F491855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1221 | 680 | 995 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300035724|Ga0373933_0076006|Ga0373933_0076006_814_1518 |
| Length | 234 |
| Sequence | MGQLISIRRPDGGTCPAYVNTDAGAGAPGVVVIQEWWGLNEQIKKTADRFAKAGYRALVPDLYRGKLASNADEASHMMNHLDFADAADQDLQGAVNHLRAESKGAVSAAGPRIGVAGFCMGGALTILSALRVKGVAAGACFYGIPPKAFANPADLAIPMILHFANTDDWCTPKLVDELEAELRRSKSKFELYRYDAEHAFMNEARPEVYEPKSAQLAWDRTQKFFDQALARQAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 29 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 66 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 67 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 68 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 69 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 70 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 80 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 81 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 82 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 83 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 84 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 92 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 93 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 94 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 95 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 96 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 97 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 98 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 99 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 100 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 101 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 102 | 2904699407 | |||
| 103 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 104 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 105 | 2906610324 | |||
| 106 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 107 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 108 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 109 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 110 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 111 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 112 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 113 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 114 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 115 | 2922368715 | |||
| 116 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 117 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 118 | 2922425934 | |||
| 119 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 120 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 121 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 122 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 123 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 124 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 125 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 126 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 127 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 128 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 129 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 130 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 131 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 132 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 133 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 134 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 135 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 136 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 137 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 138 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 139 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 140 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 141 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 142 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 143 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 144 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 145 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 146 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 147 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 148 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 149 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 150 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 151 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 152 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 153 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 154 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 155 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 156 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 157 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 158 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 159 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 160 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 161 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 162 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 163 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 164 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 165 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 166 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 167 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 168 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 169 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 170 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 171 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 172 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 173 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 174 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 175 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 176 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 177 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 178 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 179 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 180 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 181 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 182 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 183 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 184 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 185 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 186 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 187 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 188 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 189 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 190 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 191 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 192 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 193 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 194 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 195 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 196 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 199 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 204 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 205 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 206 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 207 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 208 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 216 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 217 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 223 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 227 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 228 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 230 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 232 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 233 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 234 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 235 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 236 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 240 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 241 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 242 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 243 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 244 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 245 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 246 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 247 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 248 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 249 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 250 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 251 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 252 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 253 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 254 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 256 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 257 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 258 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 259 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 260 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 263 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 264 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 265 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 266 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 268 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 269 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 270 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 271 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 272 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 273 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 274 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 276 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 277 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 278 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 279 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 280 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 281 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 282 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 295 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 298 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 311 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 313 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 314 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 315 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 316 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 317 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 318 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 319 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 320 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 321 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 323 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 327 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 328 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 330 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 386 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 387 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 388 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 389 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 391 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 395 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 396 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 397 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 398 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 399 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 400 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 401 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 402 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 403 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 404 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 405 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 406 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 407 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 408 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 409 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 410 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 411 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 412 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 413 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 414 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 415 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 416 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 417 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 418 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 419 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 420 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 421 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 422 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 423 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 424 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 425 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 426 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 427 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 428 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 429 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 430 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 431 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 432 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 433 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 434 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 435 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 436 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 437 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 438 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 439 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 440 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 441 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 442 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 443 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 444 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 445 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 446 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 447 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 448 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 449 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 450 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 451 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 452 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 453 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 454 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 455 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 456 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 457 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 458 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 459 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 528 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 530 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 531 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 532 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 533 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 534 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 535 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 536 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 537 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 538 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 539 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 540 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 541 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 542 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 543 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 544 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 545 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 546 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 547 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 548 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 549 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 550 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 551 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 552 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 553 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 554 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 557 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 573 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 574 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 575 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 576 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 577 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 578 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 579 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 580 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 582 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 583 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 586 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 589 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 590 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 593 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 595 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 596 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 597 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 598 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 599 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 600 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 601 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 602 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 603 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 604 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 605 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 606 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 607 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 608 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 609 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 610 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 611 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 612 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 613 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 614 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 615 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 616 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 617 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 618 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 619 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 620 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 621 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 622 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 623 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 624 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 625 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 626 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 627 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 628 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 629 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 630 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 631 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 632 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 633 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 634 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 635 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 636 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 637 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 638 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 639 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 640 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 642 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 644 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 645 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 646 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 647 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 648 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 649 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 650 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 651 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 652 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 653 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 654 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 655 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 656 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 657 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 658 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 659 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 660 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 661 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 662 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 663 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 664 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 665 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 666 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 667 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 668 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 669 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 670 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 671 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 672 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 673 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 674 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 675 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 676 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 677 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 678 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 679 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 680 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.41 |
| Metatranscriptomes | 0.41 |
| Isolates | 18.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.45 |
| Nodule | 14.82 |
| Rhizoplane | 5 |
| Rhizosphere | 55.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10031895 | 3300001989 | Bacteria | 1817 |
| 2 | JGI25406J46586_10000449 | 3300003203 | Bacteria | 19106 |
| 3 | JGI25165J46597_1014521 | 3300003214 | Bacteria | 1071 |
| 4 | JGI25165J46597_1024683 | 3300003214 | Bacteria | 780 |
| 5 | JGI25153J46596_10009921 | 3300003215 | Bacteria | 4363 |
| 6 | JGI25153J46596_10010561 | 3300003215 | Bacteria | 4165 |
| 7 | JGI25160J50197_1001648 | 3300003354 | Bacteria | 10920 |
| 8 | JGI25160J50197_1002130 | 3300003354 | Bacteria | 9392 |
| 9 | JGI25160J50197_1019345 | 3300003354 | Bacteria | 2090 |
| 10 | JGI25160J50197_1047548 | 3300003354 | Bacteria | 933 |
| 11 | JGI25404J52841_10001620 | 3300003659 | Bacteria | 4022 |
| 12 | Ga0055529_1007195 | 3300003763 | Bacteria | 1523 |
| 13 | Ga0055531_10010882 | 3300003794 | Bacteria | 4465 |
| 14 | JGI25405J52794_10024657 | 3300003911 | Bacteria | 1229 |
| 15 | Ga0055543_1003126 | 3300004625 | Bacteria | 5068 |
| 16 | Ga0055543_1009210 | 3300004625 | Bacteria | 2137 |
| 17 | Ga0065165_1001015 | 3300005262 | Bacteria | 34129 |
| 18 | Ga0065165_1003915 | 3300005262 | Bacteria | 9828 |
| 19 | Ga0065165_1005320 | 3300005262 | Bacteria | 7316 |
| 20 | Ga0065165_1005972 | 3300005262 | Bacteria | 6580 |
| 21 | Ga0065165_1024939 | 3300005262 | Bacteria | 1998 |
| 22 | Ga0070658_10104328 | 3300005327 | Bacteria | 2345 |
| 23 | Ga0070658_10143011 | 3300005327 | Bacteria | 1999 |
| 24 | Ga0070658_10235014 | 3300005327 | Bacteria | 1553 |
| 25 | Ga0070683_100233918 | 3300005329 | Bacteria | 1747 |
| 26 | Ga0070683_100524586 | 3300005329 | Bacteria | 1132 |
| 27 | Ga0070690_100068847 | 3300005330 | Bacteria | 2296 |
| 28 | Ga0068869_100330842 | 3300005334 | Bacteria | 1238 |
| 29 | Ga0070680_100113146 | 3300005336 | Bacteria | 2260 |
| 30 | Ga0070682_100041329 | 3300005337 | Bacteria | 2842 |
| 31 | Ga0070682_100044975 | 3300005337 | Bacteria | 2735 |
| 32 | Ga0070682_100318574 | 3300005337 | Bacteria | 1148 |
| 33 | Ga0070682_100427868 | 3300005337 | Bacteria | 1008 |
| 34 | Ga0068868_100025479 | 3300005338 | Bacteria | 4499 |
| 35 | Ga0070660_100011831 | 3300005339 | Bacteria | 6216 |
| 36 | Ga0070661_100052521 | 3300005344 | Bacteria | 2983 |
| 37 | Ga0070661_100088122 | 3300005344 | Bacteria | 2297 |
| 38 | Ga0070661_100106546 | 3300005344 | Bacteria | 2090 |
| 39 | Ga0070661_100265363 | 3300005344 | Bacteria | 1328 |
| 40 | Ga0070692_10288427 | 3300005345 | Bacteria | 998 |
| 41 | Ga0070668_100100152 | 3300005347 | Bacteria | 2295 |
| 42 | Ga0070668_100634462 | 3300005347 | Bacteria | 937 |
| 43 | Ga0070669_100171320 | 3300005353 | Bacteria | 1692 |
| 44 | Ga0070671_100086849 | 3300005355 | Bacteria | 2617 |
| 45 | Ga0070671_100170800 | 3300005355 | Bacteria | 1839 |
| 46 | Ga0070659_100312806 | 3300005366 | Bacteria | 1312 |
| 47 | Ga0070659_100579541 | 3300005366 | Bacteria | 962 |
| 48 | Ga0070703_10045888 | 3300005406 | Bacteria | 1380 |
| 49 | Ga0070709_10000778 | 3300005434 | Bacteria | 17844 |
| 50 | Ga0070709_10007154 | 3300005434 | Bacteria | 6111 |
| 51 | Ga0070709_10013044 | 3300005434 | Bacteria | 4665 |
| 52 | Ga0070709_10175986 | 3300005434 | Bacteria | 1499 |
| 53 | Ga0070709_10378686 | 3300005434 | Bacteria | 1052 |
| 54 | Ga0070714_100013419 | 3300005435 | Bacteria | 6566 |
| 55 | Ga0070714_100031338 | 3300005435 | Bacteria | 4435 |
| 56 | Ga0070714_100270133 | 3300005435 | Bacteria | 1577 |
| 57 | Ga0070714_100310108 | 3300005435 | Bacteria | 1473 |
| 58 | Ga0070714_100367633 | 3300005435 | Bacteria | 1353 |
| 59 | Ga0070714_100997170 | 3300005435 | Bacteria | 815 |
| 60 | Ga0070713_100025862 | 3300005436 | Bacteria | 4597 |
| 61 | Ga0070713_100171302 | 3300005436 | Bacteria | 1945 |
| 62 | Ga0070713_100273775 | 3300005436 | Bacteria | 1547 |
| 63 | Ga0070713_100310055 | 3300005436 | Bacteria | 1455 |
| 64 | Ga0070713_100557115 | 3300005436 | Bacteria | 1086 |
| 65 | Ga0070710_10004897 | 3300005437 | Bacteria | 6337 |
| 66 | Ga0070710_10009727 | 3300005437 | Bacteria | 4709 |
| 67 | Ga0070710_10298032 | 3300005437 | Bacteria | 1051 |
| 68 | Ga0070711_100005828 | 3300005439 | Bacteria | 7394 |
| 69 | Ga0070711_100051265 | 3300005439 | Bacteria | 2833 |
| 70 | Ga0070711_100054196 | 3300005439 | Bacteria | 2767 |
| 71 | Ga0070711_100228645 | 3300005439 | Bacteria | 1449 |
| 72 | Ga0070711_100408992 | 3300005439 | Bacteria | 1103 |
| 73 | Ga0070700_100117728 | 3300005441 | Bacteria | 1775 |
| 74 | Ga0070694_100225499 | 3300005444 | Bacteria | 1407 |
| 75 | Ga0070708_100127678 | 3300005445 | Bacteria | 2352 |
| 76 | Ga0070663_100036220 | 3300005455 | Bacteria | 3428 |
| 77 | Ga0070663_100059522 | 3300005455 | Bacteria | 2745 |
| 78 | Ga0070663_100379740 | 3300005455 | Bacteria | 1150 |
| 79 | Ga0070662_100143125 | 3300005457 | Bacteria | 1855 |
| 80 | Ga0070681_10048974 | 3300005458 | Bacteria | 4220 |
| 81 | Ga0070681_10063856 | 3300005458 | Bacteria | 3655 |
| 82 | Ga0070681_10143228 | 3300005458 | Bacteria | 2319 |
| 83 | Ga0070681_10355721 | 3300005458 | Bacteria | 1375 |
| 84 | Ga0070681_10383361 | 3300005458 | Bacteria | 1316 |
| 85 | Ga0068867_100175184 | 3300005459 | Bacteria | 1702 |
| 86 | Ga0070685_10499638 | 3300005466 | Bacteria | 860 |
| 87 | Ga0070706_100103899 | 3300005467 | Bacteria | 2642 |
| 88 | Ga0070706_100590125 | 3300005467 | Bacteria | 1033 |
| 89 | Ga0070698_100029876 | 3300005471 | Bacteria | 5655 |
| 90 | Ga0070698_100516437 | 3300005471 | Bacteria | 1133 |
| 91 | Ga0070679_100013103 | 3300005530 | Bacteria | 7940 |
| 92 | Ga0070679_100025223 | 3300005530 | Bacteria | 5831 |
| 93 | Ga0070679_100074795 | 3300005530 | Bacteria | 3378 |
| 94 | Ga0070684_100013479 | 3300005535 | Bacteria | 6594 |
| 95 | Ga0070684_100024449 | 3300005535 | Bacteria | 5068 |
| 96 | Ga0070684_100085868 | 3300005535 | Bacteria | 2791 |
| 97 | Ga0070684_101094621 | 3300005535 | Bacteria | 749 |
| 98 | Ga0070697_100014896 | 3300005536 | Bacteria | 6103 |
| 99 | Ga0070697_100694497 | 3300005536 | Bacteria | 898 |
| 100 | Ga0068853_100014418 | 3300005539 | Bacteria | 6471 |
| 101 | Ga0068853_100021360 | 3300005539 | Bacteria | 5396 |
| 102 | Ga0068853_100047626 | 3300005539 | Bacteria | 3679 |
| 103 | Ga0068853_100208234 | 3300005539 | Bacteria | 1782 |
| 104 | Ga0070686_100056153 | 3300005544 | Bacteria | 2525 |
| 105 | Ga0070693_100023630 | 3300005547 | Bacteria | 3288 |
| 106 | Ga0070665_100109075 | 3300005548 | Bacteria | 2770 |
| 107 | Ga0070665_100168214 | 3300005548 | Bacteria | 2194 |
| 108 | Ga0070665_100192798 | 3300005548 | Bacteria | 2038 |
| 109 | Ga0070665_100357872 | 3300005548 | Bacteria | 1465 |
| 110 | Ga0070704_100137184 | 3300005549 | Bacteria | 1905 |
| 111 | Ga0068855_100054688 | 3300005563 | Bacteria | 4691 |
| 112 | Ga0068855_100055771 | 3300005563 | Bacteria | 4639 |
| 113 | Ga0068855_100103512 | 3300005563 | Bacteria | 3275 |
| 114 | Ga0068855_100127380 | 3300005563 | Bacteria | 2910 |
| 115 | Ga0068855_100593765 | 3300005563 | Bacteria | 1195 |
| 116 | Ga0068857_100074421 | 3300005577 | Bacteria | 3026 |
| 117 | Ga0068857_100308188 | 3300005577 | Bacteria | 1460 |
| 118 | Ga0068854_100060797 | 3300005578 | Bacteria | 2734 |
| 119 | Ga0068856_100000477 | 3300005614 | Bacteria | 44284 |
| 120 | Ga0068856_100129762 | 3300005614 | Bacteria | 2525 |
| 121 | Ga0068856_100174968 | 3300005614 | Bacteria | 2159 |
| 122 | Ga0068852_100030147 | 3300005616 | Bacteria | 4462 |
| 123 | Ga0068852_100073061 | 3300005616 | Bacteria | 3016 |
| 124 | Ga0068852_100094876 | 3300005616 | Bacteria | 2677 |
| 125 | Ga0068852_100613723 | 3300005616 | Bacteria | 1093 |
| 126 | Ga0068859_100439993 | 3300005617 | Bacteria | 1400 |
| 127 | Ga0068864_100319617 | 3300005618 | Bacteria | 1458 |
| 128 | Ga0068861_100399328 | 3300005719 | Bacteria | 1219 |
| 129 | Ga0068861_100454382 | 3300005719 | Bacteria | 1148 |
| 130 | Ga0068851_10003264 | 3300005834 | Bacteria | 7194 |
| 131 | Ga0068851_10044749 | 3300005834 | Bacteria | 2236 |
| 132 | Ga0068851_10102036 | 3300005834 | Bacteria | 1523 |
| 133 | Ga0068851_10416438 | 3300005834 | Bacteria | 793 |
| 134 | Ga0068860_100000324 | 3300005843 | Bacteria | 64920 |
| 135 | Ga0068860_100240384 | 3300005843 | Bacteria | 1761 |
| 136 | Ga0068860_100624935 | 3300005843 | Bacteria | 1084 |
| 137 | Ga0068862_100112944 | 3300005844 | Bacteria | 2386 |
| 138 | Ga0068862_100567855 | 3300005844 | Bacteria | 1085 |
| 139 | Ga0081455_10001871 | 3300005937 | Bacteria | 25308 |
| 140 | Ga0081455_10011253 | 3300005937 | Bacteria | 9002 |
| 141 | Ga0081455_10016763 | 3300005937 | Bacteria | 7051 |
| 142 | Ga0081455_10022225 | 3300005937 | Bacteria | 5933 |
| 143 | Ga0081455_10044838 | 3300005937 | Bacteria | 3852 |
| 144 | Ga0081455_10097121 | 3300005937 | Bacteria | 2374 |
| 145 | Ga0081455_10103018 | 3300005937 | Bacteria | 2287 |
| 146 | Ga0081455_10331051 | 3300005937 | Bacteria | 1081 |
| 147 | Ga0081538_10016530 | 3300005981 | Bacteria | 5651 |
| 148 | Ga0081538_10114658 | 3300005981 | Bacteria | 1312 |
| 149 | Ga0081538_10118419 | 3300005981 | Unclassified | 1280 |
| 150 | Ga0081540_1004943 | 3300005983 | Bacteria | 10022 |
| 151 | Ga0081540_1012323 | 3300005983 | Bacteria | 5643 |
| 152 | Ga0081540_1012929 | 3300005983 | Bacteria | 5455 |
| 153 | Ga0081540_1013478 | 3300005983 | Bacteria | 5310 |
| 154 | Ga0081540_1014993 | 3300005983 | Bacteria | 4926 |
| 155 | Ga0081540_1064646 | 3300005983 | Bacteria | 1725 |
| 156 | Ga0081540_1093158 | 3300005983 | Bacteria | 1320 |
| 157 | Ga0081540_1100486 | 3300005983 | Bacteria | 1247 |
| 158 | Ga0081539_10000306 | 3300005985 | Bacteria | 110402 |
| 159 | Ga0081539_10001290 | 3300005985 | Bacteria | 44006 |
| 160 | Ga0081539_10026446 | 3300005985 | Bacteria | 3703 |
| 161 | Ga0070717_10000521 | 3300006028 | Bacteria | 24353 |
| 162 | Ga0070717_10024234 | 3300006028 | Bacteria | 4816 |
| 163 | Ga0070717_10047558 | 3300006028 | Bacteria | 3516 |
| 164 | Ga0070717_10560528 | 3300006028 | Bacteria | 1035 |
| 165 | Ga0070717_10732517 | 3300006028 | Bacteria | 899 |
| 166 | Ga0075365_10049232 | 3300006038 | Bacteria | 2776 |
| 167 | Ga0075365_10069084 | 3300006038 | Bacteria | 2374 |
| 168 | Ga0075365_10101316 | 3300006038 | Bacteria | 1972 |
| 169 | Ga0075365_10216737 | 3300006038 | Bacteria | 1342 |
| 170 | Ga0075365_10246154 | 3300006038 | Bacteria | 1256 |
| 171 | Ga0075365_10250170 | 3300006038 | Bacteria | 1245 |
| 172 | Ga0075365_10313357 | 3300006038 | Bacteria | 1105 |
| 173 | Ga0075363_100173605 | 3300006048 | Bacteria | 1224 |
| 174 | Ga0075364_10263690 | 3300006051 | Bacteria | 1171 |
| 175 | Ga0075432_10080907 | 3300006058 | Bacteria | 1178 |
| 176 | Ga0070715_10006756 | 3300006163 | Bacteria | 3915 |
| 177 | Ga0070715_10021529 | 3300006163 | Bacteria | 2502 |
| 178 | Ga0070715_10117296 | 3300006163 | Bacteria | 1264 |
| 179 | Ga0070716_100012501 | 3300006173 | Bacteria | 4305 |
| 180 | Ga0070716_100045303 | 3300006173 | Bacteria | 2469 |
| 181 | Ga0070716_100051114 | 3300006173 | Bacteria | 2348 |
| 182 | Ga0070712_100006981 | 3300006175 | Bacteria | 7039 |
| 183 | Ga0070712_100058182 | 3300006175 | Bacteria | 2719 |
| 184 | Ga0070712_100114609 | 3300006175 | Bacteria | 2018 |
| 185 | Ga0070712_100425851 | 3300006175 | Bacteria | 1101 |
| 186 | Ga0075362_10008952 | 3300006177 | Bacteria | 3850 |
| 187 | Ga0075362_10075963 | 3300006177 | Bacteria | 1541 |
| 188 | Ga0075362_10092607 | 3300006177 | Bacteria | 1404 |
| 189 | Ga0075367_10041929 | 3300006178 | Bacteria | 2677 |
| 190 | Ga0075369_10040562 | 3300006186 | Bacteria | 1990 |
| 191 | Ga0075366_10108345 | 3300006195 | Bacteria | 1670 |
| 192 | Ga0075366_10235297 | 3300006195 | Bacteria | 1116 |
| 193 | Ga0097621_100257966 | 3300006237 | Bacteria | 1528 |
| 194 | Ga0075370_10234298 | 3300006353 | Bacteria | 1087 |
| 195 | Ga0075370_10280621 | 3300006353 | Bacteria | 989 |
| 196 | Ga0075370_10436071 | 3300006353 | Bacteria | 788 |
| 197 | Ga0075428_100064665 | 3300006844 | Bacteria | 4006 |
| 198 | Ga0075428_100114727 | 3300006844 | Bacteria | 2934 |
| 199 | Ga0075428_100189179 | 3300006844 | Bacteria | 2226 |
| 200 | Ga0075431_100001225 | 3300006847 | Bacteria | 23251 |
| 201 | Ga0075431_100466500 | 3300006847 | Bacteria | 1257 |
| 202 | Ga0075431_100577774 | 3300006847 | Bacteria | 1109 |
| 203 | Ga0075433_10398345 | 3300006852 | Bacteria | 1214 |
| 204 | Ga0075434_100027921 | 3300006871 | Bacteria | 5540 |
| 205 | Ga0075429_100018718 | 3300006880 | Bacteria | 5997 |
| 206 | Ga0075429_100248209 | 3300006880 | Bacteria | 1558 |
| 207 | Ga0068865_100042431 | 3300006881 | Bacteria | 3102 |
| 208 | Ga0097620_100439959 | 3300006931 | Bacteria | 1400 |
| 209 | Ga0099825_1023491 | 3300006941 | Bacteria | 3767 |
| 210 | Ga0099825_1027660 | 3300006941 | Bacteria | 2858 |
| 211 | Ga0099824_1023526 | 3300006942 | Bacteria | 3801 |
| 212 | Ga0099824_1025601 | 3300006942 | Bacteria | 3198 |
| 213 | Ga0099822_1024641 | 3300006943 | Bacteria | 5356 |
| 214 | Ga0099823_1036903 | 3300006944 | Bacteria | 3725 |
| 215 | Ga0075435_100023928 | 3300007076 | Bacteria | 4733 |
| 216 | Ga0099794_10002976 | 3300007265 | Bacteria | 6393 |
| 217 | Ga0099794_10007419 | 3300007265 | Bacteria | 4506 |
| 218 | Ga0099795_10271064 | 3300007788 | Bacteria | 738 |
| 219 | Ga0105240_10013788 | 3300009093 | Bacteria | 11073 |
| 220 | Ga0105240_10071470 | 3300009093 | Bacteria | 4291 |
| 221 | Ga0105240_10083063 | 3300009093 | Bacteria | 3932 |
| 222 | Ga0105240_10093352 | 3300009093 | Bacteria | 3673 |
| 223 | Ga0105240_10336296 | 3300009093 | Bacteria | 1716 |
| 224 | Ga0111539_10352323 | 3300009094 | Bacteria | 1713 |
| 225 | Ga0105245_10084091 | 3300009098 | Bacteria | 2914 |
| 226 | Ga0105245_11068879 | 3300009098 | Bacteria | 853 |
| 227 | Ga0105247_10092044 | 3300009101 | Bacteria | 1926 |
| 228 | Ga0105247_10264117 | 3300009101 | Bacteria | 1181 |
| 229 | Ga0114129_10267821 | 3300009147 | Bacteria | 2287 |
| 230 | Ga0114129_10604008 | 3300009147 | Bacteria | 1421 |
| 231 | Ga0114129_10732406 | 3300009147 | Bacteria | 1268 |
| 232 | Ga0105243_10297525 | 3300009148 | Bacteria | 1461 |
| 233 | Ga0105241_10001008 | 3300009174 | Bacteria | 21388 |
| 234 | Ga0105241_10121468 | 3300009174 | Bacteria | 2104 |
| 235 | Ga0105242_10919459 | 3300009176 | Bacteria | 876 |
| 236 | Ga0105248_10077301 | 3300009177 | Bacteria | 3742 |
| 237 | Ga0105248_10557551 | 3300009177 | Bacteria | 1293 |
| 238 | Ga0105248_11138035 | 3300009177 | Bacteria | 882 |
| 239 | Ga0105237_10015187 | 3300009545 | Bacteria | 8024 |
| 240 | Ga0105237_10015820 | 3300009545 | Bacteria | 7848 |
| 241 | Ga0105237_10285034 | 3300009545 | Bacteria | 1654 |
| 242 | Ga0105237_10444601 | 3300009545 | Bacteria | 1302 |
| 243 | Ga0105237_11183873 | 3300009545 | Bacteria | 771 |
| 244 | Ga0105238_10017578 | 3300009551 | Bacteria | 7271 |
| 245 | Ga0105238_10046426 | 3300009551 | Bacteria | 4384 |
| 246 | Ga0105238_10084272 | 3300009551 | Bacteria | 3168 |
| 247 | Ga0105238_10087410 | 3300009551 | Bacteria | 3104 |
| 248 | Ga0105238_10394335 | 3300009551 | Bacteria | 1377 |
| 249 | Ga0105249_10108270 | 3300009553 | Bacteria | 2623 |
| 250 | Ga0099796_10071308 | 3300010159 | Bacteria | 1255 |
| 251 | Ga0105239_10062974 | 3300010375 | Bacteria | 4071 |
| 252 | Ga0105239_10074658 | 3300010375 | Bacteria | 3728 |
| 253 | Ga0105239_10089192 | 3300010375 | Bacteria | 3400 |
| 254 | Ga0105239_10092021 | 3300010375 | Bacteria | 3347 |
| 255 | Ga0105239_10138632 | 3300010375 | Bacteria | 2709 |
| 256 | Ga0105239_10248700 | 3300010375 | Bacteria | 1997 |
| 257 | Ga0105246_10291503 | 3300011119 | Bacteria | 1313 |
| 258 | Ga0157315_1004111 | 3300012508 | Bacteria | 1022 |
| 259 | Ga0157370_10045059 | 3300013104 | Bacteria | 4234 |
| 260 | Ga0157370_10203539 | 3300013104 | Bacteria | 1836 |
| 261 | Ga0157369_10005277 | 3300013105 | Bacteria | 15062 |
| 262 | Ga0157369_10007048 | 3300013105 | Bacteria | 12962 |
| 263 | Ga0157369_10026918 | 3300013105 | Bacteria | 6378 |
| 264 | Ga0157369_10397687 | 3300013105 | Bacteria | 1429 |
| 265 | Ga0157369_10653850 | 3300013105 | Bacteria | 1084 |
| 266 | Ga0157374_10150302 | 3300013296 | Bacteria | 2264 |
| 267 | Ga0157374_10433937 | 3300013296 | Bacteria | 1313 |
| 268 | Ga0157374_10519993 | 3300013296 | Bacteria | 1196 |
| 269 | Ga0157378_10759627 | 3300013297 | Bacteria | 993 |
| 270 | Ga0163162_10175716 | 3300013306 | Bacteria | 2267 |
| 271 | Ga0157372_10141777 | 3300013307 | Bacteria | 2769 |
| 272 | Ga0157375_10024362 | 3300013308 | Bacteria | 5600 |
| 273 | Ga0157375_10033711 | 3300013308 | Bacteria | 4870 |
| 274 | Ga0157375_10410164 | 3300013308 | Bacteria | 1521 |
| 275 | Ga0157375_11678833 | 3300013308 | Bacteria | 752 |
| 276 | Ga0163163_10034881 | 3300014325 | Bacteria | 4877 |
| 277 | Ga0157380_10356831 | 3300014326 | Bacteria | 1370 |
| 278 | Ga0157380_10668996 | 3300014326 | Bacteria | 1038 |
| 279 | Ga0157377_10384178 | 3300014745 | Bacteria | 952 |
| 280 | Ga0157376_10043247 | 3300014969 | Bacteria | 3696 |
| 281 | Ga0163161_10141459 | 3300017792 | Bacteria | 1822 |
| 282 | Ga0163161_10157536 | 3300017792 | Bacteria | 1730 |
| 283 | Ga0163161_10392669 | 3300017792 | Bacteria | 1111 |
| 284 | Ga0206350_11050481 | 3300020080 | Bacteria | 1203 |
| 285 | Ga0206350_11210336 | 3300020080 | Bacteria | 937 |
| 286 | Ga0154015_1433898 | 3300020610 | Bacteria | 1088 |
| 287 | Ga0214544_1000136 | 3300021320 | Bacteria | 107814 |
| 288 | Ga0214542_1000127 | 3300021321 | Bacteria | 107829 |
| 289 | Ga0214545_1000063 | 3300021324 | Bacteria | 107829 |
| 290 | Ga0214543_1000238 | 3300021327 | Bacteria | 84004 |
| 291 | Ga0213874_10177782 | 3300021377 | Bacteria | 756 |
| 292 | Ga0213876_10003778 | 3300021384 | Bacteria | 8586 |
| 293 | Ga0213876_10017018 | 3300021384 | Bacteria | 3840 |
| 294 | Ga0213876_10183977 | 3300021384 | Bacteria | 1111 |
| 295 | Ga0213875_10104794 | 3300021388 | Bacteria | 1320 |
| 296 | Ga0213871_10005533 | 3300021441 | Bacteria | 2611 |
| 297 | Ga0224712_10089601 | 3300022467 | Bacteria | 1286 |
| 298 | Ga0224712_10299251 | 3300022467 | Bacteria | 752 |
| 299 | Ga0209563_101314 | 3300025230 | Bacteria | 6783 |
| 300 | Ga0209677_100344 | 3300025253 | Bacteria | 29159 |
| 301 | Ga0209677_101591 | 3300025253 | Bacteria | 9594 |
| 302 | Ga0209148_1000529 | 3300025254 | Bacteria | 37615 |
| 303 | Ga0209233_1000933 | 3300025261 | Bacteria | 12708 |
| 304 | Ga0209233_1017814 | 3300025261 | Bacteria | 1925 |
| 305 | Ga0209233_1018846 | 3300025261 | Bacteria | 1846 |
| 306 | Ga0209233_1042504 | 3300025261 | Bacteria | 974 |
| 307 | Ga0209455_1002494 | 3300025272 | Bacteria | 7068 |
| 308 | Ga0209673_1040759 | 3300025273 | Bacteria | 1326 |
| 309 | Ga0209564_1004806 | 3300025295 | Bacteria | 8049 |
| 310 | Ga0209564_1018699 | 3300025295 | Bacteria | 2628 |
| 311 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 312 | Ga0209758_1000455 | 3300025297 | Bacteria | 68279 |
| 313 | Ga0209758_1001990 | 3300025297 | Bacteria | 22036 |
| 314 | Ga0209758_1006185 | 3300025297 | Bacteria | 8752 |
| 315 | Ga0209758_1012065 | 3300025297 | Bacteria | 4897 |
| 316 | Ga0209758_1017504 | 3300025297 | Bacteria | 3563 |
| 317 | Ga0209256_1033968 | 3300025299 | Bacteria | 1364 |
| 318 | Ga0207426_1000480 | 3300025302 | Bacteria | 60866 |
| 319 | Ga0207426_1000669 | 3300025302 | Bacteria | 41627 |
| 320 | Ga0207426_1001491 | 3300025302 | Bacteria | 19157 |
| 321 | Ga0207426_1015249 | 3300025302 | Bacteria | 2791 |
| 322 | Ga0209051_1041116 | 3300025303 | Bacteria | 1648 |
| 323 | Ga0209257_1001458 | 3300025304 | Bacteria | 27945 |
| 324 | Ga0207697_10068080 | 3300025315 | Bacteria | 1489 |
| 325 | Ga0207656_10021788 | 3300025321 | Bacteria | 2564 |
| 326 | Ga0207656_10044531 | 3300025321 | Bacteria | 1896 |
| 327 | Ga0207653_10125727 | 3300025885 | Bacteria | 927 |
| 328 | Ga0207692_10023106 | 3300025898 | Bacteria | 2872 |
| 329 | Ga0207692_10073455 | 3300025898 | Bacteria | 1809 |
| 330 | Ga0207692_10077921 | 3300025898 | Unclassified | 1764 |
| 331 | Ga0207642_10233509 | 3300025899 | Bacteria | 1035 |
| 332 | Ga0207710_10363959 | 3300025900 | Bacteria | 738 |
| 333 | Ga0207647_10001884 | 3300025904 | Bacteria | 16066 |
| 334 | Ga0207647_10004039 | 3300025904 | Bacteria | 10933 |
| 335 | Ga0207685_10001667 | 3300025905 | Bacteria | 4783 |
| 336 | Ga0207699_10006106 | 3300025906 | Bacteria | 5806 |
| 337 | Ga0207699_10035655 | 3300025906 | Bacteria | 2832 |
| 338 | Ga0207699_10088526 | 3300025906 | Bacteria | 1938 |
| 339 | Ga0207699_10104744 | 3300025906 | Bacteria | 1802 |
| 340 | Ga0207643_10074402 | 3300025908 | Bacteria | 1959 |
| 341 | Ga0207705_10061293 | 3300025909 | Bacteria | 2717 |
| 342 | Ga0207705_10086384 | 3300025909 | Bacteria | 2292 |
| 343 | Ga0207705_10338364 | 3300025909 | Bacteria | 1158 |
| 344 | Ga0207684_10141154 | 3300025910 | Bacteria | 2071 |
| 345 | Ga0207654_10004108 | 3300025911 | Bacteria | 7337 |
| 346 | Ga0207654_10055191 | 3300025911 | Bacteria | 2299 |
| 347 | Ga0207654_10078427 | 3300025911 | Bacteria | 1982 |
| 348 | Ga0207707_10001006 | 3300025912 | Bacteria | 27014 |
| 349 | Ga0207707_10003605 | 3300025912 | Bacteria | 13731 |
| 350 | Ga0207707_10017450 | 3300025912 | Bacteria | 6258 |
| 351 | Ga0207707_10044046 | 3300025912 | Bacteria | 3891 |
| 352 | Ga0207695_10000157 | 3300025913 | Bacteria | 204140 |
| 353 | Ga0207695_10001596 | 3300025913 | Bacteria | 36807 |
| 354 | Ga0207695_10046830 | 3300025913 | Bacteria | 4581 |
| 355 | Ga0207695_10134161 | 3300025913 | Bacteria | 2430 |
| 356 | Ga0207695_10626737 | 3300025913 | Bacteria | 957 |
| 357 | Ga0207695_10829160 | 3300025913 | Bacteria | 805 |
| 358 | Ga0207671_10050591 | 3300025914 | Bacteria | 3077 |
| 359 | Ga0207671_10066557 | 3300025914 | Bacteria | 2682 |
| 360 | Ga0207693_10014734 | 3300025915 | Bacteria | 6281 |
| 361 | Ga0207693_10024253 | 3300025915 | Bacteria | 4815 |
| 362 | Ga0207693_10055218 | 3300025915 | Bacteria | 3116 |
| 363 | Ga0207693_10093014 | 3300025915 | Bacteria | 2363 |
| 364 | Ga0207693_10293714 | 3300025915 | Bacteria | 1273 |
| 365 | Ga0207693_10461006 | 3300025915 | Bacteria | 993 |
| 366 | Ga0207663_10000211 | 3300025916 | Bacteria | 25872 |
| 367 | Ga0207663_10131532 | 3300025916 | Bacteria | 1730 |
| 368 | Ga0207663_10212380 | 3300025916 | Bacteria | 1403 |
| 369 | Ga0207663_10253479 | 3300025916 | Bacteria | 1296 |
| 370 | Ga0207663_10450717 | 3300025916 | Bacteria | 992 |
| 371 | Ga0207660_10001786 | 3300025917 | Bacteria | 14369 |
| 372 | Ga0207660_10046067 | 3300025917 | Bacteria | 3076 |
| 373 | Ga0207660_10660862 | 3300025917 | Bacteria | 852 |
| 374 | Ga0207662_10294182 | 3300025918 | Bacteria | 1078 |
| 375 | Ga0207657_10017803 | 3300025919 | Bacteria | 6802 |
| 376 | Ga0207657_10055233 | 3300025919 | Bacteria | 3431 |
| 377 | Ga0207649_10056956 | 3300025920 | Bacteria | 2442 |
| 378 | Ga0207649_10063665 | 3300025920 | Bacteria | 2329 |
| 379 | Ga0207649_10138119 | 3300025920 | Bacteria | 1664 |
| 380 | Ga0207649_10189582 | 3300025920 | Bacteria | 1445 |
| 381 | Ga0207652_10002365 | 3300025921 | Bacteria | 15944 |
| 382 | Ga0207652_10014023 | 3300025921 | Bacteria | 6488 |
| 383 | Ga0207652_10031387 | 3300025921 | Bacteria | 4462 |
| 384 | Ga0207652_10202137 | 3300025921 | Bacteria | 1788 |
| 385 | Ga0207694_10000757 | 3300025924 | Bacteria | 28985 |
| 386 | Ga0207694_10051570 | 3300025924 | Bacteria | 3189 |
| 387 | Ga0207694_10127588 | 3300025924 | Bacteria | 2036 |
| 388 | Ga0207687_10175949 | 3300025927 | Bacteria | 1654 |
| 389 | Ga0207700_10012705 | 3300025928 | Bacteria | 5443 |
| 390 | Ga0207700_10133770 | 3300025928 | Bacteria | 2028 |
| 391 | Ga0207700_10604816 | 3300025928 | Bacteria | 976 |
| 392 | Ga0207664_10097594 | 3300025929 | Bacteria | 2421 |
| 393 | Ga0207664_10154186 | 3300025929 | Bacteria | 1954 |
| 394 | Ga0207664_10240314 | 3300025929 | Bacteria | 1577 |
| 395 | Ga0207664_10530326 | 3300025929 | Bacteria | 1055 |
| 396 | Ga0207664_10672775 | 3300025929 | Bacteria | 931 |
| 397 | Ga0207664_10718922 | 3300025929 | Bacteria | 898 |
| 398 | Ga0207644_10090576 | 3300025931 | Bacteria | 2279 |
| 399 | Ga0207690_10429890 | 3300025932 | Bacteria | 1058 |
| 400 | Ga0207706_10164599 | 3300025933 | Bacteria | 1949 |
| 401 | Ga0207669_10031720 | 3300025937 | Bacteria | 2956 |
| 402 | Ga0207669_10099677 | 3300025937 | Bacteria | 1916 |
| 403 | Ga0207665_10029652 | 3300025939 | Bacteria | 3616 |
| 404 | Ga0207665_10045152 | 3300025939 | Bacteria | 2950 |
| 405 | Ga0207665_10098165 | 3300025939 | Bacteria | 2040 |
| 406 | Ga0207691_10231613 | 3300025940 | Bacteria | 1599 |
| 407 | Ga0207711_10050232 | 3300025941 | Bacteria | 3570 |
| 408 | Ga0207661_10001813 | 3300025944 | Bacteria | 14603 |
| 409 | Ga0207661_10008843 | 3300025944 | Bacteria | 7207 |
| 410 | Ga0207667_10013120 | 3300025949 | Bacteria | 9507 |
| 411 | Ga0207667_10027313 | 3300025949 | Bacteria | 6214 |
| 412 | Ga0207667_10062687 | 3300025949 | Bacteria | 3886 |
| 413 | Ga0207667_10129200 | 3300025949 | Bacteria | 2602 |
| 414 | Ga0207667_10430730 | 3300025949 | Bacteria | 1341 |
| 415 | Ga0207667_10473635 | 3300025949 | Bacteria | 1271 |
| 416 | Ga0207667_10554015 | 3300025949 | Bacteria | 1163 |
| 417 | Ga0207712_10220597 | 3300025961 | Bacteria | 1516 |
| 418 | Ga0207712_10370930 | 3300025961 | Bacteria | 1195 |
| 419 | Ga0207668_10110621 | 3300025972 | Bacteria | 2060 |
| 420 | Ga0207668_10123928 | 3300025972 | Bacteria | 1961 |
| 421 | Ga0207668_10151381 | 3300025972 | Bacteria | 1796 |
| 422 | Ga0207640_10006211 | 3300025981 | Bacteria | 6543 |
| 423 | Ga0207640_10078470 | 3300025981 | Bacteria | 2248 |
| 424 | Ga0207640_10152952 | 3300025981 | Bacteria | 1697 |
| 425 | Ga0207640_10383123 | 3300025981 | Bacteria | 1140 |
| 426 | Ga0207658_10305054 | 3300025986 | Bacteria | 1373 |
| 427 | Ga0207677_10139059 | 3300026023 | Bacteria | 1856 |
| 428 | Ga0207703_10261584 | 3300026035 | Bacteria | 1564 |
| 429 | Ga0207703_10727415 | 3300026035 | Bacteria | 945 |
| 430 | Ga0207639_10013907 | 3300026041 | Bacteria | 5644 |
| 431 | Ga0207639_10016218 | 3300026041 | Bacteria | 5265 |
| 432 | Ga0207639_10083636 | 3300026041 | Bacteria | 2533 |
| 433 | Ga0207639_10133476 | 3300026041 | Bacteria | 2059 |
| 434 | Ga0207639_10582971 | 3300026041 | Bacteria | 1030 |
| 435 | Ga0207678_10070874 | 3300026067 | Bacteria | 2988 |
| 436 | Ga0207678_10072576 | 3300026067 | Bacteria | 2949 |
| 437 | Ga0207678_10221531 | 3300026067 | Bacteria | 1619 |
| 438 | Ga0207678_10400012 | 3300026067 | Bacteria | 1189 |
| 439 | Ga0207678_10452936 | 3300026067 | Bacteria | 1116 |
| 440 | Ga0207708_10074639 | 3300026075 | Bacteria | 2599 |
| 441 | Ga0207708_10267339 | 3300026075 | Bacteria | 1382 |
| 442 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 443 | Ga0207702_10000744 | 3300026078 | Bacteria | 34789 |
| 444 | Ga0207702_10138381 | 3300026078 | Bacteria | 2200 |
| 445 | Ga0207702_10248579 | 3300026078 | Bacteria | 1669 |
| 446 | Ga0207641_10212515 | 3300026088 | Bacteria | 1790 |
| 447 | Ga0207641_10316844 | 3300026088 | Bacteria | 1478 |
| 448 | Ga0207648_10095149 | 3300026089 | Bacteria | 2605 |
| 449 | Ga0207674_10055685 | 3300026116 | Bacteria | 4019 |
| 450 | Ga0207674_10065865 | 3300026116 | Bacteria | 3651 |
| 451 | Ga0207674_10076930 | 3300026116 | Bacteria | 3344 |
| 452 | Ga0207674_10077074 | 3300026116 | Bacteria | 3340 |
| 453 | Ga0207674_10323603 | 3300026116 | Bacteria | 1491 |
| 454 | Ga0207674_10826388 | 3300026116 | Bacteria | 894 |
| 455 | Ga0207675_100100246 | 3300026118 | Bacteria | 2728 |
| 456 | Ga0207675_100118791 | 3300026118 | Bacteria | 2500 |
| 457 | Ga0207683_10123427 | 3300026121 | Bacteria | 2326 |
| 458 | Ga0207698_10039521 | 3300026142 | Bacteria | 3496 |
| 459 | Ga0207698_11264693 | 3300026142 | Bacteria | 752 |
| 460 | Ga0209389_1000009 | 3300027296 | Bacteria | 226873 |
| 461 | Ga0209389_1000088 | 3300027296 | Bacteria | 83578 |
| 462 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 463 | Ga0209589_1000189 | 3300027357 | Bacteria | 71403 |
| 464 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 465 | Ga0209489_100050 | 3300027361 | Bacteria | 154669 |
| 466 | Ga0209489_100085 | 3300027361 | Bacteria | 126199 |
| 467 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 468 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 469 | Ga0209588_1025767 | 3300027671 | Bacteria | 1863 |
| 470 | Ga0209588_1133221 | 3300027671 | Bacteria | 792 |
| 471 | Ga0209813_10040615 | 3300027866 | Bacteria | 1415 |
| 472 | Ga0268266_10050046 | 3300028379 | Bacteria | 3584 |
| 473 | Ga0268266_10070563 | 3300028379 | Bacteria | 3027 |
| 474 | Ga0268265_10099986 | 3300028380 | Bacteria | 2339 |
| 475 | Ga0268265_10307339 | 3300028380 | Bacteria | 1430 |
| 476 | Ga0268265_10406113 | 3300028380 | Bacteria | 1260 |
| 477 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 478 | Ga0268264_10071583 | 3300028381 | Bacteria | 2938 |
| 479 | Ga0268264_10505345 | 3300028381 | Bacteria | 1179 |
| 480 | Ga0268264_10886878 | 3300028381 | Bacteria | 895 |
| 481 | Ga0265319_1008276 | 3300028563 | Bacteria | 4576 |
| 482 | Ga0265336_10002175 | 3300028666 | Bacteria | 8281 |
| 483 | Ga0307517_10000512 | 3300028786 | Bacteria | 66501 |
| 484 | Ga0307517_10201351 | 3300028786 | Bacteria | 1244 |
| 485 | Ga0307515_10051295 | 3300028794 | Bacteria | 6156 |
| 486 | Ga0307515_10081344 | 3300028794 | Bacteria | 4209 |
| 487 | Ga0265338_10000116 | 3300028800 | Bacteria | 146839 |
| 488 | Ga0265324_10005816 | 3300029957 | Bacteria | 5245 |
| 489 | Ga0265328_10155178 | 3300031239 | Bacteria | 862 |
| 490 | Ga0265339_10001103 | 3300031249 | Bacteria | 20475 |
| 491 | Ga0265339_10012106 | 3300031249 | Bacteria | 5284 |
| 492 | Ga0265339_10166699 | 3300031249 | Bacteria | 1105 |
| 493 | Ga0307509_10165420 | 3300031507 | Bacteria | 2102 |
| 494 | Ga0307509_10226909 | 3300031507 | Bacteria | 1674 |
| 495 | Ga0307509_10424421 | 3300031507 | Bacteria | 1029 |
| 496 | Ga0307508_10000008 | 3300031616 | Bacteria | 265023 |
| 497 | Ga0307508_10240708 | 3300031616 | Bacteria | 1407 |
| 498 | Ga0307508_10285142 | 3300031616 | Bacteria | 1245 |
| 499 | Ga0265314_10001759 | 3300031711 | Bacteria | 23380 |
| 500 | Ga0265314_10038466 | 3300031711 | Bacteria | 3455 |
| 501 | Ga0265314_10087044 | 3300031711 | Bacteria | 2044 |
| 502 | Ga0265342_10006885 | 3300031712 | Bacteria | 8400 |
| 503 | Ga0265342_10309580 | 3300031712 | Bacteria | 830 |
| 504 | Ga0307516_10096696 | 3300031730 | Bacteria | 2773 |
| 505 | Ga0307406_10646108 | 3300031901 | Bacteria | 878 |
| 506 | Ga0307416_100486582 | 3300032002 | Bacteria | 1295 |
| 507 | Ga0307507_10028768 | 3300033179 | Bacteria | 5912 |
| 508 | Ga0307510_10016371 | 3300033180 | Bacteria | 8751 |
| 509 | Ga0307510_10027712 | 3300033180 | Bacteria | 6484 |
| 510 | Ga0307510_10052175 | 3300033180 | Bacteria | 4316 |
| 511 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 512 | Ga0373959_0012593 | 3300034820 | Bacteria | 1514 |
| 513 | Ga0373926_0007233 | 3300035083 | Bacteria | 3700 |
| 514 | Ga0373934_0166294 | 3300035086 | Bacteria | 905 |
| 515 | Ga0373951_0039839 | 3300035091 | Bacteria | 1130 |
| 516 | Ga0373923_0010246 | 3300035111 | Bacteria | 3404 |
| 517 | Ga0373923_0012016 | 3300035111 | Bacteria | 3191 |
| 518 | Ga0373936_0020563 | 3300035113 | Bacteria | 2565 |
| 519 | Ga0373945_0003891 | 3300035116 | Bacteria | 4720 |
| 520 | Ga0373945_0037545 | 3300035116 | Bacteria | 1739 |
| 521 | Ga0373953_0001272 | 3300035117 | Bacteria | 7217 |
| 522 | Ga0373954_0000228 | 3300035118 | Bacteria | 20399 |
| 523 | Ga0373954_0093189 | 3300035118 | Bacteria | 1448 |
| 524 | Ga0373956_0002043 | 3300035119 | Bacteria | 8358 |
| 525 | Ga0373957_0000531 | 3300035120 | Bacteria | 9609 |
| 526 | Ga0373943_0371294 | 3300035170 | Bacteria | 822 |
| 527 | Ga0373946_0044385 | 3300035171 | Bacteria | 1835 |
| 528 | Ga0373946_0105317 | 3300035171 | Bacteria | 1270 |
| 529 | Ga0373955_0012568 | 3300035172 | Bacteria | 4069 |
| 530 | Ga0373935_0026404 | 3300035692 | Bacteria | 3583 |
| 531 | Ga0373935_0049502 | 3300035692 | Bacteria | 2663 |
| 532 | Ga0373935_0373164 | 3300035692 | Bacteria | 1020 |
| 533 | Ga0373935_0396374 | 3300035692 | Bacteria | 991 |
| 534 | Ga0373935_0450491 | 3300035692 | Bacteria | 930 |
| 535 | Ga0373927_0009711 | 3300035695 | Bacteria | 6450 |
| 536 | Ga0373927_0053685 | 3300035695 | Bacteria | 2607 |
| 537 | Ga0373927_0066330 | 3300035695 | Bacteria | 2335 |
| 538 | Ga0373927_0091955 | 3300035695 | Bacteria | 1971 |
| 539 | Ga0373927_0093269 | 3300035695 | Bacteria | 1956 |
| 540 | Ga0373927_0237968 | 3300035695 | Bacteria | 1196 |
| 541 | Ga0373933_0004420 | 3300035724 | Bacteria | 7717 |
| 542 | Ga0373933_0051579 | 3300035724 | Bacteria | 2459 |
| 543 | Ga0373933_0076006 | 3300035724 | Bacteria | 2051 |
| 544 | Ga0373933_0332859 | 3300035724 | Bacteria | 985 |
| 545 | Ga0373947_0132093 | 3300035725 | Bacteria | 1595 |
| 546 | Ga0373947_0298475 | 3300035725 | Bacteria | 1074 |
| 547 | Ga0373937_0001379 | 3300036401 | Bacteria | 20316 |
| 548 | Ga0373937_0052771 | 3300036401 | Bacteria | 3729 |
| 549 | Ga0373937_0062906 | 3300036401 | Bacteria | 3412 |
| 550 | Ga0373937_0725255 | 3300036401 | Bacteria | 941 |
| 551 | Ga0373937_0869521 | 3300036401 | Bacteria | 850 |
| 552 | Ga0373925_0067108 | 3300037068 | Bacteria | 2705 |
| 553 | Ga0373925_0084095 | 3300037068 | Bacteria | 2424 |
| 554 | Ga0373925_0097602 | 3300037068 | Bacteria | 2254 |
| 555 | Ga0373925_0196909 | 3300037068 | Bacteria | 1601 |
| 556 | Ga0373925_0348185 | 3300037068 | Bacteria | 1203 |
| 557 | Ga0395899_0271608 | 3300037312 | Bacteria | 1156 |
| 558 | Ga0395900_0000134 | 3300037418 | Bacteria | 124444 |
| 559 | Ga0395900_0014518 | 3300037418 | Bacteria | 8038 |
| 560 | Ga0395900_0105300 | 3300037418 | Bacteria | 2898 |
| 561 | Ga0395900_0443512 | 3300037418 | Bacteria | 1255 |
| 562 | Ga0395898_0019042 | 3300037466 | Bacteria | 6990 |
| 563 | Ga0395898_0027084 | 3300037466 | Bacteria | 5759 |
| 564 | Ga0395905_0018896 | 3300037471 | Bacteria | 6536 |
| 565 | Ga0395905_0040242 | 3300037471 | Bacteria | 4384 |
| 566 | Ga0395905_0175863 | 3300037471 | Bacteria | 2010 |
| 567 | Ga0395905_0426937 | 3300037471 | Bacteria | 1222 |
| 568 | Ga0436364_0051166 | 3300037853 | Bacteria | 1962 |
| 569 | Ga0436364_0475552 | 3300037853 | Bacteria | 4120 |
| 570 | Ga0436364_0986822 | 3300037853 | Bacteria | 930 |
| 571 | Ga0436364_1075789 | 3300037853 | Bacteria | 926 |
| 572 | Ga0395901_0013321 | 3300038443 | Bacteria | 8353 |
| 573 | Ga0395901_0102903 | 3300038443 | Bacteria | 2997 |
| 574 | Ga0436365_0481444 | 3300039437 | Bacteria | 17117 |
| 575 | Ga0436365_0769976 | 3300039437 | Bacteria | 1123 |
| 576 | Ga0436365_1210825 | 3300039437 | Bacteria | 3174 |
| 577 | Ga0436361_0317256 | 3300039447 | Bacteria | 1420 |
| 578 | Ga0436361_0346254 | 3300039447 | Bacteria | 874 |
| 579 | Ga0436361_0402388 | 3300039447 | Bacteria | 21228 |
| 580 | Ga0436363_0271674 | 3300039450 | Bacteria | 742 |
| 581 | Ga0436363_0861308 | 3300039450 | Bacteria | 1016 |
| 582 | Ga0436363_1401795 | 3300039450 | Bacteria | 17008 |
| 583 | Ga0436362_0084779 | 3300039453 | Bacteria | 1725 |
| 584 | Ga0436362_0817857 | 3300039453 | Bacteria | 1456 |
| 585 | Ga0439465_0120252 | 3300041413 | Bacteria | 920 |
| 586 | Ga0451793_1559700 | 3300041452 | Bacteria | 858 |
| 587 | Ga0451797_0752526 | 3300041453 | Bacteria | 1023 |
| 588 | Ga0451837_0571975 | 3300041494 | Bacteria | 1103 |
| 589 | Ga0439448_0076097 | 3300042005 | Bacteria | 1123 |
| 590 | Ga0439459_0010174 | 3300042438 | Bacteria | 1636 |
| 591 | Ga0466969_0193501 | 3300044656 | Bacteria | 929 |
| 592 | Ga0466972_0008710 | 3300044658 | Bacteria | 5088 |
| 593 | Ga0466972_0018187 | 3300044658 | Bacteria | 3515 |
| 594 | Ga0466965_0029714 | 3300044683 | Bacteria | 2660 |
| 595 | Ga0466966_0448711 | 3300044684 | Bacteria | 775 |
| 596 | Ga0466961_0000060 | 3300044693 | Bacteria | 65360 |
| 597 | Ga0466963_0223958 | 3300044694 | Bacteria | 1318 |
| 598 | Ga0466963_0467975 | 3300044694 | Bacteria | 889 |
| 599 | Ga0466971_0231926 | 3300044719 | Bacteria | 877 |
| 600 | Ga0466968_0005390 | 3300044735 | Bacteria | 4788 |
| 601 | Ga0466968_0040389 | 3300044735 | Bacteria | 1967 |
| 602 | Ga0466960_0009676 | 3300044901 | Bacteria | 3982 |
| 603 | Ga0466959_0307627 | 3300045049 | Bacteria | 1085 |
| 604 | Ga0466959_0352048 | 3300045049 | Bacteria | 1004 |
| 605 | Ga0466967_0034297 | 3300045976 | Bacteria | 4306 |
| 606 | Ga0466967_0113396 | 3300045976 | Bacteria | 2494 |
| 607 | Ga0466967_0241307 | 3300045976 | Bacteria | 1724 |
| 608 | Ga0466967_0283797 | 3300045976 | Bacteria | 1589 |
| 609 | Ga0466967_0286790 | 3300045976 | Bacteria | 1581 |
| 610 | Ga0466967_0454243 | 3300045976 | Bacteria | 1252 |
| 611 | Ga0466967_0531399 | 3300045976 | Bacteria | 1156 |
| 612 | Ga0495592_0001209 | 3300046454 | Bacteria | 17916 |
| 613 | Ga0495603_0053369 | 3300046455 | Bacteria | 2398 |
| 614 | Ga0495629_0002443 | 3300046459 | Bacteria | 14254 |
| 615 | Ga0495629_0061638 | 3300046459 | Bacteria | 2621 |
| 616 | Ga0495629_0304269 | 3300046459 | Bacteria | 1091 |
| 617 | Ga0495629_0386274 | 3300046459 | Bacteria | 952 |
| 618 | Ga0495638_0002824 | 3300046460 | Bacteria | 13909 |
| 619 | Ga0495638_0016287 | 3300046460 | Bacteria | 4981 |
| 620 | Ga0495638_0166082 | 3300046460 | Bacteria | 1269 |
| 621 | Ga0495641_0089348 | 3300046461 | Bacteria | 1377 |
| 622 | Ga0495651_0005605 | 3300046462 | Bacteria | 9569 |
| 623 | Ga0495651_0008316 | 3300046462 | Bacteria | 7951 |
| 624 | Ga0495651_0295336 | 3300046462 | Bacteria | 1089 |
| 625 | Ga0495653_0002888 | 3300046463 | Bacteria | 13740 |
| 626 | Ga0495653_0176426 | 3300046463 | Bacteria | 1470 |
| 627 | Ga0495650_0058527 | 3300046471 | Bacteria | 1555 |
| 628 | Ga0495580_0025402 | 3300046472 | Bacteria | 4329 |
| 629 | Ga0495582_0068768 | 3300046473 | Bacteria | 1957 |
| 630 | Ga0495639_0027392 | 3300046475 | Bacteria | 2522 |
| 631 | Ga0495639_0124352 | 3300046475 | Bacteria | 1232 |
| 632 | Ga0495662_0049320 | 3300046476 | Bacteria | 2032 |
| 633 | Ga0495664_0002664 | 3300046477 | Bacteria | 9612 |
| 634 | Ga0495664_0025173 | 3300046477 | Bacteria | 3464 |
| 635 | Ga0495664_0146779 | 3300046477 | Bacteria | 1430 |
| 636 | Ga0495664_0435457 | 3300046477 | Bacteria | 786 |
| 637 | Ga0495594_0030401 | 3300046499 | Bacteria | 2922 |
| 638 | Ga0495594_0233471 | 3300046499 | Bacteria | 1048 |
| 639 | Ga0495596_0044108 | 3300046500 | Bacteria | 1756 |
| 640 | Ga0495607_0171715 | 3300046501 | Bacteria | 1094 |
| 641 | Ga0495606_0003208 | 3300046507 | Bacteria | 17626 |
| 642 | Ga0495606_0076927 | 3300046507 | Bacteria | 2084 |
| 643 | Ga0495608_0003566 | 3300046511 | Bacteria | 11150 |
| 644 | Ga0495616_0043080 | 3300046513 | Bacteria | 2294 |
| 645 | Ga0495618_0058014 | 3300046514 | Bacteria | 2452 |
| 646 | Ga0495620_0142108 | 3300046515 | Bacteria | 938 |
| 647 | Ga0495628_0012258 | 3300046516 | Bacteria | 7226 |
| 648 | Ga0495628_0181266 | 3300046516 | Bacteria | 1593 |
| 649 | Ga0495630_0015746 | 3300046517 | Bacteria | 5525 |
| 650 | Ga0495631_0020454 | 3300046518 | Bacteria | 3092 |
| 651 | Ga0495631_0156536 | 3300046518 | Bacteria | 978 |
| 652 | Ga0495632_0022490 | 3300046519 | Bacteria | 3378 |
| 653 | Ga0495632_0144262 | 3300046519 | Bacteria | 1103 |
| 654 | Ga0495643_0022092 | 3300046522 | Bacteria | 3636 |
| 655 | Ga0495648_0002556 | 3300046524 | Bacteria | 16672 |
| 656 | Ga0495648_0004859 | 3300046524 | Bacteria | 11342 |
| 657 | Ga0495666_0046587 | 3300046526 | Bacteria | 2090 |
| 658 | Ga0495652_0007973 | 3300046529 | Bacteria | 9713 |
| 659 | Ga0495652_0021828 | 3300046529 | Bacteria | 5691 |
| 660 | Ga0495652_0173623 | 3300046529 | Bacteria | 1661 |
| 661 | Ga0495652_0277714 | 3300046529 | Bacteria | 1228 |
| 662 | Ga0495665_0072181 | 3300046531 | Bacteria | 1818 |
| 663 | Ga0495665_0163763 | 3300046531 | Bacteria | 1159 |
| 664 | Ga0495640_0012896 | 3300046533 | Bacteria | 6373 |
| 665 | Ga0495640_0147258 | 3300046533 | Bacteria | 1514 |
| 666 | Ga0495587_0004873 | 3300046536 | Bacteria | 8807 |
| 667 | Ga0495587_0031035 | 3300046536 | Bacteria | 3238 |
| 668 | Ga0495645_0033526 | 3300046543 | Bacteria | 3746 |
| 669 | Ga0495622_0004120 | 3300046557 | Bacteria | 6780 |
| 670 | Ga0495622_0058842 | 3300046557 | Bacteria | 1779 |
| 671 | Ga0495622_0166193 | 3300046557 | Bacteria | 993 |
| 672 | Ga0495667_0009322 | 3300046559 | Bacteria | 6651 |
| 673 | Ga0495667_0013615 | 3300046559 | Bacteria | 5500 |
| 674 | Ga0495656_0030522 | 3300046615 | Bacteria | 2179 |
| 675 | Ga0495668_0009486 | 3300046616 | Bacteria | 5975 |
| 676 | Ga0495668_0103877 | 3300046616 | Bacteria | 1555 |
| 677 | Ga0495634_0005394 | 3300046642 | Bacteria | 9850 |
| 678 | Ga0495634_0116381 | 3300046642 | Bacteria | 1715 |
| 679 | Ga0495611_0054941 | 3300046648 | Bacteria | 1801 |
| 680 | Ga0495611_0132438 | 3300046648 | Bacteria | 1163 |
| 681 | Ga0495635_0003508 | 3300046663 | Bacteria | 10848 |
| 682 | Ga0495635_0032590 | 3300046663 | Bacteria | 3614 |
| 683 | Ga0495635_0176343 | 3300046663 | Bacteria | 1453 |
| 684 | Ga0495661_0098331 | 3300046665 | Bacteria | 1652 |
| 685 | Ga0495661_0107686 | 3300046665 | Bacteria | 1558 |
| 686 | Ga0495588_0032165 | 3300046674 | Bacteria | 2642 |
| 687 | Ga0495588_0037012 | 3300046674 | Bacteria | 2478 |
| 688 | Ga0495588_0090187 | 3300046674 | Bacteria | 1605 |
| 689 | Ga0495588_0200844 | 3300046674 | Bacteria | 1053 |
| 690 | Ga0495657_0055464 | 3300046675 | Bacteria | 2642 |
| 691 | Ga0495657_0091660 | 3300046675 | Bacteria | 1948 |
| 692 | Ga0495599_0002630 | 3300046678 | Bacteria | 10467 |
| 693 | Ga0495599_0344558 | 3300046678 | Bacteria | 894 |
| 694 | Ga0495623_0002096 | 3300046679 | Bacteria | 13330 |
| 695 | Ga0495623_0005614 | 3300046679 | Bacteria | 8190 |
| 696 | Ga0495646_0031779 | 3300046680 | Bacteria | 3288 |
| 697 | Ga0495646_0040339 | 3300046680 | Bacteria | 2876 |
| 698 | Ga0495647_0040362 | 3300046681 | Bacteria | 1773 |
| 699 | Ga0495669_0047383 | 3300046684 | Bacteria | 1920 |
| 700 | Ga0495669_0132142 | 3300046684 | Bacteria | 1175 |
| 701 | Ga0495669_0266536 | 3300046684 | Bacteria | 823 |
| 702 | Ga0495613_0005605 | 3300046689 | Bacteria | 9426 |
| 703 | Ga0495613_0108585 | 3300046689 | Bacteria | 2001 |
| 704 | Ga0495613_0138635 | 3300046689 | Bacteria | 1739 |
| 705 | Ga0495624_0032311 | 3300046690 | Bacteria | 3394 |
| 706 | Ga0495624_0039775 | 3300046690 | Bacteria | 3014 |
| 707 | Ga0495670_0038100 | 3300046691 | Bacteria | 2396 |
| 708 | Ga0495671_0027114 | 3300046692 | Bacteria | 2961 |
| 709 | Ga0495589_0031998 | 3300046794 | Bacteria | 2646 |
| 710 | Ga0495589_0093365 | 3300046794 | Bacteria | 1461 |
| 711 | Ga0495600_0011959 | 3300046809 | Bacteria | 5419 |
| 712 | Ga0495600_0030308 | 3300046809 | Bacteria | 3504 |
| 713 | Ga0495600_0150591 | 3300046809 | Bacteria | 1506 |
| 714 | Ga0495581_0010414 | 3300047315 | Bacteria | 5377 |
| 715 | Ga0495581_0062978 | 3300047315 | Bacteria | 2143 |
| 716 | Ga0495604_0020791 | 3300047317 | Bacteria | 5240 |
| 717 | Ga0495674_0048444 | 3300047319 | Bacteria | 3760 |
| 718 | Ga0495674_0147106 | 3300047319 | Bacteria | 1977 |
| 719 | Ga0495672_0032579 | 3300047320 | Bacteria | 3240 |
| 720 | Ga0495672_0051629 | 3300047320 | Bacteria | 2420 |
| 721 | Ga0495676_0088068 | 3300047321 | Bacteria | 2330 |
| 722 | Ga0495680_0006958 | 3300047322 | Bacteria | 10437 |
| 723 | Ga0495680_0032642 | 3300047322 | Bacteria | 4223 |
| 724 | Ga0495687_046980 | 3300047443 | Bacteria | 1860 |
| 725 | Ga0495675_0000826 | 3300047444 | Bacteria | 19005 |
| 726 | Ga0495677_0096075 | 3300047445 | Bacteria | 1119 |
| 727 | Ga0495673_0038873 | 3300047469 | Bacteria | 2162 |
| 728 | Ga0495673_0040939 | 3300047469 | Bacteria | 2089 |
| 729 | Ga0495673_0158155 | 3300047469 | Bacteria | 871 |
| 730 | Ga0495684_0000938 | 3300047471 | Bacteria | 23706 |
| 731 | Ga0495684_0100786 | 3300047471 | Bacteria | 2183 |
| 732 | Ga0495684_0588180 | 3300047471 | Bacteria | 753 |
| 733 | Ga0495686_0023445 | 3300047472 | Bacteria | 4070 |
| 734 | Ga0495686_0081311 | 3300047472 | Bacteria | 1979 |
| 735 | Ga0495593_0004740 | 3300047673 | Bacteria | 8083 |
| 736 | Ga0495593_0026536 | 3300047673 | Bacteria | 3197 |
| 737 | Ga0495602_0003873 | 3300048088 | Bacteria | 15572 |
| 738 | Ga0495602_0059895 | 3300048088 | Bacteria | 3321 |
| 739 | Ga0496100_0076896 | 3300048903 | Bacteria | 2243 |
| 740 | Ga0496100_0106470 | 3300048903 | Bacteria | 1941 |
| 741 | Ga0496100_0279395 | 3300048903 | Bacteria | 1244 |
| 742 | Ga0496101_0021482 | 3300048904 | Bacteria | 4435 |
| 743 | Ga0496101_0122781 | 3300048904 | Bacteria | 1965 |
| 744 | Ga0496102_0009611 | 3300048905 | Bacteria | 8317 |
| 745 | Ga0496102_0027169 | 3300048905 | Bacteria | 5111 |
| 746 | Ga0496102_0045663 | 3300048905 | Bacteria | 3978 |
| 747 | Ga0496102_0173603 | 3300048905 | Bacteria | 2029 |
| 748 | Ga0496102_0412299 | 3300048905 | Bacteria | 1269 |
| 749 | Ga0496102_1121092 | 3300048905 | Bacteria | 706 |
| 750 | Ga0496103_0073533 | 3300048906 | Bacteria | 2141 |
| 751 | Ga0496103_0140982 | 3300048906 | Bacteria | 1541 |
| 752 | Ga0496103_0207301 | 3300048906 | Bacteria | 1261 |
| 753 | Ga0496103_0376577 | 3300048906 | Bacteria | 912 |
| 754 | Ga0496104_0002704 | 3300048907 | Bacteria | 15259 |
| 755 | Ga0496104_0007514 | 3300048907 | Bacteria | 9635 |
| 756 | Ga0496104_0009587 | 3300048907 | Bacteria | 8619 |
| 757 | Ga0496105_0002708 | 3300048908 | Bacteria | 12919 |
| 758 | Ga0496105_0085674 | 3300048908 | Bacteria | 2603 |
| 759 | Ga0496106_0000634 | 3300048909 | Bacteria | 25214 |
| 760 | Ga0496106_0001384 | 3300048909 | Bacteria | 18192 |
| 761 | Ga0496106_0343633 | 3300048909 | Bacteria | 1198 |
| 762 | Ga0496106_0451585 | 3300048909 | Bacteria | 1032 |
| 763 | Ga0496107_0002095 | 3300048910 | Bacteria | 12782 |
| 764 | Ga0496107_0013782 | 3300048910 | Bacteria | 5653 |
| 765 | Ga0496107_0054133 | 3300048910 | Bacteria | 2896 |
| 766 | Ga0496108_0001003 | 3300048911 | Bacteria | 22020 |
| 767 | Ga0496108_0022639 | 3300048911 | Bacteria | 5167 |
| 768 | Ga0496108_0027124 | 3300048911 | Bacteria | 4726 |
| 769 | Ga0496109_0000166 | 3300048912 | Bacteria | 64848 |
| 770 | Ga0496109_0084838 | 3300048912 | Bacteria | 2922 |
| 771 | Ga0496109_0096435 | 3300048912 | Bacteria | 2740 |
| 772 | Ga0496109_0780746 | 3300048912 | Bacteria | 893 |
| 773 | Ga0496110_0003914 | 3300048913 | Bacteria | 11454 |
| 774 | Ga0496110_0029261 | 3300048913 | Bacteria | 4739 |
| 775 | Ga0496110_0060588 | 3300048913 | Bacteria | 3338 |
| 776 | Ga0496110_0062285 | 3300048913 | Bacteria | 3294 |
| 777 | Ga0496111_0136560 | 3300048914 | Bacteria | 1816 |
| 778 | Ga0496111_0368171 | 3300048914 | Bacteria | 1063 |
| 779 | Ga0496111_0452405 | 3300048914 | Bacteria | 947 |
| 780 | Ga0496112_0000142 | 3300048915 | Bacteria | 44742 |
| 781 | Ga0496112_0000358 | 3300048915 | Bacteria | 29716 |
| 782 | Ga0496112_0018397 | 3300048915 | Bacteria | 6577 |
| 783 | Ga0496112_0044524 | 3300048915 | Bacteria | 4349 |
| 784 | Ga0496112_0385023 | 3300048915 | Bacteria | 1343 |
| 785 | Ga0496112_0426024 | 3300048915 | Bacteria | 1265 |
| 786 | Ga0496112_0633742 | 3300048915 | Bacteria | 999 |
| 787 | Ga0496113_0004839 | 3300048916 | Bacteria | 8333 |
| 788 | Ga0496113_0093035 | 3300048916 | Bacteria | 2326 |
| 789 | Ga0496114_0006347 | 3300048917 | Bacteria | 9303 |
| 790 | Ga0496114_0601707 | 3300048917 | Bacteria | 969 |
| 791 | Ga0496115_0028727 | 3300048918 | Bacteria | 4361 |
| 792 | Ga0496115_0034976 | 3300048918 | Bacteria | 3972 |
| 793 | Ga0496115_0077226 | 3300048918 | Bacteria | 2708 |
| 794 | Ga0496115_0161871 | 3300048918 | Bacteria | 1849 |
| 795 | Ga0496115_0773138 | 3300048918 | Bacteria | 749 |
| 796 | Ga0496116_0001611 | 3300048919 | Bacteria | 24820 |
| 797 | Ga0496116_0073189 | 3300048919 | Bacteria | 2162 |
| 798 | Ga0496116_0265906 | 3300048919 | Bacteria | 842 |
| 799 | Ga0496117_0136641 | 3300048920 | Bacteria | 1475 |
| 800 | Ga0496117_0164634 | 3300048920 | Bacteria | 1295 |
| 801 | Ga0496117_0256521 | 3300048920 | Bacteria | 950 |
| 802 | Ga0496118_0008176 | 3300048921 | Bacteria | 10886 |
| 803 | Ga0496118_0024339 | 3300048921 | Bacteria | 5228 |
| 804 | Ga0496118_0161696 | 3300048921 | Bacteria | 1383 |
| 805 | Ga0496118_0250727 | 3300048921 | Bacteria | 1006 |
| 806 | Ga0496119_0036025 | 3300048922 | Bacteria | 3234 |
| 807 | Ga0496119_0105704 | 3300048922 | Bacteria | 1572 |
| 808 | Ga0496119_0155884 | 3300048922 | Bacteria | 1219 |
| 809 | Ga0496119_0165214 | 3300048922 | Bacteria | 1173 |
| 810 | Ga0496120_0060665 | 3300048923 | Bacteria | 2115 |
| 811 | Ga0496121_0000365 | 3300048924 | Bacteria | 92822 |
| 812 | Ga0496121_0001250 | 3300048924 | Bacteria | 44073 |
| 813 | Ga0496121_0020850 | 3300048924 | Bacteria | 6457 |
| 814 | Ga0496121_0032052 | 3300048924 | Bacteria | 4785 |
| 815 | Ga0496121_0042595 | 3300048924 | Bacteria | 3945 |
| 816 | Ga0496121_0053980 | 3300048924 | Bacteria | 3362 |
| 817 | Ga0496121_0063730 | 3300048924 | Bacteria | 3009 |
| 818 | Ga0496121_0070373 | 3300048924 | Bacteria | 2818 |
| 819 | Ga0496121_0091700 | 3300048924 | Bacteria | 2371 |
| 820 | Ga0496121_0105596 | 3300048924 | Bacteria | 2161 |
| 821 | Ga0496121_0146386 | 3300048924 | Bacteria | 1745 |
| 822 | Ga0496121_0189880 | 3300048924 | Bacteria | 1474 |
| 823 | Ga0496121_0241472 | 3300048924 | Bacteria | 1258 |
| 824 | Ga0496121_0270059 | 3300048924 | Bacteria | 1169 |
| 825 | Ga0496122_0055591 | 3300048925 | Bacteria | 2960 |
| 826 | Ga0496122_0301695 | 3300048925 | Bacteria | 863 |
| 827 | Ga0496123_0084809 | 3300048926 | Bacteria | 1908 |
| 828 | Ga0496124_0002671 | 3300048927 | Bacteria | 22854 |
| 829 | Ga0496124_0373380 | 3300048927 | Bacteria | 1000 |
| 830 | Ga0496124_0382654 | 3300048927 | Bacteria | 983 |
| 831 | Ga0496125_0008303 | 3300048928 | Bacteria | 10905 |
| 832 | Ga0496125_0013887 | 3300048928 | Bacteria | 7881 |
| 833 | Ga0496125_0030378 | 3300048928 | Bacteria | 4835 |
| 834 | Ga0496125_0039257 | 3300048928 | Bacteria | 4080 |
| 835 | Ga0496125_0096714 | 3300048928 | Bacteria | 2191 |
| 836 | Ga0496126_0003397 | 3300048929 | Bacteria | 20144 |
| 837 | Ga0496126_0004058 | 3300048929 | Bacteria | 17778 |
| 838 | Ga0496126_0004467 | 3300048929 | Bacteria | 16697 |
| 839 | Ga0496126_0009177 | 3300048929 | Bacteria | 10550 |
| 840 | Ga0496126_0011808 | 3300048929 | Bacteria | 8989 |
| 841 | Ga0496126_0018439 | 3300048929 | Bacteria | 6914 |
| 842 | Ga0496126_0018516 | 3300048929 | Bacteria | 6896 |
| 843 | Ga0496126_0044443 | 3300048929 | Bacteria | 4091 |
| 844 | Ga0496126_0052156 | 3300048929 | Bacteria | 3719 |
| 845 | Ga0496126_0061909 | 3300048929 | Bacteria | 3360 |
| 846 | Ga0496126_0295827 | 3300048929 | Bacteria | 1337 |
| 847 | Ga0496126_0325157 | 3300048929 | Bacteria | 1263 |
| 848 | Ga0496126_0372463 | 3300048929 | Bacteria | 1164 |
| 849 | Ga0496126_0443718 | 3300048929 | Bacteria | 1046 |
| 850 | Ga0496126_0517402 | 3300048929 | Bacteria | 951 |
| 851 | Ga0495682_0081060 | 3300049460 | Bacteria | 1167 |
| 852 | Ga0501032_0026447 | 3300049569 | Bacteria | 3991 |
| 853 | Ga0501032_0268884 | 3300049569 | Bacteria | 1105 |
| 854 | Ga0501036_0085011 | 3300049572 | Bacteria | 2674 |
| 855 | Ga0501036_0147325 | 3300049572 | Bacteria | 1986 |
| 856 | Ga0501039_0327142 | 3300049575 | Bacteria | 1205 |
| 857 | Ga0501042_0128487 | 3300049578 | Bacteria | 1826 |
| 858 | Ga0501043_0029487 | 3300049579 | Bacteria | 4311 |
| 859 | Ga0501046_0014282 | 3300049580 | Bacteria | 6706 |
| 860 | Ga0501047_0019249 | 3300049581 | Bacteria | 6549 |
| 861 | Ga0501048_0100848 | 3300049582 | Bacteria | 2037 |
| 862 | Ga0501070_0018349 | 3300049586 | Bacteria | 5869 |
| 863 | Ga0501070_0067287 | 3300049586 | Bacteria | 2967 |
| 864 | Ga0501070_0404570 | 3300049586 | Bacteria | 1104 |
| 865 | Ga0501070_0467361 | 3300049586 | Bacteria | 1016 |
| 866 | Ga0501072_0716113 | 3300049588 | Bacteria | 786 |
| 867 | Ga0501073_0148436 | 3300049589 | Bacteria | 1625 |
| 868 | Ga0501077_0125181 | 3300049593 | Bacteria | 1629 |
| 869 | Ga0501079_0394304 | 3300049741 | Bacteria | 1086 |
| 870 | Ga0501080_0097586 | 3300049742 | Bacteria | 2728 |
| 871 | Ga0501035_0051567 | 3300049822 | Bacteria | 3683 |
| 872 | Ga0501044_0009213 | 3300049823 | Bacteria | 10783 |
| 873 | Ga0501044_0026949 | 3300049823 | Bacteria | 6080 |
| 874 | Ga0501044_0425329 | 3300049823 | Bacteria | 1238 |
| 875 | Ga0501045_0373826 | 3300049824 | Bacteria | 1061 |
| 876 | nmdc:mga03683_14358_c1 | 3300050489 | Bacteria | 2929 |
| 877 | nmdc:mga03683_193256_c1 | 3300050489 | Bacteria | 932 |
| 878 | nmdc:mga00v17_213852_c1 | 3300050491 | Bacteria | 1248 |
| 879 | nmdc:mga00v17_244451_c1 | 3300050491 | Bacteria | 1164 |
| 880 | nmdc:mga0yw44_279822_c1 | 3300050492 | Bacteria | 1115 |
| 881 | nmdc:mga0yw44_284003_c1 | 3300050492 | Bacteria | 1107 |
| 882 | nmdc:mga0yw44_35109_c1 | 3300050492 | Bacteria | 2944 |
| 883 | nmdc:mga0yw44_57538_c1 | 3300050492 | Bacteria | 2372 |
| 884 | nmdc:mga0yw44_68762_c1 | 3300050492 | Bacteria | 2192 |
| 885 | nmdc:mga0k408_9657_c1 | 3300050493 | Bacteria | 5207 |
| 886 | nmdc:mga06z11_51738_c1 | 3300050494 | Bacteria | 2104 |
| 887 | nmdc:mga06z11_9579_c1 | 3300050494 | Bacteria | 4087 |
| 888 | nmdc:mga07m45_19552_c1 | 3300050496 | Bacteria | 3670 |
| 889 | nmdc:mga07m45_24035_c2 | 3300050496 | Bacteria | 2418 |
| 890 | nmdc:mga07m45_34764_c1 | 3300050496 | Bacteria | 2802 |
| 891 | nmdc:mga05p37_381088_c1 | 3300050507 | Bacteria | 1652 |
| 892 | nmdc:mga09592_16208_c1 | 3300050508 | Bacteria | 6091 |
| 893 | nmdc:mga09592_424127_c1 | 3300050508 | Bacteria | 1149 |
| 894 | nmdc:mga0qj67_80587_c1 | 3300050509 | Bacteria | 2608 |
| 895 | nmdc:mga06r32_1139_c1 | 3300050510 | Bacteria | 23882 |
| 896 | nmdc:mga06r32_284235_c1 | 3300050510 | Bacteria | 1641 |
| 897 | nmdc:mga06r32_300228_c1 | 3300050510 | Bacteria | 1592 |
| 898 | nmdc:mga06r32_589991_c1 | 3300050510 | Bacteria | 1083 |
| 899 | nmdc:mga08y16_226410_c1 | 3300050511 | Bacteria | 1935 |
| 900 | nmdc:mga08y16_341470_c1 | 3300050511 | Bacteria | 1539 |
| 901 | nmdc:mga0n895_517383_c1 | 3300050512 | Bacteria | 1201 |
| 902 | nmdc:mga0rr50_12850_c1 | 3300050513 | Bacteria | 5427 |
| 903 | nmdc:mga0a205_162849_c1 | 3300050515 | Bacteria | 2126 |
| 904 | nmdc:mga0a205_350223_c1 | 3300050515 | Bacteria | 1344 |
| 905 | Ga0495601_0028797 | 3300053077 | Bacteria | 3442 |
| 906 | Ga0495601_0084098 | 3300053077 | Bacteria | 2044 |
| 907 | Ga0495601_0121729 | 3300053077 | Bacteria | 1695 |
| 908 | Ga0495601_0254211 | 3300053077 | Bacteria | 1147 |
| 909 | Ga0495612_0143077 | 3300053078 | Bacteria | 1038 |
| 910 | Ga0500610_0281489 | 3300053079 | Bacteria | 746 |
| 911 | Ga0500635_0103296 | 3300053080 | Bacteria | 1051 |
| 912 | Ga0500635_0175232 | 3300053080 | Bacteria | 827 |
| 913 | Ga0495595_0001721 | 3300053084 | Bacteria | 8565 |
| 914 | Ga0495595_0242206 | 3300053084 | Bacteria | 902 |
| 915 | Ga0495595_0249975 | 3300053084 | Bacteria | 888 |
| 916 | Ga0495619_0002764 | 3300053085 | Bacteria | 11448 |
| 917 | Ga0495619_0026952 | 3300053085 | Bacteria | 3701 |
| 918 | Ga0495619_0027657 | 3300053085 | Bacteria | 3655 |
| 919 | Ga0495619_0246754 | 3300053085 | Bacteria | 1237 |
| 920 | Ga0500643_000042 | 3300053087 | Bacteria | 158933 |
| 921 | Ga0500643_040787 | 3300053087 | Bacteria | 1366 |
| 922 | Ga0500644_0038550 | 3300053088 | Bacteria | 1569 |
| 923 | Ga0500647_0012259 | 3300053091 | Bacteria | 3854 |
| 924 | Ga0500651_0052451 | 3300053093 | Bacteria | 2558 |
| 925 | Ga0500566_0000178 | 3300053094 | Bacteria | 32469 |
| 926 | Ga0500566_0003121 | 3300053094 | Bacteria | 9907 |
| 927 | Ga0500566_0004694 | 3300053094 | Bacteria | 8133 |
| 928 | Ga0500566_0016779 | 3300053094 | Bacteria | 4297 |
| 929 | Ga0500640_016747 | 3300053095 | Bacteria | 3097 |
| 930 | Ga0500641_0004300 | 3300053096 | Bacteria | 5024 |
| 931 | Ga0500650_0004206 | 3300053098 | Bacteria | 5166 |
| 932 | Ga0500554_008738 | 3300053102 | Bacteria | 2394 |
| 933 | Ga0500555_000735 | 3300053103 | Bacteria | 12142 |
| 934 | Ga0500555_008486 | 3300053103 | Bacteria | 2929 |
| 935 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 936 | Ga0500556_0052243 | 3300053104 | Bacteria | 1482 |
| 937 | Ga0500557_000006 | 3300053105 | Bacteria | 141252 |
| 938 | Ga0500562_075560 | 3300053108 | Bacteria | 910 |
| 939 | Ga0500572_000041 | 3300053111 | Bacteria | 39295 |
| 940 | Ga0500595_002365 | 3300053119 | Bacteria | 9422 |
| 941 | Ga0500595_005588 | 3300053119 | Bacteria | 5472 |
| 942 | Ga0500607_016121 | 3300053121 | Bacteria | 4292 |
| 943 | Ga0500607_057563 | 3300053121 | Bacteria | 2048 |
| 944 | Ga0500608_003394 | 3300053122 | Bacteria | 5964 |
| 945 | Ga0500614_035057 | 3300053123 | Bacteria | 1248 |
| 946 | Ga0500618_007537 | 3300053125 | Bacteria | 3096 |
| 947 | Ga0500618_064543 | 3300053125 | Bacteria | 823 |
| 948 | Ga0500642_0000013 | 3300053130 | Bacteria | 197927 |
| 949 | Ga0500642_0000040 | 3300053130 | Bacteria | 96160 |
| 950 | Ga0500652_000186 | 3300053131 | Bacteria | 24000 |
| 951 | Ga0500658_0154631 | 3300053134 | Bacteria | 1035 |
| 952 | Ga0500559_0000597 | 3300053136 | Bacteria | 24582 |
| 953 | Ga0500559_0007742 | 3300053136 | Bacteria | 4745 |
| 954 | Ga0500559_0009057 | 3300053136 | Bacteria | 4325 |
| 955 | Ga0500559_0036178 | 3300053136 | Bacteria | 2134 |
| 956 | Ga0500568_0005482 | 3300053139 | Bacteria | 6548 |
| 957 | Ga0500568_0045042 | 3300053139 | Bacteria | 1757 |
| 958 | Ga0500568_0051835 | 3300053139 | Bacteria | 1613 |
| 959 | Ga0500568_0129283 | 3300053139 | Bacteria | 939 |
| 960 | Ga0500586_000482 | 3300053145 | Bacteria | 8011 |
| 961 | Ga0500590_133876 | 3300053148 | Bacteria | 1143 |
| 962 | Ga0500603_000312 | 3300053150 | Bacteria | 12796 |
| 963 | Ga0500604_0021776 | 3300053151 | Bacteria | 1814 |
| 964 | Ga0500604_0167645 | 3300053151 | Bacteria | 750 |
| 965 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 966 | Ga0500616_0052615 | 3300053153 | Bacteria | 2141 |
| 967 | Ga0500619_070986 | 3300053154 | Bacteria | 1158 |
| 968 | Ga0500622_0019026 | 3300053156 | Bacteria | 3647 |
| 969 | Ga0500624_012678 | 3300053157 | Bacteria | 1250 |
| 970 | Ga0500627_0186092 | 3300053158 | Bacteria | 933 |
| 971 | Ga0500630_000840 | 3300053159 | Bacteria | 14239 |
| 972 | Ga0500633_0065278 | 3300053160 | Bacteria | 1289 |
| 973 | Ga0500634_0040350 | 3300053161 | Bacteria | 2537 |
| 974 | Ga0500638_001490 | 3300053162 | Bacteria | 7404 |
| 975 | Ga0500639_000029 | 3300053163 | Bacteria | 76014 |
| 976 | Ga0500639_052625 | 3300053163 | Bacteria | 2119 |
| 977 | Ga0500636_0000105 | 3300053177 | Bacteria | 43109 |
| 978 | Ga0500636_0011341 | 3300053177 | Bacteria | 5217 |
| 979 | Ga0500636_0077175 | 3300053177 | Bacteria | 1924 |
| 980 | Ga0500636_0085694 | 3300053177 | Bacteria | 1810 |
| 981 | Ga0500637_0000215 | 3300053178 | Bacteria | 21698 |
| 982 | Ga0500637_0124232 | 3300053178 | Bacteria | 1497 |
| 983 | Ga0500576_091957 | 3300053725 | Bacteria | 1258 |
| 984 | Ga0500611_041918 | 3300053727 | Bacteria | 1010 |
| 985 | Ga0500625_022414 | 3300053729 | Bacteria | 2983 |
| 986 | Ga0500645_004319 | 3300053730 | Bacteria | 5474 |
| 987 | Ga0500656_028492 | 3300053732 | Bacteria | 732 |
| 988 | Ga0500552_006729 | 3300053733 | Bacteria | 1300 |
| 989 | Ga0500596_019804 | 3300053735 | Bacteria | 1011 |
| 990 | Ga0500601_000611 | 3300053737 | Bacteria | 5074 |
| 991 | Ga0501084_0914998 | 3300054114 | Bacteria | 738 |
| 992 | Ga0500661_002447 | 3300055283 | Bacteria | 3498 |
| 993 | Ga0501082_0212161 | 3300060353 | Bacteria | 1684 |
| 994 | Ga0501082_0437711 | 3300060353 | Bacteria | 1142 |
| 995 | Ga0530510_0034799 | 3300061734 | Bacteria | 3629 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10055218 | Ga0207693_100552183 | 179 |
| 2 | 3300025898 | Ga0207692_10077921 | Ga0207692_100779212 | 183 |
| 3 | 3300037471 | Ga0395905_0426937 | Ga0395905_0426937_205_858 | 217 |
| 4 | 3300005434 | Ga0070709_10013044 | Ga0070709_100130442 | 220 |
| 5 | 3300005435 | Ga0070714_100367633 | Ga0070714_1003676332 | 220 |
| 6 | 3300005436 | Ga0070713_100310055 | Ga0070713_1003100552 | 220 |
| 7 | 3300005471 | Ga0070698_100516437 | Ga0070698_1005164372 | 220 |
| 8 | 3300010375 | Ga0105239_10092021 | Ga0105239_100920212 | 220 |
| 9 | 3300011119 | Ga0105246_10291503 | Ga0105246_102915032 | 220 |
| 10 | 3300013296 | Ga0157374_10150302 | Ga0157374_101503022 | 220 |
| 11 | 3300039450 | Ga0436363_0271674 | Ga0436363_0271674_19_681 | 220 |
| 12 | 3300048903 | Ga0496100_0076896 | Ga0496100_0076896_814_1476 | 220 |
| 13 | 3300048905 | Ga0496102_0045663 | Ga0496102_0045663_1309_1971 | 220 |
| 14 | 3300048906 | Ga0496103_0207301 | Ga0496103_0207301_385_1047 | 220 |
| 15 | 3300048911 | Ga0496108_0027124 | Ga0496108_0027124_3921_4583 | 220 |
| 16 | 3300048912 | Ga0496109_0096435 | Ga0496109_0096435_350_1012 | 220 |
| 17 | 3300048913 | Ga0496110_0062285 | Ga0496110_0062285_2370_3032 | 220 |
| 18 | 3300048915 | Ga0496112_0633742 | Ga0496112_0633742_224_886 | 220 |
| 19 | 3300048918 | Ga0496115_0028727 | Ga0496115_0028727_1557_2219 | 220 |
| 20 | iso_pu_bacteria | 2507262055 | 2507507209 | 220 |
| 21 | iso_pu_bacteria | 2508501009 | 2508541263 | 220 |
| 22 | iso_pu_bacteria | 2508501042 | 2508693407 | 220 |
| 23 | iso_pu_bacteria | 2508501128 | 2509148795 | 220 |
| 24 | iso_pu_bacteria | 2511231028 | 2511395674 | 220 |
| 25 | iso_pu_bacteria | 2513237092 | 2513628885 | 220 |
| 26 | iso_pu_bacteria | 2513237094 | 2513637162 | 220 |
| 27 | iso_pu_bacteria | 2513237095 | 2513651571 | 220 |
| 28 | iso_pu_bacteria | 2513237096 | 2513655766 | 220 |
| 29 | iso_pu_bacteria | 2513237101 | 2513693262 | 220 |
| 30 | iso_pu_bacteria | 2513237102 | 2513702714 | 220 |
| 31 | iso_pu_bacteria | 2513237104 | 2513717468 | 220 |
| 32 | iso_pu_bacteria | 2513237137 | 2513856740 | 220 |
| 33 | iso_pu_bacteria | 2513237139 | 2513876732 | 220 |
| 34 | iso_pu_bacteria | 2513237145 | 2513917321 | 220 |
| 35 | iso_pu_bacteria | 2513237161 | 2514012227 | 220 |
| 36 | iso_pu_bacteria | 2515154112 | 2515628768 | 220 |
| 37 | iso_pu_bacteria | 2517093001 | 2517104866 | 220 |
| 38 | iso_pu_bacteria | 2517572143 | 2517895393 | 220 |
| 39 | iso_pu_bacteria | 2524023205 | 2524440671 | 220 |
| 40 | iso_pu_bacteria | 2524023228 | 2524540505 | 220 |
| 41 | iso_pu_bacteria | 2528768022 | 2528857431 | 220 |
| 42 | iso_pu_bacteria | 2602042107 | 2603857745 | 220 |
| 43 | iso_pu_bacteria | 2617270735 | 2617347982 | 220 |
| 44 | iso_pu_bacteria | 2617270741 | 2617377792 | 220 |
| 45 | iso_pu_bacteria | 2667528175 | 2671122068 | 220 |
| 46 | iso_pu_bacteria | 2721755755 | 2723848172 | 220 |
| 47 | iso_pu_bacteria | 2728368998 | 2728750873 | 220 |
| 48 | iso_pu_bacteria | 2744054633 | 2745077483 | 220 |
| 49 | iso_pu_bacteria | 2791355196 | 2793065528 | 220 |
| 50 | iso_pu_bacteria | 2791355197 | 2793069367 | 220 |
| 51 | iso_pu_bacteria | 2791355199 | 2793078118 | 220 |
| 52 | iso_pu_bacteria | 2802429603 | 2805918712 | 220 |
| 53 | iso_pu_bacteria | 2816332527 | 2818243832 | 220 |
| 54 | iso_pu_bacteria | 2824600985 | 2824607842 | 220 |
| 55 | iso_pu_bacteria | 2824609381 | 2824616941 | 220 |
| 56 | iso_pu_bacteria | 2824617872 | 2824623640 | 220 |
| 57 | iso_pu_bacteria | 2824626560 | 2824632443 | 220 |
| 58 | iso_pu_bacteria | 2824635225 | 2824639899 | 220 |
| 59 | iso_pu_bacteria | 2824644064 | 2824646467 | 220 |
| 60 | iso_pu_bacteria | 2824653114 | 2824658963 | 220 |
| 61 | iso_pu_bacteria | 2824661429 | 2824668474 | 220 |
| 62 | iso_pu_bacteria | 2824671348 | 2824676830 | 220 |
| 63 | iso_pu_bacteria | 2824679649 | 2824684175 | 220 |
| 64 | iso_pu_bacteria | 2824687955 | 2824693300 | 220 |
| 65 | iso_pu_bacteria | 2824696289 | 2824701311 | 220 |
| 66 | iso_pu_bacteria | 2824704595 | 2824708433 | 220 |
| 67 | iso_pu_bacteria | 2824714736 | 2824717226 | 220 |
| 68 | iso_pu_bacteria | 2824723954 | 2824726934 | 220 |
| 69 | iso_pu_bacteria | 2824732956 | 2824737333 | 220 |
| 70 | iso_pu_bacteria | 2824746037 | 2824751820 | 220 |
| 71 | iso_pu_bacteria | 2824753945 | 2824762385 | 220 |
| 72 | iso_pu_bacteria | 2824763712 | 2824770736 | 220 |
| 73 | iso_pu_bacteria | 2824773399 | 2824776094 | 220 |
| 74 | iso_pu_bacteria | 2838122688 | 2838127049 | 220 |
| 75 | iso_pu_bacteria | 2841941048 | 2841945469 | 220 |
| 76 | iso_pu_bacteria | 2841949485 | 2841955922 | 220 |
| 77 | iso_pu_bacteria | 2841957949 | 2841961634 | 220 |
| 78 | iso_pu_bacteria | 2841966195 | 2841973993 | 220 |
| 79 | iso_pu_bacteria | 2841974524 | 2841980614 | 220 |
| 80 | iso_pu_bacteria | 2841983080 | 2841987150 | 220 |
| 81 | iso_pu_bacteria | 2842038055 | 2842041216 | 220 |
| 82 | iso_pu_bacteria | 2842045827 | 2842045839 | 220 |
| 83 | iso_pu_bacteria | 2844315083 | 2844320467 | 220 |
| 84 | iso_pu_bacteria | 2847930680 | 2847937996 | 220 |
| 85 | iso_pu_bacteria | 2847939898 | 2847939938 | 220 |
| 86 | iso_pu_bacteria | 2849076700 | 2849077858 | 220 |
| 87 | iso_pu_bacteria | 2857509624 | 2857511055 | 220 |
| 88 | iso_pu_bacteria | 2857524615 | 2857527118 | 220 |
| 89 | iso_pu_bacteria | 2874590934 | 2874596051 | 220 |
| 90 | iso_pu_bacteria | 2874604998 | 2874608840 | 220 |
| 91 | iso_pu_bacteria | 2874612657 | 2874616838 | 220 |
| 92 | iso_pu_bacteria | 2874620515 | 2874625812 | 220 |
| 93 | iso_pu_bacteria | 2874628541 | 2874632851 | 220 |
| 94 | iso_pu_bacteria | 2874645413 | 2874650875 | 220 |
| 95 | iso_pu_bacteria | 2876761206 | 2876769070 | 220 |
| 96 | iso_pu_bacteria | 2876771140 | 2876776121 | 220 |
| 97 | iso_pu_bacteria | 2876808645 | 2876813903 | 220 |
| 98 | iso_pu_bacteria | 2876818435 | 2876820607 | 220 |
| 99 | iso_pu_bacteria | 2879074833 | 2879080210 | 220 |
| 100 | iso_pu_bacteria | 2879083081 | 2879084456 | 220 |
| 101 | iso_pu_bacteria | 2879099564 | 2879105332 | 220 |
| 102 | iso_pu_bacteria | 2879110137 | 2879115432 | 220 |
| 103 | iso_pu_bacteria | 2879127579 | 2879129983 | 220 |
| 104 | iso_pu_bacteria | 2879142872 | 2879147462 | 220 |
| 105 | iso_pu_bacteria | 2881364244 | 2881367857 | 220 |
| 106 | iso_pu_bacteria | 2881665667 | 2881668796 | 220 |
| 107 | iso_pu_bacteria | 2885366525 | 2885368423 | 220 |
| 108 | iso_pu_bacteria | 2885374607 | 2885378942 | 220 |
| 109 | iso_pu_bacteria | 2885409591 | 2885410124 | 220 |
| 110 | iso_pu_bacteria | 2888378607 | 2888385974 | 220 |
| 111 | iso_pu_bacteria | 2888388044 | 2888392333 | 220 |
| 112 | iso_pu_bacteria | 2888419890 | 2888426077 | 220 |
| 113 | iso_pu_bacteria | 2889033259 | 2889037312 | 220 |
| 114 | iso_pu_bacteria | 2893066018 | 2893068104 | 220 |
| 115 | iso_pu_bacteria | 2903727486 | 2903732876 | 220 |
| 116 | iso_pu_bacteria | 2903748898 | 2903759073 | 220 |
| 117 | iso_pu_bacteria | 2904666416 | 2904673827 | 220 |
| 118 | iso_pu_bacteria | 2904690495 | 2904698735 | 220 |
| 119 | iso_pu_bacteria | 2904699407 | 2904710856 | 220 |
| 120 | iso_pu_bacteria | 2904711408 | 2904711421 | 220 |
| 121 | iso_pu_bacteria | 2906602504 | 2906606995 | 220 |
| 122 | iso_pu_bacteria | 2906610324 | 2906615997 | 220 |
| 123 | iso_pu_bacteria | 2906626472 | 2906626600 | 220 |
| 124 | iso_pu_bacteria | 2906635258 | 2906639084 | 220 |
| 125 | iso_pu_bacteria | 2906643746 | 2906647062 | 220 |
| 126 | iso_pu_bacteria | 2906660503 | 2906665229 | 220 |
| 127 | iso_pu_bacteria | 2908739725 | 2908741002 | 220 |
| 128 | iso_pu_bacteria | 2908756301 | 2908759249 | 220 |
| 129 | iso_pu_bacteria | 2908775508 | 2908782156 | 220 |
| 130 | iso_pu_bacteria | 2919073203 | 2919078233 | 220 |
| 131 | iso_pu_bacteria | 2922361189 | 2922361444 | 220 |
| 132 | iso_pu_bacteria | 2922368715 | 2922376294 | 220 |
| 133 | iso_pu_bacteria | 2922386360 | 2922388865 | 220 |
| 134 | iso_pu_bacteria | 2922393267 | 2922399990 | 220 |
| 135 | iso_pu_bacteria | 2922425934 | 2922432036 | 220 |
| 136 | iso_pu_bacteria | 2929615660 | 2929624262 | 220 |
| 137 | iso_pu_bacteria | 2929624759 | 2929633312 | 220 |
| 138 | iso_pu_bacteria | 2932784394 | 2932789444 | 220 |
| 139 | iso_pu_bacteria | 2932794094 | 2932797780 | 220 |
| 140 | iso_pu_bacteria | 2932801729 | 2932804297 | 220 |
| 141 | iso_pu_bacteria | 2932809354 | 2932816493 | 220 |
| 142 | iso_pu_bacteria | 2932828146 | 2932832051 | 220 |
| 143 | iso_pu_bacteria | 2933577622 | 2933585977 | 220 |
| 144 | iso_pu_bacteria | 2935608549 | 2935610413 | 220 |
| 145 | iso_pu_bacteria | 2935616580 | 2935621990 | 220 |
| 146 | iso_pu_bacteria | 2935630451 | 2935631088 | 220 |
| 147 | iso_pu_bacteria | 2935638405 | 2935644000 | 220 |
| 148 | iso_pu_bacteria | 2935648319 | 2935654384 | 220 |
| 149 | iso_pu_bacteria | 2935656913 | 2935663264 | 220 |
| 150 | iso_pu_bacteria | 2935665750 | 2935669085 | 220 |
| 151 | iso_pu_bacteria | 2935675223 | 2935683357 | 220 |
| 152 | iso_pu_bacteria | 2935684952 | 2935692298 | 220 |
| 153 | iso_pu_bacteria | 2935694250 | 2935700531 | 220 |
| 154 | iso_pu_bacteria | 2935703347 | 2935708840 | 220 |
| 155 | iso_pu_bacteria | 2935713505 | 2935720464 | 220 |
| 156 | iso_pu_bacteria | 2935722832 | 2935729745 | 220 |
| 157 | iso_pu_bacteria | 2935732158 | 2935739273 | 220 |
| 158 | iso_pu_bacteria | 2935741537 | 2935748186 | 220 |
| 159 | iso_pu_bacteria | 2935750917 | 2935758389 | 220 |
| 160 | iso_pu_bacteria | 2935769743 | 2935771055 | 220 |
| 161 | iso_pu_bacteria | 2935777560 | 2935781223 | 220 |
| 162 | iso_pu_bacteria | 2935785616 | 2935786244 | 220 |
| 163 | iso_pu_bacteria | 2935793552 | 2935793959 | 220 |
| 164 | iso_pu_bacteria | 2935801545 | 2935805801 | 220 |
| 165 | iso_pu_bacteria | 2935819856 | 2935823574 | 220 |
| 166 | iso_pu_bacteria | 2935827899 | 2935833252 | 220 |
| 167 | iso_pu_bacteria | 2935837841 | 2935843173 | 220 |
| 168 | iso_pu_bacteria | 2935847175 | 2935849099 | 220 |
| 169 | iso_pu_bacteria | 2935855204 | 2935860237 | 220 |
| 170 | iso_pu_bacteria | 2935864058 | 2935867634 | 220 |
| 171 | iso_pu_bacteria | 2935873716 | 2935878556 | 220 |
| 172 | iso_pu_bacteria | 2935883170 | 2935888324 | 220 |
| 173 | iso_pu_bacteria | 2935959822 | 2935965305 | 220 |
| 174 | iso_pu_bacteria | 2935975950 | 2935976078 | 220 |
| 175 | iso_pu_bacteria | 2935984226 | 2935986427 | 220 |
| 176 | iso_pu_bacteria | 2935992306 | 2935998167 | 220 |
| 177 | iso_pu_bacteria | 2936002035 | 2936006867 | 220 |
| 178 | iso_pu_bacteria | 2936011229 | 2936017420 | 220 |
| 179 | iso_pu_bacteria | 2936019824 | 2936025922 | 220 |
| 180 | iso_pu_bacteria | 2936028420 | 2936034670 | 220 |
| 181 | iso_pu_bacteria | 2936046547 | 2936052727 | 220 |
| 182 | iso_pu_bacteria | 2936055302 | 2936059922 | 220 |
| 183 | iso_pu_bacteria | 2940556831 | 2940564293 | 220 |
| 184 | iso_pu_bacteria | 2941507105 | 2941507740 | 220 |
| 185 | iso_pu_bacteria | 2941515067 | 2941516167 | 220 |
| 186 | iso_pu_bacteria | 2941523033 | 2941523125 | 220 |
| 187 | iso_pu_bacteria | 2941531003 | 2941531673 | 220 |
| 188 | iso_pu_bacteria | 2941538514 | 2941544719 | 220 |
| 189 | iso_pu_bacteria | 3005474847 | 3005476942 | 220 |
| 190 | iso_pu_bacteria | 3005483717 | 3005485627 | 220 |
| 191 | iso_pu_bacteria | 3005506211 | 3005511568 | 220 |
| 192 | iso_pu_bacteria | 3005587118 | 3005594451 | 220 |
| 193 | iso_pu_bacteria | 3005594810 | 3005600842 | 220 |
| 194 | iso_pu_bacteria | 3005710791 | 3005716255 | 220 |
| 195 | iso_pu_bacteria | 3005718088 | 3005723635 | 220 |
| 196 | iso_pu_bacteria | 8006933436 | 8006934477 | 220 |
| 197 | iso_pu_bacteria | 8006964411 | 8006968892 | 220 |
| 198 | iso_pu_bacteria | 8006973647 | 8006974447 | 220 |
| 199 | iso_pu_bacteria | 8006984368 | 8006985227 | 220 |
| 200 | iso_pu_bacteria | 8006994254 | 8006998546 | 220 |
| 201 | iso_pu_bacteria | 8016522445 | 8016528030 | 220 |
| 202 | iso_pu_bacteria | 8016539877 | 8016546394 | 220 |
| 203 | iso_pu_bacteria | 8016548790 | 8016555733 | 220 |
| 204 | iso_pu_bacteria | 8016557553 | 8016564086 | 220 |
| 205 | iso_pu_bacteria | 8016566248 | 8016571476 | 220 |
| 206 | iso_pu_bacteria | 8016575299 | 8016575729 | 220 |
| 207 | iso_pu_bacteria | 8016583857 | 8016594965 | 220 |
| 208 | iso_pu_bacteria | 8016595262 | 8016601791 | 220 |
| 209 | iso_pu_bacteria | 8016603502 | 8016608458 | 220 |
| 210 | iso_pu_bacteria | 8016613128 | 8016616409 | 220 |
| 211 | iso_pu_bacteria | 8016622563 | 8016624729 | 220 |
| 212 | iso_pu_bacteria | 8016630954 | 8016638225 | 220 |
| 213 | iso_pu_bacteria | 8017057580 | 8017065438 | 220 |
| 214 | iso_pu_bacteria | 8019538911 | 8019546899 | 220 |
| 215 | iso_pu_bacteria | 8019547302 | 8019551770 | 220 |
| 216 | iso_pu_bacteria | 8019555841 | 8019564205 | 220 |
| 217 | iso_pu_bacteria | 8019565922 | 8019574283 | 220 |
| 218 | iso_pu_bacteria | 8019576017 | 8019584834 | 220 |
| 219 | iso_pu_bacteria | 8019597564 | 8019598665 | 220 |
| 220 | iso_pu_bacteria | 8019608314 | 8019609705 | 220 |
| 221 | iso_pu_bacteria | 8019619141 | 8019620294 | 220 |
| 222 | iso_pu_bacteria | 8019629233 | 8019632806 | 220 |
| 223 | iso_pu_bacteria | 8019638758 | 8019647122 | 220 |
| 224 | iso_pu_bacteria | 8019648815 | 8019655570 | 220 |
| 225 | iso_pu_bacteria | 8019659431 | 8019660668 | 220 |
| 226 | iso_pu_bacteria | 8019678201 | 8019686009 | 220 |
| 227 | iso_pu_bacteria | 8055742211 | 8055744579 | 220 |
| 228 | iso_pu_bacteria | 8056673599 | 8056675921 | 220 |
| 229 | iso_pu_bacteria | 8056689827 | 8056690337 | 220 |
| 230 | iso_pu_bacteria | 8056967851 | 8056971861 | 220 |
| 231 | 3300004625 | Ga0055543_1009210 | Ga0055543_10092102 | 221 |
| 232 | 3300005262 | Ga0065165_1005320 | Ga0065165_10053202 | 221 |
| 233 | 3300005981 | Ga0081538_10118419 | Ga0081538_101184192 | 221 |
| 234 | 3300045976 | Ga0466967_0283797 | Ga0466967_0283797_879_1547 | 221 |
| 235 | 3300005844 | Ga0068862_100567855 | Ga0068862_1005678551 | 222 |
| 236 | 3300006844 | Ga0075428_100114727 | Ga0075428_1001147273 | 222 |
| 237 | 3300006847 | Ga0075431_100466500 | Ga0075431_1004665002 | 222 |
| 238 | 3300006847 | Ga0075431_100577774 | Ga0075431_1005777741 | 222 |
| 239 | 3300006880 | Ga0075429_100248209 | Ga0075429_1002482092 | 222 |
| 240 | 3300009147 | Ga0114129_10604008 | Ga0114129_106040082 | 222 |
| 241 | 3300035724 | Ga0373933_0076006 | Ga0373933_0076006_814_1518 | 222 |
| 242 | 3300049593 | Ga0501077_0125181 | Ga0501077_0125181_661_1335 | 222 |
| 243 | 3300050508 | nmdc:mga09592_424127_c1 | nmdc:mga09592_424127_c1_283_951 | 222 |
| 244 | 3300050510 | nmdc:mga06r32_300228_c1 | nmdc:mga06r32_300228_c1_690_1358 | 222 |
| 245 | 3300050510 | nmdc:mga06r32_589991_c1 | nmdc:mga06r32_589991_c1_216_884 | 222 |
| 246 | 3300053088 | Ga0500644_0038550 | Ga0500644_0038550_413_1096 | 222 |
| 247 | 3300053103 | Ga0500555_008486 | Ga0500555_008486_2208_2882 | 222 |
| 248 | 3300005330 | Ga0070690_100068847 | Ga0070690_1000688472 | 223 |
| 249 | 3300005466 | Ga0070685_10499638 | Ga0070685_104996381 | 223 |
| 250 | 3300005843 | Ga0068860_100624935 | Ga0068860_1006249352 | 223 |
| 251 | 3300006844 | Ga0075428_100064665 | Ga0075428_1000646651 | 223 |
| 252 | 3300006847 | Ga0075431_100001225 | Ga0075431_10000122510 | 223 |
| 253 | 3300006852 | Ga0075433_10398345 | Ga0075433_103983452 | 223 |
| 254 | 3300006880 | Ga0075429_100018718 | Ga0075429_1000187184 | 223 |
| 255 | 3300007076 | Ga0075435_100023928 | Ga0075435_1000239283 | 223 |
| 256 | 3300009101 | Ga0105247_10092044 | Ga0105247_100920442 | 223 |
| 257 | 3300009147 | Ga0114129_10732406 | Ga0114129_107324061 | 223 |
| 258 | 3300014326 | Ga0157380_10668996 | Ga0157380_106689962 | 223 |
| 259 | 3300021377 | Ga0213874_10177782 | Ga0213874_101777821 | 223 |
| 260 | 3300025961 | Ga0207712_10370930 | Ga0207712_103709302 | 223 |
| 261 | 3300028381 | Ga0268264_10886878 | Ga0268264_108868781 | 223 |
| 262 | 3300035170 | Ga0373943_0371294 | Ga0373943_0371294_53_724 | 223 |
| 263 | 3300035171 | Ga0373946_0105317 | Ga0373946_0105317_128_799 | 223 |
| 264 | 3300035692 | Ga0373935_0373164 | Ga0373935_0373164_97_768 | 223 |
| 265 | 3300035692 | Ga0373935_0396374 | Ga0373935_0396374_184_861 | 223 |
| 266 | 3300035695 | Ga0373927_0053685 | Ga0373927_0053685_1821_2492 | 223 |
| 267 | 3300037068 | Ga0373925_0348185 | Ga0373925_0348185_106_783 | 223 |
| 268 | 3300046674 | Ga0495588_0200844 | Ga0495588_0200844_297_968 | 223 |
| 269 | 3300047321 | Ga0495676_0088068 | Ga0495676_0088068_110_781 | 223 |
| 270 | 3300048907 | Ga0496104_0002704 | Ga0496104_0002704_12547_13221 | 223 |
| 271 | 3300048913 | Ga0496110_0003914 | Ga0496110_0003914_8176_8850 | 223 |
| 272 | 3300048915 | Ga0496112_0385023 | Ga0496112_0385023_532_1206 | 223 |
| 273 | 3300049578 | Ga0501042_0128487 | Ga0501042_0128487_1013_1687 | 223 |
| 274 | 3300050508 | nmdc:mga09592_16208_c1 | nmdc:mga09592_16208_c1_2027_2701 | 223 |
| 275 | 3300050509 | nmdc:mga0qj67_80587_c1 | nmdc:mga0qj67_80587_c1_1181_1858 | 223 |
| 276 | 3300050510 | nmdc:mga06r32_1139_c1 | nmdc:mga06r32_1139_c1_7924_8598 | 223 |
| 277 | 3300050510 | nmdc:mga06r32_284235_c1 | nmdc:mga06r32_284235_c1_415_1092 | 223 |
| 278 | 3300050511 | nmdc:mga08y16_341470_c1 | nmdc:mga08y16_341470_c1_802_1488 | 223 |
| 279 | 3300050512 | nmdc:mga0n895_517383_c1 | nmdc:mga0n895_517383_c1_81_758 | 223 |
| 280 | 3300050513 | nmdc:mga0rr50_12850_c1 | nmdc:mga0rr50_12850_c1_1553_2227 | 223 |
| 281 | 3300050515 | nmdc:mga0a205_162849_c1 | nmdc:mga0a205_162849_c1_1423_2100 | 223 |
| 282 | 3300050515 | nmdc:mga0a205_350223_c1 | nmdc:mga0a205_350223_c1_116_793 | 223 |
| 283 | 3300054114 | Ga0501084_0914998 | Ga0501084_0914998_27_701 | 223 |
| 284 | 3300060353 | Ga0501082_0212161 | Ga0501082_0212161_208_879 | 223 |
| 285 | 3300060353 | Ga0501082_0437711 | Ga0501082_0437711_74_748 | 223 |
| 286 | 3300061734 | Ga0530510_0034799 | Ga0530510_0034799_26_700 | 223 |
| 287 | 3300001989 | JGI24739J22299_10031895 | JGI24739J22299_100318952 | 224 |
| 288 | 3300003203 | JGI25406J46586_10000449 | JGI25406J46586_1000044912 | 224 |
| 289 | 3300003214 | JGI25165J46597_1014521 | JGI25165J46597_10145212 | 224 |
| 290 | 3300003214 | JGI25165J46597_1024683 | JGI25165J46597_10246831 | 224 |
| 291 | 3300003215 | JGI25153J46596_10009921 | JGI25153J46596_100099212 | 224 |
| 292 | 3300003215 | JGI25153J46596_10010561 | JGI25153J46596_100105613 | 224 |
| 293 | 3300003354 | JGI25160J50197_1001648 | JGI25160J50197_10016482 | 224 |
| 294 | 3300003354 | JGI25160J50197_1002130 | JGI25160J50197_10021302 | 224 |
| 295 | 3300003354 | JGI25160J50197_1019345 | JGI25160J50197_10193451 | 224 |
| 296 | 3300003354 | JGI25160J50197_1047548 | JGI25160J50197_10475482 | 224 |
| 297 | 3300003659 | JGI25404J52841_10001620 | JGI25404J52841_100016202 | 224 |
| 298 | 3300003763 | Ga0055529_1007195 | Ga0055529_10071952 | 224 |
| 299 | 3300003794 | Ga0055531_10010882 | Ga0055531_100108824 | 224 |
| 300 | 3300003911 | JGI25405J52794_10024657 | JGI25405J52794_100246572 | 224 |
| 301 | 3300004625 | Ga0055543_1003126 | Ga0055543_10031263 | 224 |
| 302 | 3300005262 | Ga0065165_1001015 | Ga0065165_100101535 | 224 |
| 303 | 3300005262 | Ga0065165_1003915 | Ga0065165_10039152 | 224 |
| 304 | 3300005262 | Ga0065165_1005972 | Ga0065165_10059726 | 224 |
| 305 | 3300005262 | Ga0065165_1024939 | Ga0065165_10249392 | 224 |
| 306 | 3300005327 | Ga0070658_10104328 | Ga0070658_101043281 | 224 |
| 307 | 3300005327 | Ga0070658_10143011 | Ga0070658_101430112 | 224 |
| 308 | 3300005327 | Ga0070658_10235014 | Ga0070658_102350142 | 224 |
| 309 | 3300005329 | Ga0070683_100233918 | Ga0070683_1002339182 | 224 |
| 310 | 3300005329 | Ga0070683_100524586 | Ga0070683_1005245861 | 224 |
| 311 | 3300005334 | Ga0068869_100330842 | Ga0068869_1003308421 | 224 |
| 312 | 3300005336 | Ga0070680_100113146 | Ga0070680_1001131462 | 224 |
| 313 | 3300005337 | Ga0070682_100041329 | Ga0070682_1000413293 | 224 |
| 314 | 3300005337 | Ga0070682_100044975 | Ga0070682_1000449752 | 224 |
| 315 | 3300005337 | Ga0070682_100318574 | Ga0070682_1003185742 | 224 |
| 316 | 3300005337 | Ga0070682_100427868 | Ga0070682_1004278681 | 224 |
| 317 | 3300005338 | Ga0068868_100025479 | Ga0068868_1000254794 | 224 |
| 318 | 3300005339 | Ga0070660_100011831 | Ga0070660_1000118312 | 224 |
| 319 | 3300005344 | Ga0070661_100052521 | Ga0070661_1000525212 | 224 |
| 320 | 3300005344 | Ga0070661_100088122 | Ga0070661_1000881222 | 224 |
| 321 | 3300005344 | Ga0070661_100106546 | Ga0070661_1001065461 | 224 |
| 322 | 3300005344 | Ga0070661_100265363 | Ga0070661_1002653631 | 224 |
| 323 | 3300005345 | Ga0070692_10288427 | Ga0070692_102884271 | 224 |
| 324 | 3300005347 | Ga0070668_100100152 | Ga0070668_1001001522 | 224 |
| 325 | 3300005347 | Ga0070668_100634462 | Ga0070668_1006344621 | 224 |
| 326 | 3300005353 | Ga0070669_100171320 | Ga0070669_1001713202 | 224 |
| 327 | 3300005355 | Ga0070671_100086849 | Ga0070671_1000868493 | 224 |
| 328 | 3300005355 | Ga0070671_100170800 | Ga0070671_1001708001 | 224 |
| 329 | 3300005366 | Ga0070659_100312806 | Ga0070659_1003128062 | 224 |
| 330 | 3300005366 | Ga0070659_100579541 | Ga0070659_1005795412 | 224 |
| 331 | 3300005406 | Ga0070703_10045888 | Ga0070703_100458882 | 224 |
| 332 | 3300005434 | Ga0070709_10000778 | Ga0070709_1000077818 | 224 |
| 333 | 3300005434 | Ga0070709_10007154 | Ga0070709_100071544 | 224 |
| 334 | 3300005434 | Ga0070709_10175986 | Ga0070709_101759862 | 224 |
| 335 | 3300005434 | Ga0070709_10378686 | Ga0070709_103786861 | 224 |
| 336 | 3300005435 | Ga0070714_100013419 | Ga0070714_1000134195 | 224 |
| 337 | 3300005435 | Ga0070714_100031338 | Ga0070714_1000313384 | 224 |
| 338 | 3300005435 | Ga0070714_100270133 | Ga0070714_1002701332 | 224 |
| 339 | 3300005435 | Ga0070714_100310108 | Ga0070714_1003101082 | 224 |
| 340 | 3300005435 | Ga0070714_100997170 | Ga0070714_1009971701 | 224 |
| 341 | 3300005436 | Ga0070713_100025862 | Ga0070713_1000258624 | 224 |
| 342 | 3300005436 | Ga0070713_100171302 | Ga0070713_1001713022 | 224 |
| 343 | 3300005436 | Ga0070713_100273775 | Ga0070713_1002737751 | 224 |
| 344 | 3300005436 | Ga0070713_100557115 | Ga0070713_1005571152 | 224 |
| 345 | 3300005437 | Ga0070710_10004897 | Ga0070710_100048973 | 224 |
| 346 | 3300005437 | Ga0070710_10009727 | Ga0070710_100097272 | 224 |
| 347 | 3300005437 | Ga0070710_10298032 | Ga0070710_102980321 | 224 |
| 348 | 3300005439 | Ga0070711_100005828 | Ga0070711_1000058281 | 224 |
| 349 | 3300005439 | Ga0070711_100051265 | Ga0070711_1000512652 | 224 |
| 350 | 3300005439 | Ga0070711_100054196 | Ga0070711_1000541962 | 224 |
| 351 | 3300005439 | Ga0070711_100228645 | Ga0070711_1002286452 | 224 |
| 352 | 3300005439 | Ga0070711_100408992 | Ga0070711_1004089922 | 224 |
| 353 | 3300005441 | Ga0070700_100117728 | Ga0070700_1001177282 | 224 |
| 354 | 3300005444 | Ga0070694_100225499 | Ga0070694_1002254993 | 224 |
| 355 | 3300005445 | Ga0070708_100127678 | Ga0070708_1001276782 | 224 |
| 356 | 3300005455 | Ga0070663_100036220 | Ga0070663_1000362203 | 224 |
| 357 | 3300005455 | Ga0070663_100059522 | Ga0070663_1000595222 | 224 |
| 358 | 3300005455 | Ga0070663_100379740 | Ga0070663_1003797402 | 224 |
| 359 | 3300005457 | Ga0070662_100143125 | Ga0070662_1001431252 | 224 |
| 360 | 3300005458 | Ga0070681_10048974 | Ga0070681_100489742 | 224 |
| 361 | 3300005458 | Ga0070681_10063856 | Ga0070681_100638562 | 224 |
| 362 | 3300005458 | Ga0070681_10143228 | Ga0070681_101432282 | 224 |
| 363 | 3300005458 | Ga0070681_10355721 | Ga0070681_103557211 | 224 |
| 364 | 3300005458 | Ga0070681_10383361 | Ga0070681_103833611 | 224 |
| 365 | 3300005459 | Ga0068867_100175184 | Ga0068867_1001751842 | 224 |
| 366 | 3300005467 | Ga0070706_100103899 | Ga0070706_1001038992 | 224 |
| 367 | 3300005467 | Ga0070706_100590125 | Ga0070706_1005901251 | 224 |
| 368 | 3300005471 | Ga0070698_100029876 | Ga0070698_1000298764 | 224 |
| 369 | 3300005530 | Ga0070679_100013103 | Ga0070679_1000131033 | 224 |
| 370 | 3300005530 | Ga0070679_100025223 | Ga0070679_1000252232 | 224 |
| 371 | 3300005530 | Ga0070679_100074795 | Ga0070679_1000747952 | 224 |
| 372 | 3300005535 | Ga0070684_100013479 | Ga0070684_1000134795 | 224 |
| 373 | 3300005535 | Ga0070684_100024449 | Ga0070684_1000244493 | 224 |
| 374 | 3300005535 | Ga0070684_100085868 | Ga0070684_1000858682 | 224 |
| 375 | 3300005535 | Ga0070684_101094621 | Ga0070684_1010946211 | 224 |
| 376 | 3300005536 | Ga0070697_100014896 | Ga0070697_1000148964 | 224 |
| 377 | 3300005536 | Ga0070697_100694497 | Ga0070697_1006944971 | 224 |
| 378 | 3300005539 | Ga0068853_100014418 | Ga0068853_1000144185 | 224 |
| 379 | 3300005539 | Ga0068853_100021360 | Ga0068853_1000213602 | 224 |
| 380 | 3300005539 | Ga0068853_100047626 | Ga0068853_1000476262 | 224 |
| 381 | 3300005539 | Ga0068853_100208234 | Ga0068853_1002082342 | 224 |
| 382 | 3300005544 | Ga0070686_100056153 | Ga0070686_1000561532 | 224 |
| 383 | 3300005547 | Ga0070693_100023630 | Ga0070693_1000236302 | 224 |
| 384 | 3300005548 | Ga0070665_100109075 | Ga0070665_1001090752 | 224 |
| 385 | 3300005548 | Ga0070665_100168214 | Ga0070665_1001682143 | 224 |
| 386 | 3300005548 | Ga0070665_100192798 | Ga0070665_1001927982 | 224 |
| 387 | 3300005548 | Ga0070665_100357872 | Ga0070665_1003578722 | 224 |
| 388 | 3300005549 | Ga0070704_100137184 | Ga0070704_1001371842 | 224 |
| 389 | 3300005563 | Ga0068855_100054688 | Ga0068855_1000546885 | 224 |
| 390 | 3300005563 | Ga0068855_100055771 | Ga0068855_1000557712 | 224 |
| 391 | 3300005563 | Ga0068855_100103512 | Ga0068855_1001035122 | 224 |
| 392 | 3300005563 | Ga0068855_100127380 | Ga0068855_1001273802 | 224 |
| 393 | 3300005563 | Ga0068855_100593765 | Ga0068855_1005937652 | 224 |
| 394 | 3300005577 | Ga0068857_100074421 | Ga0068857_1000744212 | 224 |
| 395 | 3300005577 | Ga0068857_100308188 | Ga0068857_1003081883 | 224 |
| 396 | 3300005578 | Ga0068854_100060797 | Ga0068854_1000607972 | 224 |
| 397 | 3300005614 | Ga0068856_100000477 | Ga0068856_10000047719 | 224 |
| 398 | 3300005614 | Ga0068856_100129762 | Ga0068856_1001297621 | 224 |
| 399 | 3300005614 | Ga0068856_100174968 | Ga0068856_1001749682 | 224 |
| 400 | 3300005616 | Ga0068852_100030147 | Ga0068852_1000301472 | 224 |
| 401 | 3300005616 | Ga0068852_100073061 | Ga0068852_1000730611 | 224 |
| 402 | 3300005616 | Ga0068852_100094876 | Ga0068852_1000948764 | 224 |
| 403 | 3300005616 | Ga0068852_100613723 | Ga0068852_1006137232 | 224 |
| 404 | 3300005617 | Ga0068859_100439993 | Ga0068859_1004399932 | 224 |
| 405 | 3300005618 | Ga0068864_100319617 | Ga0068864_1003196172 | 224 |
| 406 | 3300005719 | Ga0068861_100399328 | Ga0068861_1003993281 | 224 |
| 407 | 3300005719 | Ga0068861_100454382 | Ga0068861_1004543821 | 224 |
| 408 | 3300005834 | Ga0068851_10003264 | Ga0068851_100032648 | 224 |
| 409 | 3300005834 | Ga0068851_10044749 | Ga0068851_100447492 | 224 |
| 410 | 3300005834 | Ga0068851_10102036 | Ga0068851_101020361 | 224 |
| 411 | 3300005834 | Ga0068851_10416438 | Ga0068851_104164381 | 224 |
| 412 | 3300005843 | Ga0068860_100000324 | Ga0068860_10000032416 | 224 |
| 413 | 3300005843 | Ga0068860_100240384 | Ga0068860_1002403842 | 224 |
| 414 | 3300005844 | Ga0068862_100112944 | Ga0068862_1001129442 | 224 |
| 415 | 3300005937 | Ga0081455_10001871 | Ga0081455_1000187113 | 224 |
| 416 | 3300005937 | Ga0081455_10011253 | Ga0081455_1001125312 | 224 |
| 417 | 3300005937 | Ga0081455_10016763 | Ga0081455_100167637 | 224 |
| 418 | 3300005937 | Ga0081455_10022225 | Ga0081455_100222255 | 224 |
| 419 | 3300005937 | Ga0081455_10044838 | Ga0081455_100448382 | 224 |
| 420 | 3300005937 | Ga0081455_10097121 | Ga0081455_100971212 | 224 |
| 421 | 3300005937 | Ga0081455_10103018 | Ga0081455_101030183 | 224 |
| 422 | 3300005937 | Ga0081455_10331051 | Ga0081455_103310511 | 224 |
| 423 | 3300005981 | Ga0081538_10016530 | Ga0081538_100165302 | 224 |
| 424 | 3300005981 | Ga0081538_10114658 | Ga0081538_101146582 | 224 |
| 425 | 3300005983 | Ga0081540_1004943 | Ga0081540_10049434 | 224 |
| 426 | 3300005983 | Ga0081540_1012323 | Ga0081540_10123233 | 224 |
| 427 | 3300005983 | Ga0081540_1012929 | Ga0081540_10129292 | 224 |
| 428 | 3300005983 | Ga0081540_1013478 | Ga0081540_10134783 | 224 |
| 429 | 3300005983 | Ga0081540_1014993 | Ga0081540_10149932 | 224 |
| 430 | 3300005983 | Ga0081540_1064646 | Ga0081540_10646461 | 224 |
| 431 | 3300005983 | Ga0081540_1093158 | Ga0081540_10931582 | 224 |
| 432 | 3300005983 | Ga0081540_1100486 | Ga0081540_11004862 | 224 |
| 433 | 3300005985 | Ga0081539_10000306 | Ga0081539_1000030632 | 224 |
| 434 | 3300005985 | Ga0081539_10001290 | Ga0081539_1000129013 | 224 |
| 435 | 3300005985 | Ga0081539_10026446 | Ga0081539_100264462 | 224 |
| 436 | 3300006028 | Ga0070717_10000521 | Ga0070717_1000052123 | 224 |
| 437 | 3300006028 | Ga0070717_10024234 | Ga0070717_100242344 | 224 |
| 438 | 3300006028 | Ga0070717_10047558 | Ga0070717_100475582 | 224 |
| 439 | 3300006028 | Ga0070717_10560528 | Ga0070717_105605281 | 224 |
| 440 | 3300006028 | Ga0070717_10732517 | Ga0070717_107325171 | 224 |
| 441 | 3300006038 | Ga0075365_10049232 | Ga0075365_100492322 | 224 |
| 442 | 3300006038 | Ga0075365_10069084 | Ga0075365_100690842 | 224 |
| 443 | 3300006038 | Ga0075365_10101316 | Ga0075365_101013162 | 224 |
| 444 | 3300006038 | Ga0075365_10216737 | Ga0075365_102167372 | 224 |
| 445 | 3300006038 | Ga0075365_10246154 | Ga0075365_102461542 | 224 |
| 446 | 3300006038 | Ga0075365_10250170 | Ga0075365_102501702 | 224 |
| 447 | 3300006038 | Ga0075365_10313357 | Ga0075365_103133572 | 224 |
| 448 | 3300006048 | Ga0075363_100173605 | Ga0075363_1001736051 | 224 |
| 449 | 3300006051 | Ga0075364_10263690 | Ga0075364_102636902 | 224 |
| 450 | 3300006058 | Ga0075432_10080907 | Ga0075432_100809072 | 224 |
| 451 | 3300006163 | Ga0070715_10006756 | Ga0070715_100067563 | 224 |
| 452 | 3300006163 | Ga0070715_10021529 | Ga0070715_100215292 | 224 |
| 453 | 3300006163 | Ga0070715_10117296 | Ga0070715_101172961 | 224 |
| 454 | 3300006173 | Ga0070716_100012501 | Ga0070716_1000125015 | 224 |
| 455 | 3300006173 | Ga0070716_100045303 | Ga0070716_1000453032 | 224 |
| 456 | 3300006173 | Ga0070716_100051114 | Ga0070716_1000511142 | 224 |
| 457 | 3300006175 | Ga0070712_100006981 | Ga0070712_1000069812 | 224 |
| 458 | 3300006175 | Ga0070712_100058182 | Ga0070712_1000581822 | 224 |
| 459 | 3300006175 | Ga0070712_100114609 | Ga0070712_1001146092 | 224 |
| 460 | 3300006175 | Ga0070712_100425851 | Ga0070712_1004258512 | 224 |
| 461 | 3300006177 | Ga0075362_10008952 | Ga0075362_100089523 | 224 |
| 462 | 3300006177 | Ga0075362_10075963 | Ga0075362_100759632 | 224 |
| 463 | 3300006177 | Ga0075362_10092607 | Ga0075362_100926072 | 224 |
| 464 | 3300006178 | Ga0075367_10041929 | Ga0075367_100419292 | 224 |
| 465 | 3300006186 | Ga0075369_10040562 | Ga0075369_100405622 | 224 |
| 466 | 3300006195 | Ga0075366_10108345 | Ga0075366_101083452 | 224 |
| 467 | 3300006195 | Ga0075366_10235297 | Ga0075366_102352971 | 224 |
| 468 | 3300006237 | Ga0097621_100257966 | Ga0097621_1002579662 | 224 |
| 469 | 3300006353 | Ga0075370_10234298 | Ga0075370_102342982 | 224 |
| 470 | 3300006353 | Ga0075370_10280621 | Ga0075370_102806211 | 224 |
| 471 | 3300006353 | Ga0075370_10436071 | Ga0075370_104360711 | 224 |
| 472 | 3300006844 | Ga0075428_100189179 | Ga0075428_1001891792 | 224 |
| 473 | 3300006871 | Ga0075434_100027921 | Ga0075434_1000279213 | 224 |
| 474 | 3300006881 | Ga0068865_100042431 | Ga0068865_1000424311 | 224 |
| 475 | 3300006931 | Ga0097620_100439959 | Ga0097620_1004399591 | 224 |
| 476 | 3300006941 | Ga0099825_1023491 | Ga0099825_10234912 | 224 |
| 477 | 3300006941 | Ga0099825_1027660 | Ga0099825_10276601 | 224 |
| 478 | 3300006942 | Ga0099824_1023526 | Ga0099824_10235262 | 224 |
| 479 | 3300006942 | Ga0099824_1025601 | Ga0099824_10256013 | 224 |
| 480 | 3300006943 | Ga0099822_1024641 | Ga0099822_10246412 | 224 |
| 481 | 3300006944 | Ga0099823_1036903 | Ga0099823_10369034 | 224 |
| 482 | 3300007265 | Ga0099794_10002976 | Ga0099794_100029763 | 224 |
| 483 | 3300007265 | Ga0099794_10007419 | Ga0099794_100074192 | 224 |
| 484 | 3300007788 | Ga0099795_10271064 | Ga0099795_102710641 | 224 |
| 485 | 3300009093 | Ga0105240_10013788 | Ga0105240_100137885 | 224 |
| 486 | 3300009093 | Ga0105240_10071470 | Ga0105240_100714703 | 224 |
| 487 | 3300009093 | Ga0105240_10083063 | Ga0105240_100830633 | 224 |
| 488 | 3300009093 | Ga0105240_10093352 | Ga0105240_100933522 | 224 |
| 489 | 3300009093 | Ga0105240_10336296 | Ga0105240_103362962 | 224 |
| 490 | 3300009094 | Ga0111539_10352323 | Ga0111539_103523233 | 224 |
| 491 | 3300009098 | Ga0105245_10084091 | Ga0105245_100840912 | 224 |
| 492 | 3300009098 | Ga0105245_11068879 | Ga0105245_110688791 | 224 |
| 493 | 3300009101 | Ga0105247_10264117 | Ga0105247_102641172 | 224 |
| 494 | 3300009147 | Ga0114129_10267821 | Ga0114129_102678212 | 224 |
| 495 | 3300009148 | Ga0105243_10297525 | Ga0105243_102975251 | 224 |
| 496 | 3300009174 | Ga0105241_10001008 | Ga0105241_1000100811 | 224 |
| 497 | 3300009174 | Ga0105241_10121468 | Ga0105241_101214683 | 224 |
| 498 | 3300009176 | Ga0105242_10919459 | Ga0105242_109194591 | 224 |
| 499 | 3300009177 | Ga0105248_10077301 | Ga0105248_100773011 | 224 |
| 500 | 3300009177 | Ga0105248_10557551 | Ga0105248_105575511 | 224 |
| 501 | 3300009177 | Ga0105248_11138035 | Ga0105248_111380351 | 224 |
| 502 | 3300009545 | Ga0105237_10015187 | Ga0105237_100151876 | 224 |
| 503 | 3300009545 | Ga0105237_10015820 | Ga0105237_100158208 | 224 |
| 504 | 3300009545 | Ga0105237_10285034 | Ga0105237_102850342 | 224 |
| 505 | 3300009545 | Ga0105237_10444601 | Ga0105237_104446011 | 224 |
| 506 | 3300009545 | Ga0105237_11183873 | Ga0105237_111838731 | 224 |
| 507 | 3300009551 | Ga0105238_10017578 | Ga0105238_100175782 | 224 |
| 508 | 3300009551 | Ga0105238_10046426 | Ga0105238_100464263 | 224 |
| 509 | 3300009551 | Ga0105238_10084272 | Ga0105238_100842722 | 224 |
| 510 | 3300009551 | Ga0105238_10087410 | Ga0105238_100874102 | 224 |
| 511 | 3300009551 | Ga0105238_10394335 | Ga0105238_103943351 | 224 |
| 512 | 3300009553 | Ga0105249_10108270 | Ga0105249_101082701 | 224 |
| 513 | 3300010159 | Ga0099796_10071308 | Ga0099796_100713081 | 224 |
| 514 | 3300010375 | Ga0105239_10062974 | Ga0105239_100629742 | 224 |
| 515 | 3300010375 | Ga0105239_10074658 | Ga0105239_100746582 | 224 |
| 516 | 3300010375 | Ga0105239_10089192 | Ga0105239_100891923 | 224 |
| 517 | 3300010375 | Ga0105239_10138632 | Ga0105239_101386322 | 224 |
| 518 | 3300010375 | Ga0105239_10248700 | Ga0105239_102487003 | 224 |
| 519 | 3300012508 | Ga0157315_1004111 | Ga0157315_10041112 | 224 |
| 520 | 3300013104 | Ga0157370_10045059 | Ga0157370_100450595 | 224 |
| 521 | 3300013104 | Ga0157370_10203539 | Ga0157370_102035392 | 224 |
| 522 | 3300013105 | Ga0157369_10005277 | Ga0157369_1000527714 | 224 |
| 523 | 3300013105 | Ga0157369_10007048 | Ga0157369_100070488 | 224 |
| 524 | 3300013105 | Ga0157369_10026918 | Ga0157369_100269183 | 224 |
| 525 | 3300013105 | Ga0157369_10397687 | Ga0157369_103976872 | 224 |
| 526 | 3300013105 | Ga0157369_10653850 | Ga0157369_106538501 | 224 |
| 527 | 3300013296 | Ga0157374_10433937 | Ga0157374_104339372 | 224 |
| 528 | 3300013296 | Ga0157374_10519993 | Ga0157374_105199931 | 224 |
| 529 | 3300013297 | Ga0157378_10759627 | Ga0157378_107596272 | 224 |
| 530 | 3300013306 | Ga0163162_10175716 | Ga0163162_101757162 | 224 |
| 531 | 3300013307 | Ga0157372_10141777 | Ga0157372_101417772 | 224 |
| 532 | 3300013308 | Ga0157375_10024362 | Ga0157375_100243622 | 224 |
| 533 | 3300013308 | Ga0157375_10033711 | Ga0157375_100337115 | 224 |
| 534 | 3300013308 | Ga0157375_10410164 | Ga0157375_104101642 | 224 |
| 535 | 3300013308 | Ga0157375_11678833 | Ga0157375_116788331 | 224 |
| 536 | 3300014325 | Ga0163163_10034881 | Ga0163163_100348812 | 224 |
| 537 | 3300014326 | Ga0157380_10356831 | Ga0157380_103568312 | 224 |
| 538 | 3300014745 | Ga0157377_10384178 | Ga0157377_103841781 | 224 |
| 539 | 3300014969 | Ga0157376_10043247 | Ga0157376_100432472 | 224 |
| 540 | 3300017792 | Ga0163161_10141459 | Ga0163161_101414592 | 224 |
| 541 | 3300017792 | Ga0163161_10157536 | Ga0163161_101575362 | 224 |
| 542 | 3300017792 | Ga0163161_10392669 | Ga0163161_103926691 | 224 |
| 543 | 3300020080 | Ga0206350_11050481 | Ga0206350_110504812 | 224 |
| 544 | 3300020080 | Ga0206350_11210336 | Ga0206350_112103361 | 224 |
| 545 | 3300020610 | Ga0154015_1433898 | Ga0154015_14338981 | 224 |
| 546 | 3300021320 | Ga0214544_1000136 | Ga0214544_100013670 | 224 |
| 547 | 3300021321 | Ga0214542_1000127 | Ga0214542_100012770 | 224 |
| 548 | 3300021324 | Ga0214545_1000063 | Ga0214545_100006328 | 224 |
| 549 | 3300021327 | Ga0214543_1000238 | Ga0214543_100023850 | 224 |
| 550 | 3300021384 | Ga0213876_10003778 | Ga0213876_100037785 | 224 |
| 551 | 3300021384 | Ga0213876_10017018 | Ga0213876_100170182 | 224 |
| 552 | 3300021384 | Ga0213876_10183977 | Ga0213876_101839771 | 224 |
| 553 | 3300021388 | Ga0213875_10104794 | Ga0213875_101047942 | 224 |
| 554 | 3300021441 | Ga0213871_10005533 | Ga0213871_100055331 | 224 |
| 555 | 3300022467 | Ga0224712_10089601 | Ga0224712_100896011 | 224 |
| 556 | 3300022467 | Ga0224712_10299251 | Ga0224712_102992511 | 224 |
| 557 | 3300025230 | Ga0209563_101314 | Ga0209563_1013146 | 224 |
| 558 | 3300025253 | Ga0209677_100344 | Ga0209677_10034422 | 224 |
| 559 | 3300025253 | Ga0209677_101591 | Ga0209677_1015919 | 224 |
| 560 | 3300025254 | Ga0209148_1000529 | Ga0209148_100052930 | 224 |
| 561 | 3300025261 | Ga0209233_1000933 | Ga0209233_10009333 | 224 |
| 562 | 3300025261 | Ga0209233_1017814 | Ga0209233_10178143 | 224 |
| 563 | 3300025261 | Ga0209233_1018846 | Ga0209233_10188462 | 224 |
| 564 | 3300025261 | Ga0209233_1042504 | Ga0209233_10425042 | 224 |
| 565 | 3300025272 | Ga0209455_1002494 | Ga0209455_10024945 | 224 |
| 566 | 3300025273 | Ga0209673_1040759 | Ga0209673_10407592 | 224 |
| 567 | 3300025295 | Ga0209564_1004806 | Ga0209564_10048067 | 224 |
| 568 | 3300025295 | Ga0209564_1018699 | Ga0209564_10186994 | 224 |
| 569 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011836 | 224 |
| 570 | 3300025297 | Ga0209758_1000455 | Ga0209758_100045567 | 224 |
| 571 | 3300025297 | Ga0209758_1001990 | Ga0209758_100199017 | 224 |
| 572 | 3300025297 | Ga0209758_1006185 | Ga0209758_10061855 | 224 |
| 573 | 3300025297 | Ga0209758_1012065 | Ga0209758_10120653 | 224 |
| 574 | 3300025297 | Ga0209758_1017504 | Ga0209758_10175044 | 224 |
| 575 | 3300025299 | Ga0209256_1033968 | Ga0209256_10339681 | 224 |
| 576 | 3300025302 | Ga0207426_1000480 | Ga0207426_100048056 | 224 |
| 577 | 3300025302 | Ga0207426_1000669 | Ga0207426_100066934 | 224 |
| 578 | 3300025302 | Ga0207426_1001491 | Ga0207426_10014919 | 224 |
| 579 | 3300025302 | Ga0207426_1015249 | Ga0207426_10152492 | 224 |
| 580 | 3300025303 | Ga0209051_1041116 | Ga0209051_10411161 | 224 |
| 581 | 3300025304 | Ga0209257_1001458 | Ga0209257_100145823 | 224 |
| 582 | 3300025315 | Ga0207697_10068080 | Ga0207697_100680802 | 224 |
| 583 | 3300025321 | Ga0207656_10021788 | Ga0207656_100217882 | 224 |
| 584 | 3300025321 | Ga0207656_10044531 | Ga0207656_100445312 | 224 |
| 585 | 3300025885 | Ga0207653_10125727 | Ga0207653_101257272 | 224 |
| 586 | 3300025898 | Ga0207692_10023106 | Ga0207692_100231062 | 224 |
| 587 | 3300025898 | Ga0207692_10073455 | Ga0207692_100734552 | 224 |
| 588 | 3300025899 | Ga0207642_10233509 | Ga0207642_102335092 | 224 |
| 589 | 3300025900 | Ga0207710_10363959 | Ga0207710_103639591 | 224 |
| 590 | 3300025904 | Ga0207647_10001884 | Ga0207647_100018842 | 224 |
| 591 | 3300025904 | Ga0207647_10004039 | Ga0207647_1000403911 | 224 |
| 592 | 3300025905 | Ga0207685_10001667 | Ga0207685_100016671 | 224 |
| 593 | 3300025906 | Ga0207699_10006106 | Ga0207699_100061061 | 224 |
| 594 | 3300025906 | Ga0207699_10035655 | Ga0207699_100356552 | 224 |
| 595 | 3300025906 | Ga0207699_10088526 | Ga0207699_100885262 | 224 |
| 596 | 3300025906 | Ga0207699_10104744 | Ga0207699_101047442 | 224 |
| 597 | 3300025908 | Ga0207643_10074402 | Ga0207643_100744022 | 224 |
| 598 | 3300025909 | Ga0207705_10061293 | Ga0207705_100612931 | 224 |
| 599 | 3300025909 | Ga0207705_10086384 | Ga0207705_100863842 | 224 |
| 600 | 3300025909 | Ga0207705_10338364 | Ga0207705_103383641 | 224 |
| 601 | 3300025910 | Ga0207684_10141154 | Ga0207684_101411541 | 224 |
| 602 | 3300025911 | Ga0207654_10004108 | Ga0207654_100041088 | 224 |
| 603 | 3300025911 | Ga0207654_10055191 | Ga0207654_100551913 | 224 |
| 604 | 3300025911 | Ga0207654_10078427 | Ga0207654_100784272 | 224 |
| 605 | 3300025912 | Ga0207707_10001006 | Ga0207707_1000100621 | 224 |
| 606 | 3300025912 | Ga0207707_10003605 | Ga0207707_100036056 | 224 |
| 607 | 3300025912 | Ga0207707_10017450 | Ga0207707_100174503 | 224 |
| 608 | 3300025912 | Ga0207707_10044046 | Ga0207707_100440463 | 224 |
| 609 | 3300025913 | Ga0207695_10000157 | Ga0207695_10000157173 | 224 |
| 610 | 3300025913 | Ga0207695_10001596 | Ga0207695_1000159611 | 224 |
| 611 | 3300025913 | Ga0207695_10046830 | Ga0207695_100468302 | 224 |
| 612 | 3300025913 | Ga0207695_10134161 | Ga0207695_101341612 | 224 |
| 613 | 3300025913 | Ga0207695_10626737 | Ga0207695_106267371 | 224 |
| 614 | 3300025913 | Ga0207695_10829160 | Ga0207695_108291601 | 224 |
| 615 | 3300025914 | Ga0207671_10050591 | Ga0207671_100505913 | 224 |
| 616 | 3300025914 | Ga0207671_10066557 | Ga0207671_100665572 | 224 |
| 617 | 3300025915 | Ga0207693_10014734 | Ga0207693_100147345 | 224 |
| 618 | 3300025915 | Ga0207693_10024253 | Ga0207693_100242531 | 224 |
| 619 | 3300025915 | Ga0207693_10093014 | Ga0207693_100930141 | 224 |
| 620 | 3300025915 | Ga0207693_10293714 | Ga0207693_102937141 | 224 |
| 621 | 3300025915 | Ga0207693_10461006 | Ga0207693_104610061 | 224 |
| 622 | 3300025916 | Ga0207663_10000211 | Ga0207663_1000021120 | 224 |
| 623 | 3300025916 | Ga0207663_10131532 | Ga0207663_101315322 | 224 |
| 624 | 3300025916 | Ga0207663_10212380 | Ga0207663_102123803 | 224 |
| 625 | 3300025916 | Ga0207663_10253479 | Ga0207663_102534792 | 224 |
| 626 | 3300025916 | Ga0207663_10450717 | Ga0207663_104507172 | 224 |
| 627 | 3300025917 | Ga0207660_10001786 | Ga0207660_1000178614 | 224 |
| 628 | 3300025917 | Ga0207660_10046067 | Ga0207660_100460672 | 224 |
| 629 | 3300025917 | Ga0207660_10660862 | Ga0207660_106608621 | 224 |
| 630 | 3300025918 | Ga0207662_10294182 | Ga0207662_102941822 | 224 |
| 631 | 3300025919 | Ga0207657_10017803 | Ga0207657_100178035 | 224 |
| 632 | 3300025919 | Ga0207657_10055233 | Ga0207657_100552332 | 224 |
| 633 | 3300025920 | Ga0207649_10056956 | Ga0207649_100569561 | 224 |
| 634 | 3300025920 | Ga0207649_10063665 | Ga0207649_100636652 | 224 |
| 635 | 3300025920 | Ga0207649_10138119 | Ga0207649_101381192 | 224 |
| 636 | 3300025920 | Ga0207649_10189582 | Ga0207649_101895822 | 224 |
| 637 | 3300025921 | Ga0207652_10002365 | Ga0207652_1000236514 | 224 |
| 638 | 3300025921 | Ga0207652_10014023 | Ga0207652_100140232 | 224 |
| 639 | 3300025921 | Ga0207652_10031387 | Ga0207652_100313873 | 224 |
| 640 | 3300025921 | Ga0207652_10202137 | Ga0207652_102021372 | 224 |
| 641 | 3300025924 | Ga0207694_10000757 | Ga0207694_1000075722 | 224 |
| 642 | 3300025924 | Ga0207694_10051570 | Ga0207694_100515702 | 224 |
| 643 | 3300025924 | Ga0207694_10127588 | Ga0207694_101275882 | 224 |
| 644 | 3300025927 | Ga0207687_10175949 | Ga0207687_101759492 | 224 |
| 645 | 3300025928 | Ga0207700_10012705 | Ga0207700_100127055 | 224 |
| 646 | 3300025928 | Ga0207700_10133770 | Ga0207700_101337702 | 224 |
| 647 | 3300025928 | Ga0207700_10604816 | Ga0207700_106048161 | 224 |
| 648 | 3300025929 | Ga0207664_10097594 | Ga0207664_100975942 | 224 |
| 649 | 3300025929 | Ga0207664_10154186 | Ga0207664_101541862 | 224 |
| 650 | 3300025929 | Ga0207664_10240314 | Ga0207664_102403142 | 224 |
| 651 | 3300025929 | Ga0207664_10530326 | Ga0207664_105303261 | 224 |
| 652 | 3300025929 | Ga0207664_10672775 | Ga0207664_106727751 | 224 |
| 653 | 3300025929 | Ga0207664_10718922 | Ga0207664_107189221 | 224 |
| 654 | 3300025931 | Ga0207644_10090576 | Ga0207644_100905762 | 224 |
| 655 | 3300025932 | Ga0207690_10429890 | Ga0207690_104298902 | 224 |
| 656 | 3300025933 | Ga0207706_10164599 | Ga0207706_101645992 | 224 |
| 657 | 3300025937 | Ga0207669_10031720 | Ga0207669_100317203 | 224 |
| 658 | 3300025937 | Ga0207669_10099677 | Ga0207669_100996771 | 224 |
| 659 | 3300025939 | Ga0207665_10029652 | Ga0207665_100296523 | 224 |
| 660 | 3300025939 | Ga0207665_10045152 | Ga0207665_100451521 | 224 |
| 661 | 3300025939 | Ga0207665_10098165 | Ga0207665_100981652 | 224 |
| 662 | 3300025940 | Ga0207691_10231613 | Ga0207691_102316133 | 224 |
| 663 | 3300025941 | Ga0207711_10050232 | Ga0207711_100502321 | 224 |
| 664 | 3300025944 | Ga0207661_10001813 | Ga0207661_1000181313 | 224 |
| 665 | 3300025944 | Ga0207661_10008843 | Ga0207661_100088435 | 224 |
| 666 | 3300025949 | Ga0207667_10013120 | Ga0207667_100131203 | 224 |
| 667 | 3300025949 | Ga0207667_10027313 | Ga0207667_100273132 | 224 |
| 668 | 3300025949 | Ga0207667_10062687 | Ga0207667_100626873 | 224 |
| 669 | 3300025949 | Ga0207667_10129200 | Ga0207667_101292002 | 224 |
| 670 | 3300025949 | Ga0207667_10430730 | Ga0207667_104307301 | 224 |
| 671 | 3300025949 | Ga0207667_10473635 | Ga0207667_104736351 | 224 |
| 672 | 3300025949 | Ga0207667_10554015 | Ga0207667_105540151 | 224 |
| 673 | 3300025961 | Ga0207712_10220597 | Ga0207712_102205971 | 224 |
| 674 | 3300025972 | Ga0207668_10110621 | Ga0207668_101106213 | 224 |
| 675 | 3300025972 | Ga0207668_10123928 | Ga0207668_101239282 | 224 |
| 676 | 3300025972 | Ga0207668_10151381 | Ga0207668_101513812 | 224 |
| 677 | 3300025981 | Ga0207640_10006211 | Ga0207640_100062111 | 224 |
| 678 | 3300025981 | Ga0207640_10078470 | Ga0207640_100784702 | 224 |
| 679 | 3300025981 | Ga0207640_10152952 | Ga0207640_101529522 | 224 |
| 680 | 3300025981 | Ga0207640_10383123 | Ga0207640_103831231 | 224 |
| 681 | 3300025986 | Ga0207658_10305054 | Ga0207658_103050542 | 224 |
| 682 | 3300026023 | Ga0207677_10139059 | Ga0207677_101390592 | 224 |
| 683 | 3300026035 | Ga0207703_10261584 | Ga0207703_102615841 | 224 |
| 684 | 3300026035 | Ga0207703_10727415 | Ga0207703_107274152 | 224 |
| 685 | 3300026041 | Ga0207639_10013907 | Ga0207639_100139072 | 224 |
| 686 | 3300026041 | Ga0207639_10016218 | Ga0207639_100162186 | 224 |
| 687 | 3300026041 | Ga0207639_10083636 | Ga0207639_100836362 | 224 |
| 688 | 3300026041 | Ga0207639_10133476 | Ga0207639_101334762 | 224 |
| 689 | 3300026041 | Ga0207639_10582971 | Ga0207639_105829711 | 224 |
| 690 | 3300026067 | Ga0207678_10070874 | Ga0207678_100708742 | 224 |
| 691 | 3300026067 | Ga0207678_10072576 | Ga0207678_100725763 | 224 |
| 692 | 3300026067 | Ga0207678_10221531 | Ga0207678_102215311 | 224 |
| 693 | 3300026067 | Ga0207678_10400012 | Ga0207678_104000122 | 224 |
| 694 | 3300026067 | Ga0207678_10452936 | Ga0207678_104529362 | 224 |
| 695 | 3300026075 | Ga0207708_10074639 | Ga0207708_100746392 | 224 |
| 696 | 3300026075 | Ga0207708_10267339 | Ga0207708_102673392 | 224 |
| 697 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003334 | 224 |
| 698 | 3300026078 | Ga0207702_10000744 | Ga0207702_100007443 | 224 |
| 699 | 3300026078 | Ga0207702_10138381 | Ga0207702_101383812 | 224 |
| 700 | 3300026078 | Ga0207702_10248579 | Ga0207702_102485793 | 224 |
| 701 | 3300026088 | Ga0207641_10212515 | Ga0207641_102125152 | 224 |
| 702 | 3300026088 | Ga0207641_10316844 | Ga0207641_103168441 | 224 |
| 703 | 3300026089 | Ga0207648_10095149 | Ga0207648_100951491 | 224 |
| 704 | 3300026116 | Ga0207674_10055685 | Ga0207674_100556853 | 224 |
| 705 | 3300026116 | Ga0207674_10065865 | Ga0207674_100658653 | 224 |
| 706 | 3300026116 | Ga0207674_10076930 | Ga0207674_100769302 | 224 |
| 707 | 3300026116 | Ga0207674_10077074 | Ga0207674_100770742 | 224 |
| 708 | 3300026116 | Ga0207674_10323603 | Ga0207674_103236032 | 224 |
| 709 | 3300026116 | Ga0207674_10826388 | Ga0207674_108263881 | 224 |
| 710 | 3300026118 | Ga0207675_100100246 | Ga0207675_1001002462 | 224 |
| 711 | 3300026118 | Ga0207675_100118791 | Ga0207675_1001187911 | 224 |
| 712 | 3300026121 | Ga0207683_10123427 | Ga0207683_101234272 | 224 |
| 713 | 3300026142 | Ga0207698_10039521 | Ga0207698_100395212 | 224 |
| 714 | 3300026142 | Ga0207698_11264693 | Ga0207698_112646931 | 224 |
| 715 | 3300027296 | Ga0209389_1000009 | Ga0209389_100000972 | 224 |
| 716 | 3300027296 | Ga0209389_1000088 | Ga0209389_100008834 | 224 |
| 717 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007162 | 224 |
| 718 | 3300027357 | Ga0209589_1000189 | Ga0209589_100018924 | 224 |
| 719 | 3300027361 | Ga0209489_100008 | Ga0209489_100008162 | 224 |
| 720 | 3300027361 | Ga0209489_100050 | Ga0209489_10005053 | 224 |
| 721 | 3300027361 | Ga0209489_100085 | Ga0209489_10008573 | 224 |
| 722 | 3300027363 | Ga0209700_100009 | Ga0209700_100009162 | 224 |
| 723 | 3300027363 | Ga0209700_100016 | Ga0209700_100016161 | 224 |
| 724 | 3300027671 | Ga0209588_1025767 | Ga0209588_10257672 | 224 |
| 725 | 3300027671 | Ga0209588_1133221 | Ga0209588_11332211 | 224 |
| 726 | 3300027866 | Ga0209813_10040615 | Ga0209813_100406151 | 224 |
| 727 | 3300028379 | Ga0268266_10050046 | Ga0268266_100500462 | 224 |
| 728 | 3300028379 | Ga0268266_10070563 | Ga0268266_100705632 | 224 |
| 729 | 3300028380 | Ga0268265_10099986 | Ga0268265_100999862 | 224 |
| 730 | 3300028380 | Ga0268265_10307339 | Ga0268265_103073392 | 224 |
| 731 | 3300028380 | Ga0268265_10406113 | Ga0268265_104061131 | 224 |
| 732 | 3300028381 | Ga0268264_10000038 | Ga0268264_10000038317 | 224 |
| 733 | 3300028381 | Ga0268264_10071583 | Ga0268264_100715833 | 224 |
| 734 | 3300028381 | Ga0268264_10505345 | Ga0268264_105053452 | 224 |
| 735 | 3300028563 | Ga0265319_1008276 | Ga0265319_10082765 | 224 |
| 736 | 3300028666 | Ga0265336_10002175 | Ga0265336_100021752 | 224 |
| 737 | 3300028786 | Ga0307517_10000512 | Ga0307517_100005122 | 224 |
| 738 | 3300028786 | Ga0307517_10201351 | Ga0307517_102013511 | 224 |
| 739 | 3300028794 | Ga0307515_10051295 | Ga0307515_100512951 | 224 |
| 740 | 3300028794 | Ga0307515_10081344 | Ga0307515_100813444 | 224 |
| 741 | 3300028800 | Ga0265338_10000116 | Ga0265338_10000116118 | 224 |
| 742 | 3300029957 | Ga0265324_10005816 | Ga0265324_100058163 | 224 |
| 743 | 3300031239 | Ga0265328_10155178 | Ga0265328_101551781 | 224 |
| 744 | 3300031249 | Ga0265339_10001103 | Ga0265339_100011033 | 224 |
| 745 | 3300031249 | Ga0265339_10012106 | Ga0265339_100121062 | 224 |
| 746 | 3300031249 | Ga0265339_10166699 | Ga0265339_101666991 | 224 |
| 747 | 3300031507 | Ga0307509_10165420 | Ga0307509_101654202 | 224 |
| 748 | 3300031507 | Ga0307509_10226909 | Ga0307509_102269092 | 224 |
| 749 | 3300031507 | Ga0307509_10424421 | Ga0307509_104244212 | 224 |
| 750 | 3300031616 | Ga0307508_10000008 | Ga0307508_10000008111 | 224 |
| 751 | 3300031616 | Ga0307508_10240708 | Ga0307508_102407082 | 224 |
| 752 | 3300031616 | Ga0307508_10285142 | Ga0307508_102851421 | 224 |
| 753 | 3300031711 | Ga0265314_10001759 | Ga0265314_1000175910 | 224 |
| 754 | 3300031711 | Ga0265314_10038466 | Ga0265314_100384662 | 224 |
| 755 | 3300031711 | Ga0265314_10087044 | Ga0265314_100870442 | 224 |
| 756 | 3300031712 | Ga0265342_10006885 | Ga0265342_100068852 | 224 |
| 757 | 3300031712 | Ga0265342_10309580 | Ga0265342_103095801 | 224 |
| 758 | 3300031730 | Ga0307516_10096696 | Ga0307516_100966962 | 224 |
| 759 | 3300031901 | Ga0307406_10646108 | Ga0307406_106461081 | 224 |
| 760 | 3300032002 | Ga0307416_100486582 | Ga0307416_1004865822 | 224 |
| 761 | 3300033179 | Ga0307507_10028768 | Ga0307507_100287685 | 224 |
| 762 | 3300033180 | Ga0307510_10016371 | Ga0307510_100163718 | 224 |
| 763 | 3300033180 | Ga0307510_10027712 | Ga0307510_100277123 | 224 |
| 764 | 3300033180 | Ga0307510_10052175 | Ga0307510_100521756 | 224 |
| 765 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004371 | 224 |
| 766 | 3300034820 | Ga0373959_0012593 | Ga0373959_0012593_572_1246 | 224 |
| 767 | 3300035083 | Ga0373926_0007233 | Ga0373926_0007233_1818_2492 | 224 |
| 768 | 3300035086 | Ga0373934_0166294 | Ga0373934_0166294_40_714 | 224 |
| 769 | 3300035091 | Ga0373951_0039839 | Ga0373951_0039839_418_1095 | 224 |
| 770 | 3300035111 | Ga0373923_0010246 | Ga0373923_0010246_1776_2495 | 224 |
| 771 | 3300035111 | Ga0373923_0012016 | Ga0373923_0012016_1340_2014 | 224 |
| 772 | 3300035113 | Ga0373936_0020563 | Ga0373936_0020563_1670_2344 | 224 |
| 773 | 3300035116 | Ga0373945_0003891 | Ga0373945_0003891_3997_4671 | 224 |
| 774 | 3300035116 | Ga0373945_0037545 | Ga0373945_0037545_418_1092 | 224 |
| 775 | 3300035117 | Ga0373953_0001272 | Ga0373953_0001272_172_891 | 224 |
| 776 | 3300035118 | Ga0373954_0000228 | Ga0373954_0000228_13187_13906 | 224 |
| 777 | 3300035118 | Ga0373954_0093189 | Ga0373954_0093189_523_1197 | 224 |
| 778 | 3300035119 | Ga0373956_0002043 | Ga0373956_0002043_1091_1810 | 224 |
| 779 | 3300035120 | Ga0373957_0000531 | Ga0373957_0000531_1502_2221 | 224 |
| 780 | 3300035171 | Ga0373946_0044385 | Ga0373946_0044385_471_1145 | 224 |
| 781 | 3300035172 | Ga0373955_0012568 | Ga0373955_0012568_2070_2789 | 224 |
| 782 | 3300035692 | Ga0373935_0026404 | Ga0373935_0026404_780_1454 | 224 |
| 783 | 3300035692 | Ga0373935_0049502 | Ga0373935_0049502_1311_1985 | 224 |
| 784 | 3300035692 | Ga0373935_0450491 | Ga0373935_0450491_32_745 | 224 |
| 785 | 3300035695 | Ga0373927_0009711 | Ga0373927_0009711_5371_6045 | 224 |
| 786 | 3300035695 | Ga0373927_0066330 | Ga0373927_0066330_291_965 | 224 |
| 787 | 3300035695 | Ga0373927_0091955 | Ga0373927_0091955_832_1506 | 224 |
| 788 | 3300035695 | Ga0373927_0093269 | Ga0373927_0093269_921_1595 | 224 |
| 789 | 3300035695 | Ga0373927_0237968 | Ga0373927_0237968_307_981 | 224 |
| 790 | 3300035724 | Ga0373933_0004420 | Ga0373933_0004420_185_859 | 224 |
| 791 | 3300035724 | Ga0373933_0051579 | Ga0373933_0051579_1140_1859 | 224 |
| 792 | 3300035724 | Ga0373933_0332859 | Ga0373933_0332859_181_855 | 224 |
| 793 | 3300035725 | Ga0373947_0132093 | Ga0373947_0132093_595_1269 | 224 |
| 794 | 3300035725 | Ga0373947_0298475 | Ga0373947_0298475_173_847 | 224 |
| 795 | 3300036401 | Ga0373937_0001379 | Ga0373937_0001379_8245_8964 | 224 |
| 796 | 3300036401 | Ga0373937_0052771 | Ga0373937_0052771_1629_2303 | 224 |
| 797 | 3300036401 | Ga0373937_0062906 | Ga0373937_0062906_2145_2819 | 224 |
| 798 | 3300036401 | Ga0373937_0725255 | Ga0373937_0725255_197_871 | 224 |
| 799 | 3300036401 | Ga0373937_0869521 | Ga0373937_0869521_137_811 | 224 |
| 800 | 3300037068 | Ga0373925_0067108 | Ga0373925_0067108_1729_2403 | 224 |
| 801 | 3300037068 | Ga0373925_0084095 | Ga0373925_0084095_1635_2309 | 224 |
| 802 | 3300037068 | Ga0373925_0097602 | Ga0373925_0097602_1175_1849 | 224 |
| 803 | 3300037068 | Ga0373925_0196909 | Ga0373925_0196909_17_691 | 224 |
| 804 | 3300037312 | Ga0395899_0271608 | Ga0395899_0271608_312_986 | 224 |
| 805 | 3300037418 | Ga0395900_0000134 | Ga0395900_0000134_76623_77297 | 224 |
| 806 | 3300037418 | Ga0395900_0014518 | Ga0395900_0014518_4274_4948 | 224 |
| 807 | 3300037418 | Ga0395900_0105300 | Ga0395900_0105300_1938_2660 | 224 |
| 808 | 3300037418 | Ga0395900_0443512 | Ga0395900_0443512_68_742 | 224 |
| 809 | 3300037466 | Ga0395898_0019042 | Ga0395898_0019042_6204_6878 | 224 |
| 810 | 3300037466 | Ga0395898_0027084 | Ga0395898_0027084_1429_2151 | 224 |
| 811 | 3300037471 | Ga0395905_0018896 | Ga0395905_0018896_260_934 | 224 |
| 812 | 3300037471 | Ga0395905_0040242 | Ga0395905_0040242_716_1390 | 224 |
| 813 | 3300037471 | Ga0395905_0175863 | Ga0395905_0175863_168_881 | 224 |
| 814 | 3300037853 | Ga0436364_0051166 | Ga0436364_0051166_1240_1914 | 224 |
| 815 | 3300037853 | Ga0436364_0475552 | Ga0436364_0475552_1257_1931 | 224 |
| 816 | 3300037853 | Ga0436364_0986822 | Ga0436364_0986822_45_803 | 224 |
| 817 | 3300037853 | Ga0436364_1075789 | Ga0436364_1075789_46_720 | 224 |
| 818 | 3300038443 | Ga0395901_0013321 | Ga0395901_0013321_161_835 | 224 |
| 819 | 3300038443 | Ga0395901_0102903 | Ga0395901_0102903_1443_2165 | 224 |
| 820 | 3300039437 | Ga0436365_0481444 | Ga0436365_0481444_654_1328 | 224 |
| 821 | 3300039437 | Ga0436365_0769976 | Ga0436365_0769976_415_1089 | 224 |
| 822 | 3300039437 | Ga0436365_1210825 | Ga0436365_1210825_1980_2654 | 224 |
| 823 | 3300039447 | Ga0436361_0317256 | Ga0436361_0317256_586_1329 | 224 |
| 824 | 3300039447 | Ga0436361_0346254 | Ga0436361_0346254_56_730 | 224 |
| 825 | 3300039447 | Ga0436361_0402388 | Ga0436361_0402388_4607_5281 | 224 |
| 826 | 3300039450 | Ga0436363_0861308 | Ga0436363_0861308_254_928 | 224 |
| 827 | 3300039450 | Ga0436363_1401795 | Ga0436363_1401795_12762_13436 | 224 |
| 828 | 3300039453 | Ga0436362_0084779 | Ga0436362_0084779_1035_1709 | 224 |
| 829 | 3300039453 | Ga0436362_0817857 | Ga0436362_0817857_725_1408 | 224 |
| 830 | 3300041413 | Ga0439465_0120252 | Ga0439465_0120252_35_709 | 224 |
| 831 | 3300041452 | Ga0451793_1559700 | Ga0451793_1559700_158_832 | 224 |
| 832 | 3300041453 | Ga0451797_0752526 | Ga0451797_0752526_189_863 | 224 |
| 833 | 3300041494 | Ga0451837_0571975 | Ga0451837_0571975_407_1081 | 224 |
| 834 | 3300042005 | Ga0439448_0076097 | Ga0439448_0076097_100_774 | 224 |
| 835 | 3300042438 | Ga0439459_0010174 | Ga0439459_0010174_142_816 | 224 |
| 836 | 3300044656 | Ga0466969_0193501 | Ga0466969_0193501_193_876 | 224 |
| 837 | 3300044658 | Ga0466972_0008710 | Ga0466972_0008710_1142_1816 | 224 |
| 838 | 3300044658 | Ga0466972_0018187 | Ga0466972_0018187_999_1673 | 224 |
| 839 | 3300044683 | Ga0466965_0029714 | Ga0466965_0029714_455_1129 | 224 |
| 840 | 3300044684 | Ga0466966_0448711 | Ga0466966_0448711_55_729 | 224 |
| 841 | 3300044693 | Ga0466961_0000060 | Ga0466961_0000060_46664_47338 | 224 |
| 842 | 3300044694 | Ga0466963_0223958 | Ga0466963_0223958_10_684 | 224 |
| 843 | 3300044694 | Ga0466963_0467975 | Ga0466963_0467975_164_838 | 224 |
| 844 | 3300044719 | Ga0466971_0231926 | Ga0466971_0231926_95_769 | 224 |
| 845 | 3300044735 | Ga0466968_0005390 | Ga0466968_0005390_2105_2779 | 224 |
| 846 | 3300044735 | Ga0466968_0040389 | Ga0466968_0040389_881_1555 | 224 |
| 847 | 3300044901 | Ga0466960_0009676 | Ga0466960_0009676_3158_3832 | 224 |
| 848 | 3300045049 | Ga0466959_0307627 | Ga0466959_0307627_360_1034 | 224 |
| 849 | 3300045049 | Ga0466959_0352048 | Ga0466959_0352048_184_858 | 224 |
| 850 | 3300045976 | Ga0466967_0034297 | Ga0466967_0034297_1868_2542 | 224 |
| 851 | 3300045976 | Ga0466967_0113396 | Ga0466967_0113396_772_1446 | 224 |
| 852 | 3300045976 | Ga0466967_0241307 | Ga0466967_0241307_295_969 | 224 |
| 853 | 3300045976 | Ga0466967_0286790 | Ga0466967_0286790_746_1420 | 224 |
| 854 | 3300045976 | Ga0466967_0454243 | Ga0466967_0454243_420_1094 | 224 |
| 855 | 3300045976 | Ga0466967_0531399 | Ga0466967_0531399_100_774 | 224 |
| 856 | 3300046454 | Ga0495592_0001209 | Ga0495592_0001209_13767_14486 | 224 |
| 857 | 3300046455 | Ga0495603_0053369 | Ga0495603_0053369_161_835 | 224 |
| 858 | 3300046459 | Ga0495629_0002443 | Ga0495629_0002443_1343_2062 | 224 |
| 859 | 3300046459 | Ga0495629_0061638 | Ga0495629_0061638_613_1416 | 224 |
| 860 | 3300046459 | Ga0495629_0304269 | Ga0495629_0304269_356_1030 | 224 |
| 861 | 3300046459 | Ga0495629_0386274 | Ga0495629_0386274_116_790 | 224 |
| 862 | 3300046460 | Ga0495638_0002824 | Ga0495638_0002824_2158_2832 | 224 |
| 863 | 3300046460 | Ga0495638_0016287 | Ga0495638_0016287_3109_3783 | 224 |
| 864 | 3300046460 | Ga0495638_0166082 | Ga0495638_0166082_515_1189 | 224 |
| 865 | 3300046461 | Ga0495641_0089348 | Ga0495641_0089348_321_1079 | 224 |
| 866 | 3300046462 | Ga0495651_0005605 | Ga0495651_0005605_7328_8047 | 224 |
| 867 | 3300046462 | Ga0495651_0008316 | Ga0495651_0008316_2053_2727 | 224 |
| 868 | 3300046462 | Ga0495651_0295336 | Ga0495651_0295336_328_1002 | 224 |
| 869 | 3300046463 | Ga0495653_0002888 | Ga0495653_0002888_7001_7720 | 224 |
| 870 | 3300046463 | Ga0495653_0176426 | Ga0495653_0176426_767_1441 | 224 |
| 871 | 3300046471 | Ga0495650_0058527 | Ga0495650_0058527_18_692 | 224 |
| 872 | 3300046472 | Ga0495580_0025402 | Ga0495580_0025402_2438_3112 | 224 |
| 873 | 3300046473 | Ga0495582_0068768 | Ga0495582_0068768_1086_1760 | 224 |
| 874 | 3300046475 | Ga0495639_0027392 | Ga0495639_0027392_1712_2473 | 224 |
| 875 | 3300046475 | Ga0495639_0124352 | Ga0495639_0124352_394_1068 | 224 |
| 876 | 3300046476 | Ga0495662_0049320 | Ga0495662_0049320_1006_1680 | 224 |
| 877 | 3300046477 | Ga0495664_0002664 | Ga0495664_0002664_8558_9232 | 224 |
| 878 | 3300046477 | Ga0495664_0025173 | Ga0495664_0025173_2390_3064 | 224 |
| 879 | 3300046477 | Ga0495664_0146779 | Ga0495664_0146779_135_809 | 224 |
| 880 | 3300046477 | Ga0495664_0435457 | Ga0495664_0435457_86_772 | 224 |
| 881 | 3300046499 | Ga0495594_0030401 | Ga0495594_0030401_1062_1823 | 224 |
| 882 | 3300046499 | Ga0495594_0233471 | Ga0495594_0233471_342_1016 | 224 |
| 883 | 3300046500 | Ga0495596_0044108 | Ga0495596_0044108_454_1128 | 224 |
| 884 | 3300046501 | Ga0495607_0171715 | Ga0495607_0171715_135_809 | 224 |
| 885 | 3300046507 | Ga0495606_0003208 | Ga0495606_0003208_1717_2391 | 224 |
| 886 | 3300046507 | Ga0495606_0076927 | Ga0495606_0076927_172_930 | 224 |
| 887 | 3300046511 | Ga0495608_0003566 | Ga0495608_0003566_3431_4150 | 224 |
| 888 | 3300046513 | Ga0495616_0043080 | Ga0495616_0043080_958_1632 | 224 |
| 889 | 3300046514 | Ga0495618_0058014 | Ga0495618_0058014_1538_2212 | 224 |
| 890 | 3300046515 | Ga0495620_0142108 | Ga0495620_0142108_132_806 | 224 |
| 891 | 3300046516 | Ga0495628_0012258 | Ga0495628_0012258_959_1678 | 224 |
| 892 | 3300046516 | Ga0495628_0181266 | Ga0495628_0181266_679_1353 | 224 |
| 893 | 3300046517 | Ga0495630_0015746 | Ga0495630_0015746_124_798 | 224 |
| 894 | 3300046518 | Ga0495631_0020454 | Ga0495631_0020454_2382_3056 | 224 |
| 895 | 3300046518 | Ga0495631_0156536 | Ga0495631_0156536_275_949 | 224 |
| 896 | 3300046519 | Ga0495632_0022490 | Ga0495632_0022490_602_1276 | 224 |
| 897 | 3300046519 | Ga0495632_0144262 | Ga0495632_0144262_114_875 | 224 |
| 898 | 3300046522 | Ga0495643_0022092 | Ga0495643_0022092_1849_2538 | 224 |
| 899 | 3300046524 | Ga0495648_0002556 | Ga0495648_0002556_5880_6554 | 224 |
| 900 | 3300046524 | Ga0495648_0004859 | Ga0495648_0004859_4393_5067 | 224 |
| 901 | 3300046526 | Ga0495666_0046587 | Ga0495666_0046587_1266_1940 | 224 |
| 902 | 3300046529 | Ga0495652_0007973 | Ga0495652_0007973_3861_4580 | 224 |
| 903 | 3300046529 | Ga0495652_0021828 | Ga0495652_0021828_778_1581 | 224 |
| 904 | 3300046529 | Ga0495652_0173623 | Ga0495652_0173623_226_900 | 224 |
| 905 | 3300046529 | Ga0495652_0277714 | Ga0495652_0277714_271_990 | 224 |
| 906 | 3300046531 | Ga0495665_0072181 | Ga0495665_0072181_268_942 | 224 |
| 907 | 3300046531 | Ga0495665_0163763 | Ga0495665_0163763_278_952 | 224 |
| 908 | 3300046533 | Ga0495640_0012896 | Ga0495640_0012896_592_1311 | 224 |
| 909 | 3300046533 | Ga0495640_0147258 | Ga0495640_0147258_829_1503 | 224 |
| 910 | 3300046536 | Ga0495587_0004873 | Ga0495587_0004873_6300_6974 | 224 |
| 911 | 3300046536 | Ga0495587_0031035 | Ga0495587_0031035_2531_3205 | 224 |
| 912 | 3300046543 | Ga0495645_0033526 | Ga0495645_0033526_1521_2240 | 224 |
| 913 | 3300046557 | Ga0495622_0004120 | Ga0495622_0004120_5005_5808 | 224 |
| 914 | 3300046557 | Ga0495622_0058842 | Ga0495622_0058842_707_1465 | 224 |
| 915 | 3300046557 | Ga0495622_0166193 | Ga0495622_0166193_292_966 | 224 |
| 916 | 3300046559 | Ga0495667_0009322 | Ga0495667_0009322_74_793 | 224 |
| 917 | 3300046559 | Ga0495667_0013615 | Ga0495667_0013615_2915_3589 | 224 |
| 918 | 3300046615 | Ga0495656_0030522 | Ga0495656_0030522_1107_1781 | 224 |
| 919 | 3300046616 | Ga0495668_0009486 | Ga0495668_0009486_4826_5500 | 224 |
| 920 | 3300046616 | Ga0495668_0103877 | Ga0495668_0103877_144_818 | 224 |
| 921 | 3300046642 | Ga0495634_0005394 | Ga0495634_0005394_1526_2245 | 224 |
| 922 | 3300046642 | Ga0495634_0116381 | Ga0495634_0116381_87_890 | 224 |
| 923 | 3300046648 | Ga0495611_0054941 | Ga0495611_0054941_229_903 | 224 |
| 924 | 3300046648 | Ga0495611_0132438 | Ga0495611_0132438_324_1082 | 224 |
| 925 | 3300046663 | Ga0495635_0003508 | Ga0495635_0003508_3302_4021 | 224 |
| 926 | 3300046663 | Ga0495635_0032590 | Ga0495635_0032590_1722_2525 | 224 |
| 927 | 3300046663 | Ga0495635_0176343 | Ga0495635_0176343_83_757 | 224 |
| 928 | 3300046665 | Ga0495661_0098331 | Ga0495661_0098331_720_1394 | 224 |
| 929 | 3300046665 | Ga0495661_0107686 | Ga0495661_0107686_543_1217 | 224 |
| 930 | 3300046674 | Ga0495588_0032165 | Ga0495588_0032165_1336_2094 | 224 |
| 931 | 3300046674 | Ga0495588_0037012 | Ga0495588_0037012_1561_2235 | 224 |
| 932 | 3300046674 | Ga0495588_0090187 | Ga0495588_0090187_919_1593 | 224 |
| 933 | 3300046675 | Ga0495657_0055464 | Ga0495657_0055464_1344_2063 | 224 |
| 934 | 3300046675 | Ga0495657_0091660 | Ga0495657_0091660_522_1325 | 224 |
| 935 | 3300046678 | Ga0495599_0002630 | Ga0495599_0002630_4241_4960 | 224 |
| 936 | 3300046678 | Ga0495599_0344558 | Ga0495599_0344558_179_853 | 224 |
| 937 | 3300046679 | Ga0495623_0002096 | Ga0495623_0002096_6753_7472 | 224 |
| 938 | 3300046679 | Ga0495623_0005614 | Ga0495623_0005614_1281_1955 | 224 |
| 939 | 3300046680 | Ga0495646_0031779 | Ga0495646_0031779_1743_2417 | 224 |
| 940 | 3300046680 | Ga0495646_0040339 | Ga0495646_0040339_1658_2377 | 224 |
| 941 | 3300046681 | Ga0495647_0040362 | Ga0495647_0040362_134_808 | 224 |
| 942 | 3300046684 | Ga0495669_0047383 | Ga0495669_0047383_912_1625 | 224 |
| 943 | 3300046684 | Ga0495669_0132142 | Ga0495669_0132142_486_1160 | 224 |
| 944 | 3300046684 | Ga0495669_0266536 | Ga0495669_0266536_88_762 | 224 |
| 945 | 3300046689 | Ga0495613_0005605 | Ga0495613_0005605_1953_2672 | 224 |
| 946 | 3300046689 | Ga0495613_0108585 | Ga0495613_0108585_342_1145 | 224 |
| 947 | 3300046689 | Ga0495613_0138635 | Ga0495613_0138635_387_1061 | 224 |
| 948 | 3300046690 | Ga0495624_0032311 | Ga0495624_0032311_1523_2326 | 224 |
| 949 | 3300046690 | Ga0495624_0039775 | Ga0495624_0039775_1386_2060 | 224 |
| 950 | 3300046691 | Ga0495670_0038100 | Ga0495670_0038100_309_983 | 224 |
| 951 | 3300046692 | Ga0495671_0027114 | Ga0495671_0027114_158_919 | 224 |
| 952 | 3300046794 | Ga0495589_0031998 | Ga0495589_0031998_1575_2288 | 224 |
| 953 | 3300046794 | Ga0495589_0093365 | Ga0495589_0093365_16_690 | 224 |
| 954 | 3300046809 | Ga0495600_0011959 | Ga0495600_0011959_1271_1990 | 224 |
| 955 | 3300046809 | Ga0495600_0030308 | Ga0495600_0030308_68_742 | 224 |
| 956 | 3300046809 | Ga0495600_0150591 | Ga0495600_0150591_496_1299 | 224 |
| 957 | 3300047315 | Ga0495581_0010414 | Ga0495581_0010414_4241_4915 | 224 |
| 958 | 3300047315 | Ga0495581_0062978 | Ga0495581_0062978_599_1402 | 224 |
| 959 | 3300047317 | Ga0495604_0020791 | Ga0495604_0020791_3431_4150 | 224 |
| 960 | 3300047319 | Ga0495674_0048444 | Ga0495674_0048444_238_912 | 224 |
| 961 | 3300047319 | Ga0495674_0147106 | Ga0495674_0147106_270_989 | 224 |
| 962 | 3300047320 | Ga0495672_0032579 | Ga0495672_0032579_1724_2398 | 224 |
| 963 | 3300047320 | Ga0495672_0051629 | Ga0495672_0051629_1157_1831 | 224 |
| 964 | 3300047322 | Ga0495680_0006958 | Ga0495680_0006958_61_735 | 224 |
| 965 | 3300047322 | Ga0495680_0032642 | Ga0495680_0032642_3431_4150 | 224 |
| 966 | 3300047443 | Ga0495687_046980 | Ga0495687_046980_868_1557 | 224 |
| 967 | 3300047444 | Ga0495675_0000826 | Ga0495675_0000826_5987_6706 | 224 |
| 968 | 3300047445 | Ga0495677_0096075 | Ga0495677_0096075_375_1088 | 224 |
| 969 | 3300047469 | Ga0495673_0038873 | Ga0495673_0038873_704_1378 | 224 |
| 970 | 3300047469 | Ga0495673_0040939 | Ga0495673_0040939_1035_1709 | 224 |
| 971 | 3300047469 | Ga0495673_0158155 | Ga0495673_0158155_33_836 | 224 |
| 972 | 3300047471 | Ga0495684_0000938 | Ga0495684_0000938_8497_9216 | 224 |
| 973 | 3300047471 | Ga0495684_0100786 | Ga0495684_0100786_256_930 | 224 |
| 974 | 3300047471 | Ga0495684_0588180 | Ga0495684_0588180_49_723 | 224 |
| 975 | 3300047472 | Ga0495686_0023445 | Ga0495686_0023445_100_774 | 224 |
| 976 | 3300047472 | Ga0495686_0081311 | Ga0495686_0081311_1170_1844 | 224 |
| 977 | 3300047673 | Ga0495593_0004740 | Ga0495593_0004740_6136_6855 | 224 |
| 978 | 3300047673 | Ga0495593_0026536 | Ga0495593_0026536_241_915 | 224 |
| 979 | 3300048088 | Ga0495602_0003873 | Ga0495602_0003873_209_928 | 224 |
| 980 | 3300048088 | Ga0495602_0059895 | Ga0495602_0059895_1262_1936 | 224 |
| 981 | 3300048903 | Ga0496100_0106470 | Ga0496100_0106470_228_902 | 224 |
| 982 | 3300048903 | Ga0496100_0279395 | Ga0496100_0279395_25_699 | 224 |
| 983 | 3300048904 | Ga0496101_0021482 | Ga0496101_0021482_2054_2728 | 224 |
| 984 | 3300048904 | Ga0496101_0122781 | Ga0496101_0122781_129_842 | 224 |
| 985 | 3300048905 | Ga0496102_0009611 | Ga0496102_0009611_18_692 | 224 |
| 986 | 3300048905 | Ga0496102_0027169 | Ga0496102_0027169_331_1020 | 224 |
| 987 | 3300048905 | Ga0496102_0173603 | Ga0496102_0173603_808_1566 | 224 |
| 988 | 3300048905 | Ga0496102_0412299 | Ga0496102_0412299_555_1229 | 224 |
| 989 | 3300048905 | Ga0496102_1121092 | Ga0496102_1121092_14_688 | 224 |
| 990 | 3300048906 | Ga0496103_0073533 | Ga0496103_0073533_516_1190 | 224 |
| 991 | 3300048906 | Ga0496103_0140982 | Ga0496103_0140982_202_891 | 224 |
| 992 | 3300048906 | Ga0496103_0376577 | Ga0496103_0376577_115_828 | 224 |
| 993 | 3300048907 | Ga0496104_0007514 | Ga0496104_0007514_5917_6591 | 224 |
| 994 | 3300048907 | Ga0496104_0009587 | Ga0496104_0009587_1405_2079 | 224 |
| 995 | 3300048908 | Ga0496105_0002708 | Ga0496105_0002708_5558_6232 | 224 |
| 996 | 3300048908 | Ga0496105_0085674 | Ga0496105_0085674_1260_2063 | 224 |
| 997 | 3300048909 | Ga0496106_0000634 | Ga0496106_0000634_10145_10819 | 224 |
| 998 | 3300048909 | Ga0496106_0001384 | Ga0496106_0001384_15510_16184 | 224 |
| 999 | 3300048909 | Ga0496106_0343633 | Ga0496106_0343633_156_830 | 224 |
| 1000 | 3300048909 | Ga0496106_0451585 | Ga0496106_0451585_236_910 | 224 |
| 1001 | 3300048910 | Ga0496107_0002095 | Ga0496107_0002095_11494_12168 | 224 |
| 1002 | 3300048910 | Ga0496107_0013782 | Ga0496107_0013782_1719_2393 | 224 |
| 1003 | 3300048910 | Ga0496107_0054133 | Ga0496107_0054133_2017_2730 | 224 |
| 1004 | 3300048911 | Ga0496108_0001003 | Ga0496108_0001003_12817_13491 | 224 |
| 1005 | 3300048911 | Ga0496108_0022639 | Ga0496108_0022639_220_894 | 224 |
| 1006 | 3300048912 | Ga0496109_0000166 | Ga0496109_0000166_11022_11696 | 224 |
| 1007 | 3300048912 | Ga0496109_0084838 | Ga0496109_0084838_195_869 | 224 |
| 1008 | 3300048912 | Ga0496109_0780746 | Ga0496109_0780746_179_853 | 224 |
| 1009 | 3300048913 | Ga0496110_0029261 | Ga0496110_0029261_4049_4723 | 224 |
| 1010 | 3300048913 | Ga0496110_0060588 | Ga0496110_0060588_184_858 | 224 |
| 1011 | 3300048914 | Ga0496111_0136560 | Ga0496111_0136560_710_1384 | 224 |
| 1012 | 3300048914 | Ga0496111_0368171 | Ga0496111_0368171_169_843 | 224 |
| 1013 | 3300048914 | Ga0496111_0452405 | Ga0496111_0452405_125_799 | 224 |
| 1014 | 3300048915 | Ga0496112_0000142 | Ga0496112_0000142_30539_31213 | 224 |
| 1015 | 3300048915 | Ga0496112_0000358 | Ga0496112_0000358_1550_2224 | 224 |
| 1016 | 3300048915 | Ga0496112_0018397 | Ga0496112_0018397_4095_4769 | 224 |
| 1017 | 3300048915 | Ga0496112_0044524 | Ga0496112_0044524_2909_3622 | 224 |
| 1018 | 3300048915 | Ga0496112_0426024 | Ga0496112_0426024_418_1095 | 224 |
| 1019 | 3300048916 | Ga0496113_0004839 | Ga0496113_0004839_6470_7144 | 224 |
| 1020 | 3300048916 | Ga0496113_0093035 | Ga0496113_0093035_391_1068 | 224 |
| 1021 | 3300048917 | Ga0496114_0006347 | Ga0496114_0006347_5541_6215 | 224 |
| 1022 | 3300048917 | Ga0496114_0601707 | Ga0496114_0601707_36_749 | 224 |
| 1023 | 3300048918 | Ga0496115_0034976 | Ga0496115_0034976_2987_3661 | 224 |
| 1024 | 3300048918 | Ga0496115_0077226 | Ga0496115_0077226_97_771 | 224 |
| 1025 | 3300048918 | Ga0496115_0161871 | Ga0496115_0161871_191_865 | 224 |
| 1026 | 3300048918 | Ga0496115_0773138 | Ga0496115_0773138_15_689 | 224 |
| 1027 | 3300048919 | Ga0496116_0001611 | Ga0496116_0001611_22781_23455 | 224 |
| 1028 | 3300048919 | Ga0496116_0073189 | Ga0496116_0073189_671_1345 | 224 |
| 1029 | 3300048919 | Ga0496116_0265906 | Ga0496116_0265906_68_757 | 224 |
| 1030 | 3300048920 | Ga0496117_0136641 | Ga0496117_0136641_699_1373 | 224 |
| 1031 | 3300048920 | Ga0496117_0164634 | Ga0496117_0164634_266_940 | 224 |
| 1032 | 3300048920 | Ga0496117_0256521 | Ga0496117_0256521_139_813 | 224 |
| 1033 | 3300048921 | Ga0496118_0008176 | Ga0496118_0008176_8228_8902 | 224 |
| 1034 | 3300048921 | Ga0496118_0024339 | Ga0496118_0024339_3903_4577 | 224 |
| 1035 | 3300048921 | Ga0496118_0161696 | Ga0496118_0161696_579_1253 | 224 |
| 1036 | 3300048921 | Ga0496118_0250727 | Ga0496118_0250727_77_751 | 224 |
| 1037 | 3300048922 | Ga0496119_0036025 | Ga0496119_0036025_463_1266 | 224 |
| 1038 | 3300048922 | Ga0496119_0105704 | Ga0496119_0105704_759_1433 | 224 |
| 1039 | 3300048922 | Ga0496119_0155884 | Ga0496119_0155884_386_1060 | 224 |
| 1040 | 3300048922 | Ga0496119_0165214 | Ga0496119_0165214_287_961 | 224 |
| 1041 | 3300048923 | Ga0496120_0060665 | Ga0496120_0060665_779_1453 | 224 |
| 1042 | 3300048924 | Ga0496121_0000365 | Ga0496121_0000365_40011_40685 | 224 |
| 1043 | 3300048924 | Ga0496121_0001250 | Ga0496121_0001250_2395_3069 | 224 |
| 1044 | 3300048924 | Ga0496121_0020850 | Ga0496121_0020850_270_944 | 224 |
| 1045 | 3300048924 | Ga0496121_0032052 | Ga0496121_0032052_3319_4077 | 224 |
| 1046 | 3300048924 | Ga0496121_0042595 | Ga0496121_0042595_2984_3658 | 224 |
| 1047 | 3300048924 | Ga0496121_0053980 | Ga0496121_0053980_2485_3159 | 224 |
| 1048 | 3300048924 | Ga0496121_0063730 | Ga0496121_0063730_548_1222 | 224 |
| 1049 | 3300048924 | Ga0496121_0070373 | Ga0496121_0070373_2045_2719 | 224 |
| 1050 | 3300048924 | Ga0496121_0091700 | Ga0496121_0091700_1264_1977 | 224 |
| 1051 | 3300048924 | Ga0496121_0105596 | Ga0496121_0105596_598_1272 | 224 |
| 1052 | 3300048924 | Ga0496121_0146386 | Ga0496121_0146386_635_1309 | 224 |
| 1053 | 3300048924 | Ga0496121_0189880 | Ga0496121_0189880_278_952 | 224 |
| 1054 | 3300048924 | Ga0496121_0241472 | Ga0496121_0241472_40_798 | 224 |
| 1055 | 3300048924 | Ga0496121_0270059 | Ga0496121_0270059_390_1103 | 224 |
| 1056 | 3300048925 | Ga0496122_0055591 | Ga0496122_0055591_76_765 | 224 |
| 1057 | 3300048925 | Ga0496122_0301695 | Ga0496122_0301695_82_756 | 224 |
| 1058 | 3300048926 | Ga0496123_0084809 | Ga0496123_0084809_1187_1861 | 224 |
| 1059 | 3300048927 | Ga0496124_0002671 | Ga0496124_0002671_5849_6523 | 224 |
| 1060 | 3300048927 | Ga0496124_0373380 | Ga0496124_0373380_170_928 | 224 |
| 1061 | 3300048927 | Ga0496124_0382654 | Ga0496124_0382654_26_700 | 224 |
| 1062 | 3300048928 | Ga0496125_0008303 | Ga0496125_0008303_4768_5442 | 224 |
| 1063 | 3300048928 | Ga0496125_0013887 | Ga0496125_0013887_1118_1792 | 224 |
| 1064 | 3300048928 | Ga0496125_0030378 | Ga0496125_0030378_430_1104 | 224 |
| 1065 | 3300048928 | Ga0496125_0039257 | Ga0496125_0039257_1645_2319 | 224 |
| 1066 | 3300048928 | Ga0496125_0096714 | Ga0496125_0096714_723_1526 | 224 |
| 1067 | 3300048929 | Ga0496126_0003397 | Ga0496126_0003397_17125_17799 | 224 |
| 1068 | 3300048929 | Ga0496126_0004058 | Ga0496126_0004058_15158_15832 | 224 |
| 1069 | 3300048929 | Ga0496126_0004467 | Ga0496126_0004467_10576_11250 | 224 |
| 1070 | 3300048929 | Ga0496126_0009177 | Ga0496126_0009177_3732_4463 | 224 |
| 1071 | 3300048929 | Ga0496126_0011808 | Ga0496126_0011808_1579_2253 | 224 |
| 1072 | 3300048929 | Ga0496126_0018439 | Ga0496126_0018439_5056_5859 | 224 |
| 1073 | 3300048929 | Ga0496126_0018516 | Ga0496126_0018516_2585_3259 | 224 |
| 1074 | 3300048929 | Ga0496126_0044443 | Ga0496126_0044443_2029_2703 | 224 |
| 1075 | 3300048929 | Ga0496126_0052156 | Ga0496126_0052156_1782_2456 | 224 |
| 1076 | 3300048929 | Ga0496126_0061909 | Ga0496126_0061909_1989_2663 | 224 |
| 1077 | 3300048929 | Ga0496126_0295827 | Ga0496126_0295827_529_1203 | 224 |
| 1078 | 3300048929 | Ga0496126_0325157 | Ga0496126_0325157_71_745 | 224 |
| 1079 | 3300048929 | Ga0496126_0372463 | Ga0496126_0372463_152_826 | 224 |
| 1080 | 3300048929 | Ga0496126_0443718 | Ga0496126_0443718_270_944 | 224 |
| 1081 | 3300048929 | Ga0496126_0517402 | Ga0496126_0517402_173_847 | 224 |
| 1082 | 3300049460 | Ga0495682_0081060 | Ga0495682_0081060_91_894 | 224 |
| 1083 | 3300049569 | Ga0501032_0026447 | Ga0501032_0026447_1653_2327 | 224 |
| 1084 | 3300049569 | Ga0501032_0268884 | Ga0501032_0268884_266_940 | 224 |
| 1085 | 3300049572 | Ga0501036_0085011 | Ga0501036_0085011_127_801 | 224 |
| 1086 | 3300049572 | Ga0501036_0147325 | Ga0501036_0147325_1185_1859 | 224 |
| 1087 | 3300049575 | Ga0501039_0327142 | Ga0501039_0327142_115_789 | 224 |
| 1088 | 3300049579 | Ga0501043_0029487 | Ga0501043_0029487_2064_2738 | 224 |
| 1089 | 3300049580 | Ga0501046_0014282 | Ga0501046_0014282_915_1589 | 224 |
| 1090 | 3300049581 | Ga0501047_0019249 | Ga0501047_0019249_2394_3068 | 224 |
| 1091 | 3300049582 | Ga0501048_0100848 | Ga0501048_0100848_1227_1901 | 224 |
| 1092 | 3300049586 | Ga0501070_0018349 | Ga0501070_0018349_1236_1910 | 224 |
| 1093 | 3300049586 | Ga0501070_0067287 | Ga0501070_0067287_1725_2399 | 224 |
| 1094 | 3300049586 | Ga0501070_0404570 | Ga0501070_0404570_380_1054 | 224 |
| 1095 | 3300049586 | Ga0501070_0467361 | Ga0501070_0467361_275_949 | 224 |
| 1096 | 3300049588 | Ga0501072_0716113 | Ga0501072_0716113_83_757 | 224 |
| 1097 | 3300049589 | Ga0501073_0148436 | Ga0501073_0148436_72_746 | 224 |
| 1098 | 3300049741 | Ga0501079_0394304 | Ga0501079_0394304_94_768 | 224 |
| 1099 | 3300049742 | Ga0501080_0097586 | Ga0501080_0097586_1080_1754 | 224 |
| 1100 | 3300049822 | Ga0501035_0051567 | Ga0501035_0051567_2872_3546 | 224 |
| 1101 | 3300049823 | Ga0501044_0009213 | Ga0501044_0009213_5150_5824 | 224 |
| 1102 | 3300049823 | Ga0501044_0026949 | Ga0501044_0026949_1392_2066 | 224 |
| 1103 | 3300049823 | Ga0501044_0425329 | Ga0501044_0425329_62_736 | 224 |
| 1104 | 3300049824 | Ga0501045_0373826 | Ga0501045_0373826_257_931 | 224 |
| 1105 | 3300050489 | nmdc:mga03683_14358_c1 | nmdc:mga03683_14358_c1_28_702 | 224 |
| 1106 | 3300050489 | nmdc:mga03683_193256_c1 | nmdc:mga03683_193256_c1_113_802 | 224 |
| 1107 | 3300050491 | nmdc:mga00v17_213852_c1 | nmdc:mga00v17_213852_c1_304_978 | 224 |
| 1108 | 3300050491 | nmdc:mga00v17_244451_c1 | nmdc:mga00v17_244451_c1_416_1090 | 224 |
| 1109 | 3300050492 | nmdc:mga0yw44_279822_c1 | nmdc:mga0yw44_279822_c1_305_979 | 224 |
| 1110 | 3300050492 | nmdc:mga0yw44_284003_c1 | nmdc:mga0yw44_284003_c1_332_1021 | 224 |
| 1111 | 3300050492 | nmdc:mga0yw44_35109_c1 | nmdc:mga0yw44_35109_c1_1090_1764 | 224 |
| 1112 | 3300050492 | nmdc:mga0yw44_57538_c1 | nmdc:mga0yw44_57538_c1_1069_1743 | 224 |
| 1113 | 3300050492 | nmdc:mga0yw44_68762_c1 | nmdc:mga0yw44_68762_c1_460_1173 | 224 |
| 1114 | 3300050493 | nmdc:mga0k408_9657_c1 | nmdc:mga0k408_9657_c1_3182_3871 | 224 |
| 1115 | 3300050494 | nmdc:mga06z11_51738_c1 | nmdc:mga06z11_51738_c1_37_711 | 224 |
| 1116 | 3300050494 | nmdc:mga06z11_9579_c1 | nmdc:mga06z11_9579_c1_1059_1733 | 224 |
| 1117 | 3300050496 | nmdc:mga07m45_19552_c1 | nmdc:mga07m45_19552_c1_1131_1805 | 224 |
| 1118 | 3300050496 | nmdc:mga07m45_24035_c2 | nmdc:mga07m45_24035_c2_106_780 | 224 |
| 1119 | 3300050496 | nmdc:mga07m45_34764_c1 | nmdc:mga07m45_34764_c1_1263_1976 | 224 |
| 1120 | 3300050507 | nmdc:mga05p37_381088_c1 | nmdc:mga05p37_381088_c1_43_756 | 224 |
| 1121 | 3300050511 | nmdc:mga08y16_226410_c1 | nmdc:mga08y16_226410_c1_754_1428 | 224 |
| 1122 | 3300053077 | Ga0495601_0028797 | Ga0495601_0028797_1296_2015 | 224 |
| 1123 | 3300053077 | Ga0495601_0084098 | Ga0495601_0084098_1202_1876 | 224 |
| 1124 | 3300053077 | Ga0495601_0121729 | Ga0495601_0121729_437_1111 | 224 |
| 1125 | 3300053077 | Ga0495601_0254211 | Ga0495601_0254211_209_928 | 224 |
| 1126 | 3300053078 | Ga0495612_0143077 | Ga0495612_0143077_349_1023 | 224 |
| 1127 | 3300053079 | Ga0500610_0281489 | Ga0500610_0281489_37_711 | 224 |
| 1128 | 3300053080 | Ga0500635_0103296 | Ga0500635_0103296_150_824 | 224 |
| 1129 | 3300053080 | Ga0500635_0175232 | Ga0500635_0175232_25_783 | 224 |
| 1130 | 3300053084 | Ga0495595_0001721 | Ga0495595_0001721_6902_7621 | 224 |
| 1131 | 3300053084 | Ga0495595_0242206 | Ga0495595_0242206_104_778 | 224 |
| 1132 | 3300053084 | Ga0495595_0249975 | Ga0495595_0249975_170_844 | 224 |
| 1133 | 3300053085 | Ga0495619_0002764 | Ga0495619_0002764_7000_7719 | 224 |
| 1134 | 3300053085 | Ga0495619_0026952 | Ga0495619_0026952_1129_1803 | 224 |
| 1135 | 3300053085 | Ga0495619_0027657 | Ga0495619_0027657_2870_3544 | 224 |
| 1136 | 3300053085 | Ga0495619_0246754 | Ga0495619_0246754_312_986 | 224 |
| 1137 | 3300053087 | Ga0500643_000042 | Ga0500643_000042_46953_47627 | 224 |
| 1138 | 3300053087 | Ga0500643_040787 | Ga0500643_040787_351_1025 | 224 |
| 1139 | 3300053091 | Ga0500647_0012259 | Ga0500647_0012259_2763_3437 | 224 |
| 1140 | 3300053093 | Ga0500651_0052451 | Ga0500651_0052451_754_1428 | 224 |
| 1141 | 3300053094 | Ga0500566_0000178 | Ga0500566_0000178_7680_8354 | 224 |
| 1142 | 3300053094 | Ga0500566_0003121 | Ga0500566_0003121_4839_5513 | 224 |
| 1143 | 3300053094 | Ga0500566_0004694 | Ga0500566_0004694_2447_3121 | 224 |
| 1144 | 3300053094 | Ga0500566_0016779 | Ga0500566_0016779_2017_2691 | 224 |
| 1145 | 3300053095 | Ga0500640_016747 | Ga0500640_016747_260_934 | 224 |
| 1146 | 3300053096 | Ga0500641_0004300 | Ga0500641_0004300_338_1012 | 224 |
| 1147 | 3300053098 | Ga0500650_0004206 | Ga0500650_0004206_1178_1852 | 224 |
| 1148 | 3300053102 | Ga0500554_008738 | Ga0500554_008738_400_1074 | 224 |
| 1149 | 3300053103 | Ga0500555_000735 | Ga0500555_000735_5603_6277 | 224 |
| 1150 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_85790_86464 | 224 |
| 1151 | 3300053104 | Ga0500556_0052243 | Ga0500556_0052243_710_1384 | 224 |
| 1152 | 3300053105 | Ga0500557_000006 | Ga0500557_000006_87762_88436 | 224 |
| 1153 | 3300053108 | Ga0500562_075560 | Ga0500562_075560_110_784 | 224 |
| 1154 | 3300053111 | Ga0500572_000041 | Ga0500572_000041_11440_12114 | 224 |
| 1155 | 3300053119 | Ga0500595_002365 | Ga0500595_002365_6922_7596 | 224 |
| 1156 | 3300053119 | Ga0500595_005588 | Ga0500595_005588_2089_2763 | 224 |
| 1157 | 3300053121 | Ga0500607_016121 | Ga0500607_016121_2608_3282 | 224 |
| 1158 | 3300053121 | Ga0500607_057563 | Ga0500607_057563_660_1334 | 224 |
| 1159 | 3300053122 | Ga0500608_003394 | Ga0500608_003394_4214_4888 | 224 |
| 1160 | 3300053123 | Ga0500614_035057 | Ga0500614_035057_157_831 | 224 |
| 1161 | 3300053125 | Ga0500618_007537 | Ga0500618_007537_1841_2515 | 224 |
| 1162 | 3300053125 | Ga0500618_064543 | Ga0500618_064543_14_688 | 224 |
| 1163 | 3300053130 | Ga0500642_0000013 | Ga0500642_0000013_160654_161328 | 224 |
| 1164 | 3300053130 | Ga0500642_0000040 | Ga0500642_0000040_42589_43263 | 224 |
| 1165 | 3300053131 | Ga0500652_000186 | Ga0500652_000186_15045_15719 | 224 |
| 1166 | 3300053134 | Ga0500658_0154631 | Ga0500658_0154631_340_1014 | 224 |
| 1167 | 3300053136 | Ga0500559_0000597 | Ga0500559_0000597_10667_11341 | 224 |
| 1168 | 3300053136 | Ga0500559_0007742 | Ga0500559_0007742_2653_3327 | 224 |
| 1169 | 3300053136 | Ga0500559_0009057 | Ga0500559_0009057_235_1038 | 224 |
| 1170 | 3300053136 | Ga0500559_0036178 | Ga0500559_0036178_1034_1708 | 224 |
| 1171 | 3300053139 | Ga0500568_0005482 | Ga0500568_0005482_692_1366 | 224 |
| 1172 | 3300053139 | Ga0500568_0045042 | Ga0500568_0045042_877_1551 | 224 |
| 1173 | 3300053139 | Ga0500568_0051835 | Ga0500568_0051835_283_957 | 224 |
| 1174 | 3300053139 | Ga0500568_0129283 | Ga0500568_0129283_191_865 | 224 |
| 1175 | 3300053145 | Ga0500586_000482 | Ga0500586_000482_3715_4389 | 224 |
| 1176 | 3300053148 | Ga0500590_133876 | Ga0500590_133876_428_1102 | 224 |
| 1177 | 3300053150 | Ga0500603_000312 | Ga0500603_000312_12017_12691 | 224 |
| 1178 | 3300053151 | Ga0500604_0021776 | Ga0500604_0021776_971_1645 | 224 |
| 1179 | 3300053151 | Ga0500604_0167645 | Ga0500604_0167645_38_712 | 224 |
| 1180 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_307952_308626 | 224 |
| 1181 | 3300053153 | Ga0500616_0052615 | Ga0500616_0052615_479_1153 | 224 |
| 1182 | 3300053154 | Ga0500619_070986 | Ga0500619_070986_148_822 | 224 |
| 1183 | 3300053156 | Ga0500622_0019026 | Ga0500622_0019026_2695_3369 | 224 |
| 1184 | 3300053157 | Ga0500624_012678 | Ga0500624_012678_72_746 | 224 |
| 1185 | 3300053158 | Ga0500627_0186092 | Ga0500627_0186092_235_909 | 224 |
| 1186 | 3300053159 | Ga0500630_000840 | Ga0500630_000840_11283_11957 | 224 |
| 1187 | 3300053160 | Ga0500633_0065278 | Ga0500633_0065278_242_916 | 224 |
| 1188 | 3300053161 | Ga0500634_0040350 | Ga0500634_0040350_1295_1969 | 224 |
| 1189 | 3300053162 | Ga0500638_001490 | Ga0500638_001490_1373_2047 | 224 |
| 1190 | 3300053163 | Ga0500639_000029 | Ga0500639_000029_10533_11207 | 224 |
| 1191 | 3300053163 | Ga0500639_052625 | Ga0500639_052625_1264_1938 | 224 |
| 1192 | 3300053177 | Ga0500636_0000105 | Ga0500636_0000105_17005_17679 | 224 |
| 1193 | 3300053177 | Ga0500636_0011341 | Ga0500636_0011341_223_897 | 224 |
| 1194 | 3300053177 | Ga0500636_0077175 | Ga0500636_0077175_1119_1793 | 224 |
| 1195 | 3300053177 | Ga0500636_0085694 | Ga0500636_0085694_297_983 | 224 |
| 1196 | 3300053178 | Ga0500637_0000215 | Ga0500637_0000215_13451_14125 | 224 |
| 1197 | 3300053178 | Ga0500637_0124232 | Ga0500637_0124232_690_1364 | 224 |
| 1198 | 3300053725 | Ga0500576_091957 | Ga0500576_091957_138_812 | 224 |
| 1199 | 3300053727 | Ga0500611_041918 | Ga0500611_041918_296_970 | 224 |
| 1200 | 3300053729 | Ga0500625_022414 | Ga0500625_022414_1743_2417 | 224 |
| 1201 | 3300053730 | Ga0500645_004319 | Ga0500645_004319_3963_4637 | 224 |
| 1202 | 3300053732 | Ga0500656_028492 | Ga0500656_028492_34_708 | 224 |
| 1203 | 3300053733 | Ga0500552_006729 | Ga0500552_006729_557_1231 | 224 |
| 1204 | 3300053735 | Ga0500596_019804 | Ga0500596_019804_106_780 | 224 |
| 1205 | 3300053737 | Ga0500601_000611 | Ga0500601_000611_2407_3081 | 224 |
| 1206 | 3300055283 | Ga0500661_002447 | Ga0500661_002447_1974_2648 | 224 |
| 1207 | iso_pu_bacteria | 2513237098 | 2513677747 | 224 |
| 1208 | iso_pu_bacteria | 2903768456 | 2903774292 | 224 |
| 1209 | iso_pu_bacteria | 2932818245 | 2932827386 | 224 |
| 1210 | iso_pu_bacteria | 2935760218 | 2935767468 | 224 |
| 1211 | iso_pu_bacteria | 2935810662 | 2935815641 | 224 |
| 1212 | iso_pu_bacteria | 2935908558 | 2935912811 | 224 |
| 1213 | iso_pu_bacteria | 2935916978 | 2935922870 | 224 |
| 1214 | iso_pu_bacteria | 2935926038 | 2935930295 | 224 |
| 1215 | iso_pu_bacteria | 2935934488 | 2935939195 | 224 |
| 1216 | iso_pu_bacteria | 2935942939 | 2935946143 | 224 |
| 1217 | iso_pu_bacteria | 2935951376 | 2935955480 | 224 |
| 1218 | iso_pu_bacteria | 2935967501 | 2935972149 | 224 |
| 1219 | iso_pu_bacteria | 2936037263 | 2936040879 | 224 |
| 1220 | iso_pu_bacteria | 8019586578 | 8019592783 | 224 |
| 1221 | iso_pu_bacteria | 8019687851 | 8019692174 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g3d-assembly1.cif.gz_3D | 48-nm doublet microtubule from tetrahymena thermophila strain k40r | 0.9119 | 5 | 224 |
| 1ggv-assembly1.cif.gz_A | crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) | 0.9069 | 5 | 222 |
| 4u2b-assembly1.cif.gz_A | crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution | 0.9053 | 5 | 224 |
| 1zi6-assembly1.cif.gz_A | crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a | 0.9039 | 5 | 224 |
| 1zix-assembly1.cif.gz_A | crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a | 0.9037 | 5 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1P8AZN3_78_316_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9235 | 2 | 223 | 3.40.50.1820 |
| af_A0A1P8AZN3_78_316_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9115 | 2 | 223 | 3.40.50.1820 |
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8926 | 3 | 219 | 3.40.50.1820 |
| 1zi9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8733 | 5 | 224 | 3.40.50.1820 |
| 4zv9B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8672 | 1 | 223 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A560JHM9-F1-model_v4 | Carboxymethylenebutenolidase | 0.9997 | 1 | 224 |
GO:0016787
|
| AF-A0A0S6UY21-F1-model_v4 | Usf protein | 0.9994 | 1 | 224 |
GO:0016787
|
| AF-A0A4Q5PXA9-F1-model_v4 | Dienelactone hydrolase family protein | 0.9981 | 1 | 224 |
GO:0016787
|
| AF-A0A560JHM9-F1-model_v4 | Carboxymethylenebutenolidase | 0.9953 | 1 | 224 |
GO:0016787
|
| AF-A0A0S6UY21-F1-model_v4 | Usf protein | 0.995 | 1 | 224 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar