F491855

General Info

Members Datasets Scaffolds Average Seq Length
1221 680 995 226

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0076006|Ga0373933_0076006_814_1518
Length 234
Sequence MGQLISIRRPDGGTCPAYVNTDAGAGAPGVVVIQEWWGLNEQIKKTADRFAKAGYRALVPDLYRGKLASNADEASHMMNHLDFADAADQDLQGAVNHLRAESKGAVSAAGPRIGVAGFCMGGALTILSALRVKGVAAGACFYGIPPKAFANPADLAIPMILHFANTDDWCTPKLVDELEAELRRSKSKFELYRYDAEHAFMNEARPEVYEPKSAQLAWDRTQKFFDQALARQAT

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
77 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
78 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
79 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
80 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
81 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
82 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
83 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
84 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
85 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
86 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
87 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
88 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
89 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
90 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
91 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
92 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
93 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
94 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
95 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
96 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
97 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
98 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
99 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
100 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
101 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
102 2904699407
103 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
104 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
105 2906610324
106 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
107 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
108 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
109 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
110 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
111 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
112 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
113 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
114 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
115 2922368715
116 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
117 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
118 2922425934
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
131 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
132 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
133 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
134 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
135 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
136 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
137 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
138 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
139 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
140 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
141 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
142 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
143 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
144 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
145 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
146 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
147 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
148 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
149 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
150 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
151 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
152 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
153 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
154 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
155 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
156 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
157 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
158 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
159 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
160 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
161 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
162 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
163 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
164 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
165 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
166 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
167 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
168 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
169 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
170 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
171 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
172 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
173 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
174 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
175 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
176 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
177 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
178 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
179 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
180 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
181 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
182 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
183 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
184 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
185 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
186 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
187 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
188 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
189 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
190 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
191 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
192 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
193 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
194 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
195 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
196 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
197 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
198 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
199 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
202 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
203 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
204 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
205 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
206 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
207 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
208 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
209 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
210 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
211 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
212 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
213 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
214 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
215 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
216 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
217 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
218 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
219 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
220 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
221 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
222 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
223 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
224 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
225 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
226 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
227 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
228 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
229 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
230 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
231 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
232 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
233 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
234 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
235 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
236 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
237 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
238 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
239 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
240 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
241 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
242 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
247 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
248 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
249 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
250 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
251 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
252 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
253 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
254 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
255 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
256 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
257 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
258 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
259 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
260 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
261 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
262 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
263 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
264 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
265 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
266 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
267 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
268 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
269 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
270 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
271 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
272 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
273 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
274 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
275 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
276 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
277 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
278 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
279 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
280 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
281 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
282 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
283 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
284 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
285 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
286 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
287 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
288 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
289 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
290 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
291 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
292 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
293 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
294 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
295 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
296 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
297 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
298 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
299 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
300 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
301 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
302 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
303 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
304 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
305 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
306 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
307 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
308 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
309 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
310 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
311 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
313 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
314 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
315 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
316 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
317 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
318 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
319 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
320 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
321 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
325 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
327 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
329 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
331 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
386 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
387 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
388 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
389 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
391 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
395 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
396 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
397 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
398 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
399 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
400 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
401 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
402 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
403 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
404 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
405 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
406 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
407 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
408 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
409 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
410 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
411 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
412 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
413 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
414 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
415 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
416 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
417 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
418 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
419 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
420 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
421 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
422 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
423 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
424 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
425 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
426 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
427 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
428 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
429 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
430 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
431 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
432 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
433 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
434 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
435 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
436 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
437 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
438 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
439 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
440 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
441 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
442 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
443 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
444 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
445 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
446 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
447 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
448 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
449 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
450 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
451 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
452 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
453 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
454 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
455 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
456 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
457 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
458 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
459 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
460 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
461 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
462 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
463 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
464 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
465 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
466 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
467 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
468 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
469 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
470 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
471 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
472 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
473 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
474 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
475 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
476 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
477 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
478 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
479 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
480 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
481 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
482 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
483 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
484 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
485 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
486 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
487 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
488 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
489 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
490 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
491 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
492 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
493 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
494 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
495 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
496 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
497 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
498 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
499 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
500 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
501 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
502 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
503 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
504 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
505 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
506 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
507 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
508 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
509 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
510 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
511 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
512 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
513 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
514 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
515 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
516 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
517 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
518 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
519 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
520 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
521 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
522 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
523 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
524 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
525 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
526 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
527 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
528 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
529 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
530 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
531 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
532 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
533 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
534 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
535 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
536 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
537 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
538 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
539 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
540 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
541 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
542 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
543 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
544 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
545 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
546 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
547 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
548 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
549 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
550 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
551 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
552 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
553 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
554 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
555 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
559 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
564 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
565 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
566 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
567 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
568 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
569 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
572 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
573 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
574 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
575 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
576 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
577 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
578 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
579 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
580 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
581 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
582 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
583 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
584 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
585 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
586 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
587 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
588 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
589 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
590 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
591 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
592 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
593 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
594 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
595 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
596 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
597 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
598 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
599 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
600 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
601 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
602 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
603 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
604 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
605 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
606 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
607 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
608 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
609 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
610 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
611 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
612 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
613 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
614 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
615 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
616 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
617 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
618 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
619 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
620 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
621 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
622 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
623 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
624 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
625 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
626 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
627 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
628 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
629 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
630 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
631 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
632 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
633 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
634 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
635 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
636 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
637 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
638 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
639 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
640 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
641 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
642 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
643 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
644 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
645 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
646 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
647 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
648 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
649 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
650 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
651 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
652 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
653 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
654 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
655 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
656 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
657 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
658 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
659 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
660 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
661 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
662 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
663 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
664 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
665 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
666 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
667 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
668 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
669 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
670 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
671 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
672 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
673 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
674 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
675 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
676 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
677 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
678 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
679 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
680 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.41
Metatranscriptomes 0.41
Isolates 18.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.45
Nodule 14.82
Rhizoplane 5
Rhizosphere 55.61
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10031895 3300001989 Bacteria 1817
2 JGI25406J46586_10000449 3300003203 Bacteria 19106
3 JGI25165J46597_1014521 3300003214 Bacteria 1071
4 JGI25165J46597_1024683 3300003214 Bacteria 780
5 JGI25153J46596_10009921 3300003215 Bacteria 4363
6 JGI25153J46596_10010561 3300003215 Bacteria 4165
7 JGI25160J50197_1001648 3300003354 Bacteria 10920
8 JGI25160J50197_1002130 3300003354 Bacteria 9392
9 JGI25160J50197_1019345 3300003354 Bacteria 2090
10 JGI25160J50197_1047548 3300003354 Bacteria 933
11 JGI25404J52841_10001620 3300003659 Bacteria 4022
12 Ga0055529_1007195 3300003763 Bacteria 1523
13 Ga0055531_10010882 3300003794 Bacteria 4465
14 JGI25405J52794_10024657 3300003911 Bacteria 1229
15 Ga0055543_1003126 3300004625 Bacteria 5068
16 Ga0055543_1009210 3300004625 Bacteria 2137
17 Ga0065165_1001015 3300005262 Bacteria 34129
18 Ga0065165_1003915 3300005262 Bacteria 9828
19 Ga0065165_1005320 3300005262 Bacteria 7316
20 Ga0065165_1005972 3300005262 Bacteria 6580
21 Ga0065165_1024939 3300005262 Bacteria 1998
22 Ga0070658_10104328 3300005327 Bacteria 2345
23 Ga0070658_10143011 3300005327 Bacteria 1999
24 Ga0070658_10235014 3300005327 Bacteria 1553
25 Ga0070683_100233918 3300005329 Bacteria 1747
26 Ga0070683_100524586 3300005329 Bacteria 1132
27 Ga0070690_100068847 3300005330 Bacteria 2296
28 Ga0068869_100330842 3300005334 Bacteria 1238
29 Ga0070680_100113146 3300005336 Bacteria 2260
30 Ga0070682_100041329 3300005337 Bacteria 2842
31 Ga0070682_100044975 3300005337 Bacteria 2735
32 Ga0070682_100318574 3300005337 Bacteria 1148
33 Ga0070682_100427868 3300005337 Bacteria 1008
34 Ga0068868_100025479 3300005338 Bacteria 4499
35 Ga0070660_100011831 3300005339 Bacteria 6216
36 Ga0070661_100052521 3300005344 Bacteria 2983
37 Ga0070661_100088122 3300005344 Bacteria 2297
38 Ga0070661_100106546 3300005344 Bacteria 2090
39 Ga0070661_100265363 3300005344 Bacteria 1328
40 Ga0070692_10288427 3300005345 Bacteria 998
41 Ga0070668_100100152 3300005347 Bacteria 2295
42 Ga0070668_100634462 3300005347 Bacteria 937
43 Ga0070669_100171320 3300005353 Bacteria 1692
44 Ga0070671_100086849 3300005355 Bacteria 2617
45 Ga0070671_100170800 3300005355 Bacteria 1839
46 Ga0070659_100312806 3300005366 Bacteria 1312
47 Ga0070659_100579541 3300005366 Bacteria 962
48 Ga0070703_10045888 3300005406 Bacteria 1380
49 Ga0070709_10000778 3300005434 Bacteria 17844
50 Ga0070709_10007154 3300005434 Bacteria 6111
51 Ga0070709_10013044 3300005434 Bacteria 4665
52 Ga0070709_10175986 3300005434 Bacteria 1499
53 Ga0070709_10378686 3300005434 Bacteria 1052
54 Ga0070714_100013419 3300005435 Bacteria 6566
55 Ga0070714_100031338 3300005435 Bacteria 4435
56 Ga0070714_100270133 3300005435 Bacteria 1577
57 Ga0070714_100310108 3300005435 Bacteria 1473
58 Ga0070714_100367633 3300005435 Bacteria 1353
59 Ga0070714_100997170 3300005435 Bacteria 815
60 Ga0070713_100025862 3300005436 Bacteria 4597
61 Ga0070713_100171302 3300005436 Bacteria 1945
62 Ga0070713_100273775 3300005436 Bacteria 1547
63 Ga0070713_100310055 3300005436 Bacteria 1455
64 Ga0070713_100557115 3300005436 Bacteria 1086
65 Ga0070710_10004897 3300005437 Bacteria 6337
66 Ga0070710_10009727 3300005437 Bacteria 4709
67 Ga0070710_10298032 3300005437 Bacteria 1051
68 Ga0070711_100005828 3300005439 Bacteria 7394
69 Ga0070711_100051265 3300005439 Bacteria 2833
70 Ga0070711_100054196 3300005439 Bacteria 2767
71 Ga0070711_100228645 3300005439 Bacteria 1449
72 Ga0070711_100408992 3300005439 Bacteria 1103
73 Ga0070700_100117728 3300005441 Bacteria 1775
74 Ga0070694_100225499 3300005444 Bacteria 1407
75 Ga0070708_100127678 3300005445 Bacteria 2352
76 Ga0070663_100036220 3300005455 Bacteria 3428
77 Ga0070663_100059522 3300005455 Bacteria 2745
78 Ga0070663_100379740 3300005455 Bacteria 1150
79 Ga0070662_100143125 3300005457 Bacteria 1855
80 Ga0070681_10048974 3300005458 Bacteria 4220
81 Ga0070681_10063856 3300005458 Bacteria 3655
82 Ga0070681_10143228 3300005458 Bacteria 2319
83 Ga0070681_10355721 3300005458 Bacteria 1375
84 Ga0070681_10383361 3300005458 Bacteria 1316
85 Ga0068867_100175184 3300005459 Bacteria 1702
86 Ga0070685_10499638 3300005466 Bacteria 860
87 Ga0070706_100103899 3300005467 Bacteria 2642
88 Ga0070706_100590125 3300005467 Bacteria 1033
89 Ga0070698_100029876 3300005471 Bacteria 5655
90 Ga0070698_100516437 3300005471 Bacteria 1133
91 Ga0070679_100013103 3300005530 Bacteria 7940
92 Ga0070679_100025223 3300005530 Bacteria 5831
93 Ga0070679_100074795 3300005530 Bacteria 3378
94 Ga0070684_100013479 3300005535 Bacteria 6594
95 Ga0070684_100024449 3300005535 Bacteria 5068
96 Ga0070684_100085868 3300005535 Bacteria 2791
97 Ga0070684_101094621 3300005535 Bacteria 749
98 Ga0070697_100014896 3300005536 Bacteria 6103
99 Ga0070697_100694497 3300005536 Bacteria 898
100 Ga0068853_100014418 3300005539 Bacteria 6471
101 Ga0068853_100021360 3300005539 Bacteria 5396
102 Ga0068853_100047626 3300005539 Bacteria 3679
103 Ga0068853_100208234 3300005539 Bacteria 1782
104 Ga0070686_100056153 3300005544 Bacteria 2525
105 Ga0070693_100023630 3300005547 Bacteria 3288
106 Ga0070665_100109075 3300005548 Bacteria 2770
107 Ga0070665_100168214 3300005548 Bacteria 2194
108 Ga0070665_100192798 3300005548 Bacteria 2038
109 Ga0070665_100357872 3300005548 Bacteria 1465
110 Ga0070704_100137184 3300005549 Bacteria 1905
111 Ga0068855_100054688 3300005563 Bacteria 4691
112 Ga0068855_100055771 3300005563 Bacteria 4639
113 Ga0068855_100103512 3300005563 Bacteria 3275
114 Ga0068855_100127380 3300005563 Bacteria 2910
115 Ga0068855_100593765 3300005563 Bacteria 1195
116 Ga0068857_100074421 3300005577 Bacteria 3026
117 Ga0068857_100308188 3300005577 Bacteria 1460
118 Ga0068854_100060797 3300005578 Bacteria 2734
119 Ga0068856_100000477 3300005614 Bacteria 44284
120 Ga0068856_100129762 3300005614 Bacteria 2525
121 Ga0068856_100174968 3300005614 Bacteria 2159
122 Ga0068852_100030147 3300005616 Bacteria 4462
123 Ga0068852_100073061 3300005616 Bacteria 3016
124 Ga0068852_100094876 3300005616 Bacteria 2677
125 Ga0068852_100613723 3300005616 Bacteria 1093
126 Ga0068859_100439993 3300005617 Bacteria 1400
127 Ga0068864_100319617 3300005618 Bacteria 1458
128 Ga0068861_100399328 3300005719 Bacteria 1219
129 Ga0068861_100454382 3300005719 Bacteria 1148
130 Ga0068851_10003264 3300005834 Bacteria 7194
131 Ga0068851_10044749 3300005834 Bacteria 2236
132 Ga0068851_10102036 3300005834 Bacteria 1523
133 Ga0068851_10416438 3300005834 Bacteria 793
134 Ga0068860_100000324 3300005843 Bacteria 64920
135 Ga0068860_100240384 3300005843 Bacteria 1761
136 Ga0068860_100624935 3300005843 Bacteria 1084
137 Ga0068862_100112944 3300005844 Bacteria 2386
138 Ga0068862_100567855 3300005844 Bacteria 1085
139 Ga0081455_10001871 3300005937 Bacteria 25308
140 Ga0081455_10011253 3300005937 Bacteria 9002
141 Ga0081455_10016763 3300005937 Bacteria 7051
142 Ga0081455_10022225 3300005937 Bacteria 5933
143 Ga0081455_10044838 3300005937 Bacteria 3852
144 Ga0081455_10097121 3300005937 Bacteria 2374
145 Ga0081455_10103018 3300005937 Bacteria 2287
146 Ga0081455_10331051 3300005937 Bacteria 1081
147 Ga0081538_10016530 3300005981 Bacteria 5651
148 Ga0081538_10114658 3300005981 Bacteria 1312
149 Ga0081538_10118419 3300005981 Unclassified 1280
150 Ga0081540_1004943 3300005983 Bacteria 10022
151 Ga0081540_1012323 3300005983 Bacteria 5643
152 Ga0081540_1012929 3300005983 Bacteria 5455
153 Ga0081540_1013478 3300005983 Bacteria 5310
154 Ga0081540_1014993 3300005983 Bacteria 4926
155 Ga0081540_1064646 3300005983 Bacteria 1725
156 Ga0081540_1093158 3300005983 Bacteria 1320
157 Ga0081540_1100486 3300005983 Bacteria 1247
158 Ga0081539_10000306 3300005985 Bacteria 110402
159 Ga0081539_10001290 3300005985 Bacteria 44006
160 Ga0081539_10026446 3300005985 Bacteria 3703
161 Ga0070717_10000521 3300006028 Bacteria 24353
162 Ga0070717_10024234 3300006028 Bacteria 4816
163 Ga0070717_10047558 3300006028 Bacteria 3516
164 Ga0070717_10560528 3300006028 Bacteria 1035
165 Ga0070717_10732517 3300006028 Bacteria 899
166 Ga0075365_10049232 3300006038 Bacteria 2776
167 Ga0075365_10069084 3300006038 Bacteria 2374
168 Ga0075365_10101316 3300006038 Bacteria 1972
169 Ga0075365_10216737 3300006038 Bacteria 1342
170 Ga0075365_10246154 3300006038 Bacteria 1256
171 Ga0075365_10250170 3300006038 Bacteria 1245
172 Ga0075365_10313357 3300006038 Bacteria 1105
173 Ga0075363_100173605 3300006048 Bacteria 1224
174 Ga0075364_10263690 3300006051 Bacteria 1171
175 Ga0075432_10080907 3300006058 Bacteria 1178
176 Ga0070715_10006756 3300006163 Bacteria 3915
177 Ga0070715_10021529 3300006163 Bacteria 2502
178 Ga0070715_10117296 3300006163 Bacteria 1264
179 Ga0070716_100012501 3300006173 Bacteria 4305
180 Ga0070716_100045303 3300006173 Bacteria 2469
181 Ga0070716_100051114 3300006173 Bacteria 2348
182 Ga0070712_100006981 3300006175 Bacteria 7039
183 Ga0070712_100058182 3300006175 Bacteria 2719
184 Ga0070712_100114609 3300006175 Bacteria 2018
185 Ga0070712_100425851 3300006175 Bacteria 1101
186 Ga0075362_10008952 3300006177 Bacteria 3850
187 Ga0075362_10075963 3300006177 Bacteria 1541
188 Ga0075362_10092607 3300006177 Bacteria 1404
189 Ga0075367_10041929 3300006178 Bacteria 2677
190 Ga0075369_10040562 3300006186 Bacteria 1990
191 Ga0075366_10108345 3300006195 Bacteria 1670
192 Ga0075366_10235297 3300006195 Bacteria 1116
193 Ga0097621_100257966 3300006237 Bacteria 1528
194 Ga0075370_10234298 3300006353 Bacteria 1087
195 Ga0075370_10280621 3300006353 Bacteria 989
196 Ga0075370_10436071 3300006353 Bacteria 788
197 Ga0075428_100064665 3300006844 Bacteria 4006
198 Ga0075428_100114727 3300006844 Bacteria 2934
199 Ga0075428_100189179 3300006844 Bacteria 2226
200 Ga0075431_100001225 3300006847 Bacteria 23251
201 Ga0075431_100466500 3300006847 Bacteria 1257
202 Ga0075431_100577774 3300006847 Bacteria 1109
203 Ga0075433_10398345 3300006852 Bacteria 1214
204 Ga0075434_100027921 3300006871 Bacteria 5540
205 Ga0075429_100018718 3300006880 Bacteria 5997
206 Ga0075429_100248209 3300006880 Bacteria 1558
207 Ga0068865_100042431 3300006881 Bacteria 3102
208 Ga0097620_100439959 3300006931 Bacteria 1400
209 Ga0099825_1023491 3300006941 Bacteria 3767
210 Ga0099825_1027660 3300006941 Bacteria 2858
211 Ga0099824_1023526 3300006942 Bacteria 3801
212 Ga0099824_1025601 3300006942 Bacteria 3198
213 Ga0099822_1024641 3300006943 Bacteria 5356
214 Ga0099823_1036903 3300006944 Bacteria 3725
215 Ga0075435_100023928 3300007076 Bacteria 4733
216 Ga0099794_10002976 3300007265 Bacteria 6393
217 Ga0099794_10007419 3300007265 Bacteria 4506
218 Ga0099795_10271064 3300007788 Bacteria 738
219 Ga0105240_10013788 3300009093 Bacteria 11073
220 Ga0105240_10071470 3300009093 Bacteria 4291
221 Ga0105240_10083063 3300009093 Bacteria 3932
222 Ga0105240_10093352 3300009093 Bacteria 3673
223 Ga0105240_10336296 3300009093 Bacteria 1716
224 Ga0111539_10352323 3300009094 Bacteria 1713
225 Ga0105245_10084091 3300009098 Bacteria 2914
226 Ga0105245_11068879 3300009098 Bacteria 853
227 Ga0105247_10092044 3300009101 Bacteria 1926
228 Ga0105247_10264117 3300009101 Bacteria 1181
229 Ga0114129_10267821 3300009147 Bacteria 2287
230 Ga0114129_10604008 3300009147 Bacteria 1421
231 Ga0114129_10732406 3300009147 Bacteria 1268
232 Ga0105243_10297525 3300009148 Bacteria 1461
233 Ga0105241_10001008 3300009174 Bacteria 21388
234 Ga0105241_10121468 3300009174 Bacteria 2104
235 Ga0105242_10919459 3300009176 Bacteria 876
236 Ga0105248_10077301 3300009177 Bacteria 3742
237 Ga0105248_10557551 3300009177 Bacteria 1293
238 Ga0105248_11138035 3300009177 Bacteria 882
239 Ga0105237_10015187 3300009545 Bacteria 8024
240 Ga0105237_10015820 3300009545 Bacteria 7848
241 Ga0105237_10285034 3300009545 Bacteria 1654
242 Ga0105237_10444601 3300009545 Bacteria 1302
243 Ga0105237_11183873 3300009545 Bacteria 771
244 Ga0105238_10017578 3300009551 Bacteria 7271
245 Ga0105238_10046426 3300009551 Bacteria 4384
246 Ga0105238_10084272 3300009551 Bacteria 3168
247 Ga0105238_10087410 3300009551 Bacteria 3104
248 Ga0105238_10394335 3300009551 Bacteria 1377
249 Ga0105249_10108270 3300009553 Bacteria 2623
250 Ga0099796_10071308 3300010159 Bacteria 1255
251 Ga0105239_10062974 3300010375 Bacteria 4071
252 Ga0105239_10074658 3300010375 Bacteria 3728
253 Ga0105239_10089192 3300010375 Bacteria 3400
254 Ga0105239_10092021 3300010375 Bacteria 3347
255 Ga0105239_10138632 3300010375 Bacteria 2709
256 Ga0105239_10248700 3300010375 Bacteria 1997
257 Ga0105246_10291503 3300011119 Bacteria 1313
258 Ga0157315_1004111 3300012508 Bacteria 1022
259 Ga0157370_10045059 3300013104 Bacteria 4234
260 Ga0157370_10203539 3300013104 Bacteria 1836
261 Ga0157369_10005277 3300013105 Bacteria 15062
262 Ga0157369_10007048 3300013105 Bacteria 12962
263 Ga0157369_10026918 3300013105 Bacteria 6378
264 Ga0157369_10397687 3300013105 Bacteria 1429
265 Ga0157369_10653850 3300013105 Bacteria 1084
266 Ga0157374_10150302 3300013296 Bacteria 2264
267 Ga0157374_10433937 3300013296 Bacteria 1313
268 Ga0157374_10519993 3300013296 Bacteria 1196
269 Ga0157378_10759627 3300013297 Bacteria 993
270 Ga0163162_10175716 3300013306 Bacteria 2267
271 Ga0157372_10141777 3300013307 Bacteria 2769
272 Ga0157375_10024362 3300013308 Bacteria 5600
273 Ga0157375_10033711 3300013308 Bacteria 4870
274 Ga0157375_10410164 3300013308 Bacteria 1521
275 Ga0157375_11678833 3300013308 Bacteria 752
276 Ga0163163_10034881 3300014325 Bacteria 4877
277 Ga0157380_10356831 3300014326 Bacteria 1370
278 Ga0157380_10668996 3300014326 Bacteria 1038
279 Ga0157377_10384178 3300014745 Bacteria 952
280 Ga0157376_10043247 3300014969 Bacteria 3696
281 Ga0163161_10141459 3300017792 Bacteria 1822
282 Ga0163161_10157536 3300017792 Bacteria 1730
283 Ga0163161_10392669 3300017792 Bacteria 1111
284 Ga0206350_11050481 3300020080 Bacteria 1203
285 Ga0206350_11210336 3300020080 Bacteria 937
286 Ga0154015_1433898 3300020610 Bacteria 1088
287 Ga0214544_1000136 3300021320 Bacteria 107814
288 Ga0214542_1000127 3300021321 Bacteria 107829
289 Ga0214545_1000063 3300021324 Bacteria 107829
290 Ga0214543_1000238 3300021327 Bacteria 84004
291 Ga0213874_10177782 3300021377 Bacteria 756
292 Ga0213876_10003778 3300021384 Bacteria 8586
293 Ga0213876_10017018 3300021384 Bacteria 3840
294 Ga0213876_10183977 3300021384 Bacteria 1111
295 Ga0213875_10104794 3300021388 Bacteria 1320
296 Ga0213871_10005533 3300021441 Bacteria 2611
297 Ga0224712_10089601 3300022467 Bacteria 1286
298 Ga0224712_10299251 3300022467 Bacteria 752
299 Ga0209563_101314 3300025230 Bacteria 6783
300 Ga0209677_100344 3300025253 Bacteria 29159
301 Ga0209677_101591 3300025253 Bacteria 9594
302 Ga0209148_1000529 3300025254 Bacteria 37615
303 Ga0209233_1000933 3300025261 Bacteria 12708
304 Ga0209233_1017814 3300025261 Bacteria 1925
305 Ga0209233_1018846 3300025261 Bacteria 1846
306 Ga0209233_1042504 3300025261 Bacteria 974
307 Ga0209455_1002494 3300025272 Bacteria 7068
308 Ga0209673_1040759 3300025273 Bacteria 1326
309 Ga0209564_1004806 3300025295 Bacteria 8049
310 Ga0209564_1018699 3300025295 Bacteria 2628
311 Ga0209758_1000011 3300025297 Bacteria 1049685
312 Ga0209758_1000455 3300025297 Bacteria 68279
313 Ga0209758_1001990 3300025297 Bacteria 22036
314 Ga0209758_1006185 3300025297 Bacteria 8752
315 Ga0209758_1012065 3300025297 Bacteria 4897
316 Ga0209758_1017504 3300025297 Bacteria 3563
317 Ga0209256_1033968 3300025299 Bacteria 1364
318 Ga0207426_1000480 3300025302 Bacteria 60866
319 Ga0207426_1000669 3300025302 Bacteria 41627
320 Ga0207426_1001491 3300025302 Bacteria 19157
321 Ga0207426_1015249 3300025302 Bacteria 2791
322 Ga0209051_1041116 3300025303 Bacteria 1648
323 Ga0209257_1001458 3300025304 Bacteria 27945
324 Ga0207697_10068080 3300025315 Bacteria 1489
325 Ga0207656_10021788 3300025321 Bacteria 2564
326 Ga0207656_10044531 3300025321 Bacteria 1896
327 Ga0207653_10125727 3300025885 Bacteria 927
328 Ga0207692_10023106 3300025898 Bacteria 2872
329 Ga0207692_10073455 3300025898 Bacteria 1809
330 Ga0207692_10077921 3300025898 Unclassified 1764
331 Ga0207642_10233509 3300025899 Bacteria 1035
332 Ga0207710_10363959 3300025900 Bacteria 738
333 Ga0207647_10001884 3300025904 Bacteria 16066
334 Ga0207647_10004039 3300025904 Bacteria 10933
335 Ga0207685_10001667 3300025905 Bacteria 4783
336 Ga0207699_10006106 3300025906 Bacteria 5806
337 Ga0207699_10035655 3300025906 Bacteria 2832
338 Ga0207699_10088526 3300025906 Bacteria 1938
339 Ga0207699_10104744 3300025906 Bacteria 1802
340 Ga0207643_10074402 3300025908 Bacteria 1959
341 Ga0207705_10061293 3300025909 Bacteria 2717
342 Ga0207705_10086384 3300025909 Bacteria 2292
343 Ga0207705_10338364 3300025909 Bacteria 1158
344 Ga0207684_10141154 3300025910 Bacteria 2071
345 Ga0207654_10004108 3300025911 Bacteria 7337
346 Ga0207654_10055191 3300025911 Bacteria 2299
347 Ga0207654_10078427 3300025911 Bacteria 1982
348 Ga0207707_10001006 3300025912 Bacteria 27014
349 Ga0207707_10003605 3300025912 Bacteria 13731
350 Ga0207707_10017450 3300025912 Bacteria 6258
351 Ga0207707_10044046 3300025912 Bacteria 3891
352 Ga0207695_10000157 3300025913 Bacteria 204140
353 Ga0207695_10001596 3300025913 Bacteria 36807
354 Ga0207695_10046830 3300025913 Bacteria 4581
355 Ga0207695_10134161 3300025913 Bacteria 2430
356 Ga0207695_10626737 3300025913 Bacteria 957
357 Ga0207695_10829160 3300025913 Bacteria 805
358 Ga0207671_10050591 3300025914 Bacteria 3077
359 Ga0207671_10066557 3300025914 Bacteria 2682
360 Ga0207693_10014734 3300025915 Bacteria 6281
361 Ga0207693_10024253 3300025915 Bacteria 4815
362 Ga0207693_10055218 3300025915 Bacteria 3116
363 Ga0207693_10093014 3300025915 Bacteria 2363
364 Ga0207693_10293714 3300025915 Bacteria 1273
365 Ga0207693_10461006 3300025915 Bacteria 993
366 Ga0207663_10000211 3300025916 Bacteria 25872
367 Ga0207663_10131532 3300025916 Bacteria 1730
368 Ga0207663_10212380 3300025916 Bacteria 1403
369 Ga0207663_10253479 3300025916 Bacteria 1296
370 Ga0207663_10450717 3300025916 Bacteria 992
371 Ga0207660_10001786 3300025917 Bacteria 14369
372 Ga0207660_10046067 3300025917 Bacteria 3076
373 Ga0207660_10660862 3300025917 Bacteria 852
374 Ga0207662_10294182 3300025918 Bacteria 1078
375 Ga0207657_10017803 3300025919 Bacteria 6802
376 Ga0207657_10055233 3300025919 Bacteria 3431
377 Ga0207649_10056956 3300025920 Bacteria 2442
378 Ga0207649_10063665 3300025920 Bacteria 2329
379 Ga0207649_10138119 3300025920 Bacteria 1664
380 Ga0207649_10189582 3300025920 Bacteria 1445
381 Ga0207652_10002365 3300025921 Bacteria 15944
382 Ga0207652_10014023 3300025921 Bacteria 6488
383 Ga0207652_10031387 3300025921 Bacteria 4462
384 Ga0207652_10202137 3300025921 Bacteria 1788
385 Ga0207694_10000757 3300025924 Bacteria 28985
386 Ga0207694_10051570 3300025924 Bacteria 3189
387 Ga0207694_10127588 3300025924 Bacteria 2036
388 Ga0207687_10175949 3300025927 Bacteria 1654
389 Ga0207700_10012705 3300025928 Bacteria 5443
390 Ga0207700_10133770 3300025928 Bacteria 2028
391 Ga0207700_10604816 3300025928 Bacteria 976
392 Ga0207664_10097594 3300025929 Bacteria 2421
393 Ga0207664_10154186 3300025929 Bacteria 1954
394 Ga0207664_10240314 3300025929 Bacteria 1577
395 Ga0207664_10530326 3300025929 Bacteria 1055
396 Ga0207664_10672775 3300025929 Bacteria 931
397 Ga0207664_10718922 3300025929 Bacteria 898
398 Ga0207644_10090576 3300025931 Bacteria 2279
399 Ga0207690_10429890 3300025932 Bacteria 1058
400 Ga0207706_10164599 3300025933 Bacteria 1949
401 Ga0207669_10031720 3300025937 Bacteria 2956
402 Ga0207669_10099677 3300025937 Bacteria 1916
403 Ga0207665_10029652 3300025939 Bacteria 3616
404 Ga0207665_10045152 3300025939 Bacteria 2950
405 Ga0207665_10098165 3300025939 Bacteria 2040
406 Ga0207691_10231613 3300025940 Bacteria 1599
407 Ga0207711_10050232 3300025941 Bacteria 3570
408 Ga0207661_10001813 3300025944 Bacteria 14603
409 Ga0207661_10008843 3300025944 Bacteria 7207
410 Ga0207667_10013120 3300025949 Bacteria 9507
411 Ga0207667_10027313 3300025949 Bacteria 6214
412 Ga0207667_10062687 3300025949 Bacteria 3886
413 Ga0207667_10129200 3300025949 Bacteria 2602
414 Ga0207667_10430730 3300025949 Bacteria 1341
415 Ga0207667_10473635 3300025949 Bacteria 1271
416 Ga0207667_10554015 3300025949 Bacteria 1163
417 Ga0207712_10220597 3300025961 Bacteria 1516
418 Ga0207712_10370930 3300025961 Bacteria 1195
419 Ga0207668_10110621 3300025972 Bacteria 2060
420 Ga0207668_10123928 3300025972 Bacteria 1961
421 Ga0207668_10151381 3300025972 Bacteria 1796
422 Ga0207640_10006211 3300025981 Bacteria 6543
423 Ga0207640_10078470 3300025981 Bacteria 2248
424 Ga0207640_10152952 3300025981 Bacteria 1697
425 Ga0207640_10383123 3300025981 Bacteria 1140
426 Ga0207658_10305054 3300025986 Bacteria 1373
427 Ga0207677_10139059 3300026023 Bacteria 1856
428 Ga0207703_10261584 3300026035 Bacteria 1564
429 Ga0207703_10727415 3300026035 Bacteria 945
430 Ga0207639_10013907 3300026041 Bacteria 5644
431 Ga0207639_10016218 3300026041 Bacteria 5265
432 Ga0207639_10083636 3300026041 Bacteria 2533
433 Ga0207639_10133476 3300026041 Bacteria 2059
434 Ga0207639_10582971 3300026041 Bacteria 1030
435 Ga0207678_10070874 3300026067 Bacteria 2988
436 Ga0207678_10072576 3300026067 Bacteria 2949
437 Ga0207678_10221531 3300026067 Bacteria 1619
438 Ga0207678_10400012 3300026067 Bacteria 1189
439 Ga0207678_10452936 3300026067 Bacteria 1116
440 Ga0207708_10074639 3300026075 Bacteria 2599
441 Ga0207708_10267339 3300026075 Bacteria 1382
442 Ga0207702_10000003 3300026078 Bacteria 434196
443 Ga0207702_10000744 3300026078 Bacteria 34789
444 Ga0207702_10138381 3300026078 Bacteria 2200
445 Ga0207702_10248579 3300026078 Bacteria 1669
446 Ga0207641_10212515 3300026088 Bacteria 1790
447 Ga0207641_10316844 3300026088 Bacteria 1478
448 Ga0207648_10095149 3300026089 Bacteria 2605
449 Ga0207674_10055685 3300026116 Bacteria 4019
450 Ga0207674_10065865 3300026116 Bacteria 3651
451 Ga0207674_10076930 3300026116 Bacteria 3344
452 Ga0207674_10077074 3300026116 Bacteria 3340
453 Ga0207674_10323603 3300026116 Bacteria 1491
454 Ga0207674_10826388 3300026116 Bacteria 894
455 Ga0207675_100100246 3300026118 Bacteria 2728
456 Ga0207675_100118791 3300026118 Bacteria 2500
457 Ga0207683_10123427 3300026121 Bacteria 2326
458 Ga0207698_10039521 3300026142 Bacteria 3496
459 Ga0207698_11264693 3300026142 Bacteria 752
460 Ga0209389_1000009 3300027296 Bacteria 226873
461 Ga0209389_1000088 3300027296 Bacteria 83578
462 Ga0209589_1000007 3300027357 Bacteria 425699
463 Ga0209589_1000189 3300027357 Bacteria 71403
464 Ga0209489_100008 3300027361 Bacteria 425699
465 Ga0209489_100050 3300027361 Bacteria 154669
466 Ga0209489_100085 3300027361 Bacteria 126199
467 Ga0209700_100009 3300027363 Bacteria 425699
468 Ga0209700_100016 3300027363 Bacteria 252567
469 Ga0209588_1025767 3300027671 Bacteria 1863
470 Ga0209588_1133221 3300027671 Bacteria 792
471 Ga0209813_10040615 3300027866 Bacteria 1415
472 Ga0268266_10050046 3300028379 Bacteria 3584
473 Ga0268266_10070563 3300028379 Bacteria 3027
474 Ga0268265_10099986 3300028380 Bacteria 2339
475 Ga0268265_10307339 3300028380 Bacteria 1430
476 Ga0268265_10406113 3300028380 Bacteria 1260
477 Ga0268264_10000038 3300028381 Bacteria 383623
478 Ga0268264_10071583 3300028381 Bacteria 2938
479 Ga0268264_10505345 3300028381 Bacteria 1179
480 Ga0268264_10886878 3300028381 Bacteria 895
481 Ga0265319_1008276 3300028563 Bacteria 4576
482 Ga0265336_10002175 3300028666 Bacteria 8281
483 Ga0307517_10000512 3300028786 Bacteria 66501
484 Ga0307517_10201351 3300028786 Bacteria 1244
485 Ga0307515_10051295 3300028794 Bacteria 6156
486 Ga0307515_10081344 3300028794 Bacteria 4209
487 Ga0265338_10000116 3300028800 Bacteria 146839
488 Ga0265324_10005816 3300029957 Bacteria 5245
489 Ga0265328_10155178 3300031239 Bacteria 862
490 Ga0265339_10001103 3300031249 Bacteria 20475
491 Ga0265339_10012106 3300031249 Bacteria 5284
492 Ga0265339_10166699 3300031249 Bacteria 1105
493 Ga0307509_10165420 3300031507 Bacteria 2102
494 Ga0307509_10226909 3300031507 Bacteria 1674
495 Ga0307509_10424421 3300031507 Bacteria 1029
496 Ga0307508_10000008 3300031616 Bacteria 265023
497 Ga0307508_10240708 3300031616 Bacteria 1407
498 Ga0307508_10285142 3300031616 Bacteria 1245
499 Ga0265314_10001759 3300031711 Bacteria 23380
500 Ga0265314_10038466 3300031711 Bacteria 3455
501 Ga0265314_10087044 3300031711 Bacteria 2044
502 Ga0265342_10006885 3300031712 Bacteria 8400
503 Ga0265342_10309580 3300031712 Bacteria 830
504 Ga0307516_10096696 3300031730 Bacteria 2773
505 Ga0307406_10646108 3300031901 Bacteria 878
506 Ga0307416_100486582 3300032002 Bacteria 1295
507 Ga0307507_10028768 3300033179 Bacteria 5912
508 Ga0307510_10016371 3300033180 Bacteria 8751
509 Ga0307510_10027712 3300033180 Bacteria 6484
510 Ga0307510_10052175 3300033180 Bacteria 4316
511 Ga0315911_1000004 3300033442 Bacteria 472637
512 Ga0373959_0012593 3300034820 Bacteria 1514
513 Ga0373926_0007233 3300035083 Bacteria 3700
514 Ga0373934_0166294 3300035086 Bacteria 905
515 Ga0373951_0039839 3300035091 Bacteria 1130
516 Ga0373923_0010246 3300035111 Bacteria 3404
517 Ga0373923_0012016 3300035111 Bacteria 3191
518 Ga0373936_0020563 3300035113 Bacteria 2565
519 Ga0373945_0003891 3300035116 Bacteria 4720
520 Ga0373945_0037545 3300035116 Bacteria 1739
521 Ga0373953_0001272 3300035117 Bacteria 7217
522 Ga0373954_0000228 3300035118 Bacteria 20399
523 Ga0373954_0093189 3300035118 Bacteria 1448
524 Ga0373956_0002043 3300035119 Bacteria 8358
525 Ga0373957_0000531 3300035120 Bacteria 9609
526 Ga0373943_0371294 3300035170 Bacteria 822
527 Ga0373946_0044385 3300035171 Bacteria 1835
528 Ga0373946_0105317 3300035171 Bacteria 1270
529 Ga0373955_0012568 3300035172 Bacteria 4069
530 Ga0373935_0026404 3300035692 Bacteria 3583
531 Ga0373935_0049502 3300035692 Bacteria 2663
532 Ga0373935_0373164 3300035692 Bacteria 1020
533 Ga0373935_0396374 3300035692 Bacteria 991
534 Ga0373935_0450491 3300035692 Bacteria 930
535 Ga0373927_0009711 3300035695 Bacteria 6450
536 Ga0373927_0053685 3300035695 Bacteria 2607
537 Ga0373927_0066330 3300035695 Bacteria 2335
538 Ga0373927_0091955 3300035695 Bacteria 1971
539 Ga0373927_0093269 3300035695 Bacteria 1956
540 Ga0373927_0237968 3300035695 Bacteria 1196
541 Ga0373933_0004420 3300035724 Bacteria 7717
542 Ga0373933_0051579 3300035724 Bacteria 2459
543 Ga0373933_0076006 3300035724 Bacteria 2051
544 Ga0373933_0332859 3300035724 Bacteria 985
545 Ga0373947_0132093 3300035725 Bacteria 1595
546 Ga0373947_0298475 3300035725 Bacteria 1074
547 Ga0373937_0001379 3300036401 Bacteria 20316
548 Ga0373937_0052771 3300036401 Bacteria 3729
549 Ga0373937_0062906 3300036401 Bacteria 3412
550 Ga0373937_0725255 3300036401 Bacteria 941
551 Ga0373937_0869521 3300036401 Bacteria 850
552 Ga0373925_0067108 3300037068 Bacteria 2705
553 Ga0373925_0084095 3300037068 Bacteria 2424
554 Ga0373925_0097602 3300037068 Bacteria 2254
555 Ga0373925_0196909 3300037068 Bacteria 1601
556 Ga0373925_0348185 3300037068 Bacteria 1203
557 Ga0395899_0271608 3300037312 Bacteria 1156
558 Ga0395900_0000134 3300037418 Bacteria 124444
559 Ga0395900_0014518 3300037418 Bacteria 8038
560 Ga0395900_0105300 3300037418 Bacteria 2898
561 Ga0395900_0443512 3300037418 Bacteria 1255
562 Ga0395898_0019042 3300037466 Bacteria 6990
563 Ga0395898_0027084 3300037466 Bacteria 5759
564 Ga0395905_0018896 3300037471 Bacteria 6536
565 Ga0395905_0040242 3300037471 Bacteria 4384
566 Ga0395905_0175863 3300037471 Bacteria 2010
567 Ga0395905_0426937 3300037471 Bacteria 1222
568 Ga0436364_0051166 3300037853 Bacteria 1962
569 Ga0436364_0475552 3300037853 Bacteria 4120
570 Ga0436364_0986822 3300037853 Bacteria 930
571 Ga0436364_1075789 3300037853 Bacteria 926
572 Ga0395901_0013321 3300038443 Bacteria 8353
573 Ga0395901_0102903 3300038443 Bacteria 2997
574 Ga0436365_0481444 3300039437 Bacteria 17117
575 Ga0436365_0769976 3300039437 Bacteria 1123
576 Ga0436365_1210825 3300039437 Bacteria 3174
577 Ga0436361_0317256 3300039447 Bacteria 1420
578 Ga0436361_0346254 3300039447 Bacteria 874
579 Ga0436361_0402388 3300039447 Bacteria 21228
580 Ga0436363_0271674 3300039450 Bacteria 742
581 Ga0436363_0861308 3300039450 Bacteria 1016
582 Ga0436363_1401795 3300039450 Bacteria 17008
583 Ga0436362_0084779 3300039453 Bacteria 1725
584 Ga0436362_0817857 3300039453 Bacteria 1456
585 Ga0439465_0120252 3300041413 Bacteria 920
586 Ga0451793_1559700 3300041452 Bacteria 858
587 Ga0451797_0752526 3300041453 Bacteria 1023
588 Ga0451837_0571975 3300041494 Bacteria 1103
589 Ga0439448_0076097 3300042005 Bacteria 1123
590 Ga0439459_0010174 3300042438 Bacteria 1636
591 Ga0466969_0193501 3300044656 Bacteria 929
592 Ga0466972_0008710 3300044658 Bacteria 5088
593 Ga0466972_0018187 3300044658 Bacteria 3515
594 Ga0466965_0029714 3300044683 Bacteria 2660
595 Ga0466966_0448711 3300044684 Bacteria 775
596 Ga0466961_0000060 3300044693 Bacteria 65360
597 Ga0466963_0223958 3300044694 Bacteria 1318
598 Ga0466963_0467975 3300044694 Bacteria 889
599 Ga0466971_0231926 3300044719 Bacteria 877
600 Ga0466968_0005390 3300044735 Bacteria 4788
601 Ga0466968_0040389 3300044735 Bacteria 1967
602 Ga0466960_0009676 3300044901 Bacteria 3982
603 Ga0466959_0307627 3300045049 Bacteria 1085
604 Ga0466959_0352048 3300045049 Bacteria 1004
605 Ga0466967_0034297 3300045976 Bacteria 4306
606 Ga0466967_0113396 3300045976 Bacteria 2494
607 Ga0466967_0241307 3300045976 Bacteria 1724
608 Ga0466967_0283797 3300045976 Bacteria 1589
609 Ga0466967_0286790 3300045976 Bacteria 1581
610 Ga0466967_0454243 3300045976 Bacteria 1252
611 Ga0466967_0531399 3300045976 Bacteria 1156
612 Ga0495592_0001209 3300046454 Bacteria 17916
613 Ga0495603_0053369 3300046455 Bacteria 2398
614 Ga0495629_0002443 3300046459 Bacteria 14254
615 Ga0495629_0061638 3300046459 Bacteria 2621
616 Ga0495629_0304269 3300046459 Bacteria 1091
617 Ga0495629_0386274 3300046459 Bacteria 952
618 Ga0495638_0002824 3300046460 Bacteria 13909
619 Ga0495638_0016287 3300046460 Bacteria 4981
620 Ga0495638_0166082 3300046460 Bacteria 1269
621 Ga0495641_0089348 3300046461 Bacteria 1377
622 Ga0495651_0005605 3300046462 Bacteria 9569
623 Ga0495651_0008316 3300046462 Bacteria 7951
624 Ga0495651_0295336 3300046462 Bacteria 1089
625 Ga0495653_0002888 3300046463 Bacteria 13740
626 Ga0495653_0176426 3300046463 Bacteria 1470
627 Ga0495650_0058527 3300046471 Bacteria 1555
628 Ga0495580_0025402 3300046472 Bacteria 4329
629 Ga0495582_0068768 3300046473 Bacteria 1957
630 Ga0495639_0027392 3300046475 Bacteria 2522
631 Ga0495639_0124352 3300046475 Bacteria 1232
632 Ga0495662_0049320 3300046476 Bacteria 2032
633 Ga0495664_0002664 3300046477 Bacteria 9612
634 Ga0495664_0025173 3300046477 Bacteria 3464
635 Ga0495664_0146779 3300046477 Bacteria 1430
636 Ga0495664_0435457 3300046477 Bacteria 786
637 Ga0495594_0030401 3300046499 Bacteria 2922
638 Ga0495594_0233471 3300046499 Bacteria 1048
639 Ga0495596_0044108 3300046500 Bacteria 1756
640 Ga0495607_0171715 3300046501 Bacteria 1094
641 Ga0495606_0003208 3300046507 Bacteria 17626
642 Ga0495606_0076927 3300046507 Bacteria 2084
643 Ga0495608_0003566 3300046511 Bacteria 11150
644 Ga0495616_0043080 3300046513 Bacteria 2294
645 Ga0495618_0058014 3300046514 Bacteria 2452
646 Ga0495620_0142108 3300046515 Bacteria 938
647 Ga0495628_0012258 3300046516 Bacteria 7226
648 Ga0495628_0181266 3300046516 Bacteria 1593
649 Ga0495630_0015746 3300046517 Bacteria 5525
650 Ga0495631_0020454 3300046518 Bacteria 3092
651 Ga0495631_0156536 3300046518 Bacteria 978
652 Ga0495632_0022490 3300046519 Bacteria 3378
653 Ga0495632_0144262 3300046519 Bacteria 1103
654 Ga0495643_0022092 3300046522 Bacteria 3636
655 Ga0495648_0002556 3300046524 Bacteria 16672
656 Ga0495648_0004859 3300046524 Bacteria 11342
657 Ga0495666_0046587 3300046526 Bacteria 2090
658 Ga0495652_0007973 3300046529 Bacteria 9713
659 Ga0495652_0021828 3300046529 Bacteria 5691
660 Ga0495652_0173623 3300046529 Bacteria 1661
661 Ga0495652_0277714 3300046529 Bacteria 1228
662 Ga0495665_0072181 3300046531 Bacteria 1818
663 Ga0495665_0163763 3300046531 Bacteria 1159
664 Ga0495640_0012896 3300046533 Bacteria 6373
665 Ga0495640_0147258 3300046533 Bacteria 1514
666 Ga0495587_0004873 3300046536 Bacteria 8807
667 Ga0495587_0031035 3300046536 Bacteria 3238
668 Ga0495645_0033526 3300046543 Bacteria 3746
669 Ga0495622_0004120 3300046557 Bacteria 6780
670 Ga0495622_0058842 3300046557 Bacteria 1779
671 Ga0495622_0166193 3300046557 Bacteria 993
672 Ga0495667_0009322 3300046559 Bacteria 6651
673 Ga0495667_0013615 3300046559 Bacteria 5500
674 Ga0495656_0030522 3300046615 Bacteria 2179
675 Ga0495668_0009486 3300046616 Bacteria 5975
676 Ga0495668_0103877 3300046616 Bacteria 1555
677 Ga0495634_0005394 3300046642 Bacteria 9850
678 Ga0495634_0116381 3300046642 Bacteria 1715
679 Ga0495611_0054941 3300046648 Bacteria 1801
680 Ga0495611_0132438 3300046648 Bacteria 1163
681 Ga0495635_0003508 3300046663 Bacteria 10848
682 Ga0495635_0032590 3300046663 Bacteria 3614
683 Ga0495635_0176343 3300046663 Bacteria 1453
684 Ga0495661_0098331 3300046665 Bacteria 1652
685 Ga0495661_0107686 3300046665 Bacteria 1558
686 Ga0495588_0032165 3300046674 Bacteria 2642
687 Ga0495588_0037012 3300046674 Bacteria 2478
688 Ga0495588_0090187 3300046674 Bacteria 1605
689 Ga0495588_0200844 3300046674 Bacteria 1053
690 Ga0495657_0055464 3300046675 Bacteria 2642
691 Ga0495657_0091660 3300046675 Bacteria 1948
692 Ga0495599_0002630 3300046678 Bacteria 10467
693 Ga0495599_0344558 3300046678 Bacteria 894
694 Ga0495623_0002096 3300046679 Bacteria 13330
695 Ga0495623_0005614 3300046679 Bacteria 8190
696 Ga0495646_0031779 3300046680 Bacteria 3288
697 Ga0495646_0040339 3300046680 Bacteria 2876
698 Ga0495647_0040362 3300046681 Bacteria 1773
699 Ga0495669_0047383 3300046684 Bacteria 1920
700 Ga0495669_0132142 3300046684 Bacteria 1175
701 Ga0495669_0266536 3300046684 Bacteria 823
702 Ga0495613_0005605 3300046689 Bacteria 9426
703 Ga0495613_0108585 3300046689 Bacteria 2001
704 Ga0495613_0138635 3300046689 Bacteria 1739
705 Ga0495624_0032311 3300046690 Bacteria 3394
706 Ga0495624_0039775 3300046690 Bacteria 3014
707 Ga0495670_0038100 3300046691 Bacteria 2396
708 Ga0495671_0027114 3300046692 Bacteria 2961
709 Ga0495589_0031998 3300046794 Bacteria 2646
710 Ga0495589_0093365 3300046794 Bacteria 1461
711 Ga0495600_0011959 3300046809 Bacteria 5419
712 Ga0495600_0030308 3300046809 Bacteria 3504
713 Ga0495600_0150591 3300046809 Bacteria 1506
714 Ga0495581_0010414 3300047315 Bacteria 5377
715 Ga0495581_0062978 3300047315 Bacteria 2143
716 Ga0495604_0020791 3300047317 Bacteria 5240
717 Ga0495674_0048444 3300047319 Bacteria 3760
718 Ga0495674_0147106 3300047319 Bacteria 1977
719 Ga0495672_0032579 3300047320 Bacteria 3240
720 Ga0495672_0051629 3300047320 Bacteria 2420
721 Ga0495676_0088068 3300047321 Bacteria 2330
722 Ga0495680_0006958 3300047322 Bacteria 10437
723 Ga0495680_0032642 3300047322 Bacteria 4223
724 Ga0495687_046980 3300047443 Bacteria 1860
725 Ga0495675_0000826 3300047444 Bacteria 19005
726 Ga0495677_0096075 3300047445 Bacteria 1119
727 Ga0495673_0038873 3300047469 Bacteria 2162
728 Ga0495673_0040939 3300047469 Bacteria 2089
729 Ga0495673_0158155 3300047469 Bacteria 871
730 Ga0495684_0000938 3300047471 Bacteria 23706
731 Ga0495684_0100786 3300047471 Bacteria 2183
732 Ga0495684_0588180 3300047471 Bacteria 753
733 Ga0495686_0023445 3300047472 Bacteria 4070
734 Ga0495686_0081311 3300047472 Bacteria 1979
735 Ga0495593_0004740 3300047673 Bacteria 8083
736 Ga0495593_0026536 3300047673 Bacteria 3197
737 Ga0495602_0003873 3300048088 Bacteria 15572
738 Ga0495602_0059895 3300048088 Bacteria 3321
739 Ga0496100_0076896 3300048903 Bacteria 2243
740 Ga0496100_0106470 3300048903 Bacteria 1941
741 Ga0496100_0279395 3300048903 Bacteria 1244
742 Ga0496101_0021482 3300048904 Bacteria 4435
743 Ga0496101_0122781 3300048904 Bacteria 1965
744 Ga0496102_0009611 3300048905 Bacteria 8317
745 Ga0496102_0027169 3300048905 Bacteria 5111
746 Ga0496102_0045663 3300048905 Bacteria 3978
747 Ga0496102_0173603 3300048905 Bacteria 2029
748 Ga0496102_0412299 3300048905 Bacteria 1269
749 Ga0496102_1121092 3300048905 Bacteria 706
750 Ga0496103_0073533 3300048906 Bacteria 2141
751 Ga0496103_0140982 3300048906 Bacteria 1541
752 Ga0496103_0207301 3300048906 Bacteria 1261
753 Ga0496103_0376577 3300048906 Bacteria 912
754 Ga0496104_0002704 3300048907 Bacteria 15259
755 Ga0496104_0007514 3300048907 Bacteria 9635
756 Ga0496104_0009587 3300048907 Bacteria 8619
757 Ga0496105_0002708 3300048908 Bacteria 12919
758 Ga0496105_0085674 3300048908 Bacteria 2603
759 Ga0496106_0000634 3300048909 Bacteria 25214
760 Ga0496106_0001384 3300048909 Bacteria 18192
761 Ga0496106_0343633 3300048909 Bacteria 1198
762 Ga0496106_0451585 3300048909 Bacteria 1032
763 Ga0496107_0002095 3300048910 Bacteria 12782
764 Ga0496107_0013782 3300048910 Bacteria 5653
765 Ga0496107_0054133 3300048910 Bacteria 2896
766 Ga0496108_0001003 3300048911 Bacteria 22020
767 Ga0496108_0022639 3300048911 Bacteria 5167
768 Ga0496108_0027124 3300048911 Bacteria 4726
769 Ga0496109_0000166 3300048912 Bacteria 64848
770 Ga0496109_0084838 3300048912 Bacteria 2922
771 Ga0496109_0096435 3300048912 Bacteria 2740
772 Ga0496109_0780746 3300048912 Bacteria 893
773 Ga0496110_0003914 3300048913 Bacteria 11454
774 Ga0496110_0029261 3300048913 Bacteria 4739
775 Ga0496110_0060588 3300048913 Bacteria 3338
776 Ga0496110_0062285 3300048913 Bacteria 3294
777 Ga0496111_0136560 3300048914 Bacteria 1816
778 Ga0496111_0368171 3300048914 Bacteria 1063
779 Ga0496111_0452405 3300048914 Bacteria 947
780 Ga0496112_0000142 3300048915 Bacteria 44742
781 Ga0496112_0000358 3300048915 Bacteria 29716
782 Ga0496112_0018397 3300048915 Bacteria 6577
783 Ga0496112_0044524 3300048915 Bacteria 4349
784 Ga0496112_0385023 3300048915 Bacteria 1343
785 Ga0496112_0426024 3300048915 Bacteria 1265
786 Ga0496112_0633742 3300048915 Bacteria 999
787 Ga0496113_0004839 3300048916 Bacteria 8333
788 Ga0496113_0093035 3300048916 Bacteria 2326
789 Ga0496114_0006347 3300048917 Bacteria 9303
790 Ga0496114_0601707 3300048917 Bacteria 969
791 Ga0496115_0028727 3300048918 Bacteria 4361
792 Ga0496115_0034976 3300048918 Bacteria 3972
793 Ga0496115_0077226 3300048918 Bacteria 2708
794 Ga0496115_0161871 3300048918 Bacteria 1849
795 Ga0496115_0773138 3300048918 Bacteria 749
796 Ga0496116_0001611 3300048919 Bacteria 24820
797 Ga0496116_0073189 3300048919 Bacteria 2162
798 Ga0496116_0265906 3300048919 Bacteria 842
799 Ga0496117_0136641 3300048920 Bacteria 1475
800 Ga0496117_0164634 3300048920 Bacteria 1295
801 Ga0496117_0256521 3300048920 Bacteria 950
802 Ga0496118_0008176 3300048921 Bacteria 10886
803 Ga0496118_0024339 3300048921 Bacteria 5228
804 Ga0496118_0161696 3300048921 Bacteria 1383
805 Ga0496118_0250727 3300048921 Bacteria 1006
806 Ga0496119_0036025 3300048922 Bacteria 3234
807 Ga0496119_0105704 3300048922 Bacteria 1572
808 Ga0496119_0155884 3300048922 Bacteria 1219
809 Ga0496119_0165214 3300048922 Bacteria 1173
810 Ga0496120_0060665 3300048923 Bacteria 2115
811 Ga0496121_0000365 3300048924 Bacteria 92822
812 Ga0496121_0001250 3300048924 Bacteria 44073
813 Ga0496121_0020850 3300048924 Bacteria 6457
814 Ga0496121_0032052 3300048924 Bacteria 4785
815 Ga0496121_0042595 3300048924 Bacteria 3945
816 Ga0496121_0053980 3300048924 Bacteria 3362
817 Ga0496121_0063730 3300048924 Bacteria 3009
818 Ga0496121_0070373 3300048924 Bacteria 2818
819 Ga0496121_0091700 3300048924 Bacteria 2371
820 Ga0496121_0105596 3300048924 Bacteria 2161
821 Ga0496121_0146386 3300048924 Bacteria 1745
822 Ga0496121_0189880 3300048924 Bacteria 1474
823 Ga0496121_0241472 3300048924 Bacteria 1258
824 Ga0496121_0270059 3300048924 Bacteria 1169
825 Ga0496122_0055591 3300048925 Bacteria 2960
826 Ga0496122_0301695 3300048925 Bacteria 863
827 Ga0496123_0084809 3300048926 Bacteria 1908
828 Ga0496124_0002671 3300048927 Bacteria 22854
829 Ga0496124_0373380 3300048927 Bacteria 1000
830 Ga0496124_0382654 3300048927 Bacteria 983
831 Ga0496125_0008303 3300048928 Bacteria 10905
832 Ga0496125_0013887 3300048928 Bacteria 7881
833 Ga0496125_0030378 3300048928 Bacteria 4835
834 Ga0496125_0039257 3300048928 Bacteria 4080
835 Ga0496125_0096714 3300048928 Bacteria 2191
836 Ga0496126_0003397 3300048929 Bacteria 20144
837 Ga0496126_0004058 3300048929 Bacteria 17778
838 Ga0496126_0004467 3300048929 Bacteria 16697
839 Ga0496126_0009177 3300048929 Bacteria 10550
840 Ga0496126_0011808 3300048929 Bacteria 8989
841 Ga0496126_0018439 3300048929 Bacteria 6914
842 Ga0496126_0018516 3300048929 Bacteria 6896
843 Ga0496126_0044443 3300048929 Bacteria 4091
844 Ga0496126_0052156 3300048929 Bacteria 3719
845 Ga0496126_0061909 3300048929 Bacteria 3360
846 Ga0496126_0295827 3300048929 Bacteria 1337
847 Ga0496126_0325157 3300048929 Bacteria 1263
848 Ga0496126_0372463 3300048929 Bacteria 1164
849 Ga0496126_0443718 3300048929 Bacteria 1046
850 Ga0496126_0517402 3300048929 Bacteria 951
851 Ga0495682_0081060 3300049460 Bacteria 1167
852 Ga0501032_0026447 3300049569 Bacteria 3991
853 Ga0501032_0268884 3300049569 Bacteria 1105
854 Ga0501036_0085011 3300049572 Bacteria 2674
855 Ga0501036_0147325 3300049572 Bacteria 1986
856 Ga0501039_0327142 3300049575 Bacteria 1205
857 Ga0501042_0128487 3300049578 Bacteria 1826
858 Ga0501043_0029487 3300049579 Bacteria 4311
859 Ga0501046_0014282 3300049580 Bacteria 6706
860 Ga0501047_0019249 3300049581 Bacteria 6549
861 Ga0501048_0100848 3300049582 Bacteria 2037
862 Ga0501070_0018349 3300049586 Bacteria 5869
863 Ga0501070_0067287 3300049586 Bacteria 2967
864 Ga0501070_0404570 3300049586 Bacteria 1104
865 Ga0501070_0467361 3300049586 Bacteria 1016
866 Ga0501072_0716113 3300049588 Bacteria 786
867 Ga0501073_0148436 3300049589 Bacteria 1625
868 Ga0501077_0125181 3300049593 Bacteria 1629
869 Ga0501079_0394304 3300049741 Bacteria 1086
870 Ga0501080_0097586 3300049742 Bacteria 2728
871 Ga0501035_0051567 3300049822 Bacteria 3683
872 Ga0501044_0009213 3300049823 Bacteria 10783
873 Ga0501044_0026949 3300049823 Bacteria 6080
874 Ga0501044_0425329 3300049823 Bacteria 1238
875 Ga0501045_0373826 3300049824 Bacteria 1061
876 nmdc:mga03683_14358_c1 3300050489 Bacteria 2929
877 nmdc:mga03683_193256_c1 3300050489 Bacteria 932
878 nmdc:mga00v17_213852_c1 3300050491 Bacteria 1248
879 nmdc:mga00v17_244451_c1 3300050491 Bacteria 1164
880 nmdc:mga0yw44_279822_c1 3300050492 Bacteria 1115
881 nmdc:mga0yw44_284003_c1 3300050492 Bacteria 1107
882 nmdc:mga0yw44_35109_c1 3300050492 Bacteria 2944
883 nmdc:mga0yw44_57538_c1 3300050492 Bacteria 2372
884 nmdc:mga0yw44_68762_c1 3300050492 Bacteria 2192
885 nmdc:mga0k408_9657_c1 3300050493 Bacteria 5207
886 nmdc:mga06z11_51738_c1 3300050494 Bacteria 2104
887 nmdc:mga06z11_9579_c1 3300050494 Bacteria 4087
888 nmdc:mga07m45_19552_c1 3300050496 Bacteria 3670
889 nmdc:mga07m45_24035_c2 3300050496 Bacteria 2418
890 nmdc:mga07m45_34764_c1 3300050496 Bacteria 2802
891 nmdc:mga05p37_381088_c1 3300050507 Bacteria 1652
892 nmdc:mga09592_16208_c1 3300050508 Bacteria 6091
893 nmdc:mga09592_424127_c1 3300050508 Bacteria 1149
894 nmdc:mga0qj67_80587_c1 3300050509 Bacteria 2608
895 nmdc:mga06r32_1139_c1 3300050510 Bacteria 23882
896 nmdc:mga06r32_284235_c1 3300050510 Bacteria 1641
897 nmdc:mga06r32_300228_c1 3300050510 Bacteria 1592
898 nmdc:mga06r32_589991_c1 3300050510 Bacteria 1083
899 nmdc:mga08y16_226410_c1 3300050511 Bacteria 1935
900 nmdc:mga08y16_341470_c1 3300050511 Bacteria 1539
901 nmdc:mga0n895_517383_c1 3300050512 Bacteria 1201
902 nmdc:mga0rr50_12850_c1 3300050513 Bacteria 5427
903 nmdc:mga0a205_162849_c1 3300050515 Bacteria 2126
904 nmdc:mga0a205_350223_c1 3300050515 Bacteria 1344
905 Ga0495601_0028797 3300053077 Bacteria 3442
906 Ga0495601_0084098 3300053077 Bacteria 2044
907 Ga0495601_0121729 3300053077 Bacteria 1695
908 Ga0495601_0254211 3300053077 Bacteria 1147
909 Ga0495612_0143077 3300053078 Bacteria 1038
910 Ga0500610_0281489 3300053079 Bacteria 746
911 Ga0500635_0103296 3300053080 Bacteria 1051
912 Ga0500635_0175232 3300053080 Bacteria 827
913 Ga0495595_0001721 3300053084 Bacteria 8565
914 Ga0495595_0242206 3300053084 Bacteria 902
915 Ga0495595_0249975 3300053084 Bacteria 888
916 Ga0495619_0002764 3300053085 Bacteria 11448
917 Ga0495619_0026952 3300053085 Bacteria 3701
918 Ga0495619_0027657 3300053085 Bacteria 3655
919 Ga0495619_0246754 3300053085 Bacteria 1237
920 Ga0500643_000042 3300053087 Bacteria 158933
921 Ga0500643_040787 3300053087 Bacteria 1366
922 Ga0500644_0038550 3300053088 Bacteria 1569
923 Ga0500647_0012259 3300053091 Bacteria 3854
924 Ga0500651_0052451 3300053093 Bacteria 2558
925 Ga0500566_0000178 3300053094 Bacteria 32469
926 Ga0500566_0003121 3300053094 Bacteria 9907
927 Ga0500566_0004694 3300053094 Bacteria 8133
928 Ga0500566_0016779 3300053094 Bacteria 4297
929 Ga0500640_016747 3300053095 Bacteria 3097
930 Ga0500641_0004300 3300053096 Bacteria 5024
931 Ga0500650_0004206 3300053098 Bacteria 5166
932 Ga0500554_008738 3300053102 Bacteria 2394
933 Ga0500555_000735 3300053103 Bacteria 12142
934 Ga0500555_008486 3300053103 Bacteria 2929
935 Ga0500556_0000012 3300053104 Bacteria 250391
936 Ga0500556_0052243 3300053104 Bacteria 1482
937 Ga0500557_000006 3300053105 Bacteria 141252
938 Ga0500562_075560 3300053108 Bacteria 910
939 Ga0500572_000041 3300053111 Bacteria 39295
940 Ga0500595_002365 3300053119 Bacteria 9422
941 Ga0500595_005588 3300053119 Bacteria 5472
942 Ga0500607_016121 3300053121 Bacteria 4292
943 Ga0500607_057563 3300053121 Bacteria 2048
944 Ga0500608_003394 3300053122 Bacteria 5964
945 Ga0500614_035057 3300053123 Bacteria 1248
946 Ga0500618_007537 3300053125 Bacteria 3096
947 Ga0500618_064543 3300053125 Bacteria 823
948 Ga0500642_0000013 3300053130 Bacteria 197927
949 Ga0500642_0000040 3300053130 Bacteria 96160
950 Ga0500652_000186 3300053131 Bacteria 24000
951 Ga0500658_0154631 3300053134 Bacteria 1035
952 Ga0500559_0000597 3300053136 Bacteria 24582
953 Ga0500559_0007742 3300053136 Bacteria 4745
954 Ga0500559_0009057 3300053136 Bacteria 4325
955 Ga0500559_0036178 3300053136 Bacteria 2134
956 Ga0500568_0005482 3300053139 Bacteria 6548
957 Ga0500568_0045042 3300053139 Bacteria 1757
958 Ga0500568_0051835 3300053139 Bacteria 1613
959 Ga0500568_0129283 3300053139 Bacteria 939
960 Ga0500586_000482 3300053145 Bacteria 8011
961 Ga0500590_133876 3300053148 Bacteria 1143
962 Ga0500603_000312 3300053150 Bacteria 12796
963 Ga0500604_0021776 3300053151 Bacteria 1814
964 Ga0500604_0167645 3300053151 Bacteria 750
965 Ga0500616_0000035 3300053153 Bacteria 394242
966 Ga0500616_0052615 3300053153 Bacteria 2141
967 Ga0500619_070986 3300053154 Bacteria 1158
968 Ga0500622_0019026 3300053156 Bacteria 3647
969 Ga0500624_012678 3300053157 Bacteria 1250
970 Ga0500627_0186092 3300053158 Bacteria 933
971 Ga0500630_000840 3300053159 Bacteria 14239
972 Ga0500633_0065278 3300053160 Bacteria 1289
973 Ga0500634_0040350 3300053161 Bacteria 2537
974 Ga0500638_001490 3300053162 Bacteria 7404
975 Ga0500639_000029 3300053163 Bacteria 76014
976 Ga0500639_052625 3300053163 Bacteria 2119
977 Ga0500636_0000105 3300053177 Bacteria 43109
978 Ga0500636_0011341 3300053177 Bacteria 5217
979 Ga0500636_0077175 3300053177 Bacteria 1924
980 Ga0500636_0085694 3300053177 Bacteria 1810
981 Ga0500637_0000215 3300053178 Bacteria 21698
982 Ga0500637_0124232 3300053178 Bacteria 1497
983 Ga0500576_091957 3300053725 Bacteria 1258
984 Ga0500611_041918 3300053727 Bacteria 1010
985 Ga0500625_022414 3300053729 Bacteria 2983
986 Ga0500645_004319 3300053730 Bacteria 5474
987 Ga0500656_028492 3300053732 Bacteria 732
988 Ga0500552_006729 3300053733 Bacteria 1300
989 Ga0500596_019804 3300053735 Bacteria 1011
990 Ga0500601_000611 3300053737 Bacteria 5074
991 Ga0501084_0914998 3300054114 Bacteria 738
992 Ga0500661_002447 3300055283 Bacteria 3498
993 Ga0501082_0212161 3300060353 Bacteria 1684
994 Ga0501082_0437711 3300060353 Bacteria 1142
995 Ga0530510_0034799 3300061734 Bacteria 3629

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10055218 Ga0207693_100552183 179
2 3300025898 Ga0207692_10077921 Ga0207692_100779212 183
3 3300037471 Ga0395905_0426937 Ga0395905_0426937_205_858 217
4 3300005434 Ga0070709_10013044 Ga0070709_100130442 220
5 3300005435 Ga0070714_100367633 Ga0070714_1003676332 220
6 3300005436 Ga0070713_100310055 Ga0070713_1003100552 220
7 3300005471 Ga0070698_100516437 Ga0070698_1005164372 220
8 3300010375 Ga0105239_10092021 Ga0105239_100920212 220
9 3300011119 Ga0105246_10291503 Ga0105246_102915032 220
10 3300013296 Ga0157374_10150302 Ga0157374_101503022 220
11 3300039450 Ga0436363_0271674 Ga0436363_0271674_19_681 220
12 3300048903 Ga0496100_0076896 Ga0496100_0076896_814_1476 220
13 3300048905 Ga0496102_0045663 Ga0496102_0045663_1309_1971 220
14 3300048906 Ga0496103_0207301 Ga0496103_0207301_385_1047 220
15 3300048911 Ga0496108_0027124 Ga0496108_0027124_3921_4583 220
16 3300048912 Ga0496109_0096435 Ga0496109_0096435_350_1012 220
17 3300048913 Ga0496110_0062285 Ga0496110_0062285_2370_3032 220
18 3300048915 Ga0496112_0633742 Ga0496112_0633742_224_886 220
19 3300048918 Ga0496115_0028727 Ga0496115_0028727_1557_2219 220
20 iso_pu_bacteria 2507262055 2507507209 220
21 iso_pu_bacteria 2508501009 2508541263 220
22 iso_pu_bacteria 2508501042 2508693407 220
23 iso_pu_bacteria 2508501128 2509148795 220
24 iso_pu_bacteria 2511231028 2511395674 220
25 iso_pu_bacteria 2513237092 2513628885 220
26 iso_pu_bacteria 2513237094 2513637162 220
27 iso_pu_bacteria 2513237095 2513651571 220
28 iso_pu_bacteria 2513237096 2513655766 220
29 iso_pu_bacteria 2513237101 2513693262 220
30 iso_pu_bacteria 2513237102 2513702714 220
31 iso_pu_bacteria 2513237104 2513717468 220
32 iso_pu_bacteria 2513237137 2513856740 220
33 iso_pu_bacteria 2513237139 2513876732 220
34 iso_pu_bacteria 2513237145 2513917321 220
35 iso_pu_bacteria 2513237161 2514012227 220
36 iso_pu_bacteria 2515154112 2515628768 220
37 iso_pu_bacteria 2517093001 2517104866 220
38 iso_pu_bacteria 2517572143 2517895393 220
39 iso_pu_bacteria 2524023205 2524440671 220
40 iso_pu_bacteria 2524023228 2524540505 220
41 iso_pu_bacteria 2528768022 2528857431 220
42 iso_pu_bacteria 2602042107 2603857745 220
43 iso_pu_bacteria 2617270735 2617347982 220
44 iso_pu_bacteria 2617270741 2617377792 220
45 iso_pu_bacteria 2667528175 2671122068 220
46 iso_pu_bacteria 2721755755 2723848172 220
47 iso_pu_bacteria 2728368998 2728750873 220
48 iso_pu_bacteria 2744054633 2745077483 220
49 iso_pu_bacteria 2791355196 2793065528 220
50 iso_pu_bacteria 2791355197 2793069367 220
51 iso_pu_bacteria 2791355199 2793078118 220
52 iso_pu_bacteria 2802429603 2805918712 220
53 iso_pu_bacteria 2816332527 2818243832 220
54 iso_pu_bacteria 2824600985 2824607842 220
55 iso_pu_bacteria 2824609381 2824616941 220
56 iso_pu_bacteria 2824617872 2824623640 220
57 iso_pu_bacteria 2824626560 2824632443 220
58 iso_pu_bacteria 2824635225 2824639899 220
59 iso_pu_bacteria 2824644064 2824646467 220
60 iso_pu_bacteria 2824653114 2824658963 220
61 iso_pu_bacteria 2824661429 2824668474 220
62 iso_pu_bacteria 2824671348 2824676830 220
63 iso_pu_bacteria 2824679649 2824684175 220
64 iso_pu_bacteria 2824687955 2824693300 220
65 iso_pu_bacteria 2824696289 2824701311 220
66 iso_pu_bacteria 2824704595 2824708433 220
67 iso_pu_bacteria 2824714736 2824717226 220
68 iso_pu_bacteria 2824723954 2824726934 220
69 iso_pu_bacteria 2824732956 2824737333 220
70 iso_pu_bacteria 2824746037 2824751820 220
71 iso_pu_bacteria 2824753945 2824762385 220
72 iso_pu_bacteria 2824763712 2824770736 220
73 iso_pu_bacteria 2824773399 2824776094 220
74 iso_pu_bacteria 2838122688 2838127049 220
75 iso_pu_bacteria 2841941048 2841945469 220
76 iso_pu_bacteria 2841949485 2841955922 220
77 iso_pu_bacteria 2841957949 2841961634 220
78 iso_pu_bacteria 2841966195 2841973993 220
79 iso_pu_bacteria 2841974524 2841980614 220
80 iso_pu_bacteria 2841983080 2841987150 220
81 iso_pu_bacteria 2842038055 2842041216 220
82 iso_pu_bacteria 2842045827 2842045839 220
83 iso_pu_bacteria 2844315083 2844320467 220
84 iso_pu_bacteria 2847930680 2847937996 220
85 iso_pu_bacteria 2847939898 2847939938 220
86 iso_pu_bacteria 2849076700 2849077858 220
87 iso_pu_bacteria 2857509624 2857511055 220
88 iso_pu_bacteria 2857524615 2857527118 220
89 iso_pu_bacteria 2874590934 2874596051 220
90 iso_pu_bacteria 2874604998 2874608840 220
91 iso_pu_bacteria 2874612657 2874616838 220
92 iso_pu_bacteria 2874620515 2874625812 220
93 iso_pu_bacteria 2874628541 2874632851 220
94 iso_pu_bacteria 2874645413 2874650875 220
95 iso_pu_bacteria 2876761206 2876769070 220
96 iso_pu_bacteria 2876771140 2876776121 220
97 iso_pu_bacteria 2876808645 2876813903 220
98 iso_pu_bacteria 2876818435 2876820607 220
99 iso_pu_bacteria 2879074833 2879080210 220
100 iso_pu_bacteria 2879083081 2879084456 220
101 iso_pu_bacteria 2879099564 2879105332 220
102 iso_pu_bacteria 2879110137 2879115432 220
103 iso_pu_bacteria 2879127579 2879129983 220
104 iso_pu_bacteria 2879142872 2879147462 220
105 iso_pu_bacteria 2881364244 2881367857 220
106 iso_pu_bacteria 2881665667 2881668796 220
107 iso_pu_bacteria 2885366525 2885368423 220
108 iso_pu_bacteria 2885374607 2885378942 220
109 iso_pu_bacteria 2885409591 2885410124 220
110 iso_pu_bacteria 2888378607 2888385974 220
111 iso_pu_bacteria 2888388044 2888392333 220
112 iso_pu_bacteria 2888419890 2888426077 220
113 iso_pu_bacteria 2889033259 2889037312 220
114 iso_pu_bacteria 2893066018 2893068104 220
115 iso_pu_bacteria 2903727486 2903732876 220
116 iso_pu_bacteria 2903748898 2903759073 220
117 iso_pu_bacteria 2904666416 2904673827 220
118 iso_pu_bacteria 2904690495 2904698735 220
119 iso_pu_bacteria 2904699407 2904710856 220
120 iso_pu_bacteria 2904711408 2904711421 220
121 iso_pu_bacteria 2906602504 2906606995 220
122 iso_pu_bacteria 2906610324 2906615997 220
123 iso_pu_bacteria 2906626472 2906626600 220
124 iso_pu_bacteria 2906635258 2906639084 220
125 iso_pu_bacteria 2906643746 2906647062 220
126 iso_pu_bacteria 2906660503 2906665229 220
127 iso_pu_bacteria 2908739725 2908741002 220
128 iso_pu_bacteria 2908756301 2908759249 220
129 iso_pu_bacteria 2908775508 2908782156 220
130 iso_pu_bacteria 2919073203 2919078233 220
131 iso_pu_bacteria 2922361189 2922361444 220
132 iso_pu_bacteria 2922368715 2922376294 220
133 iso_pu_bacteria 2922386360 2922388865 220
134 iso_pu_bacteria 2922393267 2922399990 220
135 iso_pu_bacteria 2922425934 2922432036 220
136 iso_pu_bacteria 2929615660 2929624262 220
137 iso_pu_bacteria 2929624759 2929633312 220
138 iso_pu_bacteria 2932784394 2932789444 220
139 iso_pu_bacteria 2932794094 2932797780 220
140 iso_pu_bacteria 2932801729 2932804297 220
141 iso_pu_bacteria 2932809354 2932816493 220
142 iso_pu_bacteria 2932828146 2932832051 220
143 iso_pu_bacteria 2933577622 2933585977 220
144 iso_pu_bacteria 2935608549 2935610413 220
145 iso_pu_bacteria 2935616580 2935621990 220
146 iso_pu_bacteria 2935630451 2935631088 220
147 iso_pu_bacteria 2935638405 2935644000 220
148 iso_pu_bacteria 2935648319 2935654384 220
149 iso_pu_bacteria 2935656913 2935663264 220
150 iso_pu_bacteria 2935665750 2935669085 220
151 iso_pu_bacteria 2935675223 2935683357 220
152 iso_pu_bacteria 2935684952 2935692298 220
153 iso_pu_bacteria 2935694250 2935700531 220
154 iso_pu_bacteria 2935703347 2935708840 220
155 iso_pu_bacteria 2935713505 2935720464 220
156 iso_pu_bacteria 2935722832 2935729745 220
157 iso_pu_bacteria 2935732158 2935739273 220
158 iso_pu_bacteria 2935741537 2935748186 220
159 iso_pu_bacteria 2935750917 2935758389 220
160 iso_pu_bacteria 2935769743 2935771055 220
161 iso_pu_bacteria 2935777560 2935781223 220
162 iso_pu_bacteria 2935785616 2935786244 220
163 iso_pu_bacteria 2935793552 2935793959 220
164 iso_pu_bacteria 2935801545 2935805801 220
165 iso_pu_bacteria 2935819856 2935823574 220
166 iso_pu_bacteria 2935827899 2935833252 220
167 iso_pu_bacteria 2935837841 2935843173 220
168 iso_pu_bacteria 2935847175 2935849099 220
169 iso_pu_bacteria 2935855204 2935860237 220
170 iso_pu_bacteria 2935864058 2935867634 220
171 iso_pu_bacteria 2935873716 2935878556 220
172 iso_pu_bacteria 2935883170 2935888324 220
173 iso_pu_bacteria 2935959822 2935965305 220
174 iso_pu_bacteria 2935975950 2935976078 220
175 iso_pu_bacteria 2935984226 2935986427 220
176 iso_pu_bacteria 2935992306 2935998167 220
177 iso_pu_bacteria 2936002035 2936006867 220
178 iso_pu_bacteria 2936011229 2936017420 220
179 iso_pu_bacteria 2936019824 2936025922 220
180 iso_pu_bacteria 2936028420 2936034670 220
181 iso_pu_bacteria 2936046547 2936052727 220
182 iso_pu_bacteria 2936055302 2936059922 220
183 iso_pu_bacteria 2940556831 2940564293 220
184 iso_pu_bacteria 2941507105 2941507740 220
185 iso_pu_bacteria 2941515067 2941516167 220
186 iso_pu_bacteria 2941523033 2941523125 220
187 iso_pu_bacteria 2941531003 2941531673 220
188 iso_pu_bacteria 2941538514 2941544719 220
189 iso_pu_bacteria 3005474847 3005476942 220
190 iso_pu_bacteria 3005483717 3005485627 220
191 iso_pu_bacteria 3005506211 3005511568 220
192 iso_pu_bacteria 3005587118 3005594451 220
193 iso_pu_bacteria 3005594810 3005600842 220
194 iso_pu_bacteria 3005710791 3005716255 220
195 iso_pu_bacteria 3005718088 3005723635 220
196 iso_pu_bacteria 8006933436 8006934477 220
197 iso_pu_bacteria 8006964411 8006968892 220
198 iso_pu_bacteria 8006973647 8006974447 220
199 iso_pu_bacteria 8006984368 8006985227 220
200 iso_pu_bacteria 8006994254 8006998546 220
201 iso_pu_bacteria 8016522445 8016528030 220
202 iso_pu_bacteria 8016539877 8016546394 220
203 iso_pu_bacteria 8016548790 8016555733 220
204 iso_pu_bacteria 8016557553 8016564086 220
205 iso_pu_bacteria 8016566248 8016571476 220
206 iso_pu_bacteria 8016575299 8016575729 220
207 iso_pu_bacteria 8016583857 8016594965 220
208 iso_pu_bacteria 8016595262 8016601791 220
209 iso_pu_bacteria 8016603502 8016608458 220
210 iso_pu_bacteria 8016613128 8016616409 220
211 iso_pu_bacteria 8016622563 8016624729 220
212 iso_pu_bacteria 8016630954 8016638225 220
213 iso_pu_bacteria 8017057580 8017065438 220
214 iso_pu_bacteria 8019538911 8019546899 220
215 iso_pu_bacteria 8019547302 8019551770 220
216 iso_pu_bacteria 8019555841 8019564205 220
217 iso_pu_bacteria 8019565922 8019574283 220
218 iso_pu_bacteria 8019576017 8019584834 220
219 iso_pu_bacteria 8019597564 8019598665 220
220 iso_pu_bacteria 8019608314 8019609705 220
221 iso_pu_bacteria 8019619141 8019620294 220
222 iso_pu_bacteria 8019629233 8019632806 220
223 iso_pu_bacteria 8019638758 8019647122 220
224 iso_pu_bacteria 8019648815 8019655570 220
225 iso_pu_bacteria 8019659431 8019660668 220
226 iso_pu_bacteria 8019678201 8019686009 220
227 iso_pu_bacteria 8055742211 8055744579 220
228 iso_pu_bacteria 8056673599 8056675921 220
229 iso_pu_bacteria 8056689827 8056690337 220
230 iso_pu_bacteria 8056967851 8056971861 220
231 3300004625 Ga0055543_1009210 Ga0055543_10092102 221
232 3300005262 Ga0065165_1005320 Ga0065165_10053202 221
233 3300005981 Ga0081538_10118419 Ga0081538_101184192 221
234 3300045976 Ga0466967_0283797 Ga0466967_0283797_879_1547 221
235 3300005844 Ga0068862_100567855 Ga0068862_1005678551 222
236 3300006844 Ga0075428_100114727 Ga0075428_1001147273 222
237 3300006847 Ga0075431_100466500 Ga0075431_1004665002 222
238 3300006847 Ga0075431_100577774 Ga0075431_1005777741 222
239 3300006880 Ga0075429_100248209 Ga0075429_1002482092 222
240 3300009147 Ga0114129_10604008 Ga0114129_106040082 222
241 3300035724 Ga0373933_0076006 Ga0373933_0076006_814_1518 222
242 3300049593 Ga0501077_0125181 Ga0501077_0125181_661_1335 222
243 3300050508 nmdc:mga09592_424127_c1 nmdc:mga09592_424127_c1_283_951 222
244 3300050510 nmdc:mga06r32_300228_c1 nmdc:mga06r32_300228_c1_690_1358 222
245 3300050510 nmdc:mga06r32_589991_c1 nmdc:mga06r32_589991_c1_216_884 222
246 3300053088 Ga0500644_0038550 Ga0500644_0038550_413_1096 222
247 3300053103 Ga0500555_008486 Ga0500555_008486_2208_2882 222
248 3300005330 Ga0070690_100068847 Ga0070690_1000688472 223
249 3300005466 Ga0070685_10499638 Ga0070685_104996381 223
250 3300005843 Ga0068860_100624935 Ga0068860_1006249352 223
251 3300006844 Ga0075428_100064665 Ga0075428_1000646651 223
252 3300006847 Ga0075431_100001225 Ga0075431_10000122510 223
253 3300006852 Ga0075433_10398345 Ga0075433_103983452 223
254 3300006880 Ga0075429_100018718 Ga0075429_1000187184 223
255 3300007076 Ga0075435_100023928 Ga0075435_1000239283 223
256 3300009101 Ga0105247_10092044 Ga0105247_100920442 223
257 3300009147 Ga0114129_10732406 Ga0114129_107324061 223
258 3300014326 Ga0157380_10668996 Ga0157380_106689962 223
259 3300021377 Ga0213874_10177782 Ga0213874_101777821 223
260 3300025961 Ga0207712_10370930 Ga0207712_103709302 223
261 3300028381 Ga0268264_10886878 Ga0268264_108868781 223
262 3300035170 Ga0373943_0371294 Ga0373943_0371294_53_724 223
263 3300035171 Ga0373946_0105317 Ga0373946_0105317_128_799 223
264 3300035692 Ga0373935_0373164 Ga0373935_0373164_97_768 223
265 3300035692 Ga0373935_0396374 Ga0373935_0396374_184_861 223
266 3300035695 Ga0373927_0053685 Ga0373927_0053685_1821_2492 223
267 3300037068 Ga0373925_0348185 Ga0373925_0348185_106_783 223
268 3300046674 Ga0495588_0200844 Ga0495588_0200844_297_968 223
269 3300047321 Ga0495676_0088068 Ga0495676_0088068_110_781 223
270 3300048907 Ga0496104_0002704 Ga0496104_0002704_12547_13221 223
271 3300048913 Ga0496110_0003914 Ga0496110_0003914_8176_8850 223
272 3300048915 Ga0496112_0385023 Ga0496112_0385023_532_1206 223
273 3300049578 Ga0501042_0128487 Ga0501042_0128487_1013_1687 223
274 3300050508 nmdc:mga09592_16208_c1 nmdc:mga09592_16208_c1_2027_2701 223
275 3300050509 nmdc:mga0qj67_80587_c1 nmdc:mga0qj67_80587_c1_1181_1858 223
276 3300050510 nmdc:mga06r32_1139_c1 nmdc:mga06r32_1139_c1_7924_8598 223
277 3300050510 nmdc:mga06r32_284235_c1 nmdc:mga06r32_284235_c1_415_1092 223
278 3300050511 nmdc:mga08y16_341470_c1 nmdc:mga08y16_341470_c1_802_1488 223
279 3300050512 nmdc:mga0n895_517383_c1 nmdc:mga0n895_517383_c1_81_758 223
280 3300050513 nmdc:mga0rr50_12850_c1 nmdc:mga0rr50_12850_c1_1553_2227 223
281 3300050515 nmdc:mga0a205_162849_c1 nmdc:mga0a205_162849_c1_1423_2100 223
282 3300050515 nmdc:mga0a205_350223_c1 nmdc:mga0a205_350223_c1_116_793 223
283 3300054114 Ga0501084_0914998 Ga0501084_0914998_27_701 223
284 3300060353 Ga0501082_0212161 Ga0501082_0212161_208_879 223
285 3300060353 Ga0501082_0437711 Ga0501082_0437711_74_748 223
286 3300061734 Ga0530510_0034799 Ga0530510_0034799_26_700 223
287 3300001989 JGI24739J22299_10031895 JGI24739J22299_100318952 224
288 3300003203 JGI25406J46586_10000449 JGI25406J46586_1000044912 224
289 3300003214 JGI25165J46597_1014521 JGI25165J46597_10145212 224
290 3300003214 JGI25165J46597_1024683 JGI25165J46597_10246831 224
291 3300003215 JGI25153J46596_10009921 JGI25153J46596_100099212 224
292 3300003215 JGI25153J46596_10010561 JGI25153J46596_100105613 224
293 3300003354 JGI25160J50197_1001648 JGI25160J50197_10016482 224
294 3300003354 JGI25160J50197_1002130 JGI25160J50197_10021302 224
295 3300003354 JGI25160J50197_1019345 JGI25160J50197_10193451 224
296 3300003354 JGI25160J50197_1047548 JGI25160J50197_10475482 224
297 3300003659 JGI25404J52841_10001620 JGI25404J52841_100016202 224
298 3300003763 Ga0055529_1007195 Ga0055529_10071952 224
299 3300003794 Ga0055531_10010882 Ga0055531_100108824 224
300 3300003911 JGI25405J52794_10024657 JGI25405J52794_100246572 224
301 3300004625 Ga0055543_1003126 Ga0055543_10031263 224
302 3300005262 Ga0065165_1001015 Ga0065165_100101535 224
303 3300005262 Ga0065165_1003915 Ga0065165_10039152 224
304 3300005262 Ga0065165_1005972 Ga0065165_10059726 224
305 3300005262 Ga0065165_1024939 Ga0065165_10249392 224
306 3300005327 Ga0070658_10104328 Ga0070658_101043281 224
307 3300005327 Ga0070658_10143011 Ga0070658_101430112 224
308 3300005327 Ga0070658_10235014 Ga0070658_102350142 224
309 3300005329 Ga0070683_100233918 Ga0070683_1002339182 224
310 3300005329 Ga0070683_100524586 Ga0070683_1005245861 224
311 3300005334 Ga0068869_100330842 Ga0068869_1003308421 224
312 3300005336 Ga0070680_100113146 Ga0070680_1001131462 224
313 3300005337 Ga0070682_100041329 Ga0070682_1000413293 224
314 3300005337 Ga0070682_100044975 Ga0070682_1000449752 224
315 3300005337 Ga0070682_100318574 Ga0070682_1003185742 224
316 3300005337 Ga0070682_100427868 Ga0070682_1004278681 224
317 3300005338 Ga0068868_100025479 Ga0068868_1000254794 224
318 3300005339 Ga0070660_100011831 Ga0070660_1000118312 224
319 3300005344 Ga0070661_100052521 Ga0070661_1000525212 224
320 3300005344 Ga0070661_100088122 Ga0070661_1000881222 224
321 3300005344 Ga0070661_100106546 Ga0070661_1001065461 224
322 3300005344 Ga0070661_100265363 Ga0070661_1002653631 224
323 3300005345 Ga0070692_10288427 Ga0070692_102884271 224
324 3300005347 Ga0070668_100100152 Ga0070668_1001001522 224
325 3300005347 Ga0070668_100634462 Ga0070668_1006344621 224
326 3300005353 Ga0070669_100171320 Ga0070669_1001713202 224
327 3300005355 Ga0070671_100086849 Ga0070671_1000868493 224
328 3300005355 Ga0070671_100170800 Ga0070671_1001708001 224
329 3300005366 Ga0070659_100312806 Ga0070659_1003128062 224
330 3300005366 Ga0070659_100579541 Ga0070659_1005795412 224
331 3300005406 Ga0070703_10045888 Ga0070703_100458882 224
332 3300005434 Ga0070709_10000778 Ga0070709_1000077818 224
333 3300005434 Ga0070709_10007154 Ga0070709_100071544 224
334 3300005434 Ga0070709_10175986 Ga0070709_101759862 224
335 3300005434 Ga0070709_10378686 Ga0070709_103786861 224
336 3300005435 Ga0070714_100013419 Ga0070714_1000134195 224
337 3300005435 Ga0070714_100031338 Ga0070714_1000313384 224
338 3300005435 Ga0070714_100270133 Ga0070714_1002701332 224
339 3300005435 Ga0070714_100310108 Ga0070714_1003101082 224
340 3300005435 Ga0070714_100997170 Ga0070714_1009971701 224
341 3300005436 Ga0070713_100025862 Ga0070713_1000258624 224
342 3300005436 Ga0070713_100171302 Ga0070713_1001713022 224
343 3300005436 Ga0070713_100273775 Ga0070713_1002737751 224
344 3300005436 Ga0070713_100557115 Ga0070713_1005571152 224
345 3300005437 Ga0070710_10004897 Ga0070710_100048973 224
346 3300005437 Ga0070710_10009727 Ga0070710_100097272 224
347 3300005437 Ga0070710_10298032 Ga0070710_102980321 224
348 3300005439 Ga0070711_100005828 Ga0070711_1000058281 224
349 3300005439 Ga0070711_100051265 Ga0070711_1000512652 224
350 3300005439 Ga0070711_100054196 Ga0070711_1000541962 224
351 3300005439 Ga0070711_100228645 Ga0070711_1002286452 224
352 3300005439 Ga0070711_100408992 Ga0070711_1004089922 224
353 3300005441 Ga0070700_100117728 Ga0070700_1001177282 224
354 3300005444 Ga0070694_100225499 Ga0070694_1002254993 224
355 3300005445 Ga0070708_100127678 Ga0070708_1001276782 224
356 3300005455 Ga0070663_100036220 Ga0070663_1000362203 224
357 3300005455 Ga0070663_100059522 Ga0070663_1000595222 224
358 3300005455 Ga0070663_100379740 Ga0070663_1003797402 224
359 3300005457 Ga0070662_100143125 Ga0070662_1001431252 224
360 3300005458 Ga0070681_10048974 Ga0070681_100489742 224
361 3300005458 Ga0070681_10063856 Ga0070681_100638562 224
362 3300005458 Ga0070681_10143228 Ga0070681_101432282 224
363 3300005458 Ga0070681_10355721 Ga0070681_103557211 224
364 3300005458 Ga0070681_10383361 Ga0070681_103833611 224
365 3300005459 Ga0068867_100175184 Ga0068867_1001751842 224
366 3300005467 Ga0070706_100103899 Ga0070706_1001038992 224
367 3300005467 Ga0070706_100590125 Ga0070706_1005901251 224
368 3300005471 Ga0070698_100029876 Ga0070698_1000298764 224
369 3300005530 Ga0070679_100013103 Ga0070679_1000131033 224
370 3300005530 Ga0070679_100025223 Ga0070679_1000252232 224
371 3300005530 Ga0070679_100074795 Ga0070679_1000747952 224
372 3300005535 Ga0070684_100013479 Ga0070684_1000134795 224
373 3300005535 Ga0070684_100024449 Ga0070684_1000244493 224
374 3300005535 Ga0070684_100085868 Ga0070684_1000858682 224
375 3300005535 Ga0070684_101094621 Ga0070684_1010946211 224
376 3300005536 Ga0070697_100014896 Ga0070697_1000148964 224
377 3300005536 Ga0070697_100694497 Ga0070697_1006944971 224
378 3300005539 Ga0068853_100014418 Ga0068853_1000144185 224
379 3300005539 Ga0068853_100021360 Ga0068853_1000213602 224
380 3300005539 Ga0068853_100047626 Ga0068853_1000476262 224
381 3300005539 Ga0068853_100208234 Ga0068853_1002082342 224
382 3300005544 Ga0070686_100056153 Ga0070686_1000561532 224
383 3300005547 Ga0070693_100023630 Ga0070693_1000236302 224
384 3300005548 Ga0070665_100109075 Ga0070665_1001090752 224
385 3300005548 Ga0070665_100168214 Ga0070665_1001682143 224
386 3300005548 Ga0070665_100192798 Ga0070665_1001927982 224
387 3300005548 Ga0070665_100357872 Ga0070665_1003578722 224
388 3300005549 Ga0070704_100137184 Ga0070704_1001371842 224
389 3300005563 Ga0068855_100054688 Ga0068855_1000546885 224
390 3300005563 Ga0068855_100055771 Ga0068855_1000557712 224
391 3300005563 Ga0068855_100103512 Ga0068855_1001035122 224
392 3300005563 Ga0068855_100127380 Ga0068855_1001273802 224
393 3300005563 Ga0068855_100593765 Ga0068855_1005937652 224
394 3300005577 Ga0068857_100074421 Ga0068857_1000744212 224
395 3300005577 Ga0068857_100308188 Ga0068857_1003081883 224
396 3300005578 Ga0068854_100060797 Ga0068854_1000607972 224
397 3300005614 Ga0068856_100000477 Ga0068856_10000047719 224
398 3300005614 Ga0068856_100129762 Ga0068856_1001297621 224
399 3300005614 Ga0068856_100174968 Ga0068856_1001749682 224
400 3300005616 Ga0068852_100030147 Ga0068852_1000301472 224
401 3300005616 Ga0068852_100073061 Ga0068852_1000730611 224
402 3300005616 Ga0068852_100094876 Ga0068852_1000948764 224
403 3300005616 Ga0068852_100613723 Ga0068852_1006137232 224
404 3300005617 Ga0068859_100439993 Ga0068859_1004399932 224
405 3300005618 Ga0068864_100319617 Ga0068864_1003196172 224
406 3300005719 Ga0068861_100399328 Ga0068861_1003993281 224
407 3300005719 Ga0068861_100454382 Ga0068861_1004543821 224
408 3300005834 Ga0068851_10003264 Ga0068851_100032648 224
409 3300005834 Ga0068851_10044749 Ga0068851_100447492 224
410 3300005834 Ga0068851_10102036 Ga0068851_101020361 224
411 3300005834 Ga0068851_10416438 Ga0068851_104164381 224
412 3300005843 Ga0068860_100000324 Ga0068860_10000032416 224
413 3300005843 Ga0068860_100240384 Ga0068860_1002403842 224
414 3300005844 Ga0068862_100112944 Ga0068862_1001129442 224
415 3300005937 Ga0081455_10001871 Ga0081455_1000187113 224
416 3300005937 Ga0081455_10011253 Ga0081455_1001125312 224
417 3300005937 Ga0081455_10016763 Ga0081455_100167637 224
418 3300005937 Ga0081455_10022225 Ga0081455_100222255 224
419 3300005937 Ga0081455_10044838 Ga0081455_100448382 224
420 3300005937 Ga0081455_10097121 Ga0081455_100971212 224
421 3300005937 Ga0081455_10103018 Ga0081455_101030183 224
422 3300005937 Ga0081455_10331051 Ga0081455_103310511 224
423 3300005981 Ga0081538_10016530 Ga0081538_100165302 224
424 3300005981 Ga0081538_10114658 Ga0081538_101146582 224
425 3300005983 Ga0081540_1004943 Ga0081540_10049434 224
426 3300005983 Ga0081540_1012323 Ga0081540_10123233 224
427 3300005983 Ga0081540_1012929 Ga0081540_10129292 224
428 3300005983 Ga0081540_1013478 Ga0081540_10134783 224
429 3300005983 Ga0081540_1014993 Ga0081540_10149932 224
430 3300005983 Ga0081540_1064646 Ga0081540_10646461 224
431 3300005983 Ga0081540_1093158 Ga0081540_10931582 224
432 3300005983 Ga0081540_1100486 Ga0081540_11004862 224
433 3300005985 Ga0081539_10000306 Ga0081539_1000030632 224
434 3300005985 Ga0081539_10001290 Ga0081539_1000129013 224
435 3300005985 Ga0081539_10026446 Ga0081539_100264462 224
436 3300006028 Ga0070717_10000521 Ga0070717_1000052123 224
437 3300006028 Ga0070717_10024234 Ga0070717_100242344 224
438 3300006028 Ga0070717_10047558 Ga0070717_100475582 224
439 3300006028 Ga0070717_10560528 Ga0070717_105605281 224
440 3300006028 Ga0070717_10732517 Ga0070717_107325171 224
441 3300006038 Ga0075365_10049232 Ga0075365_100492322 224
442 3300006038 Ga0075365_10069084 Ga0075365_100690842 224
443 3300006038 Ga0075365_10101316 Ga0075365_101013162 224
444 3300006038 Ga0075365_10216737 Ga0075365_102167372 224
445 3300006038 Ga0075365_10246154 Ga0075365_102461542 224
446 3300006038 Ga0075365_10250170 Ga0075365_102501702 224
447 3300006038 Ga0075365_10313357 Ga0075365_103133572 224
448 3300006048 Ga0075363_100173605 Ga0075363_1001736051 224
449 3300006051 Ga0075364_10263690 Ga0075364_102636902 224
450 3300006058 Ga0075432_10080907 Ga0075432_100809072 224
451 3300006163 Ga0070715_10006756 Ga0070715_100067563 224
452 3300006163 Ga0070715_10021529 Ga0070715_100215292 224
453 3300006163 Ga0070715_10117296 Ga0070715_101172961 224
454 3300006173 Ga0070716_100012501 Ga0070716_1000125015 224
455 3300006173 Ga0070716_100045303 Ga0070716_1000453032 224
456 3300006173 Ga0070716_100051114 Ga0070716_1000511142 224
457 3300006175 Ga0070712_100006981 Ga0070712_1000069812 224
458 3300006175 Ga0070712_100058182 Ga0070712_1000581822 224
459 3300006175 Ga0070712_100114609 Ga0070712_1001146092 224
460 3300006175 Ga0070712_100425851 Ga0070712_1004258512 224
461 3300006177 Ga0075362_10008952 Ga0075362_100089523 224
462 3300006177 Ga0075362_10075963 Ga0075362_100759632 224
463 3300006177 Ga0075362_10092607 Ga0075362_100926072 224
464 3300006178 Ga0075367_10041929 Ga0075367_100419292 224
465 3300006186 Ga0075369_10040562 Ga0075369_100405622 224
466 3300006195 Ga0075366_10108345 Ga0075366_101083452 224
467 3300006195 Ga0075366_10235297 Ga0075366_102352971 224
468 3300006237 Ga0097621_100257966 Ga0097621_1002579662 224
469 3300006353 Ga0075370_10234298 Ga0075370_102342982 224
470 3300006353 Ga0075370_10280621 Ga0075370_102806211 224
471 3300006353 Ga0075370_10436071 Ga0075370_104360711 224
472 3300006844 Ga0075428_100189179 Ga0075428_1001891792 224
473 3300006871 Ga0075434_100027921 Ga0075434_1000279213 224
474 3300006881 Ga0068865_100042431 Ga0068865_1000424311 224
475 3300006931 Ga0097620_100439959 Ga0097620_1004399591 224
476 3300006941 Ga0099825_1023491 Ga0099825_10234912 224
477 3300006941 Ga0099825_1027660 Ga0099825_10276601 224
478 3300006942 Ga0099824_1023526 Ga0099824_10235262 224
479 3300006942 Ga0099824_1025601 Ga0099824_10256013 224
480 3300006943 Ga0099822_1024641 Ga0099822_10246412 224
481 3300006944 Ga0099823_1036903 Ga0099823_10369034 224
482 3300007265 Ga0099794_10002976 Ga0099794_100029763 224
483 3300007265 Ga0099794_10007419 Ga0099794_100074192 224
484 3300007788 Ga0099795_10271064 Ga0099795_102710641 224
485 3300009093 Ga0105240_10013788 Ga0105240_100137885 224
486 3300009093 Ga0105240_10071470 Ga0105240_100714703 224
487 3300009093 Ga0105240_10083063 Ga0105240_100830633 224
488 3300009093 Ga0105240_10093352 Ga0105240_100933522 224
489 3300009093 Ga0105240_10336296 Ga0105240_103362962 224
490 3300009094 Ga0111539_10352323 Ga0111539_103523233 224
491 3300009098 Ga0105245_10084091 Ga0105245_100840912 224
492 3300009098 Ga0105245_11068879 Ga0105245_110688791 224
493 3300009101 Ga0105247_10264117 Ga0105247_102641172 224
494 3300009147 Ga0114129_10267821 Ga0114129_102678212 224
495 3300009148 Ga0105243_10297525 Ga0105243_102975251 224
496 3300009174 Ga0105241_10001008 Ga0105241_1000100811 224
497 3300009174 Ga0105241_10121468 Ga0105241_101214683 224
498 3300009176 Ga0105242_10919459 Ga0105242_109194591 224
499 3300009177 Ga0105248_10077301 Ga0105248_100773011 224
500 3300009177 Ga0105248_10557551 Ga0105248_105575511 224
501 3300009177 Ga0105248_11138035 Ga0105248_111380351 224
502 3300009545 Ga0105237_10015187 Ga0105237_100151876 224
503 3300009545 Ga0105237_10015820 Ga0105237_100158208 224
504 3300009545 Ga0105237_10285034 Ga0105237_102850342 224
505 3300009545 Ga0105237_10444601 Ga0105237_104446011 224
506 3300009545 Ga0105237_11183873 Ga0105237_111838731 224
507 3300009551 Ga0105238_10017578 Ga0105238_100175782 224
508 3300009551 Ga0105238_10046426 Ga0105238_100464263 224
509 3300009551 Ga0105238_10084272 Ga0105238_100842722 224
510 3300009551 Ga0105238_10087410 Ga0105238_100874102 224
511 3300009551 Ga0105238_10394335 Ga0105238_103943351 224
512 3300009553 Ga0105249_10108270 Ga0105249_101082701 224
513 3300010159 Ga0099796_10071308 Ga0099796_100713081 224
514 3300010375 Ga0105239_10062974 Ga0105239_100629742 224
515 3300010375 Ga0105239_10074658 Ga0105239_100746582 224
516 3300010375 Ga0105239_10089192 Ga0105239_100891923 224
517 3300010375 Ga0105239_10138632 Ga0105239_101386322 224
518 3300010375 Ga0105239_10248700 Ga0105239_102487003 224
519 3300012508 Ga0157315_1004111 Ga0157315_10041112 224
520 3300013104 Ga0157370_10045059 Ga0157370_100450595 224
521 3300013104 Ga0157370_10203539 Ga0157370_102035392 224
522 3300013105 Ga0157369_10005277 Ga0157369_1000527714 224
523 3300013105 Ga0157369_10007048 Ga0157369_100070488 224
524 3300013105 Ga0157369_10026918 Ga0157369_100269183 224
525 3300013105 Ga0157369_10397687 Ga0157369_103976872 224
526 3300013105 Ga0157369_10653850 Ga0157369_106538501 224
527 3300013296 Ga0157374_10433937 Ga0157374_104339372 224
528 3300013296 Ga0157374_10519993 Ga0157374_105199931 224
529 3300013297 Ga0157378_10759627 Ga0157378_107596272 224
530 3300013306 Ga0163162_10175716 Ga0163162_101757162 224
531 3300013307 Ga0157372_10141777 Ga0157372_101417772 224
532 3300013308 Ga0157375_10024362 Ga0157375_100243622 224
533 3300013308 Ga0157375_10033711 Ga0157375_100337115 224
534 3300013308 Ga0157375_10410164 Ga0157375_104101642 224
535 3300013308 Ga0157375_11678833 Ga0157375_116788331 224
536 3300014325 Ga0163163_10034881 Ga0163163_100348812 224
537 3300014326 Ga0157380_10356831 Ga0157380_103568312 224
538 3300014745 Ga0157377_10384178 Ga0157377_103841781 224
539 3300014969 Ga0157376_10043247 Ga0157376_100432472 224
540 3300017792 Ga0163161_10141459 Ga0163161_101414592 224
541 3300017792 Ga0163161_10157536 Ga0163161_101575362 224
542 3300017792 Ga0163161_10392669 Ga0163161_103926691 224
543 3300020080 Ga0206350_11050481 Ga0206350_110504812 224
544 3300020080 Ga0206350_11210336 Ga0206350_112103361 224
545 3300020610 Ga0154015_1433898 Ga0154015_14338981 224
546 3300021320 Ga0214544_1000136 Ga0214544_100013670 224
547 3300021321 Ga0214542_1000127 Ga0214542_100012770 224
548 3300021324 Ga0214545_1000063 Ga0214545_100006328 224
549 3300021327 Ga0214543_1000238 Ga0214543_100023850 224
550 3300021384 Ga0213876_10003778 Ga0213876_100037785 224
551 3300021384 Ga0213876_10017018 Ga0213876_100170182 224
552 3300021384 Ga0213876_10183977 Ga0213876_101839771 224
553 3300021388 Ga0213875_10104794 Ga0213875_101047942 224
554 3300021441 Ga0213871_10005533 Ga0213871_100055331 224
555 3300022467 Ga0224712_10089601 Ga0224712_100896011 224
556 3300022467 Ga0224712_10299251 Ga0224712_102992511 224
557 3300025230 Ga0209563_101314 Ga0209563_1013146 224
558 3300025253 Ga0209677_100344 Ga0209677_10034422 224
559 3300025253 Ga0209677_101591 Ga0209677_1015919 224
560 3300025254 Ga0209148_1000529 Ga0209148_100052930 224
561 3300025261 Ga0209233_1000933 Ga0209233_10009333 224
562 3300025261 Ga0209233_1017814 Ga0209233_10178143 224
563 3300025261 Ga0209233_1018846 Ga0209233_10188462 224
564 3300025261 Ga0209233_1042504 Ga0209233_10425042 224
565 3300025272 Ga0209455_1002494 Ga0209455_10024945 224
566 3300025273 Ga0209673_1040759 Ga0209673_10407592 224
567 3300025295 Ga0209564_1004806 Ga0209564_10048067 224
568 3300025295 Ga0209564_1018699 Ga0209564_10186994 224
569 3300025297 Ga0209758_1000011 Ga0209758_1000011836 224
570 3300025297 Ga0209758_1000455 Ga0209758_100045567 224
571 3300025297 Ga0209758_1001990 Ga0209758_100199017 224
572 3300025297 Ga0209758_1006185 Ga0209758_10061855 224
573 3300025297 Ga0209758_1012065 Ga0209758_10120653 224
574 3300025297 Ga0209758_1017504 Ga0209758_10175044 224
575 3300025299 Ga0209256_1033968 Ga0209256_10339681 224
576 3300025302 Ga0207426_1000480 Ga0207426_100048056 224
577 3300025302 Ga0207426_1000669 Ga0207426_100066934 224
578 3300025302 Ga0207426_1001491 Ga0207426_10014919 224
579 3300025302 Ga0207426_1015249 Ga0207426_10152492 224
580 3300025303 Ga0209051_1041116 Ga0209051_10411161 224
581 3300025304 Ga0209257_1001458 Ga0209257_100145823 224
582 3300025315 Ga0207697_10068080 Ga0207697_100680802 224
583 3300025321 Ga0207656_10021788 Ga0207656_100217882 224
584 3300025321 Ga0207656_10044531 Ga0207656_100445312 224
585 3300025885 Ga0207653_10125727 Ga0207653_101257272 224
586 3300025898 Ga0207692_10023106 Ga0207692_100231062 224
587 3300025898 Ga0207692_10073455 Ga0207692_100734552 224
588 3300025899 Ga0207642_10233509 Ga0207642_102335092 224
589 3300025900 Ga0207710_10363959 Ga0207710_103639591 224
590 3300025904 Ga0207647_10001884 Ga0207647_100018842 224
591 3300025904 Ga0207647_10004039 Ga0207647_1000403911 224
592 3300025905 Ga0207685_10001667 Ga0207685_100016671 224
593 3300025906 Ga0207699_10006106 Ga0207699_100061061 224
594 3300025906 Ga0207699_10035655 Ga0207699_100356552 224
595 3300025906 Ga0207699_10088526 Ga0207699_100885262 224
596 3300025906 Ga0207699_10104744 Ga0207699_101047442 224
597 3300025908 Ga0207643_10074402 Ga0207643_100744022 224
598 3300025909 Ga0207705_10061293 Ga0207705_100612931 224
599 3300025909 Ga0207705_10086384 Ga0207705_100863842 224
600 3300025909 Ga0207705_10338364 Ga0207705_103383641 224
601 3300025910 Ga0207684_10141154 Ga0207684_101411541 224
602 3300025911 Ga0207654_10004108 Ga0207654_100041088 224
603 3300025911 Ga0207654_10055191 Ga0207654_100551913 224
604 3300025911 Ga0207654_10078427 Ga0207654_100784272 224
605 3300025912 Ga0207707_10001006 Ga0207707_1000100621 224
606 3300025912 Ga0207707_10003605 Ga0207707_100036056 224
607 3300025912 Ga0207707_10017450 Ga0207707_100174503 224
608 3300025912 Ga0207707_10044046 Ga0207707_100440463 224
609 3300025913 Ga0207695_10000157 Ga0207695_10000157173 224
610 3300025913 Ga0207695_10001596 Ga0207695_1000159611 224
611 3300025913 Ga0207695_10046830 Ga0207695_100468302 224
612 3300025913 Ga0207695_10134161 Ga0207695_101341612 224
613 3300025913 Ga0207695_10626737 Ga0207695_106267371 224
614 3300025913 Ga0207695_10829160 Ga0207695_108291601 224
615 3300025914 Ga0207671_10050591 Ga0207671_100505913 224
616 3300025914 Ga0207671_10066557 Ga0207671_100665572 224
617 3300025915 Ga0207693_10014734 Ga0207693_100147345 224
618 3300025915 Ga0207693_10024253 Ga0207693_100242531 224
619 3300025915 Ga0207693_10093014 Ga0207693_100930141 224
620 3300025915 Ga0207693_10293714 Ga0207693_102937141 224
621 3300025915 Ga0207693_10461006 Ga0207693_104610061 224
622 3300025916 Ga0207663_10000211 Ga0207663_1000021120 224
623 3300025916 Ga0207663_10131532 Ga0207663_101315322 224
624 3300025916 Ga0207663_10212380 Ga0207663_102123803 224
625 3300025916 Ga0207663_10253479 Ga0207663_102534792 224
626 3300025916 Ga0207663_10450717 Ga0207663_104507172 224
627 3300025917 Ga0207660_10001786 Ga0207660_1000178614 224
628 3300025917 Ga0207660_10046067 Ga0207660_100460672 224
629 3300025917 Ga0207660_10660862 Ga0207660_106608621 224
630 3300025918 Ga0207662_10294182 Ga0207662_102941822 224
631 3300025919 Ga0207657_10017803 Ga0207657_100178035 224
632 3300025919 Ga0207657_10055233 Ga0207657_100552332 224
633 3300025920 Ga0207649_10056956 Ga0207649_100569561 224
634 3300025920 Ga0207649_10063665 Ga0207649_100636652 224
635 3300025920 Ga0207649_10138119 Ga0207649_101381192 224
636 3300025920 Ga0207649_10189582 Ga0207649_101895822 224
637 3300025921 Ga0207652_10002365 Ga0207652_1000236514 224
638 3300025921 Ga0207652_10014023 Ga0207652_100140232 224
639 3300025921 Ga0207652_10031387 Ga0207652_100313873 224
640 3300025921 Ga0207652_10202137 Ga0207652_102021372 224
641 3300025924 Ga0207694_10000757 Ga0207694_1000075722 224
642 3300025924 Ga0207694_10051570 Ga0207694_100515702 224
643 3300025924 Ga0207694_10127588 Ga0207694_101275882 224
644 3300025927 Ga0207687_10175949 Ga0207687_101759492 224
645 3300025928 Ga0207700_10012705 Ga0207700_100127055 224
646 3300025928 Ga0207700_10133770 Ga0207700_101337702 224
647 3300025928 Ga0207700_10604816 Ga0207700_106048161 224
648 3300025929 Ga0207664_10097594 Ga0207664_100975942 224
649 3300025929 Ga0207664_10154186 Ga0207664_101541862 224
650 3300025929 Ga0207664_10240314 Ga0207664_102403142 224
651 3300025929 Ga0207664_10530326 Ga0207664_105303261 224
652 3300025929 Ga0207664_10672775 Ga0207664_106727751 224
653 3300025929 Ga0207664_10718922 Ga0207664_107189221 224
654 3300025931 Ga0207644_10090576 Ga0207644_100905762 224
655 3300025932 Ga0207690_10429890 Ga0207690_104298902 224
656 3300025933 Ga0207706_10164599 Ga0207706_101645992 224
657 3300025937 Ga0207669_10031720 Ga0207669_100317203 224
658 3300025937 Ga0207669_10099677 Ga0207669_100996771 224
659 3300025939 Ga0207665_10029652 Ga0207665_100296523 224
660 3300025939 Ga0207665_10045152 Ga0207665_100451521 224
661 3300025939 Ga0207665_10098165 Ga0207665_100981652 224
662 3300025940 Ga0207691_10231613 Ga0207691_102316133 224
663 3300025941 Ga0207711_10050232 Ga0207711_100502321 224
664 3300025944 Ga0207661_10001813 Ga0207661_1000181313 224
665 3300025944 Ga0207661_10008843 Ga0207661_100088435 224
666 3300025949 Ga0207667_10013120 Ga0207667_100131203 224
667 3300025949 Ga0207667_10027313 Ga0207667_100273132 224
668 3300025949 Ga0207667_10062687 Ga0207667_100626873 224
669 3300025949 Ga0207667_10129200 Ga0207667_101292002 224
670 3300025949 Ga0207667_10430730 Ga0207667_104307301 224
671 3300025949 Ga0207667_10473635 Ga0207667_104736351 224
672 3300025949 Ga0207667_10554015 Ga0207667_105540151 224
673 3300025961 Ga0207712_10220597 Ga0207712_102205971 224
674 3300025972 Ga0207668_10110621 Ga0207668_101106213 224
675 3300025972 Ga0207668_10123928 Ga0207668_101239282 224
676 3300025972 Ga0207668_10151381 Ga0207668_101513812 224
677 3300025981 Ga0207640_10006211 Ga0207640_100062111 224
678 3300025981 Ga0207640_10078470 Ga0207640_100784702 224
679 3300025981 Ga0207640_10152952 Ga0207640_101529522 224
680 3300025981 Ga0207640_10383123 Ga0207640_103831231 224
681 3300025986 Ga0207658_10305054 Ga0207658_103050542 224
682 3300026023 Ga0207677_10139059 Ga0207677_101390592 224
683 3300026035 Ga0207703_10261584 Ga0207703_102615841 224
684 3300026035 Ga0207703_10727415 Ga0207703_107274152 224
685 3300026041 Ga0207639_10013907 Ga0207639_100139072 224
686 3300026041 Ga0207639_10016218 Ga0207639_100162186 224
687 3300026041 Ga0207639_10083636 Ga0207639_100836362 224
688 3300026041 Ga0207639_10133476 Ga0207639_101334762 224
689 3300026041 Ga0207639_10582971 Ga0207639_105829711 224
690 3300026067 Ga0207678_10070874 Ga0207678_100708742 224
691 3300026067 Ga0207678_10072576 Ga0207678_100725763 224
692 3300026067 Ga0207678_10221531 Ga0207678_102215311 224
693 3300026067 Ga0207678_10400012 Ga0207678_104000122 224
694 3300026067 Ga0207678_10452936 Ga0207678_104529362 224
695 3300026075 Ga0207708_10074639 Ga0207708_100746392 224
696 3300026075 Ga0207708_10267339 Ga0207708_102673392 224
697 3300026078 Ga0207702_10000003 Ga0207702_10000003334 224
698 3300026078 Ga0207702_10000744 Ga0207702_100007443 224
699 3300026078 Ga0207702_10138381 Ga0207702_101383812 224
700 3300026078 Ga0207702_10248579 Ga0207702_102485793 224
701 3300026088 Ga0207641_10212515 Ga0207641_102125152 224
702 3300026088 Ga0207641_10316844 Ga0207641_103168441 224
703 3300026089 Ga0207648_10095149 Ga0207648_100951491 224
704 3300026116 Ga0207674_10055685 Ga0207674_100556853 224
705 3300026116 Ga0207674_10065865 Ga0207674_100658653 224
706 3300026116 Ga0207674_10076930 Ga0207674_100769302 224
707 3300026116 Ga0207674_10077074 Ga0207674_100770742 224
708 3300026116 Ga0207674_10323603 Ga0207674_103236032 224
709 3300026116 Ga0207674_10826388 Ga0207674_108263881 224
710 3300026118 Ga0207675_100100246 Ga0207675_1001002462 224
711 3300026118 Ga0207675_100118791 Ga0207675_1001187911 224
712 3300026121 Ga0207683_10123427 Ga0207683_101234272 224
713 3300026142 Ga0207698_10039521 Ga0207698_100395212 224
714 3300026142 Ga0207698_11264693 Ga0207698_112646931 224
715 3300027296 Ga0209389_1000009 Ga0209389_100000972 224
716 3300027296 Ga0209389_1000088 Ga0209389_100008834 224
717 3300027357 Ga0209589_1000007 Ga0209589_1000007162 224
718 3300027357 Ga0209589_1000189 Ga0209589_100018924 224
719 3300027361 Ga0209489_100008 Ga0209489_100008162 224
720 3300027361 Ga0209489_100050 Ga0209489_10005053 224
721 3300027361 Ga0209489_100085 Ga0209489_10008573 224
722 3300027363 Ga0209700_100009 Ga0209700_100009162 224
723 3300027363 Ga0209700_100016 Ga0209700_100016161 224
724 3300027671 Ga0209588_1025767 Ga0209588_10257672 224
725 3300027671 Ga0209588_1133221 Ga0209588_11332211 224
726 3300027866 Ga0209813_10040615 Ga0209813_100406151 224
727 3300028379 Ga0268266_10050046 Ga0268266_100500462 224
728 3300028379 Ga0268266_10070563 Ga0268266_100705632 224
729 3300028380 Ga0268265_10099986 Ga0268265_100999862 224
730 3300028380 Ga0268265_10307339 Ga0268265_103073392 224
731 3300028380 Ga0268265_10406113 Ga0268265_104061131 224
732 3300028381 Ga0268264_10000038 Ga0268264_10000038317 224
733 3300028381 Ga0268264_10071583 Ga0268264_100715833 224
734 3300028381 Ga0268264_10505345 Ga0268264_105053452 224
735 3300028563 Ga0265319_1008276 Ga0265319_10082765 224
736 3300028666 Ga0265336_10002175 Ga0265336_100021752 224
737 3300028786 Ga0307517_10000512 Ga0307517_100005122 224
738 3300028786 Ga0307517_10201351 Ga0307517_102013511 224
739 3300028794 Ga0307515_10051295 Ga0307515_100512951 224
740 3300028794 Ga0307515_10081344 Ga0307515_100813444 224
741 3300028800 Ga0265338_10000116 Ga0265338_10000116118 224
742 3300029957 Ga0265324_10005816 Ga0265324_100058163 224
743 3300031239 Ga0265328_10155178 Ga0265328_101551781 224
744 3300031249 Ga0265339_10001103 Ga0265339_100011033 224
745 3300031249 Ga0265339_10012106 Ga0265339_100121062 224
746 3300031249 Ga0265339_10166699 Ga0265339_101666991 224
747 3300031507 Ga0307509_10165420 Ga0307509_101654202 224
748 3300031507 Ga0307509_10226909 Ga0307509_102269092 224
749 3300031507 Ga0307509_10424421 Ga0307509_104244212 224
750 3300031616 Ga0307508_10000008 Ga0307508_10000008111 224
751 3300031616 Ga0307508_10240708 Ga0307508_102407082 224
752 3300031616 Ga0307508_10285142 Ga0307508_102851421 224
753 3300031711 Ga0265314_10001759 Ga0265314_1000175910 224
754 3300031711 Ga0265314_10038466 Ga0265314_100384662 224
755 3300031711 Ga0265314_10087044 Ga0265314_100870442 224
756 3300031712 Ga0265342_10006885 Ga0265342_100068852 224
757 3300031712 Ga0265342_10309580 Ga0265342_103095801 224
758 3300031730 Ga0307516_10096696 Ga0307516_100966962 224
759 3300031901 Ga0307406_10646108 Ga0307406_106461081 224
760 3300032002 Ga0307416_100486582 Ga0307416_1004865822 224
761 3300033179 Ga0307507_10028768 Ga0307507_100287685 224
762 3300033180 Ga0307510_10016371 Ga0307510_100163718 224
763 3300033180 Ga0307510_10027712 Ga0307510_100277123 224
764 3300033180 Ga0307510_10052175 Ga0307510_100521756 224
765 3300033442 Ga0315911_1000004 Ga0315911_1000004371 224
766 3300034820 Ga0373959_0012593 Ga0373959_0012593_572_1246 224
767 3300035083 Ga0373926_0007233 Ga0373926_0007233_1818_2492 224
768 3300035086 Ga0373934_0166294 Ga0373934_0166294_40_714 224
769 3300035091 Ga0373951_0039839 Ga0373951_0039839_418_1095 224
770 3300035111 Ga0373923_0010246 Ga0373923_0010246_1776_2495 224
771 3300035111 Ga0373923_0012016 Ga0373923_0012016_1340_2014 224
772 3300035113 Ga0373936_0020563 Ga0373936_0020563_1670_2344 224
773 3300035116 Ga0373945_0003891 Ga0373945_0003891_3997_4671 224
774 3300035116 Ga0373945_0037545 Ga0373945_0037545_418_1092 224
775 3300035117 Ga0373953_0001272 Ga0373953_0001272_172_891 224
776 3300035118 Ga0373954_0000228 Ga0373954_0000228_13187_13906 224
777 3300035118 Ga0373954_0093189 Ga0373954_0093189_523_1197 224
778 3300035119 Ga0373956_0002043 Ga0373956_0002043_1091_1810 224
779 3300035120 Ga0373957_0000531 Ga0373957_0000531_1502_2221 224
780 3300035171 Ga0373946_0044385 Ga0373946_0044385_471_1145 224
781 3300035172 Ga0373955_0012568 Ga0373955_0012568_2070_2789 224
782 3300035692 Ga0373935_0026404 Ga0373935_0026404_780_1454 224
783 3300035692 Ga0373935_0049502 Ga0373935_0049502_1311_1985 224
784 3300035692 Ga0373935_0450491 Ga0373935_0450491_32_745 224
785 3300035695 Ga0373927_0009711 Ga0373927_0009711_5371_6045 224
786 3300035695 Ga0373927_0066330 Ga0373927_0066330_291_965 224
787 3300035695 Ga0373927_0091955 Ga0373927_0091955_832_1506 224
788 3300035695 Ga0373927_0093269 Ga0373927_0093269_921_1595 224
789 3300035695 Ga0373927_0237968 Ga0373927_0237968_307_981 224
790 3300035724 Ga0373933_0004420 Ga0373933_0004420_185_859 224
791 3300035724 Ga0373933_0051579 Ga0373933_0051579_1140_1859 224
792 3300035724 Ga0373933_0332859 Ga0373933_0332859_181_855 224
793 3300035725 Ga0373947_0132093 Ga0373947_0132093_595_1269 224
794 3300035725 Ga0373947_0298475 Ga0373947_0298475_173_847 224
795 3300036401 Ga0373937_0001379 Ga0373937_0001379_8245_8964 224
796 3300036401 Ga0373937_0052771 Ga0373937_0052771_1629_2303 224
797 3300036401 Ga0373937_0062906 Ga0373937_0062906_2145_2819 224
798 3300036401 Ga0373937_0725255 Ga0373937_0725255_197_871 224
799 3300036401 Ga0373937_0869521 Ga0373937_0869521_137_811 224
800 3300037068 Ga0373925_0067108 Ga0373925_0067108_1729_2403 224
801 3300037068 Ga0373925_0084095 Ga0373925_0084095_1635_2309 224
802 3300037068 Ga0373925_0097602 Ga0373925_0097602_1175_1849 224
803 3300037068 Ga0373925_0196909 Ga0373925_0196909_17_691 224
804 3300037312 Ga0395899_0271608 Ga0395899_0271608_312_986 224
805 3300037418 Ga0395900_0000134 Ga0395900_0000134_76623_77297 224
806 3300037418 Ga0395900_0014518 Ga0395900_0014518_4274_4948 224
807 3300037418 Ga0395900_0105300 Ga0395900_0105300_1938_2660 224
808 3300037418 Ga0395900_0443512 Ga0395900_0443512_68_742 224
809 3300037466 Ga0395898_0019042 Ga0395898_0019042_6204_6878 224
810 3300037466 Ga0395898_0027084 Ga0395898_0027084_1429_2151 224
811 3300037471 Ga0395905_0018896 Ga0395905_0018896_260_934 224
812 3300037471 Ga0395905_0040242 Ga0395905_0040242_716_1390 224
813 3300037471 Ga0395905_0175863 Ga0395905_0175863_168_881 224
814 3300037853 Ga0436364_0051166 Ga0436364_0051166_1240_1914 224
815 3300037853 Ga0436364_0475552 Ga0436364_0475552_1257_1931 224
816 3300037853 Ga0436364_0986822 Ga0436364_0986822_45_803 224
817 3300037853 Ga0436364_1075789 Ga0436364_1075789_46_720 224
818 3300038443 Ga0395901_0013321 Ga0395901_0013321_161_835 224
819 3300038443 Ga0395901_0102903 Ga0395901_0102903_1443_2165 224
820 3300039437 Ga0436365_0481444 Ga0436365_0481444_654_1328 224
821 3300039437 Ga0436365_0769976 Ga0436365_0769976_415_1089 224
822 3300039437 Ga0436365_1210825 Ga0436365_1210825_1980_2654 224
823 3300039447 Ga0436361_0317256 Ga0436361_0317256_586_1329 224
824 3300039447 Ga0436361_0346254 Ga0436361_0346254_56_730 224
825 3300039447 Ga0436361_0402388 Ga0436361_0402388_4607_5281 224
826 3300039450 Ga0436363_0861308 Ga0436363_0861308_254_928 224
827 3300039450 Ga0436363_1401795 Ga0436363_1401795_12762_13436 224
828 3300039453 Ga0436362_0084779 Ga0436362_0084779_1035_1709 224
829 3300039453 Ga0436362_0817857 Ga0436362_0817857_725_1408 224
830 3300041413 Ga0439465_0120252 Ga0439465_0120252_35_709 224
831 3300041452 Ga0451793_1559700 Ga0451793_1559700_158_832 224
832 3300041453 Ga0451797_0752526 Ga0451797_0752526_189_863 224
833 3300041494 Ga0451837_0571975 Ga0451837_0571975_407_1081 224
834 3300042005 Ga0439448_0076097 Ga0439448_0076097_100_774 224
835 3300042438 Ga0439459_0010174 Ga0439459_0010174_142_816 224
836 3300044656 Ga0466969_0193501 Ga0466969_0193501_193_876 224
837 3300044658 Ga0466972_0008710 Ga0466972_0008710_1142_1816 224
838 3300044658 Ga0466972_0018187 Ga0466972_0018187_999_1673 224
839 3300044683 Ga0466965_0029714 Ga0466965_0029714_455_1129 224
840 3300044684 Ga0466966_0448711 Ga0466966_0448711_55_729 224
841 3300044693 Ga0466961_0000060 Ga0466961_0000060_46664_47338 224
842 3300044694 Ga0466963_0223958 Ga0466963_0223958_10_684 224
843 3300044694 Ga0466963_0467975 Ga0466963_0467975_164_838 224
844 3300044719 Ga0466971_0231926 Ga0466971_0231926_95_769 224
845 3300044735 Ga0466968_0005390 Ga0466968_0005390_2105_2779 224
846 3300044735 Ga0466968_0040389 Ga0466968_0040389_881_1555 224
847 3300044901 Ga0466960_0009676 Ga0466960_0009676_3158_3832 224
848 3300045049 Ga0466959_0307627 Ga0466959_0307627_360_1034 224
849 3300045049 Ga0466959_0352048 Ga0466959_0352048_184_858 224
850 3300045976 Ga0466967_0034297 Ga0466967_0034297_1868_2542 224
851 3300045976 Ga0466967_0113396 Ga0466967_0113396_772_1446 224
852 3300045976 Ga0466967_0241307 Ga0466967_0241307_295_969 224
853 3300045976 Ga0466967_0286790 Ga0466967_0286790_746_1420 224
854 3300045976 Ga0466967_0454243 Ga0466967_0454243_420_1094 224
855 3300045976 Ga0466967_0531399 Ga0466967_0531399_100_774 224
856 3300046454 Ga0495592_0001209 Ga0495592_0001209_13767_14486 224
857 3300046455 Ga0495603_0053369 Ga0495603_0053369_161_835 224
858 3300046459 Ga0495629_0002443 Ga0495629_0002443_1343_2062 224
859 3300046459 Ga0495629_0061638 Ga0495629_0061638_613_1416 224
860 3300046459 Ga0495629_0304269 Ga0495629_0304269_356_1030 224
861 3300046459 Ga0495629_0386274 Ga0495629_0386274_116_790 224
862 3300046460 Ga0495638_0002824 Ga0495638_0002824_2158_2832 224
863 3300046460 Ga0495638_0016287 Ga0495638_0016287_3109_3783 224
864 3300046460 Ga0495638_0166082 Ga0495638_0166082_515_1189 224
865 3300046461 Ga0495641_0089348 Ga0495641_0089348_321_1079 224
866 3300046462 Ga0495651_0005605 Ga0495651_0005605_7328_8047 224
867 3300046462 Ga0495651_0008316 Ga0495651_0008316_2053_2727 224
868 3300046462 Ga0495651_0295336 Ga0495651_0295336_328_1002 224
869 3300046463 Ga0495653_0002888 Ga0495653_0002888_7001_7720 224
870 3300046463 Ga0495653_0176426 Ga0495653_0176426_767_1441 224
871 3300046471 Ga0495650_0058527 Ga0495650_0058527_18_692 224
872 3300046472 Ga0495580_0025402 Ga0495580_0025402_2438_3112 224
873 3300046473 Ga0495582_0068768 Ga0495582_0068768_1086_1760 224
874 3300046475 Ga0495639_0027392 Ga0495639_0027392_1712_2473 224
875 3300046475 Ga0495639_0124352 Ga0495639_0124352_394_1068 224
876 3300046476 Ga0495662_0049320 Ga0495662_0049320_1006_1680 224
877 3300046477 Ga0495664_0002664 Ga0495664_0002664_8558_9232 224
878 3300046477 Ga0495664_0025173 Ga0495664_0025173_2390_3064 224
879 3300046477 Ga0495664_0146779 Ga0495664_0146779_135_809 224
880 3300046477 Ga0495664_0435457 Ga0495664_0435457_86_772 224
881 3300046499 Ga0495594_0030401 Ga0495594_0030401_1062_1823 224
882 3300046499 Ga0495594_0233471 Ga0495594_0233471_342_1016 224
883 3300046500 Ga0495596_0044108 Ga0495596_0044108_454_1128 224
884 3300046501 Ga0495607_0171715 Ga0495607_0171715_135_809 224
885 3300046507 Ga0495606_0003208 Ga0495606_0003208_1717_2391 224
886 3300046507 Ga0495606_0076927 Ga0495606_0076927_172_930 224
887 3300046511 Ga0495608_0003566 Ga0495608_0003566_3431_4150 224
888 3300046513 Ga0495616_0043080 Ga0495616_0043080_958_1632 224
889 3300046514 Ga0495618_0058014 Ga0495618_0058014_1538_2212 224
890 3300046515 Ga0495620_0142108 Ga0495620_0142108_132_806 224
891 3300046516 Ga0495628_0012258 Ga0495628_0012258_959_1678 224
892 3300046516 Ga0495628_0181266 Ga0495628_0181266_679_1353 224
893 3300046517 Ga0495630_0015746 Ga0495630_0015746_124_798 224
894 3300046518 Ga0495631_0020454 Ga0495631_0020454_2382_3056 224
895 3300046518 Ga0495631_0156536 Ga0495631_0156536_275_949 224
896 3300046519 Ga0495632_0022490 Ga0495632_0022490_602_1276 224
897 3300046519 Ga0495632_0144262 Ga0495632_0144262_114_875 224
898 3300046522 Ga0495643_0022092 Ga0495643_0022092_1849_2538 224
899 3300046524 Ga0495648_0002556 Ga0495648_0002556_5880_6554 224
900 3300046524 Ga0495648_0004859 Ga0495648_0004859_4393_5067 224
901 3300046526 Ga0495666_0046587 Ga0495666_0046587_1266_1940 224
902 3300046529 Ga0495652_0007973 Ga0495652_0007973_3861_4580 224
903 3300046529 Ga0495652_0021828 Ga0495652_0021828_778_1581 224
904 3300046529 Ga0495652_0173623 Ga0495652_0173623_226_900 224
905 3300046529 Ga0495652_0277714 Ga0495652_0277714_271_990 224
906 3300046531 Ga0495665_0072181 Ga0495665_0072181_268_942 224
907 3300046531 Ga0495665_0163763 Ga0495665_0163763_278_952 224
908 3300046533 Ga0495640_0012896 Ga0495640_0012896_592_1311 224
909 3300046533 Ga0495640_0147258 Ga0495640_0147258_829_1503 224
910 3300046536 Ga0495587_0004873 Ga0495587_0004873_6300_6974 224
911 3300046536 Ga0495587_0031035 Ga0495587_0031035_2531_3205 224
912 3300046543 Ga0495645_0033526 Ga0495645_0033526_1521_2240 224
913 3300046557 Ga0495622_0004120 Ga0495622_0004120_5005_5808 224
914 3300046557 Ga0495622_0058842 Ga0495622_0058842_707_1465 224
915 3300046557 Ga0495622_0166193 Ga0495622_0166193_292_966 224
916 3300046559 Ga0495667_0009322 Ga0495667_0009322_74_793 224
917 3300046559 Ga0495667_0013615 Ga0495667_0013615_2915_3589 224
918 3300046615 Ga0495656_0030522 Ga0495656_0030522_1107_1781 224
919 3300046616 Ga0495668_0009486 Ga0495668_0009486_4826_5500 224
920 3300046616 Ga0495668_0103877 Ga0495668_0103877_144_818 224
921 3300046642 Ga0495634_0005394 Ga0495634_0005394_1526_2245 224
922 3300046642 Ga0495634_0116381 Ga0495634_0116381_87_890 224
923 3300046648 Ga0495611_0054941 Ga0495611_0054941_229_903 224
924 3300046648 Ga0495611_0132438 Ga0495611_0132438_324_1082 224
925 3300046663 Ga0495635_0003508 Ga0495635_0003508_3302_4021 224
926 3300046663 Ga0495635_0032590 Ga0495635_0032590_1722_2525 224
927 3300046663 Ga0495635_0176343 Ga0495635_0176343_83_757 224
928 3300046665 Ga0495661_0098331 Ga0495661_0098331_720_1394 224
929 3300046665 Ga0495661_0107686 Ga0495661_0107686_543_1217 224
930 3300046674 Ga0495588_0032165 Ga0495588_0032165_1336_2094 224
931 3300046674 Ga0495588_0037012 Ga0495588_0037012_1561_2235 224
932 3300046674 Ga0495588_0090187 Ga0495588_0090187_919_1593 224
933 3300046675 Ga0495657_0055464 Ga0495657_0055464_1344_2063 224
934 3300046675 Ga0495657_0091660 Ga0495657_0091660_522_1325 224
935 3300046678 Ga0495599_0002630 Ga0495599_0002630_4241_4960 224
936 3300046678 Ga0495599_0344558 Ga0495599_0344558_179_853 224
937 3300046679 Ga0495623_0002096 Ga0495623_0002096_6753_7472 224
938 3300046679 Ga0495623_0005614 Ga0495623_0005614_1281_1955 224
939 3300046680 Ga0495646_0031779 Ga0495646_0031779_1743_2417 224
940 3300046680 Ga0495646_0040339 Ga0495646_0040339_1658_2377 224
941 3300046681 Ga0495647_0040362 Ga0495647_0040362_134_808 224
942 3300046684 Ga0495669_0047383 Ga0495669_0047383_912_1625 224
943 3300046684 Ga0495669_0132142 Ga0495669_0132142_486_1160 224
944 3300046684 Ga0495669_0266536 Ga0495669_0266536_88_762 224
945 3300046689 Ga0495613_0005605 Ga0495613_0005605_1953_2672 224
946 3300046689 Ga0495613_0108585 Ga0495613_0108585_342_1145 224
947 3300046689 Ga0495613_0138635 Ga0495613_0138635_387_1061 224
948 3300046690 Ga0495624_0032311 Ga0495624_0032311_1523_2326 224
949 3300046690 Ga0495624_0039775 Ga0495624_0039775_1386_2060 224
950 3300046691 Ga0495670_0038100 Ga0495670_0038100_309_983 224
951 3300046692 Ga0495671_0027114 Ga0495671_0027114_158_919 224
952 3300046794 Ga0495589_0031998 Ga0495589_0031998_1575_2288 224
953 3300046794 Ga0495589_0093365 Ga0495589_0093365_16_690 224
954 3300046809 Ga0495600_0011959 Ga0495600_0011959_1271_1990 224
955 3300046809 Ga0495600_0030308 Ga0495600_0030308_68_742 224
956 3300046809 Ga0495600_0150591 Ga0495600_0150591_496_1299 224
957 3300047315 Ga0495581_0010414 Ga0495581_0010414_4241_4915 224
958 3300047315 Ga0495581_0062978 Ga0495581_0062978_599_1402 224
959 3300047317 Ga0495604_0020791 Ga0495604_0020791_3431_4150 224
960 3300047319 Ga0495674_0048444 Ga0495674_0048444_238_912 224
961 3300047319 Ga0495674_0147106 Ga0495674_0147106_270_989 224
962 3300047320 Ga0495672_0032579 Ga0495672_0032579_1724_2398 224
963 3300047320 Ga0495672_0051629 Ga0495672_0051629_1157_1831 224
964 3300047322 Ga0495680_0006958 Ga0495680_0006958_61_735 224
965 3300047322 Ga0495680_0032642 Ga0495680_0032642_3431_4150 224
966 3300047443 Ga0495687_046980 Ga0495687_046980_868_1557 224
967 3300047444 Ga0495675_0000826 Ga0495675_0000826_5987_6706 224
968 3300047445 Ga0495677_0096075 Ga0495677_0096075_375_1088 224
969 3300047469 Ga0495673_0038873 Ga0495673_0038873_704_1378 224
970 3300047469 Ga0495673_0040939 Ga0495673_0040939_1035_1709 224
971 3300047469 Ga0495673_0158155 Ga0495673_0158155_33_836 224
972 3300047471 Ga0495684_0000938 Ga0495684_0000938_8497_9216 224
973 3300047471 Ga0495684_0100786 Ga0495684_0100786_256_930 224
974 3300047471 Ga0495684_0588180 Ga0495684_0588180_49_723 224
975 3300047472 Ga0495686_0023445 Ga0495686_0023445_100_774 224
976 3300047472 Ga0495686_0081311 Ga0495686_0081311_1170_1844 224
977 3300047673 Ga0495593_0004740 Ga0495593_0004740_6136_6855 224
978 3300047673 Ga0495593_0026536 Ga0495593_0026536_241_915 224
979 3300048088 Ga0495602_0003873 Ga0495602_0003873_209_928 224
980 3300048088 Ga0495602_0059895 Ga0495602_0059895_1262_1936 224
981 3300048903 Ga0496100_0106470 Ga0496100_0106470_228_902 224
982 3300048903 Ga0496100_0279395 Ga0496100_0279395_25_699 224
983 3300048904 Ga0496101_0021482 Ga0496101_0021482_2054_2728 224
984 3300048904 Ga0496101_0122781 Ga0496101_0122781_129_842 224
985 3300048905 Ga0496102_0009611 Ga0496102_0009611_18_692 224
986 3300048905 Ga0496102_0027169 Ga0496102_0027169_331_1020 224
987 3300048905 Ga0496102_0173603 Ga0496102_0173603_808_1566 224
988 3300048905 Ga0496102_0412299 Ga0496102_0412299_555_1229 224
989 3300048905 Ga0496102_1121092 Ga0496102_1121092_14_688 224
990 3300048906 Ga0496103_0073533 Ga0496103_0073533_516_1190 224
991 3300048906 Ga0496103_0140982 Ga0496103_0140982_202_891 224
992 3300048906 Ga0496103_0376577 Ga0496103_0376577_115_828 224
993 3300048907 Ga0496104_0007514 Ga0496104_0007514_5917_6591 224
994 3300048907 Ga0496104_0009587 Ga0496104_0009587_1405_2079 224
995 3300048908 Ga0496105_0002708 Ga0496105_0002708_5558_6232 224
996 3300048908 Ga0496105_0085674 Ga0496105_0085674_1260_2063 224
997 3300048909 Ga0496106_0000634 Ga0496106_0000634_10145_10819 224
998 3300048909 Ga0496106_0001384 Ga0496106_0001384_15510_16184 224
999 3300048909 Ga0496106_0343633 Ga0496106_0343633_156_830 224
1000 3300048909 Ga0496106_0451585 Ga0496106_0451585_236_910 224
1001 3300048910 Ga0496107_0002095 Ga0496107_0002095_11494_12168 224
1002 3300048910 Ga0496107_0013782 Ga0496107_0013782_1719_2393 224
1003 3300048910 Ga0496107_0054133 Ga0496107_0054133_2017_2730 224
1004 3300048911 Ga0496108_0001003 Ga0496108_0001003_12817_13491 224
1005 3300048911 Ga0496108_0022639 Ga0496108_0022639_220_894 224
1006 3300048912 Ga0496109_0000166 Ga0496109_0000166_11022_11696 224
1007 3300048912 Ga0496109_0084838 Ga0496109_0084838_195_869 224
1008 3300048912 Ga0496109_0780746 Ga0496109_0780746_179_853 224
1009 3300048913 Ga0496110_0029261 Ga0496110_0029261_4049_4723 224
1010 3300048913 Ga0496110_0060588 Ga0496110_0060588_184_858 224
1011 3300048914 Ga0496111_0136560 Ga0496111_0136560_710_1384 224
1012 3300048914 Ga0496111_0368171 Ga0496111_0368171_169_843 224
1013 3300048914 Ga0496111_0452405 Ga0496111_0452405_125_799 224
1014 3300048915 Ga0496112_0000142 Ga0496112_0000142_30539_31213 224
1015 3300048915 Ga0496112_0000358 Ga0496112_0000358_1550_2224 224
1016 3300048915 Ga0496112_0018397 Ga0496112_0018397_4095_4769 224
1017 3300048915 Ga0496112_0044524 Ga0496112_0044524_2909_3622 224
1018 3300048915 Ga0496112_0426024 Ga0496112_0426024_418_1095 224
1019 3300048916 Ga0496113_0004839 Ga0496113_0004839_6470_7144 224
1020 3300048916 Ga0496113_0093035 Ga0496113_0093035_391_1068 224
1021 3300048917 Ga0496114_0006347 Ga0496114_0006347_5541_6215 224
1022 3300048917 Ga0496114_0601707 Ga0496114_0601707_36_749 224
1023 3300048918 Ga0496115_0034976 Ga0496115_0034976_2987_3661 224
1024 3300048918 Ga0496115_0077226 Ga0496115_0077226_97_771 224
1025 3300048918 Ga0496115_0161871 Ga0496115_0161871_191_865 224
1026 3300048918 Ga0496115_0773138 Ga0496115_0773138_15_689 224
1027 3300048919 Ga0496116_0001611 Ga0496116_0001611_22781_23455 224
1028 3300048919 Ga0496116_0073189 Ga0496116_0073189_671_1345 224
1029 3300048919 Ga0496116_0265906 Ga0496116_0265906_68_757 224
1030 3300048920 Ga0496117_0136641 Ga0496117_0136641_699_1373 224
1031 3300048920 Ga0496117_0164634 Ga0496117_0164634_266_940 224
1032 3300048920 Ga0496117_0256521 Ga0496117_0256521_139_813 224
1033 3300048921 Ga0496118_0008176 Ga0496118_0008176_8228_8902 224
1034 3300048921 Ga0496118_0024339 Ga0496118_0024339_3903_4577 224
1035 3300048921 Ga0496118_0161696 Ga0496118_0161696_579_1253 224
1036 3300048921 Ga0496118_0250727 Ga0496118_0250727_77_751 224
1037 3300048922 Ga0496119_0036025 Ga0496119_0036025_463_1266 224
1038 3300048922 Ga0496119_0105704 Ga0496119_0105704_759_1433 224
1039 3300048922 Ga0496119_0155884 Ga0496119_0155884_386_1060 224
1040 3300048922 Ga0496119_0165214 Ga0496119_0165214_287_961 224
1041 3300048923 Ga0496120_0060665 Ga0496120_0060665_779_1453 224
1042 3300048924 Ga0496121_0000365 Ga0496121_0000365_40011_40685 224
1043 3300048924 Ga0496121_0001250 Ga0496121_0001250_2395_3069 224
1044 3300048924 Ga0496121_0020850 Ga0496121_0020850_270_944 224
1045 3300048924 Ga0496121_0032052 Ga0496121_0032052_3319_4077 224
1046 3300048924 Ga0496121_0042595 Ga0496121_0042595_2984_3658 224
1047 3300048924 Ga0496121_0053980 Ga0496121_0053980_2485_3159 224
1048 3300048924 Ga0496121_0063730 Ga0496121_0063730_548_1222 224
1049 3300048924 Ga0496121_0070373 Ga0496121_0070373_2045_2719 224
1050 3300048924 Ga0496121_0091700 Ga0496121_0091700_1264_1977 224
1051 3300048924 Ga0496121_0105596 Ga0496121_0105596_598_1272 224
1052 3300048924 Ga0496121_0146386 Ga0496121_0146386_635_1309 224
1053 3300048924 Ga0496121_0189880 Ga0496121_0189880_278_952 224
1054 3300048924 Ga0496121_0241472 Ga0496121_0241472_40_798 224
1055 3300048924 Ga0496121_0270059 Ga0496121_0270059_390_1103 224
1056 3300048925 Ga0496122_0055591 Ga0496122_0055591_76_765 224
1057 3300048925 Ga0496122_0301695 Ga0496122_0301695_82_756 224
1058 3300048926 Ga0496123_0084809 Ga0496123_0084809_1187_1861 224
1059 3300048927 Ga0496124_0002671 Ga0496124_0002671_5849_6523 224
1060 3300048927 Ga0496124_0373380 Ga0496124_0373380_170_928 224
1061 3300048927 Ga0496124_0382654 Ga0496124_0382654_26_700 224
1062 3300048928 Ga0496125_0008303 Ga0496125_0008303_4768_5442 224
1063 3300048928 Ga0496125_0013887 Ga0496125_0013887_1118_1792 224
1064 3300048928 Ga0496125_0030378 Ga0496125_0030378_430_1104 224
1065 3300048928 Ga0496125_0039257 Ga0496125_0039257_1645_2319 224
1066 3300048928 Ga0496125_0096714 Ga0496125_0096714_723_1526 224
1067 3300048929 Ga0496126_0003397 Ga0496126_0003397_17125_17799 224
1068 3300048929 Ga0496126_0004058 Ga0496126_0004058_15158_15832 224
1069 3300048929 Ga0496126_0004467 Ga0496126_0004467_10576_11250 224
1070 3300048929 Ga0496126_0009177 Ga0496126_0009177_3732_4463 224
1071 3300048929 Ga0496126_0011808 Ga0496126_0011808_1579_2253 224
1072 3300048929 Ga0496126_0018439 Ga0496126_0018439_5056_5859 224
1073 3300048929 Ga0496126_0018516 Ga0496126_0018516_2585_3259 224
1074 3300048929 Ga0496126_0044443 Ga0496126_0044443_2029_2703 224
1075 3300048929 Ga0496126_0052156 Ga0496126_0052156_1782_2456 224
1076 3300048929 Ga0496126_0061909 Ga0496126_0061909_1989_2663 224
1077 3300048929 Ga0496126_0295827 Ga0496126_0295827_529_1203 224
1078 3300048929 Ga0496126_0325157 Ga0496126_0325157_71_745 224
1079 3300048929 Ga0496126_0372463 Ga0496126_0372463_152_826 224
1080 3300048929 Ga0496126_0443718 Ga0496126_0443718_270_944 224
1081 3300048929 Ga0496126_0517402 Ga0496126_0517402_173_847 224
1082 3300049460 Ga0495682_0081060 Ga0495682_0081060_91_894 224
1083 3300049569 Ga0501032_0026447 Ga0501032_0026447_1653_2327 224
1084 3300049569 Ga0501032_0268884 Ga0501032_0268884_266_940 224
1085 3300049572 Ga0501036_0085011 Ga0501036_0085011_127_801 224
1086 3300049572 Ga0501036_0147325 Ga0501036_0147325_1185_1859 224
1087 3300049575 Ga0501039_0327142 Ga0501039_0327142_115_789 224
1088 3300049579 Ga0501043_0029487 Ga0501043_0029487_2064_2738 224
1089 3300049580 Ga0501046_0014282 Ga0501046_0014282_915_1589 224
1090 3300049581 Ga0501047_0019249 Ga0501047_0019249_2394_3068 224
1091 3300049582 Ga0501048_0100848 Ga0501048_0100848_1227_1901 224
1092 3300049586 Ga0501070_0018349 Ga0501070_0018349_1236_1910 224
1093 3300049586 Ga0501070_0067287 Ga0501070_0067287_1725_2399 224
1094 3300049586 Ga0501070_0404570 Ga0501070_0404570_380_1054 224
1095 3300049586 Ga0501070_0467361 Ga0501070_0467361_275_949 224
1096 3300049588 Ga0501072_0716113 Ga0501072_0716113_83_757 224
1097 3300049589 Ga0501073_0148436 Ga0501073_0148436_72_746 224
1098 3300049741 Ga0501079_0394304 Ga0501079_0394304_94_768 224
1099 3300049742 Ga0501080_0097586 Ga0501080_0097586_1080_1754 224
1100 3300049822 Ga0501035_0051567 Ga0501035_0051567_2872_3546 224
1101 3300049823 Ga0501044_0009213 Ga0501044_0009213_5150_5824 224
1102 3300049823 Ga0501044_0026949 Ga0501044_0026949_1392_2066 224
1103 3300049823 Ga0501044_0425329 Ga0501044_0425329_62_736 224
1104 3300049824 Ga0501045_0373826 Ga0501045_0373826_257_931 224
1105 3300050489 nmdc:mga03683_14358_c1 nmdc:mga03683_14358_c1_28_702 224
1106 3300050489 nmdc:mga03683_193256_c1 nmdc:mga03683_193256_c1_113_802 224
1107 3300050491 nmdc:mga00v17_213852_c1 nmdc:mga00v17_213852_c1_304_978 224
1108 3300050491 nmdc:mga00v17_244451_c1 nmdc:mga00v17_244451_c1_416_1090 224
1109 3300050492 nmdc:mga0yw44_279822_c1 nmdc:mga0yw44_279822_c1_305_979 224
1110 3300050492 nmdc:mga0yw44_284003_c1 nmdc:mga0yw44_284003_c1_332_1021 224
1111 3300050492 nmdc:mga0yw44_35109_c1 nmdc:mga0yw44_35109_c1_1090_1764 224
1112 3300050492 nmdc:mga0yw44_57538_c1 nmdc:mga0yw44_57538_c1_1069_1743 224
1113 3300050492 nmdc:mga0yw44_68762_c1 nmdc:mga0yw44_68762_c1_460_1173 224
1114 3300050493 nmdc:mga0k408_9657_c1 nmdc:mga0k408_9657_c1_3182_3871 224
1115 3300050494 nmdc:mga06z11_51738_c1 nmdc:mga06z11_51738_c1_37_711 224
1116 3300050494 nmdc:mga06z11_9579_c1 nmdc:mga06z11_9579_c1_1059_1733 224
1117 3300050496 nmdc:mga07m45_19552_c1 nmdc:mga07m45_19552_c1_1131_1805 224
1118 3300050496 nmdc:mga07m45_24035_c2 nmdc:mga07m45_24035_c2_106_780 224
1119 3300050496 nmdc:mga07m45_34764_c1 nmdc:mga07m45_34764_c1_1263_1976 224
1120 3300050507 nmdc:mga05p37_381088_c1 nmdc:mga05p37_381088_c1_43_756 224
1121 3300050511 nmdc:mga08y16_226410_c1 nmdc:mga08y16_226410_c1_754_1428 224
1122 3300053077 Ga0495601_0028797 Ga0495601_0028797_1296_2015 224
1123 3300053077 Ga0495601_0084098 Ga0495601_0084098_1202_1876 224
1124 3300053077 Ga0495601_0121729 Ga0495601_0121729_437_1111 224
1125 3300053077 Ga0495601_0254211 Ga0495601_0254211_209_928 224
1126 3300053078 Ga0495612_0143077 Ga0495612_0143077_349_1023 224
1127 3300053079 Ga0500610_0281489 Ga0500610_0281489_37_711 224
1128 3300053080 Ga0500635_0103296 Ga0500635_0103296_150_824 224
1129 3300053080 Ga0500635_0175232 Ga0500635_0175232_25_783 224
1130 3300053084 Ga0495595_0001721 Ga0495595_0001721_6902_7621 224
1131 3300053084 Ga0495595_0242206 Ga0495595_0242206_104_778 224
1132 3300053084 Ga0495595_0249975 Ga0495595_0249975_170_844 224
1133 3300053085 Ga0495619_0002764 Ga0495619_0002764_7000_7719 224
1134 3300053085 Ga0495619_0026952 Ga0495619_0026952_1129_1803 224
1135 3300053085 Ga0495619_0027657 Ga0495619_0027657_2870_3544 224
1136 3300053085 Ga0495619_0246754 Ga0495619_0246754_312_986 224
1137 3300053087 Ga0500643_000042 Ga0500643_000042_46953_47627 224
1138 3300053087 Ga0500643_040787 Ga0500643_040787_351_1025 224
1139 3300053091 Ga0500647_0012259 Ga0500647_0012259_2763_3437 224
1140 3300053093 Ga0500651_0052451 Ga0500651_0052451_754_1428 224
1141 3300053094 Ga0500566_0000178 Ga0500566_0000178_7680_8354 224
1142 3300053094 Ga0500566_0003121 Ga0500566_0003121_4839_5513 224
1143 3300053094 Ga0500566_0004694 Ga0500566_0004694_2447_3121 224
1144 3300053094 Ga0500566_0016779 Ga0500566_0016779_2017_2691 224
1145 3300053095 Ga0500640_016747 Ga0500640_016747_260_934 224
1146 3300053096 Ga0500641_0004300 Ga0500641_0004300_338_1012 224
1147 3300053098 Ga0500650_0004206 Ga0500650_0004206_1178_1852 224
1148 3300053102 Ga0500554_008738 Ga0500554_008738_400_1074 224
1149 3300053103 Ga0500555_000735 Ga0500555_000735_5603_6277 224
1150 3300053104 Ga0500556_0000012 Ga0500556_0000012_85790_86464 224
1151 3300053104 Ga0500556_0052243 Ga0500556_0052243_710_1384 224
1152 3300053105 Ga0500557_000006 Ga0500557_000006_87762_88436 224
1153 3300053108 Ga0500562_075560 Ga0500562_075560_110_784 224
1154 3300053111 Ga0500572_000041 Ga0500572_000041_11440_12114 224
1155 3300053119 Ga0500595_002365 Ga0500595_002365_6922_7596 224
1156 3300053119 Ga0500595_005588 Ga0500595_005588_2089_2763 224
1157 3300053121 Ga0500607_016121 Ga0500607_016121_2608_3282 224
1158 3300053121 Ga0500607_057563 Ga0500607_057563_660_1334 224
1159 3300053122 Ga0500608_003394 Ga0500608_003394_4214_4888 224
1160 3300053123 Ga0500614_035057 Ga0500614_035057_157_831 224
1161 3300053125 Ga0500618_007537 Ga0500618_007537_1841_2515 224
1162 3300053125 Ga0500618_064543 Ga0500618_064543_14_688 224
1163 3300053130 Ga0500642_0000013 Ga0500642_0000013_160654_161328 224
1164 3300053130 Ga0500642_0000040 Ga0500642_0000040_42589_43263 224
1165 3300053131 Ga0500652_000186 Ga0500652_000186_15045_15719 224
1166 3300053134 Ga0500658_0154631 Ga0500658_0154631_340_1014 224
1167 3300053136 Ga0500559_0000597 Ga0500559_0000597_10667_11341 224
1168 3300053136 Ga0500559_0007742 Ga0500559_0007742_2653_3327 224
1169 3300053136 Ga0500559_0009057 Ga0500559_0009057_235_1038 224
1170 3300053136 Ga0500559_0036178 Ga0500559_0036178_1034_1708 224
1171 3300053139 Ga0500568_0005482 Ga0500568_0005482_692_1366 224
1172 3300053139 Ga0500568_0045042 Ga0500568_0045042_877_1551 224
1173 3300053139 Ga0500568_0051835 Ga0500568_0051835_283_957 224
1174 3300053139 Ga0500568_0129283 Ga0500568_0129283_191_865 224
1175 3300053145 Ga0500586_000482 Ga0500586_000482_3715_4389 224
1176 3300053148 Ga0500590_133876 Ga0500590_133876_428_1102 224
1177 3300053150 Ga0500603_000312 Ga0500603_000312_12017_12691 224
1178 3300053151 Ga0500604_0021776 Ga0500604_0021776_971_1645 224
1179 3300053151 Ga0500604_0167645 Ga0500604_0167645_38_712 224
1180 3300053153 Ga0500616_0000035 Ga0500616_0000035_307952_308626 224
1181 3300053153 Ga0500616_0052615 Ga0500616_0052615_479_1153 224
1182 3300053154 Ga0500619_070986 Ga0500619_070986_148_822 224
1183 3300053156 Ga0500622_0019026 Ga0500622_0019026_2695_3369 224
1184 3300053157 Ga0500624_012678 Ga0500624_012678_72_746 224
1185 3300053158 Ga0500627_0186092 Ga0500627_0186092_235_909 224
1186 3300053159 Ga0500630_000840 Ga0500630_000840_11283_11957 224
1187 3300053160 Ga0500633_0065278 Ga0500633_0065278_242_916 224
1188 3300053161 Ga0500634_0040350 Ga0500634_0040350_1295_1969 224
1189 3300053162 Ga0500638_001490 Ga0500638_001490_1373_2047 224
1190 3300053163 Ga0500639_000029 Ga0500639_000029_10533_11207 224
1191 3300053163 Ga0500639_052625 Ga0500639_052625_1264_1938 224
1192 3300053177 Ga0500636_0000105 Ga0500636_0000105_17005_17679 224
1193 3300053177 Ga0500636_0011341 Ga0500636_0011341_223_897 224
1194 3300053177 Ga0500636_0077175 Ga0500636_0077175_1119_1793 224
1195 3300053177 Ga0500636_0085694 Ga0500636_0085694_297_983 224
1196 3300053178 Ga0500637_0000215 Ga0500637_0000215_13451_14125 224
1197 3300053178 Ga0500637_0124232 Ga0500637_0124232_690_1364 224
1198 3300053725 Ga0500576_091957 Ga0500576_091957_138_812 224
1199 3300053727 Ga0500611_041918 Ga0500611_041918_296_970 224
1200 3300053729 Ga0500625_022414 Ga0500625_022414_1743_2417 224
1201 3300053730 Ga0500645_004319 Ga0500645_004319_3963_4637 224
1202 3300053732 Ga0500656_028492 Ga0500656_028492_34_708 224
1203 3300053733 Ga0500552_006729 Ga0500552_006729_557_1231 224
1204 3300053735 Ga0500596_019804 Ga0500596_019804_106_780 224
1205 3300053737 Ga0500601_000611 Ga0500601_000611_2407_3081 224
1206 3300055283 Ga0500661_002447 Ga0500661_002447_1974_2648 224
1207 iso_pu_bacteria 2513237098 2513677747 224
1208 iso_pu_bacteria 2903768456 2903774292 224
1209 iso_pu_bacteria 2932818245 2932827386 224
1210 iso_pu_bacteria 2935760218 2935767468 224
1211 iso_pu_bacteria 2935810662 2935815641 224
1212 iso_pu_bacteria 2935908558 2935912811 224
1213 iso_pu_bacteria 2935916978 2935922870 224
1214 iso_pu_bacteria 2935926038 2935930295 224
1215 iso_pu_bacteria 2935934488 2935939195 224
1216 iso_pu_bacteria 2935942939 2935946143 224
1217 iso_pu_bacteria 2935951376 2935955480 224
1218 iso_pu_bacteria 2935967501 2935972149 224
1219 iso_pu_bacteria 2936037263 2936040879 224
1220 iso_pu_bacteria 8019586578 8019592783 224
1221 iso_pu_bacteria 8019687851 8019692174 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

15

229

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.9119 5 224
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.9069 5 222
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.9053 5 224
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.9039 5 224
1zix-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a 0.9037 5 224
ID Description Score Start End Superfamily
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9235 2 223 3.40.50.1820
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9115 2 223 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8926 3 219 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8733 5 224 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8672 1 223 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A560JHM9-F1-model_v4 Carboxymethylenebutenolidase 0.9997 1 224 GO:0016787
AF-A0A0S6UY21-F1-model_v4 Usf protein 0.9994 1 224 GO:0016787
AF-A0A4Q5PXA9-F1-model_v4 Dienelactone hydrolase family protein 0.9981 1 224 GO:0016787
AF-A0A560JHM9-F1-model_v4 Carboxymethylenebutenolidase 0.9953 1 224 GO:0016787
AF-A0A0S6UY21-F1-model_v4 Usf protein 0.995 1 224 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.95 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map