300048915 | Bacteria | 1328 |
| 1096 | Ga0496113_0456442 | 3300048916 | Bacteria | 1027 |
| 1097 | Ga0496113_0677481 | 3300048916 | Bacteria | 824 |
| 1098 | Ga0496114_0023238 | 3300048917 | Bacteria | 5058 |
| 1099 | Ga0496114_0815196 | 3300048917 | Bacteria | 812 |
| 1100 | Ga0496115_0089065 | 3300048918 | Bacteria | 2520 |
| 1101 | Ga0496115_0153307 | 3300048918 | Bacteria | 1903 |
| 1102 | Ga0496115_0439146 | 3300048918 | Bacteria | 1055 |
| 1103 | Ga0496115_0691737 | 3300048918 | Bacteria | 802 |
| 1104 | Ga0496115_0975540 | 3300048918 | Bacteria | 649 |
| 1105 | Ga0496121_0148417 | 3300048924 | Bacteria | 1729 |
| 1106 | Ga0496122_0000980 | 3300048925 | Bacteria | 51101 |
| 1107 | Ga0496123_0004729 | 3300048926 | Bacteria | 14094 |
| 1108 | Ga0496124_0003562 | 3300048927 | Bacteria | 18929 |
| 1109 | Ga0496124_0090861 | 3300048927 | Bacteria | 2489 |
| 1110 | Ga0496124_0145794 | 3300048927 | Bacteria | 1863 |
| 1111 | Ga0496124_0320269 | 3300048927 | Bacteria | 1110 |
| 1112 | Ga0496124_0494096 | 3300048927 | Bacteria | 822 |
| 1113 | Ga0496125_0005645 | 3300048928 | Bacteria | 13815 |
| 1114 | Ga0495678_000202 | 3300049459 | Bacteria | 69911 |
| 1115 | Ga0495678_000403 | 3300049459 | Bacteria | 43653 |
| 1116 | Ga0495678_000622 | 3300049459 | Bacteria | 32958 |
| 1117 | Ga0495678_002745 | 3300049459 | Bacteria | 11549 |
| 1118 | Ga0495678_002792 | 3300049459 | Bacteria | 11386 |
| 1119 | Ga0495678_011469 | 3300049459 | Bacteria | 4241 |
| 1120 | Ga0495678_095797 | 3300049459 | Bacteria | 1036 |
| 1121 | Ga0495678_118467 | 3300049459 | Bacteria | 892 |
| 1122 | Ga0495678_127104 | 3300049459 | Bacteria | 849 |
| 1123 | Ga0495682_0000578 | 3300049460 | Bacteria | 24806 |
| 1124 | Ga0495682_0002545 | 3300049460 | Bacteria | 8584 |
| 1125 | Ga0495682_0018478 | 3300049460 | Bacteria | 2625 |
| 1126 | Ga0495682_0030501 | 3300049460 | Bacteria | 1995 |
| 1127 | Ga0495682_0100229 | 3300049460 | Bacteria | 1038 |
| 1128 | Ga0495682_0158351 | 3300049460 | Bacteria | 806 |
| 1129 | Ga0501290_082565 | 3300049513 | Bacteria | 550 |
| 1130 | Ga0501294_013735 | 3300049517 | Bacteria | 823 |
| 1131 | Ga0501298_041219 | 3300049521 | Bacteria | 937 |
| 1132 | Ga0501301_037809 | 3300049524 | Bacteria | 536 |
| 1133 | Ga0501303_007496 | 3300049526 | Bacteria | 974 |
| 1134 | Ga0501206_030261 | 3300049653 | Bacteria | 803 |
| 1135 | Ga0501207_024663 | 3300049654 | Bacteria | 982 |
| 1136 | Ga0501227_027817 | 3300049665 | Bacteria | 1340 |
| 1137 | Ga0501227_125581 | 3300049665 | Bacteria | 695 |
| 1138 | Ga0501230_000096 | 3300049667 | Bacteria | 6262 |
| 1139 | Ga0501235_022748 | 3300049669 | Bacteria | 1395 |
| 1140 | Ga0501238_004691 | 3300049671 | Bacteria | 1715 |
| 1141 | Ga0501238_010894 | 3300049671 | Bacteria | 1218 |
| 1142 | Ga0501238_043335 | 3300049671 | Bacteria | 665 |
| 1143 | Ga0501249_020014 | 3300049679 | Bacteria | 1454 |
| 1144 | Ga0501257_006221 | 3300049686 | Bacteria | 2647 |
| 1145 | Ga0501225_0212303 | 3300049705 | Bacteria | 619 |
| 1146 | Ga0501229_009621 | 3300049706 | Bacteria | 1216 |
| 1147 | Ga0501234_014102 | 3300049707 | Bacteria | 1254 |
| 1148 | Ga0501241_090460 | 3300049758 | Bacteria | 648 |
| 1149 | Ga0501241_120202 | 3300049758 | Bacteria | 583 |
| 1150 | Ga0501262_007416 | 3300049759 | Bacteria | 1326 |
| 1151 | Ga0501263_031533 | 3300049760 | Bacteria | 750 |
| 1152 | Ga0501265_000954 | 3300049762 | Bacteria | 3251 |
| 1153 | Ga0501269_000353 | 3300049766 | Bacteria | 11518 |
| 1154 | Ga0501269_008408 | 3300049766 | Bacteria | 1249 |
| 1155 | Ga0501279_001525 | 3300049775 | Bacteria | 3043 |
| 1156 | Ga0501279_002615 | 3300049775 | Bacteria | 2352 |
| 1157 | Ga0501035_0443186 | 3300049822 | Bacteria | 1075 |
| 1158 | Ga0501204_017306 | 3300049850 | Bacteria | 912 |
| 1159 | Ga0501220_00384 | 3300049852 | Bacteria | 1266 |
| 1160 | nmdc:mga03683_217221_c1 | 3300050489 | Bacteria | 881 |
| 1161 | nmdc:mga03683_325506_c1 | 3300050489 | Bacteria | 724 |
| 1162 | nmdc:mga03683_47155_c1 | 3300050489 | Bacteria | 1787 |
| 1163 | nmdc:mga03n38_259789_c1 | 3300050490 | Bacteria | 920 |
| 1164 | nmdc:mga0k408_121455_c1 | 3300050493 | Bacteria | 1547 |
| 1165 | nmdc:mga0k408_136862_c1 | 3300050493 | Bacteria | 1455 |
| 1166 | nmdc:mga0k408_270410_c1 | 3300050493 | Bacteria | 1015 |
| 1167 | nmdc:mga0k408_275845_c1 | 3300050493 | Bacteria | 1004 |
| 1168 | nmdc:mga0k408_3495_c1 | 3300050493 | Bacteria | 8304 |
| 1169 | nmdc:mga0k408_36281_c1 | 3300050493 | Bacteria | 2829 |
| 1170 | nmdc:mga06z11_197113_c1 | 3300050494 | Bacteria | 1168 |
| 1171 | nmdc:mga06z11_842585_c1 | 3300050494 | Bacteria | 559 |
| 1172 | nmdc:mga04h51_214698_c1 | 3300050495 | Bacteria | 760 |
| 1173 | nmdc:mga07m45_162482_c1 | 3300050496 | Bacteria | 1297 |
| 1174 | nmdc:mga07m45_2604_c3 | 3300050496 | Bacteria | 3421 |
| 1175 | nmdc:mga05p37_1079746_c1 | 3300050507 | Bacteria | 843 |
| 1176 | nmdc:mga0rr50_1402034_c1 | 3300050513 | Bacteria | 591 |
| 1177 | Ga0500578_0000417 | 3300053086 | Bacteria | 52045 |
| 1178 | Ga0500583_0414072 | 3300053092 | Bacteria | 645 |
| 1179 | Ga0500557_225440 | 3300053105 | Bacteria | 594 |
| 1180 | Ga0500593_001719 | 3300053117 | Bacteria | 7911 |
| 1181 | Ga0500618_010710 | 3300053125 | Bacteria | 2452 |
| 1182 | Ga0500586_008708 | 3300053145 | Bacteria | 2777 |
| 1183 | Ga0500589_067596 | 3300053147 | Bacteria | 1624 |
| 1184 | Ga0500604_0122715 | 3300053151 | Bacteria | 869 |
| 1185 | Ga0500619_000069 | 3300053154 | Bacteria | 30933 |
| 1186 | Ga0500624_008318 | 3300053157 | Bacteria | 1450 |
| 1187 | Ga0500627_0127750 | 3300053158 | Bacteria | 1148 |
| 1188 | Ga0500587_011576 | 3300053739 | Bacteria | 1114 |
| 1189 | Ga0587111_0209272 | 3300060346 | Bacteria | 557 |
| 1190 | Ga0466962_0035106 | 3300061719 | Bacteria | 2400 |
| 1191 | Ga0466962_0085003 | 3300061719 | Bacteria | 1514 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0744344 | Ga0496107_0744344_93_491 | 119 |
| 2 | 3300048927 | Ga0496124_0090861 | Ga0496124_0090861_137_535 | 119 |
| 3 | 3300049758 | Ga0501241_120202 | Ga0501241_120202_81_446 | 120 |
| 4 | 3300011119 | Ga0105246_11070476 | Ga0105246_110704762 | 121 |
| 5 | 3300025253 | Ga0209677_102386 | Ga0209677_1023864 | 121 |
| 6 | 3300025919 | Ga0207657_10565729 | Ga0207657_105657292 | 121 |
| 7 | 3300025940 | Ga0207691_10987388 | Ga0207691_109873882 | 121 |
| 8 | 3300034820 | Ga0373959_0185722 | Ga0373959_0185722_156_524 | 121 |
| 9 | 3300041443 | Ga0451789_0703010 | Ga0451789_0703010_398_763 | 121 |
| 10 | 3300041451 | Ga0451791_0324143 | Ga0451791_0324143_175_540 | 121 |
| 11 | 3300041452 | Ga0451793_1670211 | Ga0451793_1670211_281_646 | 121 |
| 12 | 3300041463 | Ga0451804_0066188 | Ga0451804_0066188_170_535 | 121 |
| 13 | 3300041492 | Ga0451835_0199638 | Ga0451835_0199638_210_575 | 121 |
| 14 | 3300042121 | Ga0450919_001225 | Ga0450919_001225_2182_2550 | 121 |
| 15 | 3300042531 | Ga0450918_000992 | Ga0450918_000992_4765_5133 | 121 |
| 16 | 3300046512 | Ga0495610_0078247 | Ga0495610_0078247_794_1159 | 121 |
| 17 | 3300046515 | Ga0495620_0082992 | Ga0495620_0082992_785_1150 | 121 |
| 18 | 3300046519 | Ga0495632_0054276 | Ga0495632_0054276_237_602 | 121 |
| 19 | 3300046616 | Ga0495668_0005764 | Ga0495668_0005764_3495_3893 | 121 |
| 20 | 3300046660 | Ga0495625_0019735 | Ga0495625_0019735_2141_2509 | 121 |
| 21 | 3300046660 | Ga0495625_0027278 | Ga0495625_0027278_2807_3172 | 121 |
| 22 | 3300047323 | Ga0495683_0344331 | Ga0495683_0344331_236_604 | 121 |
| 23 | 3300048905 | Ga0496102_0001976 | Ga0496102_0001976_17222_17587 | 121 |
| 24 | 3300048906 | Ga0496103_0797080 | Ga0496103_0797080_171_539 | 121 |
| 25 | 3300048914 | Ga0496111_0761840 | Ga0496111_0761840_170_568 | 121 |
| 26 | 3300048917 | Ga0496114_0023238 | Ga0496114_0023238_393_761 | 121 |
| 27 | 3300050489 | nmdc:mga03683_217221_c1 | nmdc:mga03683_217221_c1_369_737 | 121 |
| 28 | 3300050490 | nmdc:mga03n38_259789_c1 | nmdc:mga03n38_259789_c1_11_376 | 121 |
| 29 | 3300053092 | Ga0500583_0414072 | Ga0500583_0414072_165_533 | 121 |
| 30 | 3300053117 | Ga0500593_001719 | Ga0500593_001719_185_550 | 121 |
| 31 | 3300053739 | Ga0500587_011576 | Ga0500587_011576_472_837 | 121 |
| 32 | 3300048091 | Ga0495626_0013229 | Ga0495626_0013229_14_385 | 122 |
| 33 | iso_pu_bacteria | 2521172590 | 2521560335 | 125 |
| 34 | iso_pu_bacteria | 2551306416 | 2553005178 | 125 |
| 35 | iso_pu_bacteria | 2818991449 | 2819616709 | 125 |
| 36 | iso_pu_bacteria | 2904439833 | 2904442598 | 125 |
| 37 | iso_pu_bacteria | 2904530477 | 2904535193 | 125 |
| 38 | iso_pu_bacteria | 2904584206 | 2904589538 | 125 |
| 39 | iso_pu_bacteria | 2904589729 | 2904594446 | 125 |
| 40 | iso_pu_bacteria | 2904601388 | 2904606295 | 125 |
| 41 | iso_pu_bacteria | 2919079590 | 2919084245 | 125 |
| 42 | iso_pu_bacteria | 2923510766 | 2923514120 | 125 |
| 43 | 3300031901 | Ga0307406_11752555 | Ga0307406_117525552 | 126 |
| 44 | 3300034957 | Ga0373938_0011822 | Ga0373938_0011822_1081_1470 | 126 |
| 45 | 3300049653 | Ga0501206_030261 | Ga0501206_030261_296_676 | 126 |
| 46 | iso_pu_bacteria | 2885266251 | 2885270001 | 126 |
| 47 | iso_pu_bacteria | 2919046199 | 2919048794 | 126 |
| 48 | iso_pu_bacteria | 2928130867 | 2928134638 | 126 |
| 49 | 3300048916 | Ga0496113_0677481 | Ga0496113_0677481_281_667 | 127 |
| 50 | 3300053147 | Ga0500589_067596 | Ga0500589_067596_573_959 | 127 |
| 51 | iso_pu_bacteria | 2585428062 | 2587759129 | 127 |
| 52 | iso_pu_bacteria | 2588253510 | 2588292825 | 127 |
| 53 | iso_pu_bacteria | 2643221554 | 2643792672 | 127 |
| 54 | iso_pu_bacteria | 2643221592 | 2643967933 | 127 |
| 55 | iso_pu_bacteria | 2643221625 | 2644143167 | 127 |
| 56 | iso_pu_bacteria | 2643221638 | 2644212897 | 127 |
| 57 | iso_pu_bacteria | 2643221645 | 2644254845 | 127 |
| 58 | iso_pu_bacteria | 2643221648 | 2644271745 | 127 |
| 59 | iso_pu_bacteria | 2643221664 | 2644359367 | 127 |
| 60 | iso_pu_bacteria | 2738541280 | 2738738209 | 127 |
| 61 | iso_pu_bacteria | 2738541300 | 2738842985 | 127 |
| 62 | iso_pu_bacteria | 2738543018 | 2739273733 | 127 |
| 63 | iso_pu_bacteria | 2738543030 | 2739342777 | 127 |
| 64 | iso_pu_bacteria | 2808606418 | 2809145983 | 127 |
| 65 | iso_pu_bacteria | 2842711865 | 2842717449 | 127 |
| 66 | iso_pu_bacteria | 2857558681 | 2857562096 | 127 |
| 67 | iso_pu_bacteria | 2857564685 | 2857567897 | 127 |
| 68 | iso_pu_bacteria | 2904424332 | 2904427843 | 127 |
| 69 | 3300005329 | Ga0070683_101974559 | Ga0070683_1019745591 | 128 |
| 70 | 3300025944 | Ga0207661_11221163 | Ga0207661_112211631 | 128 |
| 71 | 3300050493 | nmdc:mga0k408_121455_c1 | nmdc:mga0k408_121455_c1_554_946 | 128 |
| 72 | 3300060346 | Ga0587111_0209272 | Ga0587111_0209272_67_456 | 128 |
| 73 | 3300005333 | Ga0070677_10346951 | Ga0070677_103469511 | 129 |
| 74 | 3300005334 | Ga0068869_100632189 | Ga0068869_1006321892 | 129 |
| 75 | 3300005338 | Ga0068868_100729158 | Ga0068868_1007291582 | 129 |
| 76 | 3300005353 | Ga0070669_101053963 | Ga0070669_1010539631 | 129 |
| 77 | 3300005355 | Ga0070671_101827910 | Ga0070671_1018279102 | 129 |
| 78 | 3300005356 | Ga0070674_100012364 | Ga0070674_1000123645 | 129 |
| 79 | 3300005548 | Ga0070665_100008237 | Ga0070665_10000823710 | 129 |
| 80 | 3300005578 | Ga0068854_100014961 | Ga0068854_1000149615 | 129 |
| 81 | 3300005718 | Ga0068866_10112810 | Ga0068866_101128102 | 129 |
| 82 | 3300009093 | Ga0105240_10095969 | Ga0105240_100959693 | 129 |
| 83 | 3300009551 | Ga0105238_10001082 | Ga0105238_1000108214 | 129 |
| 84 | 3300010375 | Ga0105239_10000303 | Ga0105239_1000030364 | 129 |
| 85 | 3300025913 | Ga0207695_10002990 | Ga0207695_100029908 | 129 |
| 86 | 3300025914 | Ga0207671_10027218 | Ga0207671_100272186 | 129 |
| 87 | 3300025923 | Ga0207681_11678452 | Ga0207681_116784521 | 129 |
| 88 | 3300025924 | Ga0207694_10000126 | Ga0207694_1000012666 | 129 |
| 89 | 3300025931 | Ga0207644_11450761 | Ga0207644_114507612 | 129 |
| 90 | 3300025981 | Ga0207640_10429604 | Ga0207640_104296042 | 129 |
| 91 | 3300026089 | Ga0207648_10260088 | Ga0207648_102600882 | 129 |
| 92 | 3300026116 | Ga0207674_10427609 | Ga0207674_104276093 | 129 |
| 93 | 3300032002 | Ga0307416_100699709 | Ga0307416_1006997092 | 129 |
| 94 | 3300046471 | Ga0495650_0132386 | Ga0495650_0132386_154_543 | 129 |
| 95 | 3300046522 | Ga0495643_0049434 | Ga0495643_0049434_493_882 | 129 |
| 96 | 3300046692 | Ga0495671_0029853 | Ga0495671_0029853_2011_2400 | 129 |
| 97 | 3300048913 | Ga0496110_0677317 | Ga0496110_0677317_434_823 | 129 |
| 98 | 3300048918 | Ga0496115_0439146 | Ga0496115_0439146_400_789 | 129 |
| 99 | 3300049517 | Ga0501294_013735 | Ga0501294_013735_147_536 | 129 |
| 100 | 3300049521 | Ga0501298_041219 | Ga0501298_041219_33_422 | 129 |
| 101 | 3300049524 | Ga0501301_037809 | Ga0501301_037809_61_450 | 129 |
| 102 | 3300049526 | Ga0501303_007496 | Ga0501303_007496_325_714 | 129 |
| 103 | 3300049654 | Ga0501207_024663 | Ga0501207_024663_131_520 | 129 |
| 104 | 3300049686 | Ga0501257_006221 | Ga0501257_006221_2219_2608 | 129 |
| 105 | 3300049705 | Ga0501225_0212303 | Ga0501225_0212303_47_436 | 129 |
| 106 | 3300049759 | Ga0501262_007416 | Ga0501262_007416_374_763 | 129 |
| 107 | 3300049762 | Ga0501265_000954 | Ga0501265_000954_249_638 | 129 |
| 108 | 3300002705 | JGI25156J39149_1013037 | JGI25156J39149_10130372 | 130 |
| 109 | 3300002738 | JGI25154J39366_1002162 | JGI25154J39366_10021626 | 130 |
| 110 | 3300002739 | JGI25158J39367_1017004 | JGI25158J39367_10170042 | 130 |
| 111 | 3300002741 | JGI25157J39369_1027814 | JGI25157J39369_10278141 | 130 |
| 112 | 3300002987 | JGI25159J45721_1001262 | JGI25159J45721_10012624 | 130 |
| 113 | 3300003752 | Ga0055539_1031411 | Ga0055539_10314111 | 130 |
| 114 | 3300003756 | Ga0055533_1010344 | Ga0055533_10103441 | 130 |
| 115 | 3300003762 | Ga0055542_1001394 | Ga0055542_10013948 | 130 |
| 116 | 3300003841 | Ga0055541_1001153 | Ga0055541_10011532 | 130 |
| 117 | 3300004625 | Ga0055543_1041575 | Ga0055543_10415752 | 130 |
| 118 | 3300005262 | Ga0065165_1000161 | Ga0065165_100016113 | 130 |
| 119 | 3300005577 | Ga0068857_100667216 | Ga0068857_1006672163 | 130 |
| 120 | 3300005834 | Ga0068851_10449593 | Ga0068851_104495931 | 130 |
| 121 | 3300006051 | Ga0075364_10716092 | Ga0075364_107160922 | 130 |
| 122 | 3300009545 | Ga0105237_10187801 | Ga0105237_101878014 | 130 |
| 123 | 3300009545 | Ga0105237_11097568 | Ga0105237_110975681 | 130 |
| 124 | 3300025224 | Ga0209784_100512 | Ga0209784_1005125 | 130 |
| 125 | 3300025225 | Ga0209566_100827 | Ga0209566_1008279 | 130 |
| 126 | 3300025226 | Ga0209674_100098 | Ga0209674_10009859 | 130 |
| 127 | 3300025230 | Ga0209563_102484 | Ga0209563_1024843 | 130 |
| 128 | 3300025246 | Ga0209646_1000082 | Ga0209646_1000082115 | 130 |
| 129 | 3300025250 | Ga0209026_1002611 | Ga0209026_10026116 | 130 |
| 130 | 3300025253 | Ga0209677_101552 | Ga0209677_1015523 | 130 |
| 131 | 3300025254 | Ga0209148_1000190 | Ga0209148_100019047 | 130 |
| 132 | 3300025256 | Ga0209759_1011309 | Ga0209759_10113092 | 130 |
| 133 | 3300025284 | Ga0209130_1000175 | Ga0209130_100017513 | 130 |
| 134 | 3300025302 | Ga0207426_1028162 | Ga0207426_10281622 | 130 |
| 135 | 3300025321 | Ga0207656_10036623 | Ga0207656_100366231 | 130 |
| 136 | 3300025914 | Ga0207671_10185309 | Ga0207671_101853094 | 130 |
| 137 | 3300025914 | Ga0207671_11160125 | Ga0207671_111601252 | 130 |
| 138 | 3300025949 | Ga0207667_10000044 | Ga0207667_1000004450 | 130 |
| 139 | 3300031616 | Ga0307508_10243361 | Ga0307508_102433612 | 130 |
| 140 | 3300031649 | Ga0307514_10000369 | Ga0307514_100003695 | 130 |
| 141 | 3300037418 | Ga0395900_0016334 | Ga0395900_0016334_6893_7285 | 130 |
| 142 | 3300037471 | Ga0395905_0027659 | Ga0395905_0027659_3890_4282 | 130 |
| 143 | 3300037471 | Ga0395905_0835546 | Ga0395905_0835546_315_707 | 130 |
| 144 | 3300039447 | Ga0436361_0446649 | Ga0436361_0446649_326_718 | 130 |
| 145 | 3300042005 | Ga0439448_0235285 | Ga0439448_0235285_43_435 | 130 |
| 146 | 3300042876 | Ga0451577_0080821 | Ga0451577_0080821_1339_1731 | 130 |
| 147 | 3300044656 | Ga0466969_0000018 | Ga0466969_0000018_66577_66969 | 130 |
| 148 | 3300044656 | Ga0466969_0029967 | Ga0466969_0029967_281_673 | 130 |
| 149 | 3300044656 | Ga0466969_0062955 | Ga0466969_0062955_972_1364 | 130 |
| 150 | 3300044683 | Ga0466965_0144568 | Ga0466965_0144568_376_768 | 130 |
| 151 | 3300044683 | Ga0466965_0175665 | Ga0466965_0175665_319_711 | 130 |
| 152 | 3300044684 | Ga0466966_0001081 | Ga0466966_0001081_15852_16244 | 130 |
| 153 | 3300044684 | Ga0466966_0043326 | Ga0466966_0043326_1209_1601 | 130 |
| 154 | 3300044693 | Ga0466961_0012706 | Ga0466961_0012706_1315_1707 | 130 |
| 155 | 3300044693 | Ga0466961_0031470 | Ga0466961_0031470_1731_2123 | 130 |
| 156 | 3300044694 | Ga0466963_0030051 | Ga0466963_0030051_2139_2531 | 130 |
| 157 | 3300044706 | Ga0466964_0016862 | Ga0466964_0016862_1803_2195 | 130 |
| 158 | 3300044706 | Ga0466964_0253732 | Ga0466964_0253732_247_639 | 130 |
| 159 | 3300044719 | Ga0466971_0017750 | Ga0466971_0017750_2014_2406 | 130 |
| 160 | 3300044719 | Ga0466971_0018485 | Ga0466971_0018485_1853_2245 | 130 |
| 161 | 3300044735 | Ga0466968_0068501 | Ga0466968_0068501_209_601 | 130 |
| 162 | 3300044765 | Ga0466970_0034391 | Ga0466970_0034391_1308_1700 | 130 |
| 163 | 3300044765 | Ga0466970_0253802 | Ga0466970_0253802_319_711 | 130 |
| 164 | 3300044842 | Ga0466957_0107420 | Ga0466957_0107420_1289_1681 | 130 |
| 165 | 3300045049 | Ga0466959_0000632 | Ga0466959_0000632_8066_8458 | 130 |
| 166 | 3300045049 | Ga0466959_0022006 | Ga0466959_0022006_176_568 | 130 |
| 167 | 3300045049 | Ga0466959_0051638 | Ga0466959_0051638_555_947 | 130 |
| 168 | 3300045049 | Ga0466959_0216219 | Ga0466959_0216219_554_946 | 130 |
| 169 | 3300045051 | Ga0451576_0132583 | Ga0451576_0132583_1061_1453 | 130 |
| 170 | 3300045836 | Ga0466958_0021542 | Ga0466958_0021542_2197_2589 | 130 |
| 171 | 3300045976 | Ga0466967_0164017 | Ga0466967_0164017_11_403 | 130 |
| 172 | 3300046463 | Ga0495653_0064314 | Ga0495653_0064314_969_1364 | 130 |
| 173 | 3300046472 | Ga0495580_0012124 | Ga0495580_0012124_4924_5316 | 130 |
| 174 | 3300046473 | Ga0495582_0005956 | Ga0495582_0005956_1722_2114 | 130 |
| 175 | 3300046474 | Ga0495605_0240955 | Ga0495605_0240955_97_489 | 130 |
| 176 | 3300046477 | Ga0495664_0539629 | Ga0495664_0539629_281_673 | 130 |
| 177 | 3300046492 | Ga0495585_0035388 | Ga0495585_0035388_2338_2730 | 130 |
| 178 | 3300046492 | Ga0495585_0178082 | Ga0495585_0178082_93_488 | 130 |
| 179 | 3300046499 | Ga0495594_0040406 | Ga0495594_0040406_742_1137 | 130 |
| 180 | 3300046499 | Ga0495594_0246222 | Ga0495594_0246222_219_611 | 130 |
| 181 | 3300046507 | Ga0495606_0007181 | Ga0495606_0007181_1154_1546 | 130 |
| 182 | 3300046516 | Ga0495628_0326947 | Ga0495628_0326947_703_1095 | 130 |
| 183 | 3300046517 | Ga0495630_0007235 | Ga0495630_0007235_7421_7813 | 130 |
| 184 | 3300046517 | Ga0495630_0180401 | Ga0495630_0180401_987_1382 | 130 |
| 185 | 3300046525 | Ga0495663_0147630 | Ga0495663_0147630_332_724 | 130 |
| 186 | 3300046526 | Ga0495666_0003104 | Ga0495666_0003104_5516_5908 | 130 |
| 187 | 3300046528 | Ga0495642_0030446 | Ga0495642_0030446_921_1313 | 130 |
| 188 | 3300046528 | Ga0495642_0045118 | Ga0495642_0045118_898_1290 | 130 |
| 189 | 3300046529 | Ga0495652_0005509 | Ga0495652_0005509_497_889 | 130 |
| 190 | 3300046531 | Ga0495665_0006428 | Ga0495665_0006428_3984_4376 | 130 |
| 191 | 3300046535 | Ga0495586_0265468 | Ga0495586_0265468_91_483 | 130 |
| 192 | 3300046536 | Ga0495587_0436849 | Ga0495587_0436849_164_556 | 130 |
| 193 | 3300046542 | Ga0495597_0010859 | Ga0495597_0010859_2750_3145 | 130 |
| 194 | 3300046542 | Ga0495597_0027736 | Ga0495597_0027736_998_1390 | 130 |
| 195 | 3300046542 | Ga0495597_0039449 | Ga0495597_0039449_309_704 | 130 |
| 196 | 3300046558 | Ga0495633_0037642 | Ga0495633_0037642_1588_1983 | 130 |
| 197 | 3300046558 | Ga0495633_0190268 | Ga0495633_0190268_276_668 | 130 |
| 198 | 3300046615 | Ga0495656_0367995 | Ga0495656_0367995_191_583 | 130 |
| 199 | 3300046616 | Ga0495668_0000029 | Ga0495668_0000029_12562_12954 | 130 |
| 200 | 3300046616 | Ga0495668_0031839 | Ga0495668_0031839_2388_2780 | 130 |
| 201 | 3300046616 | Ga0495668_0453923 | Ga0495668_0453923_279_671 | 130 |
| 202 | 3300046642 | Ga0495634_0001509 | Ga0495634_0001509_1492_1884 | 130 |
| 203 | 3300046648 | Ga0495611_0001926 | Ga0495611_0001926_9199_9594 | 130 |
| 204 | 3300046663 | Ga0495635_0356568 | Ga0495635_0356568_503_895 | 130 |
| 205 | 3300046665 | Ga0495661_0489643 | Ga0495661_0489643_103_495 | 130 |
| 206 | 3300046674 | Ga0495588_0026542 | Ga0495588_0026542_2121_2513 | 130 |
| 207 | 3300046679 | Ga0495623_0347767 | Ga0495623_0347767_379_771 | 130 |
| 208 | 3300046679 | Ga0495623_0631909 | Ga0495623_0631909_124_516 | 130 |
| 209 | 3300046684 | Ga0495669_0339888 | Ga0495669_0339888_273_665 | 130 |
| 210 | 3300046689 | Ga0495613_0023417 | Ga0495613_0023417_909_1304 | 130 |
| 211 | 3300046809 | Ga0495600_0021038 | Ga0495600_0021038_3180_3572 | 130 |
| 212 | 3300047317 | Ga0495604_0019809 | Ga0495604_0019809_1805_2197 | 130 |
| 213 | 3300047444 | Ga0495675_0194612 | Ga0495675_0194612_307_699 | 130 |
| 214 | 3300047445 | Ga0495677_0207366 | Ga0495677_0207366_251_646 | 130 |
| 215 | 3300047445 | Ga0495677_0237942 | Ga0495677_0237942_129_521 | 130 |
| 216 | 3300047472 | Ga0495686_0000790 | Ga0495686_0000790_3339_3731 | 130 |
| 217 | 3300048088 | Ga0495602_0014183 | Ga0495602_0014183_3111_3503 | 130 |
| 218 | 3300048091 | Ga0495626_0000043 | Ga0495626_0000043_159858_160250 | 130 |
| 219 | 3300048918 | Ga0496115_0089065 | Ga0496115_0089065_478_873 | 130 |
| 220 | 3300048918 | Ga0496115_0153307 | Ga0496115_0153307_1423_1818 | 130 |
| 221 | 3300061719 | Ga0466962_0035106 | Ga0466962_0035106_1706_2098 | 130 |
| 222 | 3300061719 | Ga0466962_0085003 | Ga0466962_0085003_280_672 | 130 |
| 223 | 3300001979 | JGI24740J21852_10004822 | JGI24740J21852_100048222 | 131 |
| 224 | 3300002705 | JGI25156J39149_1000273 | JGI25156J39149_100027316 | 131 |
| 225 | 3300002738 | JGI25154J39366_1002357 | JGI25154J39366_10023574 | 131 |
| 226 | 3300002739 | JGI25158J39367_1005137 | JGI25158J39367_10051372 | 131 |
| 227 | 3300002741 | JGI25157J39369_1000141 | JGI25157J39369_100014116 | 131 |
| 228 | 3300002772 | JGI25164J39214_1003350 | JGI25164J39214_10033502 | 131 |
| 229 | 3300002774 | JGI25150J39212_1005651 | JGI25150J39212_10056512 | 131 |
| 230 | 3300002987 | JGI25159J45721_1010443 | JGI25159J45721_10104432 | 131 |
| 231 | 3300002987 | JGI25159J45721_1028315 | JGI25159J45721_10283152 | 131 |
| 232 | 3300003215 | JGI25153J46596_10004468 | JGI25153J46596_100044687 | 131 |
| 233 | 3300003316 | rootH1_10009326 | rootH1_100093262 | 131 |
| 234 | 3300003316 | rootH1_10023151 | rootH1_100231512 | 131 |
| 235 | 3300003316 | rootH1_10035022 | rootH1_100350222 | 131 |
| 236 | 3300003316 | rootH1_10059043 | rootH1_100590432 | 131 |
| 237 | 3300003320 | rootH2_10067644 | rootH2_100676443 | 131 |
| 238 | 3300003322 | rootL2_10028173 | rootL2_100281732 | 131 |
| 239 | 3300003323 | rootH1_10044102 | rootH1_100441022 | 131 |
| 240 | 3300003323 | rootH1_10044115 | rootH1_100441153 | 131 |
| 241 | 3300003323 | rootH1_10061481 | rootH1_100614812 | 131 |
| 242 | 3300003354 | JGI25160J50197_1014774 | JGI25160J50197_10147742 | 131 |
| 243 | 3300003374 | JGI25161J50226_1000863 | JGI25161J50226_10008633 | 131 |
| 244 | 3300003374 | JGI25161J50226_1007369 | JGI25161J50226_10073692 | 131 |
| 245 | 3300003752 | Ga0055539_1000219 | Ga0055539_100021925 | 131 |
| 246 | 3300003752 | Ga0055539_1001852 | Ga0055539_10018524 | 131 |
| 247 | 3300003756 | Ga0055533_1000008 | Ga0055533_1000008167 | 131 |
| 248 | 3300003759 | Ga0055525_1000786 | Ga0055525_10007862 | 131 |
| 249 | 3300003771 | Ga0055526_1000030 | Ga0055526_1000030124 | 131 |
| 250 | 3300003771 | Ga0055526_1000530 | Ga0055526_100053018 | 131 |
| 251 | 3300003771 | Ga0055526_1005310 | Ga0055526_10053102 | 131 |
| 252 | 3300003771 | Ga0055526_1007526 | Ga0055526_10075263 | 131 |
| 253 | 3300003771 | Ga0055526_1086230 | Ga0055526_10862301 | 131 |
| 254 | 3300003773 | Ga0055537_1000352 | Ga0055537_10003529 | 131 |
| 255 | 3300003773 | Ga0055537_1000446 | Ga0055537_10004462 | 131 |
| 256 | 3300003775 | Ga0055524_1000140 | Ga0055524_100014071 | 131 |
| 257 | 3300003775 | Ga0055524_1000304 | Ga0055524_100030414 | 131 |
| 258 | 3300003775 | Ga0055524_1001384 | Ga0055524_10013842 | 131 |
| 259 | 3300003784 | Ga0055534_1000454 | Ga0055534_10004544 | 131 |
| 260 | 3300003784 | Ga0055534_1003949 | Ga0055534_10039494 | 131 |
| 261 | 3300003790 | Ga0055528_1000059 | Ga0055528_100005966 | 131 |
| 262 | 3300003790 | Ga0055528_1015918 | Ga0055528_10159182 | 131 |
| 263 | 3300003791 | Ga0055530_10009065 | Ga0055530_100090652 | 131 |
| 264 | 3300003791 | Ga0055530_10034530 | Ga0055530_100345302 | 131 |
| 265 | 3300003791 | Ga0055530_10054163 | Ga0055530_100541632 | 131 |
| 266 | 3300003792 | Ga0055540_1000133 | Ga0055540_100013359 | 131 |
| 267 | 3300003792 | Ga0055540_1000280 | Ga0055540_100028045 | 131 |
| 268 | 3300003794 | Ga0055531_10007365 | Ga0055531_100073654 | 131 |
| 269 | 3300004625 | Ga0055543_1019746 | Ga0055543_10197462 | 131 |
| 270 | 3300005262 | Ga0065165_1001544 | Ga0065165_100154418 | 131 |
| 271 | 3300005262 | Ga0065165_1057916 | Ga0065165_10579162 | 131 |
| 272 | 3300005262 | Ga0065165_1071099 | Ga0065165_10710992 | 131 |
| 273 | 3300005293 | Ga0065715_10022803 | Ga0065715_100228033 | 131 |
| 274 | 3300005327 | Ga0070658_10647796 | Ga0070658_106477962 | 131 |
| 275 | 3300005328 | Ga0070676_10076477 | Ga0070676_100764773 | 131 |
| 276 | 3300005329 | Ga0070683_101642099 | Ga0070683_1016420991 | 131 |
| 277 | 3300005330 | Ga0070690_100022858 | Ga0070690_1000228583 | 131 |
| 278 | 3300005334 | Ga0068869_100023504 | Ga0068869_1000235042 | 131 |
| 279 | 3300005336 | Ga0070680_101114718 | Ga0070680_1011147182 | 131 |
| 280 | 3300005339 | Ga0070660_100868976 | Ga0070660_1008689762 | 131 |
| 281 | 3300005344 | Ga0070661_100003569 | Ga0070661_10000356910 | 131 |
| 282 | 3300005355 | Ga0070671_100650311 | Ga0070671_1006503112 | 131 |
| 283 | 3300005356 | Ga0070674_100202757 | Ga0070674_1002027572 | 131 |
| 284 | 3300005356 | Ga0070674_100751799 | Ga0070674_1007517992 | 131 |
| 285 | 3300005366 | Ga0070659_100003315 | Ga0070659_1000033153 | 131 |
| 286 | 3300005366 | Ga0070659_100186471 | Ga0070659_1001864712 | 131 |
| 287 | 3300005367 | Ga0070667_100365329 | Ga0070667_1003653292 | 131 |
| 288 | 3300005455 | Ga0070663_100001739 | Ga0070663_1000017399 | 131 |
| 289 | 3300005455 | Ga0070663_100449539 | Ga0070663_1004495392 | 131 |
| 290 | 3300005455 | Ga0070663_101555659 | Ga0070663_1015556591 | 131 |
| 291 | 3300005457 | Ga0070662_100421026 | Ga0070662_1004210262 | 131 |
| 292 | 3300005457 | Ga0070662_101132263 | Ga0070662_1011322631 | 131 |
| 293 | 3300005459 | Ga0068867_100000245 | Ga0068867_10000024517 | 131 |
| 294 | 3300005459 | Ga0068867_100565967 | Ga0068867_1005659672 | 131 |
| 295 | 3300005459 | Ga0068867_100793706 | Ga0068867_1007937062 | 131 |
| 296 | 3300005518 | Ga0070699_100651170 | Ga0070699_1006511702 | 131 |
| 297 | 3300005544 | Ga0070686_100272213 | Ga0070686_1002722132 | 131 |
| 298 | 3300005548 | Ga0070665_100912531 | Ga0070665_1009125312 | 131 |
| 299 | 3300005563 | Ga0068855_100012249 | Ga0068855_1000122495 | 131 |
| 300 | 3300005563 | Ga0068855_100448950 | Ga0068855_1004489502 | 131 |
| 301 | 3300005564 | Ga0070664_100031413 | Ga0070664_1000314133 | 131 |
| 302 | 3300005564 | Ga0070664_100090576 | Ga0070664_1000905763 | 131 |
| 303 | 3300005564 | Ga0070664_100127696 | Ga0070664_1001276963 | 131 |
| 304 | 3300005577 | Ga0068857_100004434 | Ga0068857_1000044342 | 131 |
| 305 | 3300005578 | Ga0068854_100199890 | Ga0068854_1001998903 | 131 |
| 306 | 3300005578 | Ga0068854_100584124 | Ga0068854_1005841242 | 131 |
| 307 | 3300005614 | Ga0068856_100000135 | Ga0068856_10000013548 | 131 |
| 308 | 3300005616 | Ga0068852_100788054 | Ga0068852_1007880542 | 131 |
| 309 | 3300005616 | Ga0068852_101174060 | Ga0068852_1011740601 | 131 |
| 310 | 3300005616 | Ga0068852_101738163 | Ga0068852_1017381632 | 131 |
| 311 | 3300005616 | Ga0068852_102461952 | Ga0068852_1024619521 | 131 |
| 312 | 3300005718 | Ga0068866_10242759 | Ga0068866_102427592 | 131 |
| 313 | 3300005843 | Ga0068860_101630392 | Ga0068860_1016303922 | 131 |
| 314 | 3300006028 | Ga0070717_11830976 | Ga0070717_118309762 | 131 |
| 315 | 3300006042 | Ga0075368_10340535 | Ga0075368_103405352 | 131 |
| 316 | 3300006177 | Ga0075362_10096834 | Ga0075362_100968342 | 131 |
| 317 | 3300006177 | Ga0075362_10108318 | Ga0075362_101083182 | 131 |
| 318 | 3300006178 | Ga0075367_10029166 | Ga0075367_100291662 | 131 |
| 319 | 3300006178 | Ga0075367_10089911 | Ga0075367_100899112 | 131 |
| 320 | 3300006195 | Ga0075366_10048533 | Ga0075366_100485333 | 131 |
| 321 | 3300006195 | Ga0075366_10138544 | Ga0075366_101385442 | 131 |
| 322 | 3300006195 | Ga0075366_10365870 | Ga0075366_103658702 | 131 |
| 323 | 3300006195 | Ga0075366_10731970 | Ga0075366_107319702 | 131 |
| 324 | 3300006237 | Ga0097621_100507689 | Ga0097621_1005076892 | 131 |
| 325 | 3300006353 | Ga0075370_10035840 | Ga0075370_100358403 | 131 |
| 326 | 3300006353 | Ga0075370_10152081 | Ga0075370_101520813 | 131 |
| 327 | 3300006881 | Ga0068865_100351186 | Ga0068865_1003511862 | 131 |
| 328 | 3300006946 | Ga0079104_1000053 | Ga0079104_100005373 | 131 |
| 329 | 3300006948 | Ga0099826_10000033 | Ga0099826_1000003315 | 131 |
| 330 | 3300009036 | Ga0105244_10000853 | Ga0105244_1000085310 | 131 |
| 331 | 3300009093 | Ga0105240_11799056 | Ga0105240_117990561 | 131 |
| 332 | 3300009101 | Ga0105247_10867759 | Ga0105247_108677591 | 131 |
| 333 | 3300009147 | Ga0114129_10738875 | Ga0114129_107388752 | 131 |
| 334 | 3300009148 | Ga0105243_10056545 | Ga0105243_100565453 | 131 |
| 335 | 3300009174 | Ga0105241_10066961 | Ga0105241_100669614 | 131 |
| 336 | 3300009176 | Ga0105242_10193009 | Ga0105242_101930092 | 131 |
| 337 | 3300009176 | Ga0105242_10683781 | Ga0105242_106837812 | 131 |
| 338 | 3300009177 | Ga0105248_10724831 | Ga0105248_107248312 | 131 |
| 339 | 3300009177 | Ga0105248_11106216 | Ga0105248_111062162 | 131 |
| 340 | 3300009177 | Ga0105248_11642312 | Ga0105248_116423122 | 131 |
| 341 | 3300009545 | Ga0105237_10423025 | Ga0105237_104230252 | 131 |
| 342 | 3300009553 | Ga0105249_10341264 | Ga0105249_103412642 | 131 |
| 343 | 3300010375 | Ga0105239_10072363 | Ga0105239_100723634 | 131 |
| 344 | 3300010375 | Ga0105239_10830340 | Ga0105239_108303402 | 131 |
| 345 | 3300010375 | Ga0105239_13514734 | Ga0105239_135147341 | 131 |
| 346 | 3300012503 | Ga0157313_1023714 | Ga0157313_10237142 | 131 |
| 347 | 3300013105 | Ga0157369_10331339 | Ga0157369_103313392 | 131 |
| 348 | 3300013296 | Ga0157374_10017239 | Ga0157374_100172395 | 131 |
| 349 | 3300013297 | Ga0157378_10058726 | Ga0157378_100587262 | 131 |
| 350 | 3300013306 | Ga0163162_11288023 | Ga0163162_112880232 | 131 |
| 351 | 3300013307 | Ga0157372_10346002 | Ga0157372_103460022 | 131 |
| 352 | 3300013308 | Ga0157375_11035515 | Ga0157375_110355151 | 131 |
| 353 | 3300013308 | Ga0157375_12111675 | Ga0157375_121116752 | 131 |
| 354 | 3300014326 | Ga0157380_10168190 | Ga0157380_101681902 | 131 |
| 355 | 3300014497 | Ga0182008_10010463 | Ga0182008_100104635 | 131 |
| 356 | 3300014745 | Ga0157377_10000034 | Ga0157377_1000003420 | 131 |
| 357 | 3300014968 | Ga0157379_10055804 | Ga0157379_100558044 | 131 |
| 358 | 3300015261 | Ga0182006_1019835 | Ga0182006_10198352 | 131 |
| 359 | 3300015262 | Ga0182007_10074214 | Ga0182007_100742142 | 131 |
| 360 | 3300017792 | Ga0163161_11103356 | Ga0163161_111033562 | 131 |
| 361 | 3300017792 | Ga0163161_11221296 | Ga0163161_112212962 | 131 |
| 362 | 3300021361 | Ga0213872_10100278 | Ga0213872_101002782 | 131 |
| 363 | 3300025208 | Ga0209436_102824 | Ga0209436_1028242 | 131 |
| 364 | 3300025208 | Ga0209436_103498 | Ga0209436_1034982 | 131 |
| 365 | 3300025226 | Ga0209674_100015 | Ga0209674_100015497 | 131 |
| 366 | 3300025230 | Ga0209563_100017 | Ga0209563_100017594 | 131 |
| 367 | 3300025231 | Ga0207427_101011 | Ga0207427_1010118 | 131 |
| 368 | 3300025242 | Ga0209258_100726 | Ga0209258_10072618 | 131 |
| 369 | 3300025245 | Ga0207425_1000009 | Ga0207425_1000009571 | 131 |
| 370 | 3300025245 | Ga0207425_1000408 | Ga0207425_100040810 | 131 |
| 371 | 3300025245 | Ga0207425_1001300 | Ga0207425_10013009 | 131 |
| 372 | 3300025246 | Ga0209646_1000229 | Ga0209646_10002293 | 131 |
| 373 | 3300025246 | Ga0209646_1000613 | Ga0209646_10006134 | 131 |
| 374 | 3300025250 | Ga0209026_1000028 | Ga0209026_1000028101 | 131 |
| 375 | 3300025253 | Ga0209677_100037 | Ga0209677_10003794 | 131 |
| 376 | 3300025253 | Ga0209677_100113 | Ga0209677_10011342 | 131 |
| 377 | 3300025256 | Ga0209759_1000021 | Ga0209759_1000021185 | 131 |
| 378 | 3300025256 | Ga0209759_1005745 | Ga0209759_10057453 | 131 |
| 379 | 3300025256 | Ga0209759_1013572 | Ga0209759_10135723 | 131 |
| 380 | 3300025258 | Ga0209129_1000061 | Ga0209129_1000061217 | 131 |
| 381 | 3300025258 | Ga0209129_1008102 | Ga0209129_10081025 | 131 |
| 382 | 3300025263 | Ga0209565_1000184 | Ga0209565_100018445 | 131 |
| 383 | 3300025263 | Ga0209565_1000684 | Ga0209565_10006845 | 131 |
| 384 | 3300025263 | Ga0209565_1000730 | Ga0209565_100073010 | 131 |
| 385 | 3300025263 | Ga0209565_1039075 | Ga0209565_10390752 | 131 |
| 386 | 3300025273 | Ga0209673_1000029 | Ga0209673_100002912 | 131 |
| 387 | 3300025273 | Ga0209673_1005549 | Ga0209673_10055496 | 131 |
| 388 | 3300025273 | Ga0209673_1010062 | Ga0209673_10100623 | 131 |
| 389 | 3300025284 | Ga0209130_1004816 | Ga0209130_10048162 | 131 |
| 390 | 3300025284 | Ga0209130_1011650 | Ga0209130_10116503 | 131 |
| 391 | 3300025291 | Ga0209675_1000019 | Ga0209675_1000019331 | 131 |
| 392 | 3300025291 | Ga0209675_1001539 | Ga0209675_10015392 | 131 |
| 393 | 3300025291 | Ga0209675_1004599 | Ga0209675_10045994 | 131 |
| 394 | 3300025294 | Ga0209025_1001479 | Ga0209025_10014796 | 131 |
| 395 | 3300025295 | Ga0209564_1000010 | Ga0209564_100001013 | 131 |
| 396 | 3300025295 | Ga0209564_1000315 | Ga0209564_100031590 | 131 |
| 397 | 3300025295 | Ga0209564_1000635 | Ga0209564_100063534 | 131 |
| 398 | 3300025295 | Ga0209564_1000889 | Ga0209564_10008898 | 131 |
| 399 | 3300025295 | Ga0209564_1020345 | Ga0209564_10203452 | 131 |
| 400 | 3300025295 | Ga0209564_1028784 | Ga0209564_10287843 | 131 |
| 401 | 3300025297 | Ga0209758_1000101 | Ga0209758_100010113 | 131 |
| 402 | 3300025297 | Ga0209758_1003320 | Ga0209758_10033208 | 131 |
| 403 | 3300025298 | Ga0209050_1000223 | Ga0209050_100022326 | 131 |
| 404 | 3300025298 | Ga0209050_1000805 | Ga0209050_100080524 | 131 |
| 405 | 3300025298 | Ga0209050_1000863 | Ga0209050_10008632 | 131 |
| 406 | 3300025298 | Ga0209050_1000996 | Ga0209050_100099614 | 131 |
| 407 | 3300025299 | Ga0209256_1000018 | Ga0209256_1000018525 | 131 |
| 408 | 3300025299 | Ga0209256_1000045 | Ga0209256_1000045178 | 131 |
| 409 | 3300025299 | Ga0209256_1000944 | Ga0209256_100094412 | 131 |
| 410 | 3300025299 | Ga0209256_1001504 | Ga0209256_10015049 | 131 |
| 411 | 3300025299 | Ga0209256_1002911 | Ga0209256_10029115 | 131 |
| 412 | 3300025299 | Ga0209256_1031413 | Ga0209256_10314133 | 131 |
| 413 | 3300025302 | Ga0207426_1002734 | Ga0207426_10027343 | 131 |
| 414 | 3300025303 | Ga0209051_1000004 | Ga0209051_10000041026 | 131 |
| 415 | 3300025303 | Ga0209051_1005569 | Ga0209051_10055697 | 131 |
| 416 | 3300025303 | Ga0209051_1006384 | Ga0209051_10063844 | 131 |
| 417 | 3300025303 | Ga0209051_1046307 | Ga0209051_10463072 | 131 |
| 418 | 3300025303 | Ga0209051_1096538 | Ga0209051_10965382 | 131 |
| 419 | 3300025304 | Ga0209257_1000315 | Ga0209257_100031547 | 131 |
| 420 | 3300025304 | Ga0209257_1000556 | Ga0209257_10005569 | 131 |
| 421 | 3300025304 | Ga0209257_1001266 | Ga0209257_100126619 | 131 |
| 422 | 3300025304 | Ga0209257_1040930 | Ga0209257_10409302 | 131 |
| 423 | 3300025728 | Ga0207655_1011085 | Ga0207655_10110855 | 131 |
| 424 | 3300025899 | Ga0207642_10385191 | Ga0207642_103851912 | 131 |
| 425 | 3300025907 | Ga0207645_10080044 | Ga0207645_100800442 | 131 |
| 426 | 3300025913 | Ga0207695_10047967 | Ga0207695_100479673 | 131 |
| 427 | 3300025914 | Ga0207671_10817493 | Ga0207671_108174931 | 131 |
| 428 | 3300025916 | Ga0207663_10560511 | Ga0207663_105605112 | 131 |
| 429 | 3300025917 | Ga0207660_10527724 | Ga0207660_105277242 | 131 |
| 430 | 3300025919 | Ga0207657_10045803 | Ga0207657_100458034 | 131 |
| 431 | 3300025919 | Ga0207657_10700128 | Ga0207657_107001282 | 131 |
| 432 | 3300025920 | Ga0207649_10001730 | Ga0207649_100017307 | 131 |
| 433 | 3300025924 | Ga0207694_10254309 | Ga0207694_102543091 | 131 |
| 434 | 3300025927 | Ga0207687_10245896 | Ga0207687_102458962 | 131 |
| 435 | 3300025932 | Ga0207690_10008290 | Ga0207690_100082908 | 131 |
| 436 | 3300025933 | Ga0207706_10314233 | Ga0207706_103142333 | 131 |
| 437 | 3300025933 | Ga0207706_10911513 | Ga0207706_109115131 | 131 |
| 438 | 3300025934 | Ga0207686_10246915 | Ga0207686_102469152 | 131 |
| 439 | 3300025934 | Ga0207686_10412081 | Ga0207686_104120812 | 131 |
| 440 | 3300025935 | Ga0207709_10000838 | Ga0207709_100008385 | 131 |
| 441 | 3300025935 | Ga0207709_10065576 | Ga0207709_100655762 | 131 |
| 442 | 3300025935 | Ga0207709_11166778 | Ga0207709_111667781 | 131 |
| 443 | 3300025937 | Ga0207669_10037240 | Ga0207669_100372403 | 131 |
| 444 | 3300025937 | Ga0207669_10218569 | Ga0207669_102185691 | 131 |
| 445 | 3300025937 | Ga0207669_11194253 | Ga0207669_111942532 | 131 |
| 446 | 3300025938 | Ga0207704_11201993 | Ga0207704_112019931 | 131 |
| 447 | 3300025941 | Ga0207711_10905668 | Ga0207711_109056682 | 131 |
| 448 | 3300025941 | Ga0207711_11712024 | Ga0207711_117120242 | 131 |
| 449 | 3300025942 | Ga0207689_10030365 | Ga0207689_100303657 | 131 |
| 450 | 3300025945 | Ga0207679_10000077 | Ga0207679_1000007736 | 131 |
| 451 | 3300025945 | Ga0207679_10095553 | Ga0207679_100955532 | 131 |
| 452 | 3300025945 | Ga0207679_10677720 | Ga0207679_106777203 | 131 |
| 453 | 3300025949 | Ga0207667_10003517 | Ga0207667_100035172 | 131 |
| 454 | 3300025949 | Ga0207667_10991572 | Ga0207667_109915722 | 131 |
| 455 | 3300025961 | Ga0207712_10418216 | Ga0207712_104182162 | 131 |
| 456 | 3300025972 | Ga0207668_11186443 | Ga0207668_111864432 | 131 |
| 457 | 3300025981 | Ga0207640_10185792 | Ga0207640_101857923 | 131 |
| 458 | 3300025981 | Ga0207640_10953415 | Ga0207640_109534152 | 131 |
| 459 | 3300025981 | Ga0207640_11104250 | Ga0207640_111042502 | 131 |
| 460 | 3300025986 | Ga0207658_10447842 | Ga0207658_104478422 | 131 |
| 461 | 3300026035 | Ga0207703_11240056 | Ga0207703_112400561 | 131 |
| 462 | 3300026067 | Ga0207678_10003990 | Ga0207678_1000399010 | 131 |
| 463 | 3300026067 | Ga0207678_10185435 | Ga0207678_101854352 | 131 |
| 464 | 3300026078 | Ga0207702_10001523 | Ga0207702_100015231 | 131 |
| 465 | 3300026088 | Ga0207641_10584012 | Ga0207641_105840122 | 131 |
| 466 | 3300026089 | Ga0207648_10000054 | Ga0207648_1000005414 | 131 |
| 467 | 3300026089 | Ga0207648_10065351 | Ga0207648_100653511 | 131 |
| 468 | 3300026116 | Ga0207674_10032801 | Ga0207674_100328016 | 131 |
| 469 | 3300026116 | Ga0207674_10443650 | Ga0207674_104436502 | 131 |
| 470 | 3300026118 | Ga0207675_100008767 | Ga0207675_10000876710 | 131 |
| 471 | 3300026118 | Ga0207675_101631286 | Ga0207675_1016312861 | 131 |
| 472 | 3300026121 | Ga0207683_10113650 | Ga0207683_101136503 | 131 |
| 473 | 3300026142 | Ga0207698_10051544 | Ga0207698_100515442 | 131 |
| 474 | 3300026142 | Ga0207698_10289205 | Ga0207698_102892052 | 131 |
| 475 | 3300026142 | Ga0207698_10638661 | Ga0207698_106386611 | 131 |
| 476 | 3300027111 | Ga0209281_1000147 | Ga0209281_100014773 | 131 |
| 477 | 3300027666 | Ga0209282_1000014 | Ga0209282_1000014104 | 131 |
| 478 | 3300027682 | Ga0209971_1036579 | Ga0209971_10365792 | 131 |
| 479 | 3300027866 | Ga0209813_10281771 | Ga0209813_102817712 | 131 |
| 480 | 3300027876 | Ga0209974_10011530 | Ga0209974_100115304 | 131 |
| 481 | 3300028381 | Ga0268264_11229288 | Ga0268264_112292882 | 131 |
| 482 | 3300028786 | Ga0307517_10259012 | Ga0307517_102590122 | 131 |
| 483 | 3300028794 | Ga0307515_10000089 | Ga0307515_1000008920 | 131 |
| 484 | 3300028794 | Ga0307515_10000096 | Ga0307515_1000009675 | 131 |
| 485 | 3300028794 | Ga0307515_10000139 | Ga0307515_10000139145 | 131 |
| 486 | 3300028794 | Ga0307515_10004133 | Ga0307515_1000413328 | 131 |
| 487 | 3300028794 | Ga0307515_10007786 | Ga0307515_100077864 | 131 |
| 488 | 3300028794 | Ga0307515_10249686 | Ga0307515_102496861 | 131 |
| 489 | 3300028794 | Ga0307515_10349371 | Ga0307515_103493712 | 131 |
| 490 | 3300028794 | Ga0307515_10735133 | Ga0307515_107351332 | 131 |
| 491 | 3300030521 | Ga0307511_10084567 | Ga0307511_100845672 | 131 |
| 492 | 3300030522 | Ga0307512_10029829 | Ga0307512_100298295 | 131 |
| 493 | 3300030522 | Ga0307512_10167904 | Ga0307512_101679042 | 131 |
| 494 | 3300030735 | Ga0316178_1120510 | Ga0316178_11205101 | 131 |
| 495 | 3300030735 | Ga0316178_1168385 | Ga0316178_11683852 | 131 |
| 496 | 3300030736 | Ga0316180_1011172 | Ga0316180_10111724 | 131 |
| 497 | 3300030744 | Ga0316181_1058384 | Ga0316181_10583842 | 131 |
| 498 | 3300030744 | Ga0316181_1092164 | Ga0316181_10921642 | 131 |
| 499 | 3300030745 | Ga0316182_1205408 | Ga0316182_12054083 | 131 |
| 500 | 3300030745 | Ga0316182_1300998 | Ga0316182_13009982 | 131 |
| 501 | 3300030745 | Ga0316182_1307621 | Ga0316182_13076212 | 131 |
| 502 | 3300031456 | Ga0307513_10004973 | Ga0307513_100049732 | 131 |
| 503 | 3300031456 | Ga0307513_10550034 | Ga0307513_105500342 | 131 |
| 504 | 3300031507 | Ga0307509_10018962 | Ga0307509_100189627 | 131 |
| 505 | 3300031548 | Ga0307408_100001390 | Ga0307408_10000139012 | 131 |
| 506 | 3300031548 | Ga0307408_100490532 | Ga0307408_1004905322 | 131 |
| 507 | 3300031616 | Ga0307508_10000504 | Ga0307508_1000050431 | 131 |
| 508 | 3300031649 | Ga0307514_10006668 | Ga0307514_100066684 | 131 |
| 509 | 3300031649 | Ga0307514_10146339 | Ga0307514_101463392 | 131 |
| 510 | 3300031730 | Ga0307516_10012514 | Ga0307516_100125144 | 131 |
| 511 | 3300031730 | Ga0307516_10060830 | Ga0307516_100608304 | 131 |
| 512 | 3300031730 | Ga0307516_10350472 | Ga0307516_103504722 | 131 |
| 513 | 3300031731 | Ga0307405_11907321 | Ga0307405_119073211 | 131 |
| 514 | 3300031838 | Ga0307518_10067586 | Ga0307518_100675863 | 131 |
| 515 | 3300031852 | Ga0307410_10450029 | Ga0307410_104500292 | 131 |
| 516 | 3300031911 | Ga0307412_10250078 | Ga0307412_102500782 | 131 |
| 517 | 3300031911 | Ga0307412_10264803 | Ga0307412_102648032 | 131 |
| 518 | 3300031911 | Ga0307412_11438353 | Ga0307412_114383532 | 131 |
| 519 | 3300032002 | Ga0307416_100011722 | Ga0307416_1000117223 | 131 |
| 520 | 3300032002 | Ga0307416_100443359 | Ga0307416_1004433592 | 131 |
| 521 | 3300032002 | Ga0307416_100471319 | Ga0307416_1004713192 | 131 |
| 522 | 3300032002 | Ga0307416_101040746 | Ga0307416_1010407462 | 131 |
| 523 | 3300032002 | Ga0307416_103787841 | Ga0307416_1037878411 | 131 |
| 524 | 3300032004 | Ga0307414_10310755 | Ga0307414_103107552 | 131 |
| 525 | 3300032004 | Ga0307414_10928519 | Ga0307414_109285192 | 131 |
| 526 | 3300032005 | Ga0307411_10108435 | Ga0307411_101084353 | 131 |
| 527 | 3300032005 | Ga0307411_10224307 | Ga0307411_102243072 | 131 |
| 528 | 3300033179 | Ga0307507_10078572 | Ga0307507_100785723 | 131 |
| 529 | 3300035691 | Ga0373931_0058502 | Ga0373931_0058502_1350_1751 | 131 |
| 530 | 3300035724 | Ga0373933_0439546 | Ga0373933_0439546_78_476 | 131 |
| 531 | 3300037418 | Ga0395900_0194521 | Ga0395900_0194521_59_457 | 131 |
| 532 | 3300037418 | Ga0395900_1030042 | Ga0395900_1030042_223_624 | 131 |
| 533 | 3300037466 | Ga0395898_0027813 | Ga0395898_0027813_603_1001 | 131 |
| 534 | 3300037466 | Ga0395898_0218355 | Ga0395898_0218355_859_1260 | 131 |
| 535 | 3300037466 | Ga0395898_1906528 | Ga0395898_1906528_40_438 | 131 |
| 536 | 3300037471 | Ga0395905_0009387 | Ga0395905_0009387_3182_3595 | 131 |
| 537 | 3300037471 | Ga0395905_0053794 | Ga0395905_0053794_1481_1876 | 131 |
| 538 | 3300037471 | Ga0395905_0092537 | Ga0395905_0092537_1241_1642 | 131 |
| 539 | 3300037471 | Ga0395905_0136564 | Ga0395905_0136564_1756_2157 | 131 |
| 540 | 3300037471 | Ga0395905_0176670 | Ga0395905_0176670_903_1301 | 131 |
| 541 | 3300037471 | Ga0395905_0348711 | Ga0395905_0348711_574_969 | 131 |
| 542 | 3300037471 | Ga0395905_0374447 | Ga0395905_0374447_243_647 | 131 |
| 543 | 3300038443 | Ga0395901_0010306 | Ga0395901_0010306_7761_8159 | 131 |
| 544 | 3300038443 | Ga0395901_0134832 | Ga0395901_0134832_844_1242 | 131 |
| 545 | 3300038443 | Ga0395901_0243301 | Ga0395901_0243301_385_786 | 131 |
| 546 | 3300039437 | Ga0436365_0201553 | Ga0436365_0201553_388_786 | 131 |
| 547 | 3300039447 | Ga0436361_0115505 | Ga0436361_0115505_4624_5022 | 131 |
| 548 | 3300039447 | Ga0436361_0538417 | Ga0436361_0538417_592_987 | 131 |
| 549 | 3300039447 | Ga0436361_1116803 | Ga0436361_1116803_288_686 | 131 |
| 550 | 3300041406 | Ga0439439_0019142 | Ga0439439_0019142_431_829 | 131 |
| 551 | 3300041410 | Ga0439461_0222592 | Ga0439461_0222592_103_501 | 131 |
| 552 | 3300041451 | Ga0451791_1953326 | Ga0451791_1953326_115_513 | 131 |
| 553 | 3300041453 | Ga0451797_0170929 | Ga0451797_0170929_413_808 | 131 |
| 554 | 3300041458 | Ga0451798_0566612 | Ga0451798_0566612_109_504 | 131 |
| 555 | 3300041459 | Ga0451800_0372506 | Ga0451800_0372506_271_666 | 131 |
| 556 | 3300041498 | Ga0451841_0987551 | Ga0451841_0987551_91_486 | 131 |
| 557 | 3300041505 | Ga0451849_1215121 | Ga0451849_1215121_134_529 | 131 |
| 558 | 3300041512 | Ga0451853_0241869 | Ga0451853_0241869_702_1097 | 131 |
| 559 | 3300041512 | Ga0451853_1496167 | Ga0451853_1496167_192_593 | 131 |
| 560 | 3300041997 | Ga0439431_0021427 | Ga0439431_0021427_256_654 | 131 |
| 561 | 3300042002 | Ga0439442_024379 | Ga0439442_024379_41_439 | 131 |
| 562 | 3300042005 | Ga0439448_0001678 | Ga0439448_0001678_593_991 | 131 |
| 563 | 3300042012 | Ga0439455_0074493 | Ga0439455_0074493_183_581 | 131 |
| 564 | 3300042014 | Ga0439457_034722 | Ga0439457_034722_195_599 | 131 |
| 565 | 3300042122 | Ga0450920_026671 | Ga0450920_026671_80_478 | 131 |
| 566 | 3300042127 | Ga0450890_017311 | Ga0450890_017311_162_560 | 131 |
| 567 | 3300042139 | Ga0450904_000068 | Ga0450904_000068_5740_6138 | 131 |
| 568 | 3300042144 | Ga0450889_050460 | Ga0450889_050460_23_421 | 131 |
| 569 | 3300042145 | Ga0450906_026519 | Ga0450906_026519_35_433 | 131 |
| 570 | 3300042435 | Ga0439434_0109150 | Ga0439434_0109150_253_651 | 131 |
| 571 | 3300042532 | Ga0450893_0019769 | Ga0450893_0019769_568_966 | 131 |
| 572 | 3300042876 | Ga0451577_0001738 | Ga0451577_0001738_27321_27719 | 131 |
| 573 | 3300042876 | Ga0451577_0332678 | Ga0451577_0332678_711_1109 | 131 |
| 574 | 3300042876 | Ga0451577_0597512 | Ga0451577_0597512_550_954 | 131 |
| 575 | 3300044658 | Ga0466972_0000566 | Ga0466972_0000566_6186_6584 | 131 |
| 576 | 3300044672 | Ga0466982_0069393 | Ga0466982_0069393_398_796 | 131 |
| 577 | 3300044683 | Ga0466965_0029883 | Ga0466965_0029883_1795_2193 | 131 |
| 578 | 3300044683 | Ga0466965_0112987 | Ga0466965_0112987_844_1239 | 131 |
| 579 | 3300044694 | Ga0466963_0692604 | Ga0466963_0692604_224_619 | 131 |
| 580 | 3300044712 | Ga0453684_0108145 | Ga0453684_0108145_2532_2930 | 131 |
| 581 | 3300044712 | Ga0453684_0490675 | Ga0453684_0490675_444_845 | 131 |
| 582 | 3300044735 | Ga0466968_0395131 | Ga0466968_0395131_73_471 | 131 |
| 583 | 3300044765 | Ga0466970_0156284 | Ga0466970_0156284_486_884 | 131 |
| 584 | 3300044842 | Ga0466957_0015162 | Ga0466957_0015162_176_574 | 131 |
| 585 | 3300044901 | Ga0466960_0137850 | Ga0466960_0137850_113_514 | 131 |
| 586 | 3300044901 | Ga0466960_0370621 | Ga0466960_0370621_173_571 | 131 |
| 587 | 3300045051 | Ga0451576_0011749 | Ga0451576_0011749_5807_6205 | 131 |
| 588 | 3300045051 | Ga0451576_0763803 | Ga0451576_0763803_338_733 | 131 |
| 589 | 3300045976 | Ga0466967_0463586 | Ga0466967_0463586_248_646 | 131 |
| 590 | 3300046452 | Ga0495617_000017 | Ga0495617_000017_10338_10736 | 131 |
| 591 | 3300046452 | Ga0495617_001215 | Ga0495617_001215_6936_7334 | 131 |
| 592 | 3300046452 | Ga0495617_002243 | Ga0495617_002243_235_633 | 131 |
| 593 | 3300046453 | Ga0495627_001838 | Ga0495627_001838_142_540 | 131 |
| 594 | 3300046453 | Ga0495627_018346 | Ga0495627_018346_546_944 | 131 |
| 595 | 3300046455 | Ga0495603_0025604 | Ga0495603_0025604_1820_2218 | 131 |
| 596 | 3300046455 | Ga0495603_0032373 | Ga0495603_0032373_2270_2668 | 131 |
| 597 | 3300046457 | Ga0495590_0000014 | Ga0495590_0000014_244945_245343 | 131 |
| 598 | 3300046457 | Ga0495590_0000118 | Ga0495590_0000118_10361_10759 | 131 |
| 599 | 3300046457 | Ga0495590_0000718 | Ga0495590_0000718_12803_13213 | 131 |
| 600 | 3300046457 | Ga0495590_0002122 | Ga0495590_0002122_7737_8135 | 131 |
| 601 | 3300046457 | Ga0495590_0047192 | Ga0495590_0047192_443_841 | 131 |
| 602 | 3300046457 | Ga0495590_0110196 | Ga0495590_0110196_339_737 | 131 |
| 603 | 3300046458 | Ga0495591_094810 | Ga0495591_094810_259_657 | 131 |
| 604 | 3300046460 | Ga0495638_0000064 | Ga0495638_0000064_167420_167818 | 131 |
| 605 | 3300046460 | Ga0495638_0000408 | Ga0495638_0000408_40428_40826 | 131 |
| 606 | 3300046460 | Ga0495638_0004398 | Ga0495638_0004398_410_808 | 131 |
| 607 | 3300046460 | Ga0495638_0018992 | Ga0495638_0018992_3904_4302 | 131 |
| 608 | 3300046460 | Ga0495638_0071341 | Ga0495638_0071341_420_818 | 131 |
| 609 | 3300046460 | Ga0495638_0094733 | Ga0495638_0094733_999_1397 | 131 |
| 610 | 3300046460 | Ga0495638_0141567 | Ga0495638_0141567_286_684 | 131 |
| 611 | 3300046460 | Ga0495638_0224794 | Ga0495638_0224794_198_596 | 131 |
| 612 | 3300046460 | Ga0495638_0271689 | Ga0495638_0271689_377_775 | 131 |
| 613 | 3300046463 | Ga0495653_0019706 | Ga0495653_0019706_796_1194 | 131 |
| 614 | 3300046471 | Ga0495650_0000084 | Ga0495650_0000084_227777_228175 | 131 |
| 615 | 3300046471 | Ga0495650_0013827 | Ga0495650_0013827_3345_3743 | 131 |
| 616 | 3300046471 | Ga0495650_0117706 | Ga0495650_0117706_33_431 | 131 |
| 617 | 3300046472 | Ga0495580_0097708 | Ga0495580_0097708_1333_1731 | 131 |
| 618 | 3300046473 | Ga0495582_0002100 | Ga0495582_0002100_340_738 | 131 |
| 619 | 3300046473 | Ga0495582_0306419 | Ga0495582_0306419_355_753 | 131 |
| 620 | 3300046473 | Ga0495582_0359856 | Ga0495582_0359856_91_489 | 131 |
| 621 | 3300046474 | Ga0495605_0000520 | Ga0495605_0000520_22032_22430 | 131 |
| 622 | 3300046474 | Ga0495605_0001968 | Ga0495605_0001968_2469_2867 | 131 |
| 623 | 3300046474 | Ga0495605_0003392 | Ga0495605_0003392_155_553 | 131 |
| 624 | 3300046474 | Ga0495605_0020160 | Ga0495605_0020160_1666_2064 | 131 |
| 625 | 3300046474 | Ga0495605_0126174 | Ga0495605_0126174_267_665 | 131 |
| 626 | 3300046474 | Ga0495605_0129569 | Ga0495605_0129569_266_664 | 131 |
| 627 | 3300046474 | Ga0495605_0130913 | Ga0495605_0130913_80_478 | 131 |
| 628 | 3300046474 | Ga0495605_0247567 | Ga0495605_0247567_289_687 | 131 |
| 629 | 3300046474 | Ga0495605_0400708 | Ga0495605_0400708_13_411 | 131 |
| 630 | 3300046475 | Ga0495639_0108220 | Ga0495639_0108220_195_593 | 131 |
| 631 | 3300046491 | Ga0495584_0000040 | Ga0495584_0000040_6857_7255 | 131 |
| 632 | 3300046491 | Ga0495584_0000482 | Ga0495584_0000482_18041_18439 | 131 |
| 633 | 3300046491 | Ga0495584_0000609 | Ga0495584_0000609_297_695 | 131 |
| 634 | 3300046491 | Ga0495584_0001576 | Ga0495584_0001576_3201_3599 | 131 |
| 635 | 3300046491 | Ga0495584_0004417 | Ga0495584_0004417_5216_5614 | 131 |
| 636 | 3300046491 | Ga0495584_0006265 | Ga0495584_0006265_1715_2113 | 131 |
| 637 | 3300046491 | Ga0495584_0012735 | Ga0495584_0012735_2100_2498 | 131 |
| 638 | 3300046491 | Ga0495584_0018120 | Ga0495584_0018120_2755_3153 | 131 |
| 639 | 3300046491 | Ga0495584_0057071 | Ga0495584_0057071_322_720 | 131 |
| 640 | 3300046491 | Ga0495584_0170189 | Ga0495584_0170189_356_754 | 131 |
| 641 | 3300046491 | Ga0495584_0225443 | Ga0495584_0225443_377_775 | 131 |
| 642 | 3300046491 | Ga0495584_0422894 | Ga0495584_0422894_70_468 | 131 |
| 643 | 3300046491 | Ga0495584_0634973 | Ga0495584_0634973_96_494 | 131 |
| 644 | 3300046492 | Ga0495585_0000404 | Ga0495585_0000404_17852_18250 | 131 |
| 645 | 3300046492 | Ga0495585_0000524 | Ga0495585_0000524_14816_15214 | 131 |
| 646 | 3300046492 | Ga0495585_0001008 | Ga0495585_0001008_16297_16695 | 131 |
| 647 | 3300046492 | Ga0495585_0001486 | Ga0495585_0001486_17909_18307 | 131 |
| 648 | 3300046492 | Ga0495585_0001735 | Ga0495585_0001735_5651_6049 | 131 |
| 649 | 3300046492 | Ga0495585_0003717 | Ga0495585_0003717_2613_3011 | 131 |
| 650 | 3300046492 | Ga0495585_0005445 | Ga0495585_0005445_2317_2715 | 131 |
| 651 | 3300046492 | Ga0495585_0008951 | Ga0495585_0008951_457_855 | 131 |
| 652 | 3300046492 | Ga0495585_0010535 | Ga0495585_0010535_4904_5302 | 131 |
| 653 | 3300046492 | Ga0495585_0041147 | Ga0495585_0041147_2183_2581 | 131 |
| 654 | 3300046492 | Ga0495585_0052286 | Ga0495585_0052286_498_896 | 131 |
| 655 | 3300046492 | Ga0495585_0079437 | Ga0495585_0079437_1296_1694 | 131 |
| 656 | 3300046492 | Ga0495585_0082560 | Ga0495585_0082560_572_970 | 131 |
| 657 | 3300046492 | Ga0495585_0103944 | Ga0495585_0103944_142_540 | 131 |
| 658 | 3300046492 | Ga0495585_0179155 | Ga0495585_0179155_137_535 | 131 |
| 659 | 3300046492 | Ga0495585_0187607 | Ga0495585_0187607_136_534 | 131 |
| 660 | 3300046492 | Ga0495585_0210848 | Ga0495585_0210848_122_520 | 131 |
| 661 | 3300046492 | Ga0495585_0211531 | Ga0495585_0211531_543_941 | 131 |
| 662 | 3300046492 | Ga0495585_0229553 | Ga0495585_0229553_205_603 | 131 |
| 663 | 3300046492 | Ga0495585_0293096 | Ga0495585_0293096_308_703 | 131 |
| 664 | 3300046499 | Ga0495594_0003237 | Ga0495594_0003237_210_608 | 131 |
| 665 | 3300046499 | Ga0495594_0024536 | Ga0495594_0024536_182_580 | 131 |
| 666 | 3300046500 | Ga0495596_0000199 | Ga0495596_0000199_10323_10721 | 131 |
| 667 | 3300046500 | Ga0495596_0001436 | Ga0495596_0001436_7387_7785 | 131 |
| 668 | 3300046500 | Ga0495596_0002255 | Ga0495596_0002255_172_570 | 131 |
| 669 | 3300046500 | Ga0495596_0014034 | Ga0495596_0014034_1286_1684 | 131 |
| 670 | 3300046500 | Ga0495596_0014475 | Ga0495596_0014475_2165_2563 | 131 |
| 671 | 3300046500 | Ga0495596_0018989 | Ga0495596_0018989_2259_2657 | 131 |
| 672 | 3300046500 | Ga0495596_0022085 | Ga0495596_0022085_492_890 | 131 |
| 673 | 3300046500 | Ga0495596_0036371 | Ga0495596_0036371_255_653 | 131 |
| 674 | 3300046500 | Ga0495596_0039490 | Ga0495596_0039490_222_620 | 131 |
| 675 | 3300046500 | Ga0495596_0211835 | Ga0495596_0211835_192_590 | 131 |
| 676 | 3300046500 | Ga0495596_0320859 | Ga0495596_0320859_129_527 | 131 |
| 677 | 3300046501 | Ga0495607_0001141 | Ga0495607_0001141_4523_4921 | 131 |
| 678 | 3300046501 | Ga0495607_0002847 | Ga0495607_0002847_2636_3034 | 131 |
| 679 | 3300046501 | Ga0495607_0003861 | Ga0495607_0003861_10338_10736 | 131 |
| 680 | 3300046501 | Ga0495607_0004084 | Ga0495607_0004084_503_901 | 131 |
| 681 | 3300046501 | Ga0495607_0029492 | Ga0495607_0029492_2371_2769 | 131 |
| 682 | 3300046501 | Ga0495607_0038470 | Ga0495607_0038470_2336_2734 | 131 |
| 683 | 3300046501 | Ga0495607_0040484 | Ga0495607_0040484_1751_2149 | 131 |
| 684 | 3300046501 | Ga0495607_0042076 | Ga0495607_0042076_165_563 | 131 |
| 685 | 3300046501 | Ga0495607_0080073 | Ga0495607_0080073_349_747 | 131 |
| 686 | 3300046501 | Ga0495607_0138980 | Ga0495607_0138980_488_886 | 131 |
| 687 | 3300046501 | Ga0495607_0196990 | Ga0495607_0196990_132_530 | 131 |
| 688 | 3300046501 | Ga0495607_0204936 | Ga0495607_0204936_562_960 | 131 |
| 689 | 3300046506 | Ga0495583_0000137 | Ga0495583_0000137_112522_112920 | 131 |
| 690 | 3300046506 | Ga0495583_0000231 | Ga0495583_0000231_9065_9463 | 131 |
| 691 | 3300046506 | Ga0495583_0000428 | Ga0495583_0000428_26615_27013 | 131 |
| 692 | 3300046506 | Ga0495583_0000446 | Ga0495583_0000446_10283_10681 | 131 |
| 693 | 3300046506 | Ga0495583_0000502 | Ga0495583_0000502_10439_10837 | 131 |
| 694 | 3300046506 | Ga0495583_0001074 | Ga0495583_0001074_20245_20643 | 131 |
| 695 | 3300046506 | Ga0495583_0001094 | Ga0495583_0001094_28971_29369 | 131 |
| 696 | 3300046506 | Ga0495583_0002471 | Ga0495583_0002471_14838_15236 | 131 |
| 697 | 3300046506 | Ga0495583_0003032 | Ga0495583_0003032_517_915 | 131 |
| 698 | 3300046506 | Ga0495583_0010646 | Ga0495583_0010646_872_1270 | 131 |
| 699 | 3300046506 | Ga0495583_0037907 | Ga0495583_0037907_183_581 | 131 |
| 700 | 3300046506 | Ga0495583_0059635 | Ga0495583_0059635_16_414 | 131 |
| 701 | 3300046506 | Ga0495583_0071658 | Ga0495583_0071658_474_872 | 131 |
| 702 | 3300046506 | Ga0495583_0122128 | Ga0495583_0122128_494_892 | 131 |
| 703 | 3300046507 | Ga0495606_0000353 | Ga0495606_0000353_68816_69214 | 131 |
| 704 | 3300046507 | Ga0495606_0000400 | Ga0495606_0000400_8711_9109 | 131 |
| 705 | 3300046507 | Ga0495606_0000821 | Ga0495606_0000821_18580_18978 | 131 |
| 706 | 3300046507 | Ga0495606_0001004 | Ga0495606_0001004_6528_6926 | 131 |
| 707 | 3300046507 | Ga0495606_0001694 | Ga0495606_0001694_17020_17418 | 131 |
| 708 | 3300046507 | Ga0495606_0012914 | Ga0495606_0012914_528_926 | 131 |
| 709 | 3300046507 | Ga0495606_0018252 | Ga0495606_0018252_276_674 | 131 |
| 710 | 3300046507 | Ga0495606_0027360 | Ga0495606_0027360_3084_3482 | 131 |
| 711 | 3300046507 | Ga0495606_0086025 | Ga0495606_0086025_1347_1745 | 131 |
| 712 | 3300046507 | Ga0495606_0106018 | Ga0495606_0106018_372_770 | 131 |
| 713 | 3300046507 | Ga0495606_0127170 | Ga0495606_0127170_868_1263 | 131 |
| 714 | 3300046507 | Ga0495606_0291668 | Ga0495606_0291668_56_454 | 131 |
| 715 | 3300046507 | Ga0495606_0413773 | Ga0495606_0413773_139_537 | 131 |
| 716 | 3300046507 | Ga0495606_0441467 | Ga0495606_0441467_65_463 | 131 |
| 717 | 3300046507 | Ga0495606_0511302 | Ga0495606_0511302_175_573 | 131 |
| 718 | 3300046507 | Ga0495606_0523469 | Ga0495606_0523469_59_454 | 131 |
| 719 | 3300046507 | Ga0495606_0581267 | Ga0495606_0581267_126_524 | 131 |
| 720 | 3300046512 | Ga0495610_0001351 | Ga0495610_0001351_11061_11459 | 131 |
| 721 | 3300046512 | Ga0495610_0001490 | Ga0495610_0001490_17798_18196 | 131 |
| 722 | 3300046512 | Ga0495610_0003715 | Ga0495610_0003715_5708_6106 | 131 |
| 723 | 3300046512 | Ga0495610_0006638 | Ga0495610_0006638_5733_6131 | 131 |
| 724 | 3300046512 | Ga0495610_0022573 | Ga0495610_0022573_2456_2854 | 131 |
| 725 | 3300046512 | Ga0495610_0049988 | Ga0495610_0049988_387_785 | 131 |
| 726 | 3300046512 | Ga0495610_0083118 | Ga0495610_0083118_140_538 | 131 |
| 727 | 3300046513 | Ga0495616_0000072 | Ga0495616_0000072_10999_11397 | 131 |
| 728 | 3300046513 | Ga0495616_0000106 | Ga0495616_0000106_6411_6809 | 131 |
| 729 | 3300046513 | Ga0495616_0000324 | Ga0495616_0000324_27053_27451 | 131 |
| 730 | 3300046513 | Ga0495616_0001789 | Ga0495616_0001789_4447_4845 | 131 |
| 731 | 3300046513 | Ga0495616_0002097 | Ga0495616_0002097_3162_3560 | 131 |
| 732 | 3300046513 | Ga0495616_0020868 | Ga0495616_0020868_1420_1818 | 131 |
| 733 | 3300046513 | Ga0495616_0021450 | Ga0495616_0021450_1995_2393 | 131 |
| 734 | 3300046513 | Ga0495616_0024185 | Ga0495616_0024185_1366_1764 | 131 |
| 735 | 3300046513 | Ga0495616_0056239 | Ga0495616_0056239_254_652 | 131 |
| 736 | 3300046513 | Ga0495616_0164792 | Ga0495616_0164792_309_707 | 131 |
| 737 | 3300046513 | Ga0495616_0224513 | Ga0495616_0224513_369_767 | 131 |
| 738 | 3300046513 | Ga0495616_0396744 | Ga0495616_0396744_155_553 | 131 |
| 739 | 3300046513 | Ga0495616_0408100 | Ga0495616_0408100_140_538 | 131 |
| 740 | 3300046514 | Ga0495618_0299255 | Ga0495618_0299255_446_847 | 131 |
| 741 | 3300046515 | Ga0495620_0004824 | Ga0495620_0004824_6032_6430 | 131 |
| 742 | 3300046518 | Ga0495631_0000349 | Ga0495631_0000349_5113_5511 | 131 |
| 743 | 3300046518 | Ga0495631_0000452 | Ga0495631_0000452_10311_10709 | 131 |
| 744 | 3300046518 | Ga0495631_0022820 | Ga0495631_0022820_2347_2745 | 131 |
| 745 | 3300046518 | Ga0495631_0033083 | Ga0495631_0033083_317_715 | 131 |
| 746 | 3300046518 | Ga0495631_0044250 | Ga0495631_0044250_1409_1807 | 131 |
| 747 | 3300046518 | Ga0495631_0083720 | Ga0495631_0083720_192_590 | 131 |
| 748 | 3300046518 | Ga0495631_0120854 | Ga0495631_0120854_42_440 | 131 |
| 749 | 3300046518 | Ga0495631_0123277 | Ga0495631_0123277_48_446 | 131 |
| 750 | 3300046518 | Ga0495631_0292300 | Ga0495631_0292300_159_557 | 131 |
| 751 | 3300046518 | Ga0495631_0372815 | Ga0495631_0372815_136_534 | 131 |
| 752 | 3300046519 | Ga0495632_0000025 | Ga0495632_0000025_9950_10348 | 131 |
| 753 | 3300046519 | Ga0495632_0000342 | Ga0495632_0000342_9903_10301 | 131 |
| 754 | 3300046519 | Ga0495632_0000566 | Ga0495632_0000566_24019_24417 | 131 |
| 755 | 3300046519 | Ga0495632_0010866 | Ga0495632_0010866_197_595 | 131 |
| 756 | 3300046519 | Ga0495632_0020918 | Ga0495632_0020918_2660_3058 | 131 |
| 757 | 3300046519 | Ga0495632_0022704 | Ga0495632_0022704_227_625 | 131 |
| 758 | 3300046519 | Ga0495632_0059315 | Ga0495632_0059315_947_1345 | 131 |
| 759 | 3300046519 | Ga0495632_0270231 | Ga0495632_0270231_307_705 | 131 |
| 760 | 3300046520 | Ga0495637_0000003 | Ga0495637_0000003_612585_612983 | 131 |
| 761 | 3300046520 | Ga0495637_0000240 | Ga0495637_0000240_4838_5236 | 131 |
| 762 | 3300046520 | Ga0495637_0000634 | Ga0495637_0000634_9859_10257 | 131 |
| 763 | 3300046520 | Ga0495637_0022590 | Ga0495637_0022590_1709_2107 | 131 |
| 764 | 3300046520 | Ga0495637_0189922 | Ga0495637_0189922_210_608 | 131 |
| 765 | 3300046522 | Ga0495643_0000108 | Ga0495643_0000108_12971_13369 | 131 |
| 766 | 3300046522 | Ga0495643_0000471 | Ga0495643_0000471_10575_10973 | 131 |
| 767 | 3300046522 | Ga0495643_0000906 | Ga0495643_0000906_860_1258 | 131 |
| 768 | 3300046522 | Ga0495643_0003125 | Ga0495643_0003125_10870_11268 | 131 |
| 769 | 3300046522 | Ga0495643_0005227 | Ga0495643_0005227_7577_7975 | 131 |
| 770 | 3300046522 | Ga0495643_0009950 | Ga0495643_0009950_1795_2193 | 131 |
| 771 | 3300046522 | Ga0495643_0030273 | Ga0495643_0030273_450_848 | 131 |
| 772 | 3300046522 | Ga0495643_0036192 | Ga0495643_0036192_927_1325 | 131 |
| 773 | 3300046522 | Ga0495643_0074329 | Ga0495643_0074329_110_505 | 131 |
| 774 | 3300046522 | Ga0495643_0098558 | Ga0495643_0098558_886_1284 | 131 |
| 775 | 3300046522 | Ga0495643_0235281 | Ga0495643_0235281_35_433 | 131 |
| 776 | 3300046522 | Ga0495643_0318034 | Ga0495643_0318034_79_477 | 131 |
| 777 | 3300046523 | Ga0495644_0001043 | Ga0495644_0001043_427_825 | 131 |
| 778 | 3300046523 | Ga0495644_0001784 | Ga0495644_0001784_7169_7567 | 131 |
| 779 | 3300046523 | Ga0495644_0010246 | Ga0495644_0010246_3182_3580 | 131 |
| 780 | 3300046523 | Ga0495644_0010507 | Ga0495644_0010507_456_854 | 131 |
| 781 | 3300046523 | Ga0495644_0014447 | Ga0495644_0014447_2182_2580 | 131 |
| 782 | 3300046523 | Ga0495644_0045983 | Ga0495644_0045983_947_1345 | 131 |
| 783 | 3300046523 | Ga0495644_0113539 | Ga0495644_0113539_339_737 | 131 |
| 784 | 3300046523 | Ga0495644_0138408 | Ga0495644_0138408_154_552 | 131 |
| 785 | 3300046523 | Ga0495644_0336127 | Ga0495644_0336127_95_493 | 131 |
| 786 | 3300046524 | Ga0495648_0000006 | Ga0495648_0000006_347857_348255 | 131 |
| 787 | 3300046524 | Ga0495648_0000134 | Ga0495648_0000134_76837_77235 | 131 |
| 788 | 3300046524 | Ga0495648_0000464 | Ga0495648_0000464_33385_33783 | 131 |
| 789 | 3300046524 | Ga0495648_0004553 | Ga0495648_0004553_1374_1772 | 131 |
| 790 | 3300046524 | Ga0495648_0007917 | Ga0495648_0007917_1300_1698 | 131 |
| 791 | 3300046524 | Ga0495648_0011923 | Ga0495648_0011923_3826_4224 | 131 |
| 792 | 3300046524 | Ga0495648_0016240 | Ga0495648_0016240_1183_1581 | 131 |
| 793 | 3300046524 | Ga0495648_0016351 | Ga0495648_0016351_14_412 | 131 |
| 794 | 3300046524 | Ga0495648_0020374 | Ga0495648_0020374_2389_2787 | 131 |
| 795 | 3300046524 | Ga0495648_0225968 | Ga0495648_0225968_381_779 | 131 |
| 796 | 3300046524 | Ga0495648_0508397 | Ga0495648_0508397_105_503 | 131 |
| 797 | 3300046524 | Ga0495648_0513936 | Ga0495648_0513936_103_501 | 131 |
| 798 | 3300046525 | Ga0495663_0018267 | Ga0495663_0018267_419_817 | 131 |
| 799 | 3300046525 | Ga0495663_0018697 | Ga0495663_0018697_523_921 | 131 |
| 800 | 3300046525 | Ga0495663_0021524 | Ga0495663_0021524_315_713 | 131 |
| 801 | 3300046526 | Ga0495666_0001620 | Ga0495666_0001620_3871_4269 | 131 |
| 802 | 3300046526 | Ga0495666_0077453 | Ga0495666_0077453_150_548 | 131 |
| 803 | 3300046526 | Ga0495666_0206238 | Ga0495666_0206238_123_521 | 131 |
| 804 | 3300046526 | Ga0495666_0243317 | Ga0495666_0243317_190_588 | 131 |
| 805 | 3300046528 | Ga0495642_0000052 | Ga0495642_0000052_4256_4654 | 131 |
| 806 | 3300046528 | Ga0495642_0000740 | Ga0495642_0000740_7200_7598 | 131 |
| 807 | 3300046528 | Ga0495642_0001769 | Ga0495642_0001769_8878_9276 | 131 |
| 808 | 3300046528 | Ga0495642_0020737 | Ga0495642_0020737_400_798 | 131 |
| 809 | 3300046528 | Ga0495642_0026741 | Ga0495642_0026741_182_580 | 131 |
| 810 | 3300046528 | Ga0495642_0026883 | Ga0495642_0026883_45_443 | 131 |
| 811 | 3300046528 | Ga0495642_0029677 | Ga0495642_0029677_1549_1947 | 131 |
| 812 | 3300046528 | Ga0495642_0125385 | Ga0495642_0125385_517_915 | 131 |
| 813 | 3300046529 | Ga0495652_0471504 | Ga0495652_0471504_346_744 | 131 |
| 814 | 3300046530 | Ga0495654_0000131 | Ga0495654_0000131_9710_10108 | 131 |
| 815 | 3300046530 | Ga0495654_0011979 | Ga0495654_0011979_180_578 | 131 |
| 816 | 3300046530 | Ga0495654_0013625 | Ga0495654_0013625_2775_3173 | 131 |
| 817 | 3300046530 | Ga0495654_0018546 | Ga0495654_0018546_1149_1547 | 131 |
| 818 | 3300046530 | Ga0495654_0030584 | Ga0495654_0030584_470_868 | 131 |
| 819 | 3300046530 | Ga0495654_0061407 | Ga0495654_0061407_1262_1660 | 131 |
| 820 | 3300046530 | Ga0495654_0330550 | Ga0495654_0330550_11_409 | 131 |
| 821 | 3300046531 | Ga0495665_0010647 | Ga0495665_0010647_409_807 | 131 |
| 822 | 3300046531 | Ga0495665_0026437 | Ga0495665_0026437_1754_2152 | 131 |
| 823 | 3300046531 | Ga0495665_0038501 | Ga0495665_0038501_233_631 | 131 |
| 824 | 3300046531 | Ga0495665_0133325 | Ga0495665_0133325_401_799 | 131 |
| 825 | 3300046531 | Ga0495665_0645579 | Ga0495665_0645579_65_463 | 131 |
| 826 | 3300046533 | Ga0495640_0034668 | Ga0495640_0034668_282_680 | 131 |
| 827 | 3300046535 | Ga0495586_0015127 | Ga0495586_0015127_3539_3937 | 131 |
| 828 | 3300046535 | Ga0495586_0015424 | Ga0495586_0015424_1895_2293 | 131 |
| 829 | 3300046535 | Ga0495586_0015542 | Ga0495586_0015542_1983_2381 | 131 |
| 830 | 3300046536 | Ga0495587_0082289 | Ga0495587_0082289_1391_1789 | 131 |
| 831 | 3300046538 | Ga0495609_0000616 | Ga0495609_0000616_7080_7478 | 131 |
| 832 | 3300046538 | Ga0495609_0000908 | Ga0495609_0000908_10968_11366 | 131 |
| 833 | 3300046538 | Ga0495609_0001364 | Ga0495609_0001364_792_1190 | 131 |
| 834 | 3300046538 | Ga0495609_0004228 | Ga0495609_0004228_6688_7086 | 131 |
| 835 | 3300046538 | Ga0495609_0005236 | Ga0495609_0005236_271_669 | 131 |
| 836 | 3300046538 | Ga0495609_0013898 | Ga0495609_0013898_532_930 | 131 |
| 837 | 3300046538 | Ga0495609_0036536 | Ga0495609_0036536_1310_1708 | 131 |
| 838 | 3300046538 | Ga0495609_0042714 | Ga0495609_0042714_185_583 | 131 |
| 839 | 3300046538 | Ga0495609_0066996 | Ga0495609_0066996_12_410 | 131 |
| 840 | 3300046538 | Ga0495609_0130333 | Ga0495609_0130333_490_888 | 131 |
| 841 | 3300046538 | Ga0495609_0416555 | Ga0495609_0416555_52_450 | 131 |
| 842 | 3300046542 | Ga0495597_0000340 | Ga0495597_0000340_4175_4573 | 131 |
| 843 | 3300046542 | Ga0495597_0000415 | Ga0495597_0000415_26326_26724 | 131 |
| 844 | 3300046542 | Ga0495597_0000648 | Ga0495597_0000648_15824_16222 | 131 |
| 845 | 3300046542 | Ga0495597_0001867 | Ga0495597_0001867_3352_3750 | 131 |
| 846 | 3300046542 | Ga0495597_0002686 | Ga0495597_0002686_3889_4287 | 131 |
| 847 | 3300046542 | Ga0495597_0002986 | Ga0495597_0002986_9518_9916 | 131 |
| 848 | 3300046542 | Ga0495597_0004079 | Ga0495597_0004079_901_1299 | 131 |
| 849 | 3300046542 | Ga0495597_0007712 | Ga0495597_0007712_4683_5081 | 131 |
| 850 | 3300046542 | Ga0495597_0054015 | Ga0495597_0054015_1183_1581 | 131 |
| 851 | 3300046542 | Ga0495597_0075255 | Ga0495597_0075255_223_621 | 131 |
| 852 | 3300046542 | Ga0495597_0190385 | Ga0495597_0190385_240_638 | 131 |
| 853 | 3300046542 | Ga0495597_0366321 | Ga0495597_0366321_114_509 | 131 |
| 854 | 3300046543 | Ga0495645_0181519 | Ga0495645_0181519_204_602 | 131 |
| 855 | 3300046557 | Ga0495622_0000208 | Ga0495622_0000208_13023_13421 | 131 |
| 856 | 3300046557 | Ga0495622_0050265 | Ga0495622_0050265_839_1237 | 131 |
| 857 | 3300046557 | Ga0495622_0081367 | Ga0495622_0081367_546_944 | 131 |
| 858 | 3300046557 | Ga0495622_0308813 | Ga0495622_0308813_263_661 | 131 |
| 859 | 3300046558 | Ga0495633_0000469 | Ga0495633_0000469_27955_28353 | 131 |
| 860 | 3300046558 | Ga0495633_0001267 | Ga0495633_0001267_14113_14511 | 131 |
| 861 | 3300046558 | Ga0495633_0002386 | Ga0495633_0002386_2862_3260 | 131 |
| 862 | 3300046558 | Ga0495633_0006514 | Ga0495633_0006514_974_1372 | 131 |
| 863 | 3300046558 | Ga0495633_0011104 | Ga0495633_0011104_412_810 | 131 |
| 864 | 3300046558 | Ga0495633_0017396 | Ga0495633_0017396_2867_3265 | 131 |
| 865 | 3300046558 | Ga0495633_0076506 | Ga0495633_0076506_162_560 | 131 |
| 866 | 3300046558 | Ga0495633_0128887 | Ga0495633_0128887_324_722 | 131 |
| 867 | 3300046558 | Ga0495633_0132044 | Ga0495633_0132044_342_740 | 131 |
| 868 | 3300046558 | Ga0495633_0198421 | Ga0495633_0198421_287_685 | 131 |
| 869 | 3300046558 | Ga0495633_0333648 | Ga0495633_0333648_260_658 | 131 |
| 870 | 3300046558 | Ga0495633_0439312 | Ga0495633_0439312_28_426 | 131 |
| 871 | 3300046558 | Ga0495633_0581509 | Ga0495633_0581509_39_437 | 131 |
| 872 | 3300046559 | Ga0495667_0072864 | Ga0495667_0072864_1465_1863 | 131 |
| 873 | 3300046615 | Ga0495656_0002559 | Ga0495656_0002559_3937_4335 | 131 |
| 874 | 3300046615 | Ga0495656_0229163 | Ga0495656_0229163_518_916 | 131 |
| 875 | 3300046615 | Ga0495656_0260687 | Ga0495656_0260687_250_648 | 131 |
| 876 | 3300046615 | Ga0495656_0371261 | Ga0495656_0371261_175_573 | 131 |
| 877 | 3300046615 | Ga0495656_0374879 | Ga0495656_0374879_11_409 | 131 |
| 878 | 3300046615 | Ga0495656_0529990 | Ga0495656_0529990_97_495 | 131 |
| 879 | 3300046616 | Ga0495668_0000119 | Ga0495668_0000119_114912_115310 | 131 |
| 880 | 3300046616 | Ga0495668_0000209 | Ga0495668_0000209_78939_79337 | 131 |
| 881 | 3300046616 | Ga0495668_0000611 | Ga0495668_0000611_32884_33282 | 131 |
| 882 | 3300046616 | Ga0495668_0000938 | Ga0495668_0000938_21844_22242 | 131 |
| 883 | 3300046616 | Ga0495668_0001212 | Ga0495668_0001212_4016_4414 | 131 |
| 884 | 3300046616 | Ga0495668_0002631 | Ga0495668_0002631_6528_6926 | 131 |
| 885 | 3300046616 | Ga0495668_0008987 | Ga0495668_0008987_533_931 | 131 |
| 886 | 3300046616 | Ga0495668_0014170 | Ga0495668_0014170_2851_3249 | 131 |
| 887 | 3300046616 | Ga0495668_0025842 | Ga0495668_0025842_106_504 | 131 |
| 888 | 3300046616 | Ga0495668_0035132 | Ga0495668_0035132_2304_2702 | 131 |
| 889 | 3300046616 | Ga0495668_0039612 | Ga0495668_0039612_1018_1416 | 131 |
| 890 | 3300046616 | Ga0495668_0040722 | Ga0495668_0040722_1606_2004 | 131 |
| 891 | 3300046616 | Ga0495668_0072257 | Ga0495668_0072257_145_543 | 131 |
| 892 | 3300046616 | Ga0495668_0131624 | Ga0495668_0131624_566_964 | 131 |
| 893 | 3300046616 | Ga0495668_0218858 | Ga0495668_0218858_172_570 | 131 |
| 894 | 3300046642 | Ga0495634_0363619 | Ga0495634_0363619_268_666 | 131 |
| 895 | 3300046648 | Ga0495611_0000370 | Ga0495611_0000370_19284_19682 | 131 |
| 896 | 3300046648 | Ga0495611_0007671 | Ga0495611_0007671_3758_4156 | 131 |
| 897 | 3300046648 | Ga0495611_0013636 | Ga0495611_0013636_1418_1816 | 131 |
| 898 | 3300046648 | Ga0495611_0017119 | Ga0495611_0017119_417_815 | 131 |
| 899 | 3300046648 | Ga0495611_0033943 | Ga0495611_0033943_1116_1514 | 131 |
| 900 | 3300046648 | Ga0495611_0047579 | Ga0495611_0047579_1411_1809 | 131 |
| 901 | 3300046648 | Ga0495611_0067998 | Ga0495611_0067998_525_923 | 131 |
| 902 | 3300046648 | Ga0495611_0072063 | Ga0495611_0072063_42_440 | 131 |
| 903 | 3300046660 | Ga0495625_0000780 | Ga0495625_0000780_33974_34372 | 131 |
| 904 | 3300046660 | Ga0495625_0001523 | Ga0495625_0001523_2645_3043 | 131 |
| 905 | 3300046660 | Ga0495625_0010304 | Ga0495625_0010304_424_822 | 131 |
| 906 | 3300046660 | Ga0495625_0016339 | Ga0495625_0016339_1022_1420 | 131 |
| 907 | 3300046660 | Ga0495625_0018403 | Ga0495625_0018403_2549_2947 | 131 |
| 908 | 3300046660 | Ga0495625_0024430 | Ga0495625_0024430_3601_3999 | 131 |
| 909 | 3300046660 | Ga0495625_0029299 | Ga0495625_0029299_1158_1556 | 131 |
| 910 | 3300046660 | Ga0495625_0050583 | Ga0495625_0050583_2379_2777 | 131 |
| 911 | 3300046660 | Ga0495625_0051383 | Ga0495625_0051383_2182_2580 | 131 |
| 912 | 3300046660 | Ga0495625_0148276 | Ga0495625_0148276_492_890 | 131 |
| 913 | 3300046660 | Ga0495625_0185140 | Ga0495625_0185140_945_1343 | 131 |
| 914 | 3300046660 | Ga0495625_0326176 | Ga0495625_0326176_533_931 | 131 |
| 915 | 3300046660 | Ga0495625_0652437 | Ga0495625_0652437_154_552 | 131 |
| 916 | 3300046663 | Ga0495635_0040957 | Ga0495635_0040957_164_562 | 131 |
| 917 | 3300046663 | Ga0495635_0879350 | Ga0495635_0879350_155_553 | 131 |
| 918 | 3300046664 | Ga0495659_0000131 | Ga0495659_0000131_10331_10729 | 131 |
| 919 | 3300046664 | Ga0495659_0003174 | Ga0495659_0003174_2142_2540 | 131 |
| 920 | 3300046664 | Ga0495659_0004375 | Ga0495659_0004375_3368_3766 | 131 |
| 921 | 3300046664 | Ga0495659_0069767 | Ga0495659_0069767_661_1059 | 131 |
| 922 | 3300046664 | Ga0495659_0078709 | Ga0495659_0078709_591_989 | 131 |
| 923 | 3300046664 | Ga0495659_0101622 | Ga0495659_0101622_44_442 | 131 |
| 924 | 3300046664 | Ga0495659_0410978 | Ga0495659_0410978_125_523 | 131 |
| 925 | 3300046665 | Ga0495661_0000735 | Ga0495661_0000735_21772_22170 | 131 |
| 926 | 3300046665 | Ga0495661_0005799 | Ga0495661_0005799_8302_8700 | 131 |
| 927 | 3300046665 | Ga0495661_0019967 | Ga0495661_0019967_729_1127 | 131 |
| 928 | 3300046665 | Ga0495661_0023662 | Ga0495661_0023662_39_437 | 131 |
| 929 | 3300046665 | Ga0495661_0041137 | Ga0495661_0041137_1560_1958 | 131 |
| 930 | 3300046665 | Ga0495661_0112338 | Ga0495661_0112338_977_1375 | 131 |
| 931 | 3300046665 | Ga0495661_0114071 | Ga0495661_0114071_560_958 | 131 |
| 932 | 3300046665 | Ga0495661_0121833 | Ga0495661_0121833_307_705 | 131 |
| 933 | 3300046665 | Ga0495661_0149751 | Ga0495661_0149751_466_864 | 131 |
| 934 | 3300046665 | Ga0495661_0172975 | Ga0495661_0172975_528_926 | 131 |
| 935 | 3300046665 | Ga0495661_0179116 | Ga0495661_0179116_563_961 | 131 |
| 936 | 3300046665 | Ga0495661_0193834 | Ga0495661_0193834_70_468 | 131 |
| 937 | 3300046665 | Ga0495661_0211605 | Ga0495661_0211605_173_571 | 131 |
| 938 | 3300046665 | Ga0495661_0259493 | Ga0495661_0259493_107_505 | 131 |
| 939 | 3300046665 | Ga0495661_0295969 | Ga0495661_0295969_209_607 | 131 |
| 940 | 3300046665 | Ga0495661_0347819 | Ga0495661_0347819_64_462 | 131 |
| 941 | 3300046665 | Ga0495661_0605979 | Ga0495661_0605979_75_473 | 131 |
| 942 | 3300046674 | Ga0495588_0001307 | Ga0495588_0001307_9982_10380 | 131 |
| 943 | 3300046674 | Ga0495588_0018147 | Ga0495588_0018147_2649_3047 | 131 |
| 944 | 3300046674 | Ga0495588_0023088 | Ga0495588_0023088_58_456 | 131 |
| 945 | 3300046674 | Ga0495588_0103688 | Ga0495588_0103688_183_581 | 131 |
| 946 | 3300046674 | Ga0495588_0318725 | Ga0495588_0318725_97_495 | 131 |
| 947 | 3300046674 | Ga0495588_0608483 | Ga0495588_0608483_150_548 | 131 |
| 948 | 3300046674 | Ga0495588_0627666 | Ga0495588_0627666_29_427 | 131 |
| 949 | 3300046679 | Ga0495623_0073538 | Ga0495623_0073538_37_435 | 131 |
| 950 | 3300046679 | Ga0495623_0248424 | Ga0495623_0248424_550_948 | 131 |
| 951 | 3300046680 | Ga0495646_0055084 | Ga0495646_0055084_388_786 | 131 |
| 952 | 3300046680 | Ga0495646_0055444 | Ga0495646_0055444_1023_1421 | 131 |
| 953 | 3300046684 | Ga0495669_0000252 | Ga0495669_0000252_19313_19711 | 131 |
| 954 | 3300046684 | Ga0495669_0001124 | Ga0495669_0001124_9937_10335 | 131 |
| 955 | 3300046684 | Ga0495669_0018087 | Ga0495669_0018087_499_897 | 131 |
| 956 | 3300046684 | Ga0495669_0052302 | Ga0495669_0052302_1424_1822 | 131 |
| 957 | 3300046684 | Ga0495669_0076559 | Ga0495669_0076559_438_836 | 131 |
| 958 | 3300046689 | Ga0495613_0092671 | Ga0495613_0092671_522_920 | 131 |
| 959 | 3300046690 | Ga0495624_0026941 | Ga0495624_0026941_1999_2397 | 131 |
| 960 | 3300046690 | Ga0495624_0227971 | Ga0495624_0227971_208_606 | 131 |
| 961 | 3300046691 | Ga0495670_0001054 | Ga0495670_0001054_10066_10464 | 131 |
| 962 | 3300046691 | Ga0495670_0001812 | Ga0495670_0001812_237_635 | 131 |
| 963 | 3300046691 | Ga0495670_0005293 | Ga0495670_0005293_4102_4500 | 131 |
| 964 | 3300046691 | Ga0495670_0009606 | Ga0495670_0009606_665_1063 | 131 |
| 965 | 3300046691 | Ga0495670_0017049 | Ga0495670_0017049_983_1381 | 131 |
| 966 | 3300046691 | Ga0495670_0020504 | Ga0495670_0020504_2458_2856 | 131 |
| 967 | 3300046691 | Ga0495670_0052475 | Ga0495670_0052475_397_795 | 131 |
| 968 | 3300046691 | Ga0495670_0054543 | Ga0495670_0054543_1171_1569 | 131 |
| 969 | 3300046691 | Ga0495670_0078626 | Ga0495670_0078626_209_607 | 131 |
| 970 | 3300046691 | Ga0495670_0149937 | Ga0495670_0149937_438_836 | 131 |
| 971 | 3300046691 | Ga0495670_0254286 | Ga0495670_0254286_217_615 | 131 |
| 972 | 3300046691 | Ga0495670_0319471 | Ga0495670_0319471_307_705 | 131 |
| 973 | 3300046692 | Ga0495671_0000424 | Ga0495671_0000424_10978_11376 | 131 |
| 974 | 3300046692 | Ga0495671_0001320 | Ga0495671_0001320_15480_15878 | 131 |
| 975 | 3300046692 | Ga0495671_0016501 | Ga0495671_0016501_1562_1960 | 131 |
| 976 | 3300046692 | Ga0495671_0026566 | Ga0495671_0026566_1095_1493 | 131 |
| 977 | 3300046692 | Ga0495671_0102556 | Ga0495671_0102556_74_469 | 131 |
| 978 | 3300046692 | Ga0495671_0464693 | Ga0495671_0464693_36_434 | 131 |
| 979 | 3300046694 | Ga0495649_0000523 | Ga0495649_0000523_5413_5811 | 131 |
| 980 | 3300046694 | Ga0495649_0002046 | Ga0495649_0002046_4276_4674 | 131 |
| 981 | 3300046694 | Ga0495649_0016799 | Ga0495649_0016799_535_933 | 131 |
| 982 | 3300046694 | Ga0495649_0023389 | Ga0495649_0023389_2342_2740 | 131 |
| 983 | 3300046694 | Ga0495649_0045174 | Ga0495649_0045174_44_442 | 131 |
| 984 | 3300046694 | Ga0495649_0129521 | Ga0495649_0129521_378_776 | 131 |
| 985 | 3300046694 | Ga0495649_0167356 | Ga0495649_0167356_720_1118 | 131 |
| 986 | 3300046694 | Ga0495649_0225544 | Ga0495649_0225544_47_445 | 131 |
| 987 | 3300046694 | Ga0495649_0259378 | Ga0495649_0259378_36_434 | 131 |
| 988 | 3300046694 | Ga0495649_0271590 | Ga0495649_0271590_244_642 | 131 |
| 989 | 3300046694 | Ga0495649_0419509 | Ga0495649_0419509_21_419 | 131 |
| 990 | 3300046794 | Ga0495589_0000287 | Ga0495589_0000287_30639_31037 | 131 |
| 991 | 3300046794 | Ga0495589_0001294 | Ga0495589_0001294_607_1005 | 131 |
| 992 | 3300046794 | Ga0495589_0002319 | Ga0495589_0002319_106_504 | 131 |
| 993 | 3300046794 | Ga0495589_0002781 | Ga0495589_0002781_1171_1569 | 131 |
| 994 | 3300046794 | Ga0495589_0004277 | Ga0495589_0004277_342_740 | 131 |
| 995 | 3300046794 | Ga0495589_0021087 | Ga0495589_0021087_2888_3286 | 131 |
| 996 | 3300046794 | Ga0495589_0076113 | Ga0495589_0076113_996_1394 | 131 |
| 997 | 3300046794 | Ga0495589_0103629 | Ga0495589_0103629_472_870 | 131 |
| 998 | 3300046794 | Ga0495589_0127280 | Ga0495589_0127280_785_1183 | 131 |
| 999 | 3300046794 | Ga0495589_0135326 | Ga0495589_0135326_218_616 | 131 |
| 1000 | 3300046794 | Ga0495589_0192920 | Ga0495589_0192920_232_630 | 131 |
| 1001 | 3300046794 | Ga0495589_0357350 | Ga0495589_0357350_94_492 | 131 |
| 1002 | 3300046809 | Ga0495600_0008955 | Ga0495600_0008955_159_557 | 131 |
| 1003 | 3300046810 | Ga0495660_0000854 | Ga0495660_0000854_7865_8263 | 131 |
| 1004 | 3300046810 | Ga0495660_0003129 | Ga0495660_0003129_9259_9657 | 131 |
| 1005 | 3300046810 | Ga0495660_0004100 | Ga0495660_0004100_8125_8523 | 131 |
| 1006 | 3300046810 | Ga0495660_0004487 | Ga0495660_0004487_464_862 | 131 |
| 1007 | 3300046810 | Ga0495660_0007612 | Ga0495660_0007612_4822_5220 | 131 |
| 1008 | 3300046810 | Ga0495660_0012236 | Ga0495660_0012236_769_1167 | 131 |
| 1009 | 3300046810 | Ga0495660_0018978 | Ga0495660_0018978_2989_3387 | 131 |
| 1010 | 3300046810 | Ga0495660_0052346 | Ga0495660_0052346_1274_1672 | 131 |
| 1011 | 3300046810 | Ga0495660_0087187 | Ga0495660_0087187_771_1169 | 131 |
| 1012 | 3300047315 | Ga0495581_0034695 | Ga0495581_0034695_1078_1476 | 131 |
| 1013 | 3300047315 | Ga0495581_0119507 | Ga0495581_0119507_349_747 | 131 |
| 1014 | 3300047315 | Ga0495581_0356603 | Ga0495581_0356603_331_732 | 131 |
| 1015 | 3300047317 | Ga0495604_0005346 | Ga0495604_0005346_139_537 | 131 |
| 1016 | 3300047317 | Ga0495604_0040951 | Ga0495604_0040951_490_888 | 131 |
| 1017 | 3300047318 | Ga0495636_0000144 | Ga0495636_0000144_28351_28749 | 131 |
| 1018 | 3300047318 | Ga0495636_0016357 | Ga0495636_0016357_1491_1889 | 131 |
| 1019 | 3300047318 | Ga0495636_0032030 | Ga0495636_0032030_535_933 | 131 |
| 1020 | 3300047318 | Ga0495636_0054377 | Ga0495636_0054377_23_421 | 131 |
| 1021 | 3300047318 | Ga0495636_0068536 | Ga0495636_0068536_241_639 | 131 |
| 1022 | 3300047318 | Ga0495636_0514888 | Ga0495636_0514888_40_438 | 131 |
| 1023 | 3300047319 | Ga0495674_0079766 | Ga0495674_0079766_2089_2487 | 131 |
| 1024 | 3300047320 | Ga0495672_0000088 | Ga0495672_0000088_146688_147086 | 131 |
| 1025 | 3300047320 | Ga0495672_0000399 | Ga0495672_0000399_10575_10973 | 131 |
| 1026 | 3300047320 | Ga0495672_0000678 | Ga0495672_0000678_7364_7762 | 131 |
| 1027 | 3300047320 | Ga0495672_0000786 | Ga0495672_0000786_23658_24056 | 131 |
| 1028 | 3300047320 | Ga0495672_0000973 | Ga0495672_0000973_19032_19430 | 131 |
| 1029 | 3300047320 | Ga0495672_0011821 | Ga0495672_0011821_3538_3936 | 131 |
| 1030 | 3300047320 | Ga0495672_0130239 | Ga0495672_0130239_364_762 | 131 |
| 1031 | 3300047320 | Ga0495672_0186864 | Ga0495672_0186864_574_972 | 131 |
| 1032 | 3300047321 | Ga0495676_0000097 | Ga0495676_0000097_11209_11607 | 131 |
| 1033 | 3300047321 | Ga0495676_0020339 | Ga0495676_0020339_5151_5549 | 131 |
| 1034 | 3300047321 | Ga0495676_0069415 | Ga0495676_0069415_2031_2429 | 131 |
| 1035 | 3300047321 | Ga0495676_0233306 | Ga0495676_0233306_652_1050 | 131 |
| 1036 | 3300047321 | Ga0495676_0479370 | Ga0495676_0479370_228_626 | 131 |
| 1037 | 3300047322 | Ga0495680_0022418 | Ga0495680_0022418_1745_2143 | 131 |
| 1038 | 3300047322 | Ga0495680_0055476 | Ga0495680_0055476_1121_1519 | 131 |
| 1039 | 3300047323 | Ga0495683_0000336 | Ga0495683_0000336_9281_9679 | 131 |
| 1040 | 3300047323 | Ga0495683_0001078 | Ga0495683_0001078_17280_17678 | 131 |
| 1041 | 3300047323 | Ga0495683_0002603 | Ga0495683_0002603_9875_10273 | 131 |
| 1042 | 3300047323 | Ga0495683_0017527 | Ga0495683_0017527_2553_2951 | 131 |
| 1043 | 3300047323 | Ga0495683_0022140 | Ga0495683_0022140_427_825 | 131 |
| 1044 | 3300047323 | Ga0495683_0038369 | Ga0495683_0038369_562_960 | 131 |
| 1045 | 3300047323 | Ga0495683_0077960 | Ga0495683_0077960_258_656 | 131 |
| 1046 | 3300047323 | Ga0495683_0131427 | Ga0495683_0131427_376_774 | 131 |
| 1047 | 3300047323 | Ga0495683_0344091 | Ga0495683_0344091_213_611 | 131 |
| 1048 | 3300047323 | Ga0495683_0485074 | Ga0495683_0485074_29_427 | 131 |
| 1049 | 3300047443 | Ga0495687_000042 | Ga0495687_000042_9065_9463 | 131 |
| 1050 | 3300047443 | Ga0495687_000115 | Ga0495687_000115_10960_11358 | 131 |
| 1051 | 3300047443 | Ga0495687_000462 | Ga0495687_000462_49285_49683 | 131 |
| 1052 | 3300047443 | Ga0495687_011298 | Ga0495687_011298_2728_3126 | 131 |
| 1053 | 3300047443 | Ga0495687_140466 | Ga0495687_140466_399_797 | 131 |
| 1054 | 3300047443 | Ga0495687_175701 | Ga0495687_175701_48_446 | 131 |
| 1055 | 3300047444 | Ga0495675_0134216 | Ga0495675_0134216_452_850 | 131 |
| 1056 | 3300047445 | Ga0495677_0000657 | Ga0495677_0000657_10640_11038 | 131 |
| 1057 | 3300047445 | Ga0495677_0000678 | Ga0495677_0000678_12263_12661 | 131 |
| 1058 | 3300047445 | Ga0495677_0001177 | Ga0495677_0001177_9854_10252 | 131 |
| 1059 | 3300047445 | Ga0495677_0002717 | Ga0495677_0002717_4886_5284 | 131 |
| 1060 | 3300047445 | Ga0495677_0011353 | Ga0495677_0011353_2633_3031 | 131 |
| 1061 | 3300047445 | Ga0495677_0033250 | Ga0495677_0033250_453_851 | 131 |
| 1062 | 3300047445 | Ga0495677_0034593 | Ga0495677_0034593_1383_1781 | 131 |
| 1063 | 3300047445 | Ga0495677_0076338 | Ga0495677_0076338_736_1134 | 131 |
| 1064 | 3300047445 | Ga0495677_0101941 | Ga0495677_0101941_71_469 | 131 |
| 1065 | 3300047445 | Ga0495677_0126009 | Ga0495677_0126009_425_823 | 131 |
| 1066 | 3300047446 | Ga0495679_005865 | Ga0495679_005865_2556_2954 | 131 |
| 1067 | 3300047446 | Ga0495679_006199 | Ga0495679_006199_2284_2682 | 131 |
| 1068 | 3300047446 | Ga0495679_006853 | Ga0495679_006853_401_799 | 131 |
| 1069 | 3300047446 | Ga0495679_009483 | Ga0495679_009483_151_549 | 131 |
| 1070 | 3300047446 | Ga0495679_018891 | Ga0495679_018891_1694_2092 | 131 |
| 1071 | 3300047447 | Ga0495685_000583 | Ga0495685_000583_10673_11071 | 131 |
| 1072 | 3300047447 | Ga0495685_001534 | Ga0495685_001534_5182_5580 | 131 |
| 1073 | 3300047447 | Ga0495685_001869 | Ga0495685_001869_3021_3419 | 131 |
| 1074 | 3300047447 | Ga0495685_024558 | Ga0495685_024558_1633_2031 | 131 |
| 1075 | 3300047447 | Ga0495685_056289 | Ga0495685_056289_193_591 | 131 |
| 1076 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_9149_9547 | 131 |
| 1077 | 3300047469 | Ga0495673_0019469 | Ga0495673_0019469_2609_3007 | 131 |
| 1078 | 3300047470 | Ga0495681_0000256 | Ga0495681_0000256_32837_33235 | 131 |
| 1079 | 3300047470 | Ga0495681_0000817 | Ga0495681_0000817_5206_5604 | 131 |
| 1080 | 3300047470 | Ga0495681_0002980 | Ga0495681_0002980_10273_10671 | 131 |
| 1081 | 3300047470 | Ga0495681_0005891 | Ga0495681_0005891_185_583 | 131 |
| 1082 | 3300047470 | Ga0495681_0015219 | Ga0495681_0015219_3709_4107 | 131 |
| 1083 | 3300047470 | Ga0495681_0015958 | Ga0495681_0015958_170_568 | 131 |
| 1084 | 3300047470 | Ga0495681_0036382 | Ga0495681_0036382_782_1180 | 131 |
| 1085 | 3300047470 | Ga0495681_0040178 | Ga0495681_0040178_1361_1759 | 131 |
| 1086 | 3300047470 | Ga0495681_0041351 | Ga0495681_0041351_1539_1937 | 131 |
| 1087 | 3300047470 | Ga0495681_0144828 | Ga0495681_0144828_509_907 | 131 |
| 1088 | 3300047470 | Ga0495681_0169332 | Ga0495681_0169332_246_644 | 131 |
| 1089 | 3300047470 | Ga0495681_0306584 | Ga0495681_0306584_103_498 | 131 |
| 1090 | 3300047472 | Ga0495686_0000381 | Ga0495686_0000381_7707_8105 | 131 |
| 1091 | 3300047472 | Ga0495686_0000728 | Ga0495686_0000728_29281_29679 | 131 |
| 1092 | 3300047472 | Ga0495686_0010013 | Ga0495686_0010013_2335_2733 | 131 |
| 1093 | 3300047472 | Ga0495686_0010126 | Ga0495686_0010126_4986_5384 | 131 |
| 1094 | 3300047472 | Ga0495686_0011743 | Ga0495686_0011743_376_774 | 131 |
| 1095 | 3300047472 | Ga0495686_0019102 | Ga0495686_0019102_3935_4333 | 131 |
| 1096 | 3300047472 | Ga0495686_0138098 | Ga0495686_0138098_865_1263 | 131 |
| 1097 | 3300047472 | Ga0495686_0266223 | Ga0495686_0266223_184_582 | 131 |
| 1098 | 3300047673 | Ga0495593_0006881 | Ga0495593_0006881_183_581 | 131 |
| 1099 | 3300047673 | Ga0495593_0032559 | Ga0495593_0032559_1202_1600 | 131 |
| 1100 | 3300047673 | Ga0495593_0039950 | Ga0495593_0039950_1898_2296 | 131 |
| 1101 | 3300048088 | Ga0495602_0350550 | Ga0495602_0350550_306_704 | 131 |
| 1102 | 3300048089 | Ga0495614_0001960 | Ga0495614_0001960_3723_4121 | 131 |
| 1103 | 3300048089 | Ga0495614_0043778 | Ga0495614_0043778_719_1117 | 131 |
| 1104 | 3300048089 | Ga0495614_0268861 | Ga0495614_0268861_266_664 | 131 |
| 1105 | 3300048090 | Ga0495615_0001225 | Ga0495615_0001225_411_809 | 131 |
| 1106 | 3300048090 | Ga0495615_0002308 | Ga0495615_0002308_2577_2975 | 131 |
| 1107 | 3300048091 | Ga0495626_0003681 | Ga0495626_0003681_8426_8824 | 131 |
| 1108 | 3300048091 | Ga0495626_0005800 | Ga0495626_0005800_62_460 | 131 |
| 1109 | 3300048091 | Ga0495626_0005864 | Ga0495626_0005864_4817_5215 | 131 |
| 1110 | 3300048091 | Ga0495626_0007150 | Ga0495626_0007150_5264_5662 | 131 |
| 1111 | 3300048091 | Ga0495626_0007568 | Ga0495626_0007568_551_949 | 131 |
| 1112 | 3300048091 | Ga0495626_0008641 | Ga0495626_0008641_1812_2210 | 131 |
| 1113 | 3300048091 | Ga0495626_0022977 | Ga0495626_0022977_2180_2578 | 131 |
| 1114 | 3300048091 | Ga0495626_0031119 | Ga0495626_0031119_1728_2126 | 131 |
| 1115 | 3300048091 | Ga0495626_0034465 | Ga0495626_0034465_157_555 | 131 |
| 1116 | 3300048091 | Ga0495626_0038564 | Ga0495626_0038564_425_823 | 131 |
| 1117 | 3300048091 | Ga0495626_0056037 | Ga0495626_0056037_1242_1640 | 131 |
| 1118 | 3300048091 | Ga0495626_0071056 | Ga0495626_0071056_562_960 | 131 |
| 1119 | 3300048091 | Ga0495626_0074360 | Ga0495626_0074360_935_1333 | 131 |
| 1120 | 3300048091 | Ga0495626_0090512 | Ga0495626_0090512_181_579 | 131 |
| 1121 | 3300048903 | Ga0496100_0030576 | Ga0496100_0030576_282_680 | 131 |
| 1122 | 3300048903 | Ga0496100_0164220 | Ga0496100_0164220_453_848 | 131 |
| 1123 | 3300048903 | Ga0496100_0706574 | Ga0496100_0706574_255_653 | 131 |
| 1124 | 3300048903 | Ga0496100_1241066 | Ga0496100_1241066_57_455 | 131 |
| 1125 | 3300048904 | Ga0496101_0074104 | Ga0496101_0074104_1787_2185 | 131 |
| 1126 | 3300048905 | Ga0496102_0000611 | Ga0496102_0000611_23230_23628 | 131 |
| 1127 | 3300048905 | Ga0496102_0000872 | Ga0496102_0000872_18108_18506 | 131 |
| 1128 | 3300048905 | Ga0496102_0004929 | Ga0496102_0004929_525_923 | 131 |
| 1129 | 3300048905 | Ga0496102_0063145 | Ga0496102_0063145_172_570 | 131 |
| 1130 | 3300048905 | Ga0496102_0387678 | Ga0496102_0387678_589_987 | 131 |
| 1131 | 3300048905 | Ga0496102_0603355 | Ga0496102_0603355_10_408 | 131 |
| 1132 | 3300048905 | Ga0496102_0681437 | Ga0496102_0681437_276_674 | 131 |
| 1133 | 3300048905 | Ga0496102_1178735 | Ga0496102_1178735_87_485 | 131 |
| 1134 | 3300048906 | Ga0496103_0003038 | Ga0496103_0003038_5105_5503 | 131 |
| 1135 | 3300048906 | Ga0496103_0015907 | Ga0496103_0015907_135_533 | 131 |
| 1136 | 3300048906 | Ga0496103_0028550 | Ga0496103_0028550_418_816 | 131 |
| 1137 | 3300048906 | Ga0496103_0217923 | Ga0496103_0217923_228_626 | 131 |
| 1138 | 3300048907 | Ga0496104_0628709 | Ga0496104_0628709_136_534 | 131 |
| 1139 | 3300048907 | Ga0496104_1211695 | Ga0496104_1211695_167_565 | 131 |
| 1140 | 3300048908 | Ga0496105_0131174 | Ga0496105_0131174_1338_1736 | 131 |
| 1141 | 3300048909 | Ga0496106_0312966 | Ga0496106_0312966_236_634 | 131 |
| 1142 | 3300048909 | Ga0496106_1272618 | Ga0496106_1272618_63_461 | 131 |
| 1143 | 3300048910 | Ga0496107_0085649 | Ga0496107_0085649_294_692 | 131 |
| 1144 | 3300048911 | Ga0496108_0292477 | Ga0496108_0292477_377_775 | 131 |
| 1145 | 3300048911 | Ga0496108_1459396 | Ga0496108_1459396_101_499 | 131 |
| 1146 | 3300048912 | Ga0496109_0263546 | Ga0496109_0263546_566_964 | 131 |
| 1147 | 3300048912 | Ga0496109_1407039 | Ga0496109_1407039_123_521 | 131 |
| 1148 | 3300048913 | Ga0496110_0004109 | Ga0496110_0004109_10450_10848 | 131 |
| 1149 | 3300048913 | Ga0496110_0471218 | Ga0496110_0471218_166_564 | 131 |
| 1150 | 3300048913 | Ga0496110_0804326 | Ga0496110_0804326_66_464 | 131 |
| 1151 | 3300048914 | Ga0496111_0650486 | Ga0496111_0650486_73_474 | 131 |
| 1152 | 3300048914 | Ga0496111_0758914 | Ga0496111_0758914_130_528 | 131 |
| 1153 | 3300048915 | Ga0496112_0392590 | Ga0496112_0392590_366_764 | 131 |
| 1154 | 3300048916 | Ga0496113_0456442 | Ga0496113_0456442_467_865 | 131 |
| 1155 | 3300048917 | Ga0496114_0815196 | Ga0496114_0815196_355_753 | 131 |
| 1156 | 3300048918 | Ga0496115_0691737 | Ga0496115_0691737_297_692 | 131 |
| 1157 | 3300048918 | Ga0496115_0975540 | Ga0496115_0975540_169_567 | 131 |
| 1158 | 3300048924 | Ga0496121_0148417 | Ga0496121_0148417_1195_1590 | 131 |
| 1159 | 3300048925 | Ga0496122_0000980 | Ga0496122_0000980_10298_10696 | 131 |
| 1160 | 3300048926 | Ga0496123_0004729 | Ga0496123_0004729_10790_11188 | 131 |
| 1161 | 3300048927 | Ga0496124_0003562 | Ga0496124_0003562_682_1080 | 131 |
| 1162 | 3300048927 | Ga0496124_0145794 | Ga0496124_0145794_615_1013 | 131 |
| 1163 | 3300048927 | Ga0496124_0320269 | Ga0496124_0320269_452_850 | 131 |
| 1164 | 3300048927 | Ga0496124_0494096 | Ga0496124_0494096_126_524 | 131 |
| 1165 | 3300048928 | Ga0496125_0005645 | Ga0496125_0005645_2800_3198 | 131 |
| 1166 | 3300049459 | Ga0495678_000202 | Ga0495678_000202_9900_10298 | 131 |
| 1167 | 3300049459 | Ga0495678_000403 | Ga0495678_000403_32945_33343 | 131 |
| 1168 | 3300049459 | Ga0495678_000622 | Ga0495678_000622_32358_32756 | 131 |
| 1169 | 3300049459 | Ga0495678_002745 | Ga0495678_002745_10949_11347 | 131 |
| 1170 | 3300049459 | Ga0495678_002792 | Ga0495678_002792_414_812 | 131 |
| 1171 | 3300049459 | Ga0495678_011469 | Ga0495678_011469_1066_1464 | 131 |
| 1172 | 3300049459 | Ga0495678_095797 | Ga0495678_095797_320_718 | 131 |
| 1173 | 3300049459 | Ga0495678_118467 | Ga0495678_118467_176_574 | 131 |
| 1174 | 3300049459 | Ga0495678_127104 | Ga0495678_127104_249_647 | 131 |
| 1175 | 3300049460 | Ga0495682_0000578 | Ga0495682_0000578_10243_10641 | 131 |
| 1176 | 3300049460 | Ga0495682_0002545 | Ga0495682_0002545_3493_3891 | 131 |
| 1177 | 3300049460 | Ga0495682_0018478 | Ga0495682_0018478_366_764 | 131 |
| 1178 | 3300049460 | Ga0495682_0030501 | Ga0495682_0030501_308_706 | 131 |
| 1179 | 3300049460 | Ga0495682_0100229 | Ga0495682_0100229_592_990 | 131 |
| 1180 | 3300049460 | Ga0495682_0158351 | Ga0495682_0158351_30_428 | 131 |
| 1181 | 3300049513 | Ga0501290_082565 | Ga0501290_082565_88_489 | 131 |
| 1182 | 3300049665 | Ga0501227_027817 | Ga0501227_027817_342_740 | 131 |
| 1183 | 3300049665 | Ga0501227_125581 | Ga0501227_125581_129_527 | 131 |
| 1184 | 3300049667 | Ga0501230_000096 | Ga0501230_000096_3299_3697 | 131 |
| 1185 | 3300049669 | Ga0501235_022748 | Ga0501235_022748_349_747 | 131 |
| 1186 | 3300049671 | Ga0501238_004691 | Ga0501238_004691_721_1119 | 131 |
| 1187 | 3300049671 | Ga0501238_010894 | Ga0501238_010894_57_452 | 131 |
| 1188 | 3300049671 | Ga0501238_043335 | Ga0501238_043335_44_439 | 131 |
| 1189 | 3300049679 | Ga0501249_020014 | Ga0501249_020014_426_824 | 131 |
| 1190 | 3300049706 | Ga0501229_009621 | Ga0501229_009621_244_642 | 131 |
| 1191 | 3300049707 | Ga0501234_014102 | Ga0501234_014102_698_1096 | 131 |
| 1192 | 3300049758 | Ga0501241_090460 | Ga0501241_090460_11_409 | 131 |
| 1193 | 3300049760 | Ga0501263_031533 | Ga0501263_031533_333_731 | 131 |
| 1194 | 3300049766 | Ga0501269_000353 | Ga0501269_000353_10377_10775 | 131 |
| 1195 | 3300049766 | Ga0501269_008408 | Ga0501269_008408_291_689 | 131 |
| 1196 | 3300049775 | Ga0501279_001525 | Ga0501279_001525_2586_2984 | 131 |
| 1197 | 3300049775 | Ga0501279_002615 | Ga0501279_002615_636_1034 | 131 |
| 1198 | 3300049822 | Ga0501035_0443186 | Ga0501035_0443186_329_730 | 131 |
| 1199 | 3300049850 | Ga0501204_017306 | Ga0501204_017306_439_837 | 131 |
| 1200 | 3300049852 | Ga0501220_00384 | Ga0501220_00384_256_654 | 131 |
| 1201 | 3300050489 | nmdc:mga03683_325506_c1 | nmdc:mga03683_325506_c1_18_413 | 131 |
| 1202 | 3300050489 | nmdc:mga03683_47155_c1 | nmdc:mga03683_47155_c1_799_1197 | 131 |
| 1203 | 3300050493 | nmdc:mga0k408_136862_c1 | nmdc:mga0k408_136862_c1_35_433 | 131 |
| 1204 | 3300050493 | nmdc:mga0k408_270410_c1 | nmdc:mga0k408_270410_c1_162_557 | 131 |
| 1205 | 3300050493 | nmdc:mga0k408_275845_c1 | nmdc:mga0k408_275845_c1_21_416 | 131 |
| 1206 | 3300050493 | nmdc:mga0k408_3495_c1 | nmdc:mga0k408_3495_c1_2014_2412 | 131 |
| 1207 | 3300050493 | nmdc:mga0k408_36281_c1 | nmdc:mga0k408_36281_c1_1397_1846 | 131 |
| 1208 | 3300050494 | nmdc:mga06z11_197113_c1 | nmdc:mga06z11_197113_c1_740_1138 | 131 |
| 1209 | 3300050494 | nmdc:mga06z11_842585_c1 | nmdc:mga06z11_842585_c1_144_539 | 131 |
| 1210 | 3300050495 | nmdc:mga04h51_214698_c1 | nmdc:mga04h51_214698_c1_139_534 | 131 |
| 1211 | 3300050496 | nmdc:mga07m45_162482_c1 | nmdc:mga07m45_162482_c1_24_422 | 131 |
| 1212 | 3300050496 | nmdc:mga07m45_2604_c3 | nmdc:mga07m45_2604_c3_1288_1686 | 131 |
| 1213 | 3300050507 | nmdc:mga05p37_1079746_c1 | nmdc:mga05p37_1079746_c1_281_691 | 131 |
| 1214 | 3300050513 | nmdc:mga0rr50_1402034_c1 | nmdc:mga0rr50_1402034_c1_161_559 | 131 |
| 1215 | 3300053086 | Ga0500578_0000417 | Ga0500578_0000417_25872_26270 | 131 |
| 1216 | 3300053105 | Ga0500557_225440 | Ga0500557_225440_184_582 | 131 |
| 1217 | 3300053125 | Ga0500618_010710 | Ga0500618_010710_147_545 | 131 |
| 1218 | 3300053145 | Ga0500586_008708 | Ga0500586_008708_322_720 | 131 |
| 1219 | 3300053151 | Ga0500604_0122715 | Ga0500604_0122715_204_602 | 131 |
| 1220 | 3300053154 | Ga0500619_000069 | Ga0500619_000069_26877_27275 | 131 |
| 1221 | 3300053157 | Ga0500624_008318 | Ga0500624_008318_628_1023 | 131 |
| 1222 | 3300053158 | Ga0500627_0127750 | Ga0500627_0127750_206_604 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3v9o-assembly1.cif.gz_A | crystal structure of dihydroneopterin aldolase (bth_i0291) from burkholderia thailendensis bound to guanine. | 0.958 | 5 | 130 |
| 3v9o-assembly1.cif.gz_A | crystal structure of dihydroneopterin aldolase (bth_i0291) from burkholderia thailendensis bound to guanine. | 0.9427 | 5 | 130 |
| 7su7-assembly1.cif.gz_D | dihydroneopterin aldolase (dhna) from yersinia pestis co-crystallized with product | 0.9164 | 13 | 129 |
| 7su6-assembly1.cif.gz_C | dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin | 0.9153 | 13 | 130 |
| 7su4-assembly1.cif.gz_C-2 | dihydroneopterin aldolase (dhna) tyr53phe from yersinia pestis co-crystallized with 7,8-dihydroneopterin | 0.9135 | 13 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3v9oA00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.958 | 5 | 130 | 3.30.1130.10 |
| 3v9oA00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9427 | 5 | 130 | 3.30.1130.10 |
| 2o9mC00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8996 | 14 | 131 | 3.30.1130.10 |
| 1b9lH00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8938 | 12 | 129 | 3.30.1130.10 |
| 2o9mC00 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.8855 | 14 | 131 | 3.30.1130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D3P5Y1-F1-model_v4 | dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) | 0.9606 | 13 | 130 |
GO:0004150
GO:0005737 GO:0006760 |
| AF-A0A4Y8ML71-F1-model_v4 | Dihydroneopterin aldolase | 0.9605 | 8 | 130 |
GO:0004150
GO:0006760 |
| AF-H5WKR1-F1-model_v4 | dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) | 0.9571 | 1 | 130 |
GO:0004150
GO:0005737 GO:0046656 |
| AF-A0A7C8BGS9-F1-model_v4 | deleted | 0.9561 | 13 | 130 |
|
| AF-A0A839HKL2-F1-model_v4 | Dihydroneopterin aldolase | 0.9551 | 5 | 131 |
GO:0004150
GO:0006760 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar