F491815

General Info

Members Datasets Scaffolds Average Seq Length
1217 495 1190 412

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_95527_c1|nmdc:mga0rr50_95527_c1_893_2299
Length 468
Sequence LTAEGIVTCSEWRLTRMSRRRSHRFPTDMLQRKTEPECYAAPSRGSSGTEALRMADGREQNPERVDRVEVLIAGAGFAGLALAXXXRQALGHAFAVAVVDPVLGRPVADARASAIAAAARRMFEALGVWDAVAPRAEPILDMVITDSKLGDAVRPAFLTFAGEVEEGEPFAHMVENGDVLAALSAAAQREGVALIADAVTDFSADSRKVTARLKSGAAIEAKLLVAADGARSAIRERAGIATVGWPYGQSAIVTTVAHERPHHGRAEEHFLPAGPFAILPLPENRSSIVWTESAAEAERIMALPDADFHAELEQRFGLHLGEIAVAGPRRAFSLGFAVARSFVAERLALVGDAAHAIHPIAGQGLNMGLRDVAALAEAIVDAARLGLDPGGATVLNRYQRWRRFDTMAMGLATDGLNRLFSNRSDVLRLARDLGLGLVERMPGLKRLFIREAAGLTGEVPKLLRGEAL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
8 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
9 2643221651 Afipia sp. Root123D2 Isolate Unclassified
10 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
11 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
12 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
13 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
14 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
15 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
16 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
17 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
18 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
19 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
20 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
21 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
22 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
23 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
24 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
25 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
26 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
27 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
28 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
29 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
30 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
31 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
32 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
38 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
39 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
40 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
41 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
42 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
43 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
44 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
45 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
84 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
85 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
86 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
136 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
137 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
141 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
142 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
147 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
159 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
163 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
179 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
180 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
181 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
183 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
258 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
259 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
260 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
269 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
270 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
271 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
272 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
273 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
274 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
279 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
280 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
281 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
282 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
283 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
284 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
285 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
286 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
287 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
288 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
289 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
290 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
308 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
311 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
315 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
316 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
317 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
318 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
319 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
320 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
321 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
322 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
323 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
324 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
327 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
330 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
331 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
332 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
348 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
349 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
350 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
351 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
357 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
358 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
359 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
360 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
361 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
366 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
369 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
381 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
382 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
383 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
389 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
390 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
394 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
395 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
396 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
397 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
398 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
399 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
444 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
445 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
446 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
447 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
448 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
449 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
450 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
451 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
452 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
453 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
454 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
455 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
460 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
461 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
462 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
466 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
477 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
478 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
479 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
480 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
481 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
482 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
483 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
484 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
485 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
486 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
487 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
488 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
489 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
490 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
493 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
494 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
495 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.16
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0.08
Rhizoplane 8.63
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772987 2209111006 Bacteria 12126
2 ARSoilYngRDRAFT_c00005 3300000042 Bacteria 35497
3 ARcpr5yngRDRAFT_c000005 3300000043 Bacteria 45740
4 ARCol0oldRDRAFT_c00605 3300000045 Bacteria 3172
5 ARCol0yngRDRAFT_1000007 3300000652 Bacteria 46089
6 JGI24736J21556_1001465 3300001904 Bacteria 4327
7 JGI24741J21665_1000079 3300001915 Bacteria 24144
8 JGI24746J21847_1000626 3300001977 Bacteria 5404
9 JGI24740J21852_10003959 3300001979 Bacteria 6428
10 JGI24740J21852_10007775 3300001979 Bacteria 4329
11 JGI24739J22299_10000027 3300001989 Bacteria 42306
12 JGI24739J22299_10000379 3300001989 Bacteria 15355
13 JGI24737J22298_10000240 3300001990 Bacteria 18284
14 JGI24737J22298_10001802 3300001990 Bacteria 7672
15 JGI24735J21928_10000880 3300002067 Bacteria 10738
16 JGI24735J21928_10014573 3300002067 Bacteria 2461
17 JGI24750J21931_1000045 3300002070 Bacteria 16505
18 JGI24745J21846_1000029 3300002073 Bacteria 9373
19 JGI24738J21930_10001349 3300002075 Bacteria 6810
20 JGI24738J21930_10003527 3300002075 Bacteria 3937
21 JGI24749J21850_1000664 3300002076 Bacteria 4992
22 JGI24035J26624_1000187 3300002126 Bacteria 5724
23 JGI24034J26672_10000122 3300002239 Bacteria 11943
24 JGI24742J22300_10001443 3300002244 Bacteria 3743
25 JGI24751J29686_10005219 3300002459 Bacteria 2643
26 Ga0006562J51391_1067863 3300003578 Bacteria 10050
27 Ga0055536_1002707 3300003781 Bacteria 9833
28 Ga0065716_1000007 3300005277 Bacteria 8171
29 Ga0065704_10134305 3300005289 Bacteria 1583
30 Ga0065712_10001604 3300005290 Bacteria 8865
31 Ga0065712_10003002 3300005290 Bacteria 9868
32 Ga0065712_10078142 3300005290 Bacteria 3388
33 Ga0065715_10000898 3300005293 Bacteria 17267
34 Ga0065715_10088997 3300005293 Bacteria 17726
35 Ga0070658_10019947 3300005327 Bacteria 5370
36 Ga0070658_10045121 3300005327 Bacteria 3563
37 Ga0070676_10000146 3300005328 Bacteria 27770
38 Ga0070683_100000116 3300005329 Bacteria 51956
39 Ga0070683_100040594 3300005329 Bacteria 4280
40 Ga0070690_100015659 3300005330 Bacteria 4529
41 Ga0070690_100015826 3300005330 Bacteria 4506
42 Ga0070690_100017738 3300005330 Bacteria 4288
43 Ga0070690_100023017 3300005330 Bacteria 3816
44 Ga0070690_100146333 3300005330 Bacteria 1608
45 Ga0070670_100013395 3300005331 Bacteria 7024
46 Ga0070677_10000151 3300005333 Bacteria 23336
47 Ga0068869_100000013 3300005334 Bacteria 73970
48 Ga0070666_10023846 3300005335 Bacteria 3983
49 Ga0070666_10041339 3300005335 Bacteria 3080
50 Ga0070680_100005855 3300005336 Bacteria 9327
51 Ga0070680_100018386 3300005336 Bacteria 5521
52 Ga0070680_100021486 3300005336 Bacteria 5130
53 Ga0070680_100023840 3300005336 Bacteria 4884
54 Ga0070680_100084167 3300005336 Bacteria 2627
55 Ga0070682_100002742 3300005337 Bacteria 9757
56 Ga0070682_100022863 3300005337 Bacteria 3708
57 Ga0070682_100038543 3300005337 Bacteria 2931
58 Ga0068868_100002546 3300005338 Bacteria 12666
59 Ga0068868_100125794 3300005338 Bacteria 2094
60 Ga0070660_100005178 3300005339 Bacteria 9017
61 Ga0070660_100009730 3300005339 Bacteria 6776
62 Ga0070689_100001113 3300005340 Bacteria 16894
63 Ga0070689_100145685 3300005340 Bacteria 1907
64 Ga0070691_10059130 3300005341 Bacteria 1841
65 Ga0070687_100003954 3300005343 Bacteria 5839
66 Ga0070687_100004416 3300005343 Bacteria 5605
67 Ga0070687_100007702 3300005343 Bacteria 4511
68 Ga0070661_100000228 3300005344 Bacteria 46622
69 Ga0070661_100065128 3300005344 Bacteria 2678
70 Ga0070692_10001025 3300005345 Bacteria 9626
71 Ga0070692_10022160 3300005345 Bacteria 3101
72 Ga0070668_100077535 3300005347 Bacteria 2598
73 Ga0070668_100161410 3300005347 Bacteria 1819
74 Ga0070668_100218410 3300005347 Bacteria 1571
75 Ga0070669_100000368 3300005353 Bacteria 34899
76 Ga0070669_100059546 3300005353 Bacteria 2804
77 Ga0070669_100165881 3300005353 Bacteria 1719
78 Ga0070669_100190929 3300005353 Bacteria 1607
79 Ga0070675_100000752 3300005354 Bacteria 22581
80 Ga0070675_100018009 3300005354 Bacteria 5622
81 Ga0070675_100083141 3300005354 Bacteria 2672
82 Ga0070671_100000142 3300005355 Bacteria 46386
83 Ga0070671_100001856 3300005355 Bacteria 16117
84 Ga0070671_100007494 3300005355 Bacteria 8722
85 Ga0070671_100010831 3300005355 Bacteria 7316
86 Ga0070671_100050533 3300005355 Bacteria 3458
87 Ga0070674_100001056 3300005356 Bacteria 14403
88 Ga0070674_100026532 3300005356 Bacteria 3786
89 Ga0070673_100000045 3300005364 Bacteria 50756
90 Ga0070673_100038893 3300005364 Bacteria 3637
91 Ga0070673_100071329 3300005364 Bacteria 2791
92 Ga0070688_100005939 3300005365 Bacteria 6468
93 Ga0070688_100028550 3300005365 Bacteria 3332
94 Ga0070659_100000183 3300005366 Bacteria 47789
95 Ga0070667_100013162 3300005367 Bacteria 6838
96 Ga0070667_100029214 3300005367 Bacteria 4593
97 Ga0070667_100205749 3300005367 Bacteria 1748
98 Ga0070667_100309758 3300005367 Bacteria 1423
99 Ga0070703_10001614 3300005406 Bacteria 6702
100 Ga0070714_100003288 3300005435 Bacteria 12043
101 Ga0070714_100078156 3300005435 Bacteria 2875
102 Ga0070714_100092438 3300005435 Bacteria 2652
103 Ga0070713_100030794 3300005436 Bacteria 4266
104 Ga0070713_100105678 3300005436 Bacteria 2446
105 Ga0070713_100117010 3300005436 Bacteria 2332
106 Ga0070710_10009606 3300005437 Bacteria 4737
107 Ga0070710_10031023 3300005437 Bacteria 2880
108 Ga0070701_10009585 3300005438 Bacteria 4247
109 Ga0070711_100028231 3300005439 Bacteria 3691
110 Ga0070711_100166329 3300005439 Bacteria 1677
111 Ga0070705_100060076 3300005440 Bacteria 2253
112 Ga0070700_100041846 3300005441 Bacteria 2810
113 Ga0070694_100026598 3300005444 Bacteria 3751
114 Ga0070694_100114519 3300005444 Bacteria 1926
115 Ga0070708_100131067 3300005445 Bacteria 2320
116 Ga0070663_100001069 3300005455 Bacteria 14988
117 Ga0070663_100037221 3300005455 Bacteria 3386
118 Ga0070663_100086303 3300005455 Bacteria 2317
119 Ga0070678_100001753 3300005456 Bacteria 11676
120 Ga0070678_100031601 3300005456 Bacteria 3655
121 Ga0070662_100042252 3300005457 Bacteria 3256
122 Ga0070662_100063974 3300005457 Bacteria 2692
123 Ga0070681_10009946 3300005458 Bacteria 9373
124 Ga0070681_10014427 3300005458 Bacteria 7864
125 Ga0070681_10041751 3300005458 Bacteria 4598
126 Ga0070681_10043818 3300005458 Bacteria 4479
127 Ga0068867_100000160 3300005459 Bacteria 43656
128 Ga0068867_100019113 3300005459 Bacteria 4879
129 Ga0070685_10008870 3300005466 Bacteria 5185
130 Ga0070685_10114232 3300005466 Bacteria 1668
131 Ga0070706_100221789 3300005467 Bacteria 1765
132 Ga0070699_100123881 3300005518 Bacteria 2274
133 Ga0070679_100006152 3300005530 Bacteria 11169
134 Ga0070679_100020075 3300005530 Bacteria 6512
135 Ga0070679_100040234 3300005530 Bacteria 4650
136 Ga0070679_100045419 3300005530 Bacteria 4377
137 Ga0070679_100062201 3300005530 Bacteria 3721
138 Ga0070679_100076376 3300005530 Bacteria 3340
139 Ga0070679_100128935 3300005530 Bacteria 2511
140 Ga0070684_100000352 3300005535 Bacteria 31642
141 Ga0070684_100070008 3300005535 Bacteria 3086
142 Ga0070684_100079467 3300005535 Bacteria 2899
143 Ga0070697_100036459 3300005536 Bacteria 3973
144 Ga0068853_100003900 3300005539 Bacteria 11434
145 Ga0068853_100006249 3300005539 Bacteria 9441
146 Ga0068853_100044038 3300005539 Bacteria 3820
147 Ga0068853_100178455 3300005539 Bacteria 1925
148 Ga0070672_100000016 3300005543 Bacteria 71848
149 Ga0070672_100014289 3300005543 Bacteria 5624
150 Ga0070672_100078359 3300005543 Bacteria 2644
151 Ga0070672_100085665 3300005543 Bacteria 2533
152 Ga0070686_100001103 3300005544 Bacteria 15541
153 Ga0070695_100002919 3300005545 Bacteria 9946
154 Ga0070695_100003518 3300005545 Bacteria 9150
155 Ga0070695_100012328 3300005545 Bacteria 5125
156 Ga0070695_100068989 3300005545 Bacteria 2310
157 Ga0070696_100030786 3300005546 Bacteria 3675
158 Ga0070665_100077477 3300005548 Bacteria 3331
159 Ga0070665_100090650 3300005548 Bacteria 3063
160 Ga0070704_100001007 3300005549 Bacteria 14414
161 Ga0070704_100036603 3300005549 Bacteria 3346
162 Ga0068855_100010817 3300005563 Bacteria 11018
163 Ga0068855_100042726 3300005563 Bacteria 5371
164 Ga0068855_100055219 3300005563 Bacteria 4666
165 Ga0068855_100055244 3300005563 Bacteria 4665
166 Ga0068855_100384727 3300005563 Bacteria 1540
167 Ga0070664_100000067 3300005564 Bacteria 65201
168 Ga0068857_100003846 3300005577 Bacteria 12629
169 Ga0068857_100017914 3300005577 Bacteria 6211
170 Ga0068857_100037829 3300005577 Bacteria 4275
171 Ga0068854_100000131 3300005578 Bacteria 51521
172 Ga0068854_100016650 3300005578 Bacteria 4905
173 Ga0068854_100018065 3300005578 Bacteria 4728
174 Ga0068854_100022998 3300005578 Bacteria 4253
175 Ga0068854_100114930 3300005578 Bacteria 2035
176 Ga0068856_100015929 3300005614 Bacteria 7268
177 Ga0068856_100020679 3300005614 Bacteria 6394
178 Ga0068856_100024647 3300005614 Bacteria 5857
179 Ga0068856_100057977 3300005614 Bacteria 3824
180 Ga0070702_100000810 3300005615 Bacteria 11975
181 Ga0070702_100008194 3300005615 Bacteria 5047
182 Ga0068852_100082220 3300005616 Bacteria 2861
183 Ga0068852_100282240 3300005616 Bacteria 1601
184 Ga0068859_100015494 3300005617 Bacteria 7660
185 Ga0068859_100025009 3300005617 Bacteria 5993
186 Ga0068859_100327190 3300005617 Bacteria 1627
187 Ga0068864_100001095 3300005618 Bacteria 22704
188 Ga0068864_100047681 3300005618 Bacteria 3681
189 Ga0068864_100115096 3300005618 Bacteria 2398
190 Ga0068866_10002457 3300005718 Bacteria 7644
191 Ga0068861_100000241 3300005719 Bacteria 30096
192 Ga0068861_100024500 3300005719 Bacteria 4365
193 Ga0068861_100084806 3300005719 Bacteria 2487
194 Ga0068861_100204099 3300005719 Bacteria 1661
195 Ga0068851_10002682 3300005834 Bacteria 7840
196 Ga0068870_10000110 3300005840 Bacteria 27850
197 Ga0068870_10131406 3300005840 Bacteria 1455
198 Ga0068863_100004900 3300005841 Bacteria 13190
199 Ga0068863_100019233 3300005841 Bacteria 6535
200 Ga0068858_100022418 3300005842 Bacteria 5894
201 Ga0068858_100039621 3300005842 Bacteria 4369
202 Ga0068858_100042243 3300005842 Bacteria 4227
203 Ga0068858_100042547 3300005842 Bacteria 4212
204 Ga0068858_100079228 3300005842 Bacteria 3053
205 Ga0068858_100121676 3300005842 Bacteria 2441
206 Ga0068860_100001050 3300005843 Bacteria 30441
207 Ga0068860_100373840 3300005843 Bacteria 1406
208 Ga0068862_100023587 3300005844 Bacteria 5156
209 Ga0068862_100024602 3300005844 Bacteria 5054
210 Ga0068862_100037899 3300005844 Bacteria 4087
211 Ga0068862_100191564 3300005844 Bacteria 1840
212 Ga0081455_10000002 3300005937 Bacteria 460472
213 Ga0081540_1001046 3300005983 Bacteria 24692
214 Ga0081540_1014999 3300005983 Bacteria 4924
215 Ga0081540_1020079 3300005983 Bacteria 4032
216 Ga0081539_10012546 3300005985 Bacteria 6513
217 Ga0070717_10044309 3300006028 Bacteria 3632
218 Ga0070717_10145022 3300006028 Bacteria 2050
219 Ga0075365_10021515 3300006038 Bacteria 4025
220 Ga0075365_10100994 3300006038 Bacteria 1975
221 Ga0075365_10130557 3300006038 Bacteria 1738
222 Ga0075368_10000081 3300006042 Bacteria 23248
223 Ga0075368_10021543 3300006042 Bacteria 2449
224 Ga0075368_10041013 3300006042 Bacteria 1818
225 Ga0075363_100072497 3300006048 Bacteria 1873
226 Ga0075363_100108057 3300006048 Bacteria 1544
227 Ga0075364_10052321 3300006051 Bacteria 2668
228 Ga0070712_100004886 3300006175 Bacteria 8290
229 Ga0070712_100079757 3300006175 Bacteria 2367
230 Ga0075367_10001178 3300006178 Bacteria 10965
231 Ga0075367_10010807 3300006178 Bacteria 4809
232 Ga0075367_10018295 3300006178 Bacteria 3864
233 Ga0075369_10028880 3300006186 Bacteria 2327
234 Ga0097621_100012044 3300006237 Bacteria 6400
235 Ga0097621_100020748 3300006237 Bacteria 5068
236 Ga0097621_100022669 3300006237 Bacteria 4877
237 Ga0097621_100030501 3300006237 Bacteria 4269
238 Ga0075370_10038028 3300006353 Bacteria 2708
239 Ga0075370_10089375 3300006353 Bacteria 1776
240 Ga0068871_100016774 3300006358 Bacteria 5527
241 Ga0068871_100028631 3300006358 Bacteria 4369
242 Ga0068871_100039933 3300006358 Bacteria 3757
243 Ga0075430_100006643 3300006846 Bacteria 9750
244 Ga0075431_100125075 3300006847 Bacteria 2653
245 Ga0075433_10001079 3300006852 Bacteria 19637
246 Ga0075433_10351223 3300006852 Bacteria 1303
247 Ga0075434_100013980 3300006871 Bacteria 7660
248 Ga0075434_100019228 3300006871 Bacteria 6608
249 Ga0075434_100038177 3300006871 Bacteria 4757
250 Ga0075434_100073207 3300006871 Bacteria 3419
251 Ga0075434_100167178 3300006871 Bacteria 2219
252 Ga0075434_100451529 3300006871 Bacteria 1307
253 Ga0075429_100121304 3300006880 Bacteria 2285
254 Ga0068865_100000209 3300006881 Bacteria 32559
255 Ga0068865_100025070 3300006881 Bacteria 3919
256 Ga0068865_100079228 3300006881 Bacteria 2352
257 Ga0075436_100004004 3300006914 Bacteria 10108
258 Ga0075436_100185210 3300006914 Bacteria 1472
259 Ga0097620_100015494 3300006931 Bacteria 7660
260 Ga0097620_100025009 3300006931 Bacteria 5993
261 Ga0097620_100327185 3300006931 Bacteria 1627
262 Ga0075435_100056907 3300007076 Bacteria 3162
263 Ga0105251_10025625 3300009011 Bacteria 3013
264 Ga0105240_10013995 3300009093 Bacteria 10978
265 Ga0105240_10036311 3300009093 Bacteria 6342
266 Ga0105240_10181196 3300009093 Bacteria 2486
267 Ga0105240_10430801 3300009093 Bacteria 1480
268 Ga0111539_10000941 3300009094 Bacteria 38137
269 Ga0111539_10001081 3300009094 Bacteria 36017
270 Ga0111539_10084487 3300009094 Bacteria 3732
271 Ga0111539_10089724 3300009094 Bacteria 3612
272 Ga0111539_10119085 3300009094 Bacteria 3094
273 Ga0105245_10000090 3300009098 Bacteria 90378
274 Ga0105245_10054168 3300009098 Bacteria 3602
275 Ga0105245_10240932 3300009098 Bacteria 1753
276 Ga0105247_10002972 3300009101 Bacteria 11243
277 Ga0105247_10008124 3300009101 Bacteria 6409
278 Ga0114129_10011617 3300009147 Bacteria 12537
279 Ga0114129_10075511 3300009147 Bacteria 4692
280 Ga0114129_10165358 3300009147 Bacteria 3020
281 Ga0105243_10017356 3300009148 Bacteria 5440
282 Ga0105243_10044255 3300009148 Bacteria 3492
283 Ga0105243_10140875 3300009148 Bacteria 2057
284 Ga0105241_10000053 3300009174 Bacteria 94578
285 Ga0105241_10009743 3300009174 Bacteria 7061
286 Ga0105242_10011145 3300009176 Bacteria 6909
287 Ga0105242_10028336 3300009176 Bacteria 4458
288 Ga0105242_10055680 3300009176 Bacteria 3235
289 Ga0105248_10000934 3300009177 Bacteria 32542
290 Ga0105248_10010774 3300009177 Bacteria 10093
291 Ga0105248_10037593 3300009177 Bacteria 5416
292 Ga0105248_10040996 3300009177 Bacteria 5191
293 Ga0105248_10179957 3300009177 Bacteria 2382
294 Ga0105248_10225181 3300009177 Bacteria 2111
295 Ga0105237_10028064 3300009545 Bacteria 5734
296 Ga0105237_10034377 3300009545 Bacteria 5133
297 Ga0105237_10184163 3300009545 Bacteria 2088
298 Ga0105237_10316943 3300009545 Bacteria 1563
299 Ga0105237_10341401 3300009545 Bacteria 1502
300 Ga0105238_10000905 3300009551 Bacteria 30512
301 Ga0105238_10011422 3300009551 Bacteria 8944
302 Ga0105238_10030815 3300009551 Bacteria 5458
303 Ga0105238_10037417 3300009551 Bacteria 4933
304 Ga0105238_10085309 3300009551 Bacteria 3146
305 Ga0105238_10099990 3300009551 Bacteria 2883
306 Ga0105249_10002035 3300009553 Bacteria 17539
307 Ga0105249_10002347 3300009553 Bacteria 16449
308 Ga0105249_10015086 3300009553 Bacteria 6835
309 Ga0105249_10093303 3300009553 Bacteria 2819
310 Ga0105249_10317834 3300009553 Bacteria 1567
311 Ga0105148_100011 3300009978 Bacteria 30290
312 Ga0099796_10010230 3300010159 Bacteria 2572
313 Ga0105239_10002502 3300010375 Bacteria 23393
314 Ga0105239_10025540 3300010375 Bacteria 6502
315 Ga0105239_10048612 3300010375 Bacteria 4651
316 Ga0105239_10179237 3300010375 Bacteria 2370
317 Ga0105239_10396815 3300010375 Bacteria 1561
318 Ga0105246_10000055 3300011119 Bacteria 45431
319 Ga0157373_10051024 3300013100 Bacteria 2946
320 Ga0157371_10001665 3300013102 Bacteria 22686
321 Ga0157371_10022274 3300013102 Bacteria 4646
322 Ga0157370_10038949 3300013104 Bacteria 4597
323 Ga0157370_10044244 3300013104 Bacteria 4281
324 Ga0157369_10044416 3300013105 Bacteria 4837
325 Ga0157369_10070663 3300013105 Bacteria 3750
326 Ga0157374_10000476 3300013296 Bacteria 36354
327 Ga0157378_10002229 3300013297 Bacteria 17200
328 Ga0157378_10120957 3300013297 Bacteria 2413
329 Ga0157378_10126805 3300013297 Bacteria 2358
330 Ga0163162_10004481 3300013306 Bacteria 13458
331 Ga0163162_10052202 3300013306 Bacteria 4105
332 Ga0157372_10004356 3300013307 Bacteria 15118
333 Ga0157372_10181124 3300013307 Bacteria 2439
334 Ga0157375_10004478 3300013308 Bacteria 12137
335 Ga0157375_10008267 3300013308 Bacteria 9111
336 Ga0157375_10035061 3300013308 Bacteria 4786
337 Ga0163163_10004723 3300014325 Bacteria 11673
338 Ga0163163_10007190 3300014325 Bacteria 9802
339 Ga0163163_10028878 3300014325 Bacteria 5331
340 Ga0163163_10054862 3300014325 Bacteria 3938
341 Ga0157380_10006672 3300014326 Bacteria 8147
342 Ga0157380_10278078 3300014326 Bacteria 1530
343 Ga0157377_10000987 3300014745 Bacteria 12004
344 Ga0157377_10004874 3300014745 Bacteria 6241
345 Ga0157379_10000805 3300014968 Bacteria 25414
346 Ga0157379_10027886 3300014968 Bacteria 5026
347 Ga0157379_10050365 3300014968 Bacteria 3718
348 Ga0157379_10086903 3300014968 Bacteria 2804
349 Ga0157376_10000283 3300014969 Bacteria 34227
350 Ga0157376_10295269 3300014969 Bacteria 1532
351 Ga0157376_10304377 3300014969 Bacteria 1510
352 Ga0163161_10000199 3300017792 Bacteria 55004
353 Ga0163161_10000897 3300017792 Bacteria 23133
354 Ga0206353_10275763 3300020082 Bacteria 3326
355 Ga0213875_10000053 3300021388 Bacteria 141791
356 Ga0213875_10003884 3300021388 Bacteria 8364
357 Ga0224572_1001790 3300024225 Bacteria 3295
358 Ga0228598_1000469 3300024227 Bacteria 8230
359 Ga0207666_1000469 3300025271 Bacteria 5162
360 Ga0207666_1000945 3300025271 Bacteria 3444
361 Ga0207673_1000045 3300025290 Bacteria 9922
362 Ga0209676_1000140 3300025292 Bacteria 176735
363 Ga0209676_1001860 3300025292 Bacteria 17366
364 Ga0209257_1000292 3300025304 Bacteria 110440
365 Ga0207697_10000245 3300025315 Bacteria 29793
366 Ga0207697_10006821 3300025315 Bacteria 5133
367 Ga0207653_10000923 3300025885 Bacteria 9730
368 Ga0207682_10000029 3300025893 Bacteria 57930
369 Ga0207642_10003101 3300025899 Bacteria 5210
370 Ga0207710_10006518 3300025900 Bacteria 4976
371 Ga0207710_10081259 3300025900 Bacteria 1504
372 Ga0207688_10000084 3300025901 Bacteria 35752
373 Ga0207688_10023584 3300025901 Bacteria 3370
374 Ga0207688_10048058 3300025901 Bacteria 2384
375 Ga0207680_10008657 3300025903 Bacteria 5010
376 Ga0207680_10018398 3300025903 Bacteria 3714
377 Ga0207680_10039933 3300025903 Bacteria 2727
378 Ga0207647_10000871 3300025904 Bacteria 23364
379 Ga0207647_10005096 3300025904 Bacteria 9685
380 Ga0207647_10006412 3300025904 Bacteria 8553
381 Ga0207647_10033960 3300025904 Bacteria 3260
382 Ga0207699_10038570 3300025906 Bacteria 2739
383 Ga0207645_10000090 3300025907 Bacteria 65569
384 Ga0207645_10033477 3300025907 Bacteria 3303
385 Ga0207643_10000044 3300025908 Bacteria 82217
386 Ga0207643_10005672 3300025908 Bacteria 6678
387 Ga0207643_10081668 3300025908 Bacteria 1873
388 Ga0207705_10026788 3300025909 Bacteria 4109
389 Ga0207684_10096437 3300025910 Bacteria 2524
390 Ga0207654_10000058 3300025911 Bacteria 75628
391 Ga0207654_10004275 3300025911 Bacteria 7208
392 Ga0207707_10017706 3300025912 Bacteria 6216
393 Ga0207707_10020258 3300025912 Bacteria 5806
394 Ga0207707_10097808 3300025912 Bacteria 2565
395 Ga0207695_10000453 3300025913 Bacteria 89314
396 Ga0207695_10002758 3300025913 Bacteria 25593
397 Ga0207695_10023280 3300025913 Bacteria 7004
398 Ga0207671_10125535 3300025914 Bacteria 1965
399 Ga0207671_10225179 3300025914 Bacteria 1470
400 Ga0207693_10000434 3300025915 Bacteria 38124
401 Ga0207693_10002841 3300025915 Bacteria 15002
402 Ga0207693_10013460 3300025915 Bacteria 6596
403 Ga0207693_10017239 3300025915 Bacteria 5760
404 Ga0207693_10047329 3300025915 Bacteria 3379
405 Ga0207693_10052546 3300025915 Bacteria 3196
406 Ga0207693_10060072 3300025915 Bacteria 2978
407 Ga0207693_10093857 3300025915 Bacteria 2352
408 Ga0207693_10131435 3300025915 Bacteria 1968
409 Ga0207693_10216281 3300025915 Bacteria 1506
410 Ga0207663_10170872 3300025916 Bacteria 1544
411 Ga0207660_10005635 3300025917 Bacteria 8131
412 Ga0207660_10016403 3300025917 Bacteria 4902
413 Ga0207660_10036154 3300025917 Bacteria 3433
414 Ga0207660_10085235 3300025917 Bacteria 2330
415 Ga0207660_10126476 3300025917 Bacteria 1941
416 Ga0207662_10000544 3300025918 Bacteria 16706
417 Ga0207662_10007517 3300025918 Bacteria 5932
418 Ga0207662_10010378 3300025918 Bacteria 5142
419 Ga0207657_10002170 3300025919 Bacteria 21251
420 Ga0207657_10005961 3300025919 Bacteria 12679
421 Ga0207657_10054105 3300025919 Bacteria 3473
422 Ga0207649_10000260 3300025920 Bacteria 41709
423 Ga0207652_10008473 3300025921 Bacteria 8274
424 Ga0207652_10011429 3300025921 Bacteria 7157
425 Ga0207652_10047793 3300025921 Bacteria 3656
426 Ga0207681_10000154 3300025923 Bacteria 57555
427 Ga0207681_10029640 3300025923 Bacteria 3558
428 Ga0207681_10057776 3300025923 Bacteria 2653
429 Ga0207681_10064101 3300025923 Bacteria 2536
430 Ga0207694_10033540 3300025924 Bacteria 3933
431 Ga0207694_10076501 3300025924 Bacteria 2621
432 Ga0207694_10082128 3300025924 Bacteria 2533
433 Ga0207650_10003395 3300025925 Bacteria 10954
434 Ga0207650_10013514 3300025925 Bacteria 5656
435 Ga0207650_10031312 3300025925 Bacteria 3840
436 Ga0207659_10000258 3300025926 Bacteria 32465
437 Ga0207659_10013822 3300025926 Bacteria 5187
438 Ga0207659_10176117 3300025926 Bacteria 1691
439 Ga0207687_10005296 3300025927 Bacteria 8548
440 Ga0207664_10025593 3300025929 Bacteria 4449
441 Ga0207664_10033479 3300025929 Bacteria 3948
442 Ga0207664_10040886 3300025929 Bacteria 3609
443 Ga0207644_10010275 3300025931 Bacteria 6168
444 Ga0207644_10011534 3300025931 Bacteria 5851
445 Ga0207644_10027515 3300025931 Bacteria 3928
446 Ga0207644_10038217 3300025931 Bacteria 3380
447 Ga0207644_10040569 3300025931 Bacteria 3290
448 Ga0207690_10002042 3300025932 Bacteria 12377
449 Ga0207690_10018700 3300025932 Bacteria 4251
450 Ga0207690_10178287 3300025932 Bacteria 1598
451 Ga0207706_10003023 3300025933 Bacteria 16211
452 Ga0207706_10018867 3300025933 Bacteria 6204
453 Ga0207706_10038206 3300025933 Bacteria 4258
454 Ga0207706_10060739 3300025933 Bacteria 3329
455 Ga0207706_10065103 3300025933 Bacteria 3210
456 Ga0207706_10110759 3300025933 Bacteria 2415
457 Ga0207706_10151650 3300025933 Bacteria 2038
458 Ga0207686_10148339 3300025934 Bacteria 1630
459 Ga0207709_10000372 3300025935 Bacteria 45219
460 Ga0207670_10004247 3300025936 Bacteria 7686
461 Ga0207670_10017680 3300025936 Bacteria 4313
462 Ga0207670_10026412 3300025936 Bacteria 3658
463 Ga0207669_10000019 3300025937 Bacteria 111630
464 Ga0207704_10000759 3300025938 Bacteria 14236
465 Ga0207665_10004784 3300025939 Bacteria 9011
466 Ga0207665_10161814 3300025939 Bacteria 1611
467 Ga0207691_10000882 3300025940 Bacteria 29793
468 Ga0207691_10001627 3300025940 Bacteria 22294
469 Ga0207691_10047049 3300025940 Bacteria 3962
470 Ga0207691_10082848 3300025940 Bacteria 2880
471 Ga0207691_10305640 3300025940 Bacteria 1366
472 Ga0207711_10001673 3300025941 Bacteria 20423
473 Ga0207711_10009158 3300025941 Bacteria 8271
474 Ga0207711_10013414 3300025941 Bacteria 6808
475 Ga0207711_10021680 3300025941 Bacteria 5367
476 Ga0207711_10101018 3300025941 Bacteria 2552
477 Ga0207689_10000228 3300025942 Bacteria 50020
478 Ga0207689_10007012 3300025942 Bacteria 9907
479 Ga0207661_10000107 3300025944 Bacteria 52429
480 Ga0207661_10076806 3300025944 Bacteria 2744
481 Ga0207661_10145070 3300025944 Bacteria 2047
482 Ga0207679_10000026 3300025945 Bacteria 200073
483 Ga0207679_10015638 3300025945 Bacteria 5020
484 Ga0207667_10007974 3300025949 Bacteria 12629
485 Ga0207667_10020988 3300025949 Bacteria 7244
486 Ga0207667_10045340 3300025949 Bacteria 4657
487 Ga0207667_10071293 3300025949 Bacteria 3613
488 Ga0207667_10194573 3300025949 Bacteria 2080
489 Ga0207651_10000069 3300025960 Bacteria 46408
490 Ga0207712_10000242 3300025961 Bacteria 53794
491 Ga0207712_10018876 3300025961 Bacteria 4497
492 Ga0207712_10035724 3300025961 Bacteria 3379
493 Ga0207712_10184011 3300025961 Bacteria 1644
494 Ga0207668_10000049 3300025972 Bacteria 99391
495 Ga0207668_10007545 3300025972 Bacteria 6475
496 Ga0207668_10052263 3300025972 Bacteria 2826
497 Ga0207640_10000234 3300025981 Bacteria 38057
498 Ga0207640_10019201 3300025981 Bacteria 4034
499 Ga0207658_10000804 3300025986 Bacteria 26394
500 Ga0207658_10036433 3300025986 Bacteria 3527
501 Ga0207658_10058728 3300025986 Bacteria 2864
502 Ga0207658_10169030 3300025986 Bacteria 1799
503 Ga0207658_10269219 3300025986 Bacteria 1455
504 Ga0207677_10017935 3300026023 Bacteria 4237
505 Ga0207677_10040031 3300026023 Bacteria 3086
506 Ga0207677_10049799 3300026023 Bacteria 2829
507 Ga0207703_10034429 3300026035 Bacteria 4019
508 Ga0207703_10054666 3300026035 Bacteria 3248
509 Ga0207703_10221093 3300026035 Bacteria 1693
510 Ga0207639_10000323 3300026041 Bacteria 33257
511 Ga0207639_10000413 3300026041 Bacteria 29583
512 Ga0207639_10017058 3300026041 Bacteria 5145
513 Ga0207639_10021124 3300026041 Bacteria 4671
514 Ga0207639_10047997 3300026041 Bacteria 3229
515 Ga0207678_10000068 3300026067 Bacteria 81610
516 Ga0207678_10000920 3300026067 Bacteria 26941
517 Ga0207678_10020051 3300026067 Bacteria 5874
518 Ga0207678_10060722 3300026067 Bacteria 3251
519 Ga0207678_10081589 3300026067 Bacteria 2768
520 Ga0207708_10001502 3300026075 Bacteria 17383
521 Ga0207708_10014245 3300026075 Bacteria 5946
522 Ga0207708_10014309 3300026075 Bacteria 5934
523 Ga0207708_10074540 3300026075 Bacteria 2601
524 Ga0207708_10110697 3300026075 Bacteria 2131
525 Ga0207702_10000004 3300026078 Bacteria 422182
526 Ga0207702_10001343 3300026078 Bacteria 24595
527 Ga0207702_10081442 3300026078 Bacteria 2811
528 Ga0207641_10000669 3300026088 Bacteria 37271
529 Ga0207641_10202093 3300026088 Bacteria 1833
530 Ga0207648_10006668 3300026089 Bacteria 11454
531 Ga0207648_10009806 3300026089 Bacteria 9148
532 Ga0207648_10071352 3300026089 Bacteria 3027
533 Ga0207648_10073831 3300026089 Bacteria 2972
534 Ga0207676_10003679 3300026095 Bacteria 10839
535 Ga0207676_10018586 3300026095 Bacteria 5056
536 Ga0207676_10039043 3300026095 Bacteria 3628
537 Ga0207676_10052240 3300026095 Bacteria 3194
538 Ga0207674_10000882 3300026116 Bacteria 39274
539 Ga0207674_10013733 3300026116 Bacteria 8965
540 Ga0207674_10015731 3300026116 Bacteria 8300
541 Ga0207674_10032534 3300026116 Bacteria 5470
542 Ga0207674_10070999 3300026116 Bacteria 3500
543 Ga0207675_100014892 3300026118 Bacteria 7259
544 Ga0207675_100056431 3300026118 Bacteria 3663
545 Ga0207675_100248502 3300026118 Bacteria 1721
546 Ga0207675_100268177 3300026118 Bacteria 1656
547 Ga0207683_10000653 3300026121 Bacteria 31779
548 Ga0207683_10012333 3300026121 Bacteria 7294
549 Ga0207683_10028701 3300026121 Bacteria 4813
550 Ga0207698_10000977 3300026142 Bacteria 16625
551 Ga0207698_10057221 3300026142 Bacteria 3015
552 Ga0207698_10074967 3300026142 Bacteria 2701
553 Ga0207698_10194176 3300026142 Bacteria 1812
554 Ga0209999_1009022 3300027543 Bacteria 1803
555 Ga0210002_1001945 3300027617 Bacteria 2964
556 Ga0209983_1003607 3300027665 Bacteria 3283
557 Ga0209966_1000652 3300027695 Bacteria 7751
558 Ga0209813_10000087 3300027866 Bacteria 34252
559 Ga0207428_10000130 3300027907 Bacteria 104457
560 Ga0207428_10000286 3300027907 Bacteria 68250
561 Ga0207428_10049012 3300027907 Bacteria 3386
562 Ga0265357_1000262 3300028023 Bacteria 2700
563 Ga0268265_10002575 3300028380 Bacteria 13532
564 Ga0268265_10011597 3300028380 Bacteria 5959
565 Ga0268265_10167932 3300028380 Bacteria 1872
566 Ga0268265_10248948 3300028380 Bacteria 1573
567 Ga0268264_10046150 3300028381 Bacteria 3618
568 Ga0265337_1003660 3300028556 Bacteria 6589
569 Ga0265330_10008622 3300031235 Bacteria 4898
570 Ga0265332_10006574 3300031238 Bacteria 5271
571 Ga0265332_10074841 3300031238 Bacteria 1440
572 Ga0265325_10001319 3300031241 Bacteria 17563
573 Ga0265325_10023154 3300031241 Bacteria 3396
574 Ga0265340_10001848 3300031247 Bacteria 12085
575 Ga0265340_10015062 3300031247 Bacteria 4025
576 Ga0265340_10022161 3300031247 Bacteria 3250
577 Ga0265340_10042126 3300031247 Bacteria 2243
578 Ga0265339_10000033 3300031249 Bacteria 130595
579 Ga0265339_10009902 3300031249 Bacteria 5952
580 Ga0265339_10030179 3300031249 Bacteria 3071
581 Ga0265331_10056121 3300031250 Bacteria 1871
582 Ga0265331_10065198 3300031250 Bacteria 1713
583 Ga0307408_100130805 3300031548 Bacteria 1957
584 Ga0265313_10000049 3300031595 Bacteria 111617
585 Ga0265313_10005321 3300031595 Bacteria 9514
586 Ga0265313_10009363 3300031595 Bacteria 6366
587 Ga0265313_10023313 3300031595 Bacteria 3336
588 Ga0265313_10039878 3300031595 Bacteria 2326
589 Ga0265313_10044294 3300031595 Bacteria 2173
590 Ga0265313_10045754 3300031595 Bacteria 2129
591 Ga0265313_10072321 3300031595 Bacteria 1585
592 Ga0307508_10077726 3300031616 Bacteria 2898
593 Ga0265314_10019730 3300031711 Bacteria 5215
594 Ga0265314_10022239 3300031711 Bacteria 4859
595 Ga0265314_10031505 3300031711 Bacteria 3912
596 Ga0265342_10000149 3300031712 Bacteria 79177
597 Ga0265342_10001524 3300031712 Bacteria 21423
598 Ga0265342_10002635 3300031712 Bacteria 15340
599 Ga0265342_10038344 3300031712 Bacteria 2918
600 Ga0316576_10016776 3300031727 Bacteria 4960
601 Ga0307413_10043361 3300031824 Bacteria 2651
602 Ga0307413_10098092 3300031824 Bacteria 1928
603 Ga0307410_10030984 3300031852 Bacteria 3425
604 Ga0307410_10079395 3300031852 Bacteria 2299
605 Ga0307406_10004876 3300031901 Bacteria 7308
606 Ga0307406_10018783 3300031901 Bacteria 4046
607 Ga0307406_10024626 3300031901 Bacteria 3596
608 Ga0307412_10002217 3300031911 Bacteria 10785
609 Ga0307412_10016299 3300031911 Bacteria 4424
610 Ga0307409_100010670 3300031995 Bacteria 5732
611 Ga0307414_10000384 3300032004 Bacteria 24016
612 Ga0307414_10014276 3300032004 Bacteria 4756
613 Ga0307414_10016354 3300032004 Bacteria 4508
614 Ga0307414_10030847 3300032004 Bacteria 3507
615 Ga0307414_10053668 3300032004 Bacteria 2812
616 Ga0307411_10174874 3300032005 Bacteria 1623
617 Ga0307415_100079976 3300032126 Bacteria 2330
618 Ga0307510_10088528 3300033180 Bacteria 2955
619 Ga0373930_0000159 3300034816 Bacteria 7789
620 Ga0373950_0001078 3300034818 Bacteria 3484
621 Ga0373958_0000305 3300034819 Bacteria 5913
622 Ga0373959_0000743 3300034820 Bacteria 5561
623 Ga0373938_0000024 3300034957 Bacteria 19333
624 Ga0373938_0001010 3300034957 Bacteria 4532
625 Ga0373926_0004308 3300035083 Bacteria 4658
626 Ga0373926_0012322 3300035083 Bacteria 2889
627 Ga0373929_0000274 3300035085 Bacteria 9537
628 Ga0373929_0005708 3300035085 Bacteria 2245
629 Ga0373934_0013351 3300035086 Bacteria 3106
630 Ga0373940_0000029 3300035088 Bacteria 15347
631 Ga0373944_0011320 3300035089 Bacteria 2442
632 Ga0373951_0000391 3300035091 Bacteria 13023
633 Ga0373951_0000779 3300035091 Bacteria 8707
634 Ga0373923_0001398 3300035111 Bacteria 6876
635 Ga0373923_0034751 3300035111 Bacteria 2048
636 Ga0373932_0000515 3300035112 Bacteria 11900
637 Ga0373932_0002870 3300035112 Bacteria 4257
638 Ga0373932_0025991 3300035112 Bacteria 1590
639 Ga0373936_0003979 3300035113 Bacteria 5569
640 Ga0373936_0041141 3300035113 Bacteria 1853
641 Ga0373939_0001312 3300035114 Bacteria 6041
642 Ga0373939_0003941 3300035114 Bacteria 3491
643 Ga0373941_0001774 3300035115 Bacteria 4647
644 Ga0373941_0038096 3300035115 Bacteria 1470
645 Ga0373945_0000654 3300035116 Bacteria 10019
646 Ga0373945_0001064 3300035116 Bacteria 8252
647 Ga0373945_0003922 3300035116 Bacteria 4704
648 Ga0373953_0025607 3300035117 Bacteria 2255
649 Ga0373954_0000906 3300035118 Bacteria 11525
650 Ga0373956_0008585 3300035119 Bacteria 4139
651 Ga0373956_0015622 3300035119 Bacteria 3182
652 Ga0373956_0019147 3300035119 Bacteria 2902
653 Ga0373957_0006119 3300035120 Bacteria 3774
654 Ga0373957_0073568 3300035120 Bacteria 1340
655 Ga0373960_0000932 3300035121 Bacteria 6250
656 Ga0373960_0006664 3300035121 Bacteria 2716
657 Ga0373943_0001179 3300035170 Bacteria 11669
658 Ga0373943_0003827 3300035170 Bacteria 6840
659 Ga0373943_0061106 3300035170 Bacteria 1882
660 Ga0373946_0001814 3300035171 Bacteria 7457
661 Ga0373946_0009494 3300035171 Bacteria 3585
662 Ga0373946_0033652 3300035171 Bacteria 2064
663 Ga0373955_0000201 3300035172 Bacteria 24761
664 Ga0373942_0000286 3300035207 Bacteria 13700
665 Ga0373961_0000298 3300035241 Bacteria 22185
666 Ga0373961_0004205 3300035241 Bacteria 3494
667 Ga0373962_0000887 3300035242 Bacteria 6842
668 Ga0373962_0001502 3300035242 Bacteria 5520
669 Ga0373931_0001002 3300035691 Bacteria 11946
670 Ga0373931_0011412 3300035691 Bacteria 4293
671 Ga0373931_0027265 3300035691 Bacteria 2915
672 Ga0373931_0039871 3300035691 Bacteria 2461
673 Ga0373931_0122606 3300035691 Bacteria 1487
674 Ga0373935_0000068 3300035692 Bacteria 43997
675 Ga0373935_0023692 3300035692 Bacteria 3773
676 Ga0373935_0044129 3300035692 Bacteria 2808
677 Ga0373935_0044940 3300035692 Bacteria 2785
678 Ga0373927_0000863 3300035695 Bacteria 23082
679 Ga0373927_0005387 3300035695 Bacteria 8840
680 Ga0373927_0011948 3300035695 Bacteria 5778
681 Ga0373927_0026187 3300035695 Bacteria 3811
682 Ga0373927_0114486 3300035695 Bacteria 1758
683 Ga0373933_0037084 3300035724 Bacteria 2858
684 Ga0373933_0096591 3300035724 Bacteria 1829
685 Ga0373947_0002147 3300035725 Bacteria 11983
686 Ga0373947_0002537 3300035725 Bacteria 10978
687 Ga0373947_0006972 3300035725 Bacteria 6544
688 Ga0373947_0040717 3300035725 Bacteria 2768
689 Ga0373937_0000347 3300036401 Bacteria 43749
690 Ga0373937_0007729 3300036401 Bacteria 9319
691 Ga0373937_0048668 3300036401 Bacteria 3881
692 Ga0373925_0000081 3300037068 Bacteria 102407
693 Ga0373925_0005678 3300037068 Bacteria 9276
694 Ga0373925_0007759 3300037068 Bacteria 7811
695 Ga0373925_0008281 3300037068 Bacteria 7566
696 Ga0373925_0009149 3300037068 Bacteria 7208
697 Ga0373925_0053408 3300037068 Bacteria 3020
698 Ga0373925_0061285 3300037068 Bacteria 2826
699 Ga0373925_0068818 3300037068 Bacteria 2673
700 Ga0373925_0142309 3300037068 Bacteria 1878
701 Ga0395899_0014213 3300037312 Bacteria 6075
702 Ga0395900_0273709 3300037418 Bacteria 1682
703 Ga0395898_0001457 3300037466 Bacteria 33463
704 Ga0395898_0011440 3300037466 Bacteria 9216
705 Ga0436364_0094686 3300037853 Bacteria 72452
706 Ga0436364_0596981 3300037853 Bacteria 1423
707 Ga0436364_0951864 3300037853 Bacteria 9370
708 Ga0395901_0284451 3300038443 Bacteria 1717
709 Ga0400483_117325 3300039062 Bacteria 2450
710 Ga0436365_0160122 3300039437 Bacteria 1369
711 Ga0436365_0840419 3300039437 Bacteria 3388
712 Ga0436365_1336443 3300039437 Bacteria 3131
713 Ga0436365_1477994 3300039437 Bacteria 2193
714 Ga0436360_0873896 3300039438 Bacteria 2917
715 Ga0436361_0500089 3300039447 Bacteria 2831
716 Ga0436361_0722936 3300039447 Bacteria 24347
717 Ga0436361_0760231 3300039447 Bacteria 2204
718 Ga0436363_0138398 3300039450 Bacteria 1347
719 Ga0436363_0887763 3300039450 Bacteria 3617
720 Ga0450901_003385 3300042533 Bacteria 1668
721 Ga0453684_0043018 3300044712 Bacteria 6078
722 Ga0453684_0094777 3300044712 Bacteria 3671
723 Ga0466957_0058841 3300044842 Bacteria 2354
724 Ga0466959_0078594 3300045049 Bacteria 2379
725 Ga0451576_0013266 3300045051 Bacteria 9221
726 Ga0466958_0029784 3300045836 Bacteria 3239
727 Ga0495617_024736 3300046452 Bacteria 2026
728 Ga0495627_029130 3300046453 Bacteria 1758
729 Ga0495592_0000196 3300046454 Bacteria 51625
730 Ga0495592_0030502 3300046454 Bacteria 4078
731 Ga0495592_0044206 3300046454 Bacteria 3329
732 Ga0495603_0101032 3300046455 Bacteria 1683
733 Ga0495629_0001034 3300046459 Bacteria 22308
734 Ga0495629_0003904 3300046459 Bacteria 11215
735 Ga0495629_0010656 3300046459 Bacteria 6687
736 Ga0495629_0054088 3300046459 Bacteria 2808
737 Ga0495629_0056006 3300046459 Bacteria 2757
738 Ga0495638_0000068 3300046460 Bacteria 167596
739 Ga0495641_0066355 3300046461 Bacteria 1624
740 Ga0495651_0000977 3300046462 Bacteria 22167
741 Ga0495651_0062022 3300046462 Bacteria 2861
742 Ga0495651_0168341 3300046462 Bacteria 1563
743 Ga0495653_0000193 3300046463 Bacteria 49516
744 Ga0495653_0010589 3300046463 Bacteria 7551
745 Ga0495653_0044231 3300046463 Bacteria 3457
746 Ga0495582_0004213 3300046473 Bacteria 8090
747 Ga0495582_0005890 3300046473 Bacteria 6830
748 Ga0495582_0034182 3300046473 Bacteria 2795
749 Ga0495639_0009208 3300046475 Bacteria 4233
750 Ga0495639_0075596 3300046475 Bacteria 1562
751 Ga0495662_0001111 3300046476 Bacteria 13243
752 Ga0495662_0002749 3300046476 Bacteria 8890
753 Ga0495662_0006973 3300046476 Bacteria 5615
754 Ga0495664_0000016 3300046477 Bacteria 175933
755 Ga0495664_0000554 3300046477 Bacteria 18816
756 Ga0495664_0036496 3300046477 Bacteria 2897
757 Ga0495664_0082802 3300046477 Bacteria 1925
758 Ga0495584_0005586 3300046491 Bacteria 6648
759 Ga0495584_0006458 3300046491 Bacteria 6135
760 Ga0495584_0099823 3300046491 Bacteria 1467
761 Ga0495585_0000744 3300046492 Bacteria 28955
762 Ga0495594_0008772 3300046499 Bacteria 5213
763 Ga0495607_0027003 3300046501 Bacteria 3556
764 Ga0495583_0038328 3300046506 Bacteria 2265
765 Ga0495608_0000121 3300046511 Bacteria 56189
766 Ga0495608_0037362 3300046511 Bacteria 3266
767 Ga0495610_0000083 3300046512 Bacteria 112946
768 Ga0495610_0035906 3300046512 Bacteria 2539
769 Ga0495616_0110694 3300046513 Bacteria 1276
770 Ga0495618_0000124 3300046514 Bacteria 56215
771 Ga0495618_0003921 3300046514 Bacteria 9181
772 Ga0495618_0127837 3300046514 Bacteria 1626
773 Ga0495628_0000018 3300046516 Bacteria 169916
774 Ga0495628_0101785 3300046516 Bacteria 2216
775 Ga0495630_0002180 3300046517 Bacteria 13643
776 Ga0495630_0006717 3300046517 Bacteria 8198
777 Ga0495630_0018839 3300046517 Bacteria 5073
778 Ga0495630_0032184 3300046517 Bacteria 3906
779 Ga0495630_0100532 3300046517 Bacteria 2188
780 Ga0495632_0000023 3300046519 Bacteria 180933
781 Ga0495637_0000836 3300046520 Bacteria 20354
782 Ga0495637_0002707 3300046520 Bacteria 9657
783 Ga0495643_0000038 3300046522 Bacteria 236010
784 Ga0495644_0002708 3300046523 Bacteria 7027
785 Ga0495644_0015905 3300046523 Bacteria 2883
786 Ga0495648_0014476 3300046524 Bacteria 5773
787 Ga0495663_0000019 3300046525 Bacteria 129361
788 Ga0495663_0013219 3300046525 Bacteria 2308
789 Ga0495666_0006120 3300046526 Bacteria 6055
790 Ga0495652_0000005 3300046529 Bacteria 524368
791 Ga0495652_0019100 3300046529 Bacteria 6104
792 Ga0495652_0049806 3300046529 Bacteria 3584
793 Ga0495640_0000063 3300046533 Bacteria 60255
794 Ga0495640_0069336 3300046533 Bacteria 2371
795 Ga0495640_0143041 3300046533 Bacteria 1541
796 Ga0495640_0165006 3300046533 Unclassified 1417
797 Ga0495586_0019585 3300046535 Bacteria 3604
798 Ga0495586_0051648 3300046535 Bacteria 2225
799 Ga0495587_0000134 3300046536 Bacteria 56076
800 Ga0495587_0007597 3300046536 Bacteria 7015
801 Ga0495598_0000513 3300046537 Bacteria 7181
802 Ga0495598_0009308 3300046537 Bacteria 2319
803 Ga0495609_0043795 3300046538 Bacteria 2009
804 Ga0495645_0000070 3300046543 Bacteria 71823
805 Ga0495645_0003212 3300046543 Bacteria 11086
806 Ga0495645_0021402 3300046543 Bacteria 4674
807 Ga0495633_0000568 3300046558 Bacteria 35912
808 Ga0495633_0000772 3300046558 Bacteria 28691
809 Ga0495633_0002060 3300046558 Bacteria 14494
810 Ga0495667_0000023 3300046559 Bacteria 169343
811 Ga0495667_0005008 3300046559 Bacteria 8957
812 Ga0495634_0000241 3300046642 Bacteria 51268
813 Ga0495634_0014117 3300046642 Bacteria 5767
814 Ga0495635_0000045 3300046663 Bacteria 82266
815 Ga0495635_0035648 3300046663 Bacteria 3449
816 Ga0495659_0002311 3300046664 Bacteria 6167
817 Ga0495588_0034636 3300046674 Bacteria 2555
818 Ga0495657_0001484 3300046675 Bacteria 20216
819 Ga0495657_0007068 3300046675 Bacteria 8708
820 Ga0495657_0086915 3300046675 Bacteria 2013
821 Ga0495599_0000107 3300046678 Bacteria 56178
822 Ga0495623_0000180 3300046679 Bacteria 39869
823 Ga0495623_0002513 3300046679 Bacteria 12140
824 Ga0495623_0009474 3300046679 Bacteria 6323
825 Ga0495646_0000027 3300046680 Bacteria 97629
826 Ga0495646_0080435 3300046680 Bacteria 1900
827 Ga0495647_0004735 3300046681 Bacteria 4438
828 Ga0495658_0020639 3300046683 Bacteria 3461
829 Ga0495658_0032995 3300046683 Bacteria 2832
830 Ga0495613_0009605 3300046689 Bacteria 7187
831 Ga0495624_0015346 3300046690 Bacteria 5175
832 Ga0495624_0053973 3300046690 Bacteria 2535
833 Ga0495624_0095759 3300046690 Bacteria 1829
834 Ga0495670_0003165 3300046691 Bacteria 8106
835 Ga0495670_0004845 3300046691 Bacteria 6606
836 Ga0495671_0000027 3300046692 Bacteria 236011
837 Ga0495649_0000048 3300046694 Bacteria 118180
838 Ga0495600_0000062 3300046809 Bacteria 61420
839 Ga0495600_0006032 3300046809 Bacteria 7336
840 Ga0495600_0028982 3300046809 Bacteria 3583
841 Ga0495600_0196222 3300046809 Bacteria 1297
842 Ga0495581_0028604 3300047315 Bacteria 3231
843 Ga0495581_0034460 3300047315 Bacteria 2929
844 Ga0495581_0039498 3300047315 Bacteria 2732
845 Ga0495604_0000014 3300047317 Bacteria 205481
846 Ga0495604_0000613 3300047317 Bacteria 30609
847 Ga0495604_0017410 3300047317 Bacteria 5752
848 Ga0495674_0000014 3300047319 Bacteria 241211
849 Ga0495674_0020715 3300047319 Bacteria 6089
850 Ga0495674_0054449 3300047319 Bacteria 3513
851 Ga0495674_0108485 3300047319 Bacteria 2355
852 Ga0495674_0158694 3300047319 Bacteria 1893
853 Ga0495672_0008846 3300047320 Bacteria 7366
854 Ga0495676_0018139 3300047321 Bacteria 6208
855 Ga0495680_0000779 3300047322 Bacteria 35728
856 Ga0495680_0004120 3300047322 Bacteria 13973
857 Ga0495680_0005491 3300047322 Bacteria 11919
858 Ga0495680_0014092 3300047322 Bacteria 6946
859 Ga0495680_0106452 3300047322 Bacteria 2084
860 Ga0495680_0214928 3300047322 Bacteria 1375
861 Ga0495675_0000058 3300047444 Bacteria 77587
862 Ga0495675_0016655 3300047444 Bacteria 4646
863 Ga0495681_0000279 3300047470 Bacteria 40888
864 Ga0495681_0001314 3300047470 Bacteria 18798
865 Ga0495684_0000059 3300047471 Bacteria 77947
866 Ga0495684_0000136 3300047471 Bacteria 54014
867 Ga0495686_0043393 3300047472 Bacteria 2851
868 Ga0495686_0135686 3300047472 Bacteria 1455
869 Ga0495593_0005129 3300047673 Bacteria 7741
870 Ga0495593_0061722 3300047673 Bacteria 1960
871 Ga0495602_0000017 3300048088 Bacteria 184180
872 Ga0495614_0020420 3300048089 Bacteria 2865
873 Ga0495614_0024753 3300048089 Bacteria 2591
874 Ga0495615_0021522 3300048090 Bacteria 1456
875 Ga0496100_0000237 3300048903 Bacteria 28937
876 Ga0496100_0006029 3300048903 Bacteria 6579
877 Ga0496100_0025954 3300048903 Bacteria 3587
878 Ga0496100_0075119 3300048903 Bacteria 2266
879 Ga0496100_0114614 3300048903 Bacteria 1878
880 Ga0496100_0208748 3300048903 Bacteria 1427
881 Ga0496101_0000697 3300048904 Bacteria 20240
882 Ga0496101_0003104 3300048904 Bacteria 10272
883 Ga0496101_0011363 3300048904 Bacteria 5905
884 Ga0496101_0013493 3300048904 Bacteria 5475
885 Ga0496101_0087126 3300048904 Bacteria 2317
886 Ga0496101_0163654 3300048904 Bacteria 1707
887 Ga0496101_0175674 3300048904 Bacteria 1647
888 Ga0496102_0004386 3300048905 Bacteria 11921
889 Ga0496102_0008462 3300048905 Bacteria 8821
890 Ga0496102_0024214 3300048905 Bacteria 5396
891 Ga0496102_0064232 3300048905 Bacteria 3362
892 Ga0496102_0085685 3300048905 Bacteria 2909
893 Ga0496102_0100039 3300048905 Bacteria 2692
894 Ga0496102_0133343 3300048905 Bacteria 2326
895 Ga0496102_0133444 3300048905 Bacteria 2325
896 Ga0496102_0145942 3300048905 Bacteria 2221
897 Ga0496102_0214057 3300048905 Bacteria 1816
898 Ga0496103_0016536 3300048906 Bacteria 4402
899 Ga0496103_0080031 3300048906 Bacteria 2054
900 Ga0496104_0006107 3300048907 Bacteria 10574
901 Ga0496104_0014689 3300048907 Bacteria 7074
902 Ga0496104_0021017 3300048907 Bacteria 5989
903 Ga0496104_0031473 3300048907 Bacteria 4934
904 Ga0496104_0035169 3300048907 Bacteria 4677
905 Ga0496104_0065269 3300048907 Bacteria 3454
906 Ga0496104_0195705 3300048907 Bacteria 1934
907 Ga0496105_0001999 3300048908 Bacteria 14708
908 Ga0496105_0005181 3300048908 Bacteria 9880
909 Ga0496105_0006825 3300048908 Bacteria 8779
910 Ga0496105_0157161 3300048908 Bacteria 1867
911 Ga0496105_0185565 3300048908 Unclassified 1702
912 Ga0496106_0000236 3300048909 Bacteria 38678
913 Ga0496106_0002012 3300048909 Bacteria 15288
914 Ga0496106_0009101 3300048909 Bacteria 7338
915 Ga0496106_0011510 3300048909 Bacteria 6542
916 Ga0496106_0016650 3300048909 Bacteria 5438
917 Ga0496106_0076915 3300048909 Bacteria 2558
918 Ga0496107_0000327 3300048910 Bacteria 25714
919 Ga0496107_0014384 3300048910 Bacteria 5541
920 Ga0496107_0017289 3300048910 Bacteria 5071
921 Ga0496107_0028396 3300048910 Bacteria 3975
922 Ga0496107_0030947 3300048910 Bacteria 3816
923 Ga0496107_0053577 3300048910 Bacteria 2910
924 Ga0496107_0078701 3300048910 Bacteria 2402
925 Ga0496107_0091247 3300048910 Bacteria 2226
926 Ga0496107_0097708 3300048910 Bacteria 2150
927 Ga0496108_0000347 3300048911 Bacteria 39108
928 Ga0496108_0000902 3300048911 Bacteria 23152
929 Ga0496108_0001376 3300048911 Bacteria 19132
930 Ga0496108_0005173 3300048911 Bacteria 10547
931 Ga0496108_0013218 3300048911 Bacteria 6727
932 Ga0496108_0045907 3300048911 Bacteria 3649
933 Ga0496108_0098577 3300048911 Bacteria 2491
934 Ga0496108_0119819 3300048911 Bacteria 2256
935 Ga0496108_0161783 3300048911 Bacteria 1935
936 Ga0496109_0000224 3300048912 Bacteria 55854
937 Ga0496109_0000925 3300048912 Bacteria 24421
938 Ga0496109_0005863 3300048912 Bacteria 10300
939 Ga0496109_0008656 3300048912 Bacteria 8661
940 Ga0496109_0025751 3300048912 Bacteria 5243
941 Ga0496109_0031922 3300048912 Bacteria 4731
942 Ga0496109_0118634 3300048912 Bacteria 2463
943 Ga0496109_0346498 3300048912 Bacteria 1403
944 Ga0496110_0010097 3300048913 Bacteria 7666
945 Ga0496110_0029719 3300048913 Bacteria 4706
946 Ga0496110_0035608 3300048913 Bacteria 4319
947 Ga0496110_0055430 3300048913 Bacteria 3488
948 Ga0496110_0059966 3300048913 Bacteria 3355
949 Ga0496110_0074428 3300048913 Bacteria 3016
950 Ga0496110_0136555 3300048913 Bacteria 2216
951 Ga0496110_0250584 3300048913 Bacteria 1611
952 Ga0496111_0009006 3300048914 Bacteria 6640
953 Ga0496111_0021601 3300048914 Bacteria 4497
954 Ga0496111_0031448 3300048914 Bacteria 3781
955 Ga0496111_0069902 3300048914 Bacteria 2553
956 Ga0496111_0070351 3300048914 Bacteria 2545
957 Ga0496111_0179786 3300048914 Bacteria 1572
958 Ga0496112_0002281 3300048915 Bacteria 15339
959 Ga0496112_0002294 3300048915 Bacteria 15311
960 Ga0496112_0005249 3300048915 Bacteria 11155
961 Ga0496112_0006289 3300048915 Bacteria 10415
962 Ga0496112_0044183 3300048915 Bacteria 4365
963 Ga0496112_0133343 3300048915 Bacteria 2454
964 Ga0496112_0134740 3300048915 Bacteria 2440
965 Ga0496112_0188480 3300048915 Bacteria 2025
966 Ga0496112_0209861 3300048915 Bacteria 1905
967 Ga0496112_0266687 3300048915 Bacteria 1661
968 Ga0496113_0018979 3300048916 Bacteria 4801
969 Ga0496113_0022653 3300048916 Bacteria 4448
970 Ga0496113_0025192 3300048916 Bacteria 4237
971 Ga0496113_0038764 3300048916 Bacteria 3505
972 Ga0496113_0058625 3300048916 Bacteria 2897
973 Ga0496113_0083590 3300048916 Bacteria 2450
974 Ga0496114_0038158 3300048917 Bacteria 3974
975 Ga0496114_0054406 3300048917 Bacteria 3337
976 Ga0496115_0003837 3300048918 Bacteria 10833
977 Ga0496115_0011128 3300048918 Bacteria 6741
978 Ga0496115_0018524 3300048918 Bacteria 5348
979 Ga0496115_0022496 3300048918 Bacteria 4885
980 Ga0496116_0013402 3300048919 Bacteria 6612
981 Ga0496116_0036936 3300048919 Bacteria 3413
982 Ga0496117_0008437 3300048920 Bacteria 9781
983 Ga0496119_0000709 3300048922 Bacteria 44727
984 Ga0496121_0000997 3300048924 Bacteria 50601
985 Ga0496122_0002462 3300048925 Bacteria 26201
986 Ga0496122_0014017 3300048925 Bacteria 7787
987 Ga0496122_0073705 3300048925 Bacteria 2419
988 Ga0496123_0058162 3300048926 Bacteria 2510
989 Ga0496123_0167756 3300048926 Bacteria 1162
990 Ga0496124_0037793 3300048927 Bacteria 4196
991 Ga0496124_0046604 3300048927 Bacteria 3711
992 Ga0496125_0001108 3300048928 Bacteria 41389
993 Ga0496125_0012656 3300048928 Bacteria 8351
994 Ga0496125_0039327 3300048928 Bacteria 4075
995 Ga0496126_0023175 3300048929 Bacteria 6019
996 Ga0495678_041432 3300049459 Bacteria 1843
997 Ga0501031_0020670 3300049568 Bacteria 4293
998 Ga0501031_0058475 3300049568 Bacteria 2512
999 Ga0501032_0000303 3300049569 Bacteria 41504
1000 Ga0501032_0087939 3300049569 Bacteria 2063
1001 Ga0501032_0123386 3300049569 Bacteria 1712
1002 Ga0501033_0000881 3300049570 Bacteria 27428
1003 Ga0501033_0005988 3300049570 Bacteria 9539
1004 Ga0501034_0000250 3300049571 Bacteria 99407
1005 Ga0501034_0111025 3300049571 Bacteria 2732
1006 Ga0501034_0118961 3300049571 Bacteria 2629
1007 Ga0501034_0222330 3300049571 Bacteria 1840
1008 Ga0501034_0394862 3300049571 Bacteria 1307
1009 Ga0501036_0000098 3300049572 Bacteria 54252
1010 Ga0501036_0133576 3300049572 Bacteria 2094
1011 Ga0501037_0000092 3300049573 Bacteria 83924
1012 Ga0501037_0063493 3300049573 Bacteria 2692
1013 Ga0501037_0069341 3300049573 Bacteria 2567
1014 Ga0501038_0002041 3300049574 Bacteria 18682
1015 Ga0501038_0050472 3300049574 Bacteria 3594
1016 Ga0501038_0052419 3300049574 Bacteria 3518
1017 Ga0501038_0151076 3300049574 Bacteria 1893
1018 Ga0501039_0000085 3300049575 Bacteria 70306
1019 Ga0501039_0058135 3300049575 Bacteria 2995
1020 Ga0501039_0154908 3300049575 Bacteria 1800
1021 Ga0501040_0010464 3300049576 Bacteria 6066
1022 Ga0501040_0188160 3300049576 Bacteria 1465
1023 Ga0501041_0016047 3300049577 Bacteria 4450
1024 Ga0501041_0016276 3300049577 Bacteria 4421
1025 Ga0501042_0020429 3300049578 Bacteria 4609
1026 Ga0501043_0000460 3300049579 Bacteria 36273
1027 Ga0501043_0077737 3300049579 Bacteria 2607
1028 Ga0501043_0192161 3300049579 Bacteria 1587
1029 Ga0501046_0000033 3300049580 Bacteria 174675
1030 Ga0501046_0000624 3300049580 Bacteria 34712
1031 Ga0501046_0045146 3300049580 Bacteria 3502
1032 Ga0501046_0052907 3300049580 Bacteria 3199
1033 Ga0501046_0084981 3300049580 Bacteria 2440
1034 Ga0501046_0143179 3300049580 Bacteria 1807
1035 Ga0501047_0000022 3300049581 Bacteria 249062
1036 Ga0501047_0061466 3300049581 Bacteria 3624
1037 Ga0501047_0066110 3300049581 Bacteria 3485
1038 Ga0501047_0082865 3300049581 Bacteria 3083
1039 Ga0501047_0085660 3300049581 Bacteria 3028
1040 Ga0501047_0176737 3300049581 Bacteria 2002
1041 Ga0501047_0268507 3300049581 Bacteria 1552
1042 Ga0501048_0000292 3300049582 Bacteria 34134
1043 Ga0501048_0173710 3300049582 Bacteria 1527
1044 Ga0501048_0178656 3300049582 Bacteria 1504
1045 Ga0501067_0003139 3300049583 Bacteria 9123
1046 Ga0501067_0029418 3300049583 Bacteria 3044
1047 Ga0501067_0084919 3300049583 Bacteria 1756
1048 Ga0501068_0003364 3300049584 Bacteria 8588
1049 Ga0501068_0054371 3300049584 Bacteria 2425
1050 Ga0501068_0151515 3300049584 Bacteria 1457
1051 Ga0501070_0014140 3300049586 Bacteria 6717
1052 Ga0501070_0020252 3300049586 Bacteria 5579
1053 Ga0501070_0049761 3300049586 Bacteria 3480
1054 Ga0501070_0055000 3300049586 Bacteria 3299
1055 Ga0501070_0173269 3300049586 Bacteria 1777
1056 Ga0501071_0045980 3300049587 Bacteria 3135
1057 Ga0501071_0086331 3300049587 Bacteria 2301
1058 Ga0501071_0099093 3300049587 Bacteria 2147
1059 Ga0501072_0027316 3300049588 Bacteria 4453
1060 Ga0501072_0054742 3300049588 Bacteria 3144
1061 Ga0501072_0111234 3300049588 Bacteria 2180
1062 Ga0501073_0000109 3300049589 Bacteria 53094
1063 Ga0501073_0023706 3300049589 Bacteria 4405
1064 Ga0501073_0044455 3300049589 Bacteria 3130
1065 Ga0501073_0046982 3300049589 Bacteria 3035
1066 Ga0501073_0062686 3300049589 Bacteria 2593
1067 Ga0501074_0000250 3300049590 Bacteria 30239
1068 Ga0501074_0013873 3300049590 Bacteria 5857
1069 Ga0501074_0049283 3300049590 Bacteria 3041
1070 Ga0501074_0053274 3300049590 Bacteria 2919
1071 Ga0501074_0080618 3300049590 Bacteria 2335
1072 Ga0501075_0039262 3300049591 Bacteria 3543
1073 Ga0501076_0091458 3300049592 Bacteria 2447
1074 Ga0501076_0175704 3300049592 Bacteria 1745
1075 Ga0501077_0056525 3300049593 Bacteria 2491
1076 Ga0501077_0197258 3300049593 Bacteria 1279
1077 Ga0501223_000086 3300049663 Bacteria 27446
1078 Ga0501225_0000034 3300049705 Bacteria 46629
1079 Ga0501225_0004061 3300049705 Bacteria 4381
1080 Ga0501079_0005234 3300049741 Bacteria 9642
1081 Ga0501080_0006971 3300049742 Bacteria 10198
1082 Ga0501080_0011399 3300049742 Bacteria 8142
1083 Ga0501080_0025088 3300049742 Bacteria 5532
1084 Ga0501080_0113678 3300049742 Bacteria 2510
1085 Ga0501080_0133642 3300049742 Bacteria 2296
1086 Ga0501080_0261239 3300049742 Bacteria 1578
1087 Ga0501080_0317699 3300049742 Bacteria 1410
1088 Ga0501081_0008911 3300049743 Bacteria 6518
1089 Ga0501081_0055428 3300049743 Bacteria 2739
1090 Ga0501081_0100093 3300049743 Bacteria 2048
1091 Ga0501081_0103323 3300049743 Bacteria 2016
1092 Ga0501083_0000618 3300049744 Bacteria 22913
1093 Ga0501083_0003365 3300049744 Bacteria 11191
1094 Ga0501083_0021302 3300049744 Bacteria 4504
1095 Ga0501083_0063674 3300049744 Bacteria 2459
1096 Ga0501083_0143314 3300049744 Bacteria 1564
1097 Ga0501035_0001489 3300049822 Bacteria 23988
1098 Ga0501035_0021051 3300049822 Bacteria 5995
1099 Ga0501035_0054468 3300049822 Bacteria 3574
1100 Ga0501044_0000072 3300049823 Bacteria 124143
1101 Ga0501044_0024914 3300049823 Bacteria 6345
1102 Ga0501044_0043948 3300049823 Bacteria 4640
1103 Ga0501044_0064936 3300049823 Bacteria 3723
1104 Ga0501044_0257729 3300049823 Bacteria 1683
1105 Ga0501045_0041254 3300049824 Bacteria 3358
1106 Ga0501045_0081425 3300049824 Bacteria 2387
1107 nmdc:mga03n38_55789_c1 3300050490 Bacteria 1781
1108 nmdc:mga03n38_74979_c1 3300050490 Bacteria 1575
1109 nmdc:mga00v17_268007_c1 3300050491 Bacteria 1108
1110 nmdc:mga0yw44_127155_c1 3300050492 Bacteria 1647
1111 nmdc:mga0yw44_58568_c1 3300050492 Bacteria 2354
1112 nmdc:mga0yw44_86222_c1 3300050492 Bacteria 1977
1113 nmdc:mga06z11_191_c1 3300050494 Bacteria 24617
1114 nmdc:mga04h51_1507_c1 3300050495 Bacteria 5395
1115 nmdc:mga04h51_22073_c1 3300050495 Bacteria 1922
1116 nmdc:mga05p37_193198_c1 3300050507 Bacteria 2470
1117 nmdc:mga05p37_27999_c1 3300050507 Bacteria 6865
1118 nmdc:mga09592_14616_c1 3300050508 Bacteria 6407
1119 nmdc:mga0qj67_350211_c1 3300050509 Bacteria 1194
1120 nmdc:mga0qj67_392_c1 3300050509 Bacteria 30232
1121 nmdc:mga06r32_51949_c1 3300050510 Bacteria 3924
1122 nmdc:mga06r32_64244_c1 3300050510 Bacteria 3539
1123 nmdc:mga08y16_14375_c1 3300050511 Bacteria 8333
1124 nmdc:mga08y16_64084_c1 3300050511 Bacteria 3838
1125 nmdc:mga08y16_66523_c1 3300050511 Bacteria 3761
1126 nmdc:mga0n895_111546_c1 3300050512 Bacteria 2751
1127 nmdc:mga0n895_15793_c1 3300050512 Bacteria 6903
1128 nmdc:mga0n895_311322_c1 3300050512 Bacteria 1596
1129 nmdc:mga0n895_552_c1 3300050512 Bacteria 25634
1130 nmdc:mga0n895_84596_c1 3300050512 Bacteria 3165
1131 nmdc:mga0rr50_157675_c1 3300050513 Bacteria 1840
1132 nmdc:mga0rr50_33063_c1 3300050513 Bacteria 3692
1133 nmdc:mga0rr50_95527_c1 3300050513 Bacteria 2323
1134 nmdc:mga08x19_40687_c1 3300050514 Bacteria 2959
1135 nmdc:mga0a205_2568_c1 3300050515 Bacteria 16009
1136 nmdc:mga0sz30_21157_c1 3300050516 Bacteria 2630
1137 Ga0495601_0000016 3300053077 Bacteria 207486
1138 Ga0495601_0002664 3300053077 Bacteria 10122
1139 Ga0495601_0007172 3300053077 Bacteria 6538
1140 Ga0495601_0011070 3300053077 Bacteria 5390
1141 Ga0495601_0053768 3300053077 Bacteria 2546
1142 Ga0495601_0054340 3300053077 Bacteria 2533
1143 Ga0495601_0057524 3300053077 Bacteria 2463
1144 Ga0495612_0000041 3300053078 Bacteria 62752
1145 Ga0495612_0003354 3300053078 Bacteria 6637
1146 Ga0495612_0010956 3300053078 Bacteria 3661
1147 Ga0495612_0015875 3300053078 Bacteria 3018
1148 Ga0495612_0019036 3300053078 Bacteria 2748
1149 Ga0495612_0036858 3300053078 Bacteria 1985
1150 Ga0495595_0000048 3300053084 Bacteria 60581
1151 Ga0495595_0001522 3300053084 Bacteria 9051
1152 Ga0495595_0008969 3300053084 Bacteria 4125
1153 Ga0495595_0010099 3300053084 Bacteria 3918
1154 Ga0495619_0000050 3300053085 Bacteria 101361
1155 Ga0495619_0000518 3300053085 Bacteria 25614
1156 Ga0495619_0001220 3300053085 Bacteria 16844
1157 Ga0495619_0001244 3300053085 Bacteria 16678
1158 Ga0495619_0008836 3300053085 Bacteria 6369
1159 Ga0495619_0025575 3300053085 Bacteria 3792
1160 Ga0495619_0029292 3300053085 Bacteria 3556
1161 Ga0495619_0093107 3300053085 Bacteria 2042
1162 Ga0500647_0002985 3300053091 Bacteria 6478
1163 Ga0500651_0039297 3300053093 Bacteria 2979
1164 Ga0500651_0059817 3300053093 Bacteria 2382
1165 Ga0500566_0007133 3300053094 Bacteria 6620
1166 Ga0500641_0024126 3300053096 Bacteria 2343
1167 Ga0500556_0001106 3300053104 Bacteria 13430
1168 Ga0500593_043998 3300053117 Bacteria 1992
1169 Ga0500618_004828 3300053125 Bacteria 4214
1170 Ga0500618_010582 3300053125 Bacteria 2472
1171 Ga0500559_0000398 3300053136 Bacteria 31511
1172 Ga0500559_0000465 3300053136 Bacteria 28853
1173 Ga0500568_0005085 3300053139 Bacteria 6878
1174 Ga0500622_0009386 3300053156 Bacteria 5414
1175 Ga0500624_004059 3300053157 Bacteria 1920
1176 Ga0500637_0037235 3300053178 Bacteria 2734
1177 Ga0500645_001143 3300053730 Bacteria 14378
1178 Ga0501084_0001321 3300054114 Bacteria 19525
1179 Ga0501084_0012745 3300054114 Bacteria 6964
1180 Ga0501084_0013172 3300054114 Bacteria 6841
1181 Ga0501084_0014344 3300054114 Bacteria 6565
1182 Ga0501082_0007370 3300060353 Bacteria 9492
1183 Ga0501082_0010751 3300060353 Bacteria 7878
1184 Ga0501082_0033077 3300060353 Bacteria 4459
1185 Ga0501082_0042143 3300060353 Bacteria 3935
1186 Ga0501082_0056526 3300060353 Bacteria 3380
1187 Ga0501082_0081619 3300060353 Bacteria 2790
1188 Ga0501082_0094166 3300060353 Bacteria 2588
1189 Ga0501082_0110314 3300060353 Bacteria 2382
1190 Ga0501082_0168915 3300060353 Bacteria 1901

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0101785 Ga0495628_0101785_1159_2193 327
2 3300050491 nmdc:mga00v17_268007_c1 nmdc:mga00v17_268007_c1_50_1084 327
3 3300050509 nmdc:mga0qj67_350211_c1 nmdc:mga0qj67_350211_c1_14_1054 327
4 3300031711 Ga0265314_10031505 Ga0265314_100315051 328
5 3300049583 Ga0501067_0084919 Ga0501067_0084919_354_1568 335
6 3300049742 Ga0501080_0011399 Ga0501080_0011399_4475_5689 335
7 3300005355 Ga0070671_100050533 Ga0070671_1000505333 340
8 3300048913 Ga0496110_0136555 Ga0496110_0136555_1157_2191 340
9 3300048926 Ga0496123_0167756 Ga0496123_0167756_102_1136 340
10 3300049572 Ga0501036_0133576 Ga0501036_0133576_1025_2065 341
11 3300049571 Ga0501034_0111025 Ga0501034_0111025_1644_2696 344
12 3300042533 Ga0450901_003385 Ga0450901_003385_13_1083 346
13 3300033180 Ga0307510_10088528 Ga0307510_100885282 358
14 3300048912 Ga0496109_0346498 Ga0496109_0346498_50_1147 362
15 3300049569 Ga0501032_0087939 Ga0501032_0087939_355_1590 364
16 3300049573 Ga0501037_0069341 Ga0501037_0069341_197_1432 365
17 3300049579 Ga0501043_0192161 Ga0501043_0192161_63_1328 365
18 3300049581 Ga0501047_0061466 Ga0501047_0061466_14_1249 365
19 3300049589 Ga0501073_0046982 Ga0501073_0046982_1021_2256 365
20 3300049742 Ga0501080_0133642 Ga0501080_0133642_572_1837 365
21 3300049592 Ga0501076_0091458 Ga0501076_0091458_1297_2427 368
22 3300048911 Ga0496108_0045907 Ga0496108_0045907_2190_3326 371
23 3300046517 Ga0495630_0100532 Ga0495630_0100532_658_1917 373
24 3300049590 Ga0501074_0049283 Ga0501074_0049283_1747_2982 373
25 3300031595 Ga0265313_10023313 Ga0265313_100233131 374
26 3300049574 Ga0501038_0050472 Ga0501038_0050472_887_2152 374
27 3300037466 Ga0395898_0001457 Ga0395898_0001457_16170_17363 377
28 3300031595 Ga0265313_10044294 Ga0265313_100442942 378
29 3300005436 Ga0070713_100105678 Ga0070713_1001056782 379
30 3300048928 Ga0496125_0001108 Ga0496125_0001108_2743_3993 380
31 3300031247 Ga0265340_10042126 Ga0265340_100421264 381
32 3300039450 Ga0436363_0138398 Ga0436363_0138398_54_1268 381
33 3300014969 Ga0157376_10304377 Ga0157376_103043772 384
34 3300049593 Ga0501077_0197258 Ga0501077_0197258_11_1189 384
35 3300053125 Ga0500618_010582 Ga0500618_010582_240_1460 384
36 3300035691 Ga0373931_0122606 Ga0373931_0122606_13_1281 385
37 3300005467 Ga0070706_100221789 Ga0070706_1002217891 386
38 3300009177 Ga0105248_10037593 Ga0105248_100375933 388
39 3300025931 Ga0207644_10011534 Ga0207644_100115342 388
40 3300025941 Ga0207711_10013414 Ga0207711_100134148 388
41 3300037312 Ga0395899_0014213 Ga0395899_0014213_1732_2946 388
42 3300037418 Ga0395900_0273709 Ga0395900_0273709_179_1393 388
43 3300037466 Ga0395898_0011440 Ga0395898_0011440_88_1302 388
44 3300038443 Ga0395901_0284451 Ga0395901_0284451_86_1300 388
45 3300048903 Ga0496100_0025954 Ga0496100_0025954_1017_2231 388
46 3300025939 Ga0207665_10161814 Ga0207665_101618141 389
47 3300037853 Ga0436364_0596981 Ga0436364_0596981_94_1314 389
48 3300049586 Ga0501070_0055000 Ga0501070_0055000_1365_2600 390
49 3300049742 Ga0501080_0317699 Ga0501080_0317699_125_1360 390
50 3300021388 Ga0213875_10003884 Ga0213875_100038847 391
51 3300031247 Ga0265340_10001848 Ga0265340_100018482 391
52 3300037853 Ga0436364_0094686 Ga0436364_0094686_68308_69555 391
53 3300049575 Ga0501039_0154908 Ga0501039_0154908_112_1347 391
54 iso_pu_bacteria 2512564014 2512642554 391
55 iso_pu_bacteria 2775507255 2778125464 391
56 iso_pu_bacteria 2808606401 2809063335 391
57 iso_pu_bacteria 2808606404 2809079229 391
58 iso_pu_bacteria 2808606405 2809083397 391
59 iso_pu_bacteria 2880518877 2880520605 391
60 3300005578 Ga0068854_100114930 Ga0068854_1001149302 393
61 3300010375 Ga0105239_10396815 Ga0105239_103968151 394
62 3300031595 Ga0265313_10072321 Ga0265313_100723212 394
63 3300001904 JGI24736J21556_1001465 JGI24736J21556_10014655 395
64 3300001915 JGI24741J21665_1000079 JGI24741J21665_100007913 395
65 3300001979 JGI24740J21852_10003959 JGI24740J21852_100039598 395
66 3300001989 JGI24739J22299_10000379 JGI24739J22299_1000037912 395
67 3300002067 JGI24735J21928_10000880 JGI24735J21928_100008805 395
68 3300002075 JGI24738J21930_10003527 JGI24738J21930_100035276 395
69 3300005289 Ga0065704_10134305 Ga0065704_101343051 395
70 3300005353 Ga0070669_100165881 Ga0070669_1001658811 395
71 3300005355 Ga0070671_100007494 Ga0070671_1000074941 395
72 3300005466 Ga0070685_10114232 Ga0070685_101142321 395
73 3300005543 Ga0070672_100078359 Ga0070672_1000783592 395
74 3300005614 Ga0068856_100024647 Ga0068856_1000246474 395
75 3300005618 Ga0068864_100047681 Ga0068864_1000476814 395
76 3300005842 Ga0068858_100079228 Ga0068858_1000792283 395
77 3300005843 Ga0068860_100373840 Ga0068860_1003738401 395
78 3300005844 Ga0068862_100191564 Ga0068862_1001915642 395
79 3300006038 Ga0075365_10100994 Ga0075365_101009942 395
80 3300006042 Ga0075368_10000081 Ga0075368_100000816 395
81 3300006178 Ga0075367_10001178 Ga0075367_100011788 395
82 3300009545 Ga0105237_10034377 Ga0105237_100343772 395
83 3300009978 Ga0105148_100011 Ga0105148_1000117 395
84 3300013100 Ga0157373_10051024 Ga0157373_100510243 395
85 3300013104 Ga0157370_10044244 Ga0157370_100442445 395
86 3300013307 Ga0157372_10181124 Ga0157372_101811243 395
87 3300017792 Ga0163161_10000897 Ga0163161_1000089713 395
88 3300024225 Ga0224572_1001790 Ga0224572_10017902 395
89 3300025904 Ga0207647_10033960 Ga0207647_100339603 395
90 3300025923 Ga0207681_10029640 Ga0207681_100296402 395
91 3300025925 Ga0207650_10013514 Ga0207650_100135143 395
92 3300025933 Ga0207706_10018867 Ga0207706_100188673 395
93 3300025940 Ga0207691_10047049 Ga0207691_100470492 395
94 3300026035 Ga0207703_10054666 Ga0207703_100546663 395
95 3300026041 Ga0207639_10000323 Ga0207639_1000032322 395
96 3300026067 Ga0207678_10000068 Ga0207678_1000006844 395
97 3300026078 Ga0207702_10001343 Ga0207702_1000134320 395
98 3300026116 Ga0207674_10015731 Ga0207674_100157315 395
99 3300027866 Ga0209813_10000087 Ga0209813_100000874 395
100 3300031249 Ga0265339_10009902 Ga0265339_100099025 395
101 3300031548 Ga0307408_100130805 Ga0307408_1001308052 395
102 3300031712 Ga0265342_10001524 Ga0265342_100015249 395
103 3300031824 Ga0307413_10043361 Ga0307413_100433613 395
104 3300031824 Ga0307413_10098092 Ga0307413_100980922 395
105 3300031852 Ga0307410_10030984 Ga0307410_100309843 395
106 3300031852 Ga0307410_10079395 Ga0307410_100793952 395
107 3300031901 Ga0307406_10018783 Ga0307406_100187834 395
108 3300031901 Ga0307406_10024626 Ga0307406_100246262 395
109 3300031911 Ga0307412_10016299 Ga0307412_100162992 395
110 3300031995 Ga0307409_100010670 Ga0307409_1000106702 395
111 3300032004 Ga0307414_10000384 Ga0307414_1000038419 395
112 3300032004 Ga0307414_10016354 Ga0307414_100163546 395
113 3300032005 Ga0307411_10174874 Ga0307411_101748741 395
114 3300032126 Ga0307415_100079976 Ga0307415_1000799762 395
115 3300039062 Ga0400483_117325 Ga0400483_117325_835_2073 395
116 3300046453 Ga0495627_029130 Ga0495627_029130_162_1370 395
117 3300046460 Ga0495638_0000068 Ga0495638_0000068_38674_39891 395
118 3300046491 Ga0495584_0099823 Ga0495584_0099823_145_1344 395
119 3300046512 Ga0495610_0000083 Ga0495610_0000083_67987_69195 395
120 3300046519 Ga0495632_0000023 Ga0495632_0000023_30150_31358 395
121 3300046520 Ga0495637_0000836 Ga0495637_0000836_10537_11745 395
122 3300046520 Ga0495637_0002707 Ga0495637_0002707_4487_5695 395
123 3300046522 Ga0495643_0000038 Ga0495643_0000038_30780_31988 395
124 3300046524 Ga0495648_0014476 Ga0495648_0014476_3278_4486 395
125 3300046525 Ga0495663_0000019 Ga0495663_0000019_30150_31358 395
126 3300046558 Ga0495633_0000568 Ga0495633_0000568_25683_26891 395
127 3300046558 Ga0495633_0000772 Ga0495633_0000772_10292_11500 395
128 3300046692 Ga0495671_0000027 Ga0495671_0000027_204024_205232 395
129 3300047470 Ga0495681_0000279 Ga0495681_0000279_27196_28404 395
130 3300047470 Ga0495681_0001314 Ga0495681_0001314_9429_10637 395
131 3300047472 Ga0495686_0043393 Ga0495686_0043393_134_1342 395
132 3300047472 Ga0495686_0135686 Ga0495686_0135686_117_1325 395
133 3300048904 Ga0496101_0163654 Ga0496101_0163654_343_1563 395
134 3300048910 Ga0496107_0053577 Ga0496107_0053577_805_2025 395
135 3300048911 Ga0496108_0001376 Ga0496108_0001376_9123_10331 395
136 3300048911 Ga0496108_0161783 Ga0496108_0161783_315_1523 395
137 3300048912 Ga0496109_0031922 Ga0496109_0031922_874_2082 395
138 3300048912 Ga0496109_0118634 Ga0496109_0118634_439_1659 395
139 3300048913 Ga0496110_0059966 Ga0496110_0059966_893_2113 395
140 3300048914 Ga0496111_0069902 Ga0496111_0069902_84_1292 395
141 3300048914 Ga0496111_0070351 Ga0496111_0070351_366_1586 395
142 3300048914 Ga0496111_0179786 Ga0496111_0179786_183_1391 395
143 3300048919 Ga0496116_0036936 Ga0496116_0036936_1375_2583 395
144 3300048920 Ga0496117_0008437 Ga0496117_0008437_7209_8417 395
145 3300048924 Ga0496121_0000997 Ga0496121_0000997_20524_21732 395
146 3300048925 Ga0496122_0014017 Ga0496122_0014017_6541_7749 395
147 3300048926 Ga0496123_0058162 Ga0496123_0058162_912_2120 395
148 3300048927 Ga0496124_0037793 Ga0496124_0037793_1961_3169 395
149 3300048927 Ga0496124_0046604 Ga0496124_0046604_218_1426 395
150 3300048928 Ga0496125_0012656 Ga0496125_0012656_6583_7791 395
151 3300048928 Ga0496125_0039327 Ga0496125_0039327_629_1837 395
152 3300049459 Ga0495678_041432 Ga0495678_041432_306_1514 395
153 3300049663 Ga0501223_000086 Ga0501223_000086_8883_10091 395
154 3300049705 Ga0501225_0000034 Ga0501225_0000034_9195_10403 395
155 3300049705 Ga0501225_0004061 Ga0501225_0004061_1103_2311 395
156 3300050492 nmdc:mga0yw44_86222_c1 nmdc:mga0yw44_86222_c1_703_1920 395
157 3300050494 nmdc:mga06z11_191_c1 nmdc:mga06z11_191_c1_2473_3681 395
158 3300050495 nmdc:mga04h51_1507_c1 nmdc:mga04h51_1507_c1_1751_2959 395
159 iso_pu_bacteria 2897803580 2897808820 395
160 3300031238 Ga0265332_10074841 Ga0265332_100748411 396
161 3300060353 Ga0501082_0081619 Ga0501082_0081619_397_1611 396
162 3300003578 Ga0006562J51391_1067863 Ga0006562J51391_10678635 397
163 3300031235 Ga0265330_10008622 Ga0265330_100086226 397
164 3300031249 Ga0265339_10030179 Ga0265339_100301793 397
165 3300031595 Ga0265313_10009363 Ga0265313_100093632 397
166 3300049583 Ga0501067_0029418 Ga0501067_0029418_159_1376 397
167 3300053104 Ga0500556_0001106 Ga0500556_0001106_7672_8904 397
168 iso_pu_bacteria 2522572158 2523103374 397
169 3300005347 Ga0070668_100077535 Ga0070668_1000775353 398
170 3300005444 Ga0070694_100114519 Ga0070694_1001145192 398
171 3300005545 Ga0070695_100012328 Ga0070695_1000123281 398
172 3300005563 Ga0068855_100384727 Ga0068855_1003847271 398
173 3300005617 Ga0068859_100327190 Ga0068859_1003271901 398
174 3300005842 Ga0068858_100039621 Ga0068858_1000396214 398
175 3300006852 Ga0075433_10351223 Ga0075433_103512231 398
176 3300006871 Ga0075434_100073207 Ga0075434_1000732074 398
177 3300006931 Ga0097620_100327185 Ga0097620_1003271851 398
178 3300009094 Ga0111539_10119085 Ga0111539_101190851 398
179 3300009553 Ga0105249_10317834 Ga0105249_103178342 398
180 3300013297 Ga0157378_10126805 Ga0157378_101268053 398
181 3300014326 Ga0157380_10278078 Ga0157380_102780781 398
182 3300025933 Ga0207706_10151650 Ga0207706_101516502 398
183 3300026075 Ga0207708_10110697 Ga0207708_101106972 398
184 3300028380 Ga0268265_10248948 Ga0268265_102489481 398
185 3300048903 Ga0496100_0075119 Ga0496100_0075119_407_1639 398
186 3300048904 Ga0496101_0087126 Ga0496101_0087126_638_1870 398
187 3300048905 Ga0496102_0004386 Ga0496102_0004386_850_2082 398
188 3300048910 Ga0496107_0091247 Ga0496107_0091247_964_2196 398
189 3300048912 Ga0496109_0025751 Ga0496109_0025751_1124_2356 398
190 3300049568 Ga0501031_0020670 Ga0501031_0020670_329_1561 398
191 3300049573 Ga0501037_0063493 Ga0501037_0063493_733_1965 398
192 3300049574 Ga0501038_0151076 Ga0501038_0151076_192_1424 398
193 3300049576 Ga0501040_0010464 Ga0501040_0010464_3303_4535 398
194 3300049578 Ga0501042_0020429 Ga0501042_0020429_2745_3977 398
195 3300049580 Ga0501046_0084981 Ga0501046_0084981_532_1764 398
196 3300049584 Ga0501068_0054371 Ga0501068_0054371_85_1317 398
197 3300049584 Ga0501068_0151515 Ga0501068_0151515_193_1425 398
198 3300049587 Ga0501071_0099093 Ga0501071_0099093_725_1957 398
199 3300049743 Ga0501081_0008911 Ga0501081_0008911_2053_3285 398
200 3300049822 Ga0501035_0021051 Ga0501035_0021051_2847_4079 398
201 3300049823 Ga0501044_0064936 Ga0501044_0064936_36_1241 398
202 3300049823 Ga0501044_0257729 Ga0501044_0257729_96_1328 398
203 3300049824 Ga0501045_0041254 Ga0501045_0041254_1936_3168 398
204 3300050510 nmdc:mga06r32_51949_c1 nmdc:mga06r32_51949_c1_55_1287 398
205 3300050512 nmdc:mga0n895_111546_c1 nmdc:mga0n895_111546_c1_1262_2494 398
206 3300054114 Ga0501084_0013172 Ga0501084_0013172_5407_6639 398
207 3300060353 Ga0501082_0056526 Ga0501082_0056526_53_1285 398
208 iso_pu_bacteria 2597490356 2599102682 398
209 iso_pu_bacteria 2846952575 2846955403 398
210 iso_pu_bacteria 2848858292 2848861046 398
211 iso_pu_bacteria 2941485952 2941488062 398
212 3300031249 Ga0265339_10000033 Ga0265339_1000003379 399
213 3300031595 Ga0265313_10000049 Ga0265313_1000004920 399
214 3300044712 Ga0453684_0043018 Ga0453684_0043018_1906_3159 399
215 3300046463 Ga0495653_0044231 Ga0495653_0044231_2125_3333 399
216 3300046491 Ga0495584_0005586 Ga0495584_0005586_1008_2246 399
217 3300049576 Ga0501040_0188160 Ga0501040_0188160_31_1278 399
218 3300049577 Ga0501041_0016047 Ga0501041_0016047_792_2039 399
219 3300049579 Ga0501043_0077737 Ga0501043_0077737_980_2227 399
220 3300049580 Ga0501046_0143179 Ga0501046_0143179_284_1531 399
221 3300049582 Ga0501048_0173710 Ga0501048_0173710_117_1361 399
222 3300049582 Ga0501048_0178656 Ga0501048_0178656_10_1257 399
223 3300049587 Ga0501071_0045980 Ga0501071_0045980_954_2198 399
224 3300049587 Ga0501071_0086331 Ga0501071_0086331_727_1974 399
225 3300049588 Ga0501072_0054742 Ga0501072_0054742_1365_2609 399
226 3300049588 Ga0501072_0111234 Ga0501072_0111234_767_2014 399
227 3300049590 Ga0501074_0080618 Ga0501074_0080618_554_1798 399
228 3300049591 Ga0501075_0039262 Ga0501075_0039262_1379_2626 399
229 3300049592 Ga0501076_0175704 Ga0501076_0175704_123_1370 399
230 3300049593 Ga0501077_0056525 Ga0501077_0056525_694_1938 399
231 3300049741 Ga0501079_0005234 Ga0501079_0005234_266_1513 399
232 3300049743 Ga0501081_0055428 Ga0501081_0055428_271_1518 399
233 3300049743 Ga0501081_0100093 Ga0501081_0100093_239_1486 399
234 3300049744 Ga0501083_0143314 Ga0501083_0143314_276_1523 399
235 3300060353 Ga0501082_0110314 Ga0501082_0110314_564_1808 399
236 3300060353 Ga0501082_0168915 Ga0501082_0168915_521_1768 399
237 iso_pu_bacteria 2511231221 2512038276 399
238 iso_pu_bacteria 2643221574 2643884552 399
239 iso_pu_bacteria 2643221663 2644351387 399
240 iso_pu_bacteria 2643221699 2644549064 399
241 iso_pu_bacteria 2643221699 2644553206 399
242 iso_pu_bacteria 2928972540 2928974528 399
243 iso_pu_bacteria 2977240413 2977243451 399
244 iso_pu_bacteria 8054002106 8054002866 399
245 3300005719 Ga0068861_100204099 Ga0068861_1002040992 400
246 3300026088 Ga0207641_10202093 Ga0207641_102020932 400
247 3300026118 Ga0207675_100248502 Ga0207675_1002485022 400
248 3300049581 Ga0501047_0085660 Ga0501047_0085660_1771_3009 400
249 3300049589 Ga0501073_0044455 Ga0501073_0044455_876_2105 400
250 3300049589 Ga0501073_0062686 Ga0501073_0062686_1349_2578 400
251 3300060353 Ga0501082_0094166 Ga0501082_0094166_782_2011 400
252 iso_pu_bacteria 2523231067 2523468637 400
253 iso_pu_bacteria 2738543031 2739349867 400
254 3300025913 Ga0207695_10002758 Ga0207695_1000275813 401
255 3300031241 Ga0265325_10001319 Ga0265325_1000131921 401
256 3300031247 Ga0265340_10022161 Ga0265340_100221615 401
257 3300031595 Ga0265313_10005321 Ga0265313_100053217 401
258 3300031712 Ga0265342_10038344 Ga0265342_100383442 401
259 3300048905 Ga0496102_0100039 Ga0496102_0100039_885_2135 401
260 3300048907 Ga0496104_0035169 Ga0496104_0035169_2920_4170 401
261 3300048907 Ga0496104_0195705 Ga0496104_0195705_647_1888 401
262 3300048908 Ga0496105_0157161 Ga0496105_0157161_356_1597 401
263 3300048908 Ga0496105_0185565 Ga0496105_0185565_146_1396 401
264 3300048911 Ga0496108_0119819 Ga0496108_0119819_182_1432 401
265 3300048915 Ga0496112_0188480 Ga0496112_0188480_717_1967 401
266 3300048917 Ga0496114_0038158 Ga0496114_0038158_561_1802 401
267 3300048918 Ga0496115_0022496 Ga0496115_0022496_2020_3270 401
268 3300049742 Ga0501080_0025088 Ga0501080_0025088_2007_3275 401
269 3300049744 Ga0501083_0003365 Ga0501083_0003365_9700_10950 401
270 3300053077 Ga0495601_0011070 Ga0495601_0011070_3013_4254 401
271 3300053730 Ga0500645_001143 Ga0500645_001143_8763_10025 401
272 3300054114 Ga0501084_0014344 Ga0501084_0014344_3491_4759 401
273 3300060353 Ga0501082_0010751 Ga0501082_0010751_782_2050 401
274 iso_pu_bacteria 2643221651 2644290964 401
275 iso_pu_bacteria 2919073203 2919073820 401
276 iso_pu_bacteria 8016557553 8016557647 401
277 3300005336 Ga0070680_100018386 Ga0070680_1000183862 402
278 3300005347 Ga0070668_100218410 Ga0070668_1002184101 402
279 3300005435 Ga0070714_100092438 Ga0070714_1000924382 402
280 3300005437 Ga0070710_10009606 Ga0070710_100096066 402
281 3300005458 Ga0070681_10041751 Ga0070681_100417512 402
282 3300005530 Ga0070679_100062201 Ga0070679_1000622015 402
283 3300005983 Ga0081540_1020079 Ga0081540_10200792 402
284 3300006038 Ga0075365_10130557 Ga0075365_101305572 402
285 3300006042 Ga0075368_10041013 Ga0075368_100410132 402
286 3300006175 Ga0070712_100004886 Ga0070712_1000048864 402
287 3300006846 Ga0075430_100006643 Ga0075430_1000066437 402
288 3300006871 Ga0075434_100019228 Ga0075434_1000192285 402
289 3300009094 Ga0111539_10084487 Ga0111539_100844871 402
290 3300025915 Ga0207693_10002841 Ga0207693_100028414 402
291 3300025926 Ga0207659_10176117 Ga0207659_101761171 402
292 3300025940 Ga0207691_10305640 Ga0207691_103056401 402
293 3300027907 Ga0207428_10049012 Ga0207428_100490125 402
294 3300028380 Ga0268265_10167932 Ga0268265_101679322 402
295 3300032004 Ga0307414_10014276 Ga0307414_100142762 402
296 3300035695 Ga0373927_0114486 Ga0373927_0114486_491_1711 402
297 3300047322 Ga0495680_0214928 Ga0495680_0214928_62_1306 402
298 3300048907 Ga0496104_0065269 Ga0496104_0065269_1674_2933 402
299 3300048919 Ga0496116_0013402 Ga0496116_0013402_4096_5346 402
300 3300049570 Ga0501033_0005988 Ga0501033_0005988_1508_2755 402
301 3300049744 Ga0501083_0021302 Ga0501083_0021302_1003_2217 402
302 3300050508 nmdc:mga09592_14616_c1 nmdc:mga09592_14616_c1_4475_5701 402
303 3300050509 nmdc:mga0qj67_392_c1 nmdc:mga0qj67_392_c1_1927_3168 402
304 3300050511 nmdc:mga08y16_66523_c1 nmdc:mga08y16_66523_c1_512_1756 402
305 3300003781 Ga0055536_1002707 Ga0055536_10027072 403
306 3300005445 Ga0070708_100131067 Ga0070708_1001310672 403
307 3300005536 Ga0070697_100036459 Ga0070697_1000364594 403
308 3300006028 Ga0070717_10145022 Ga0070717_101450222 403
309 3300006048 Ga0075363_100108057 Ga0075363_1001080571 403
310 3300006051 Ga0075364_10052321 Ga0075364_100523212 403
311 3300006186 Ga0075369_10028880 Ga0075369_100288802 403
312 3300006353 Ga0075370_10089375 Ga0075370_100893751 403
313 3300010159 Ga0099796_10010230 Ga0099796_100102303 403
314 3300013102 Ga0157371_10001665 Ga0157371_100016655 403
315 3300013104 Ga0157370_10038949 Ga0157370_100389493 403
316 3300013105 Ga0157369_10044416 Ga0157369_100444164 403
317 3300025292 Ga0209676_1000140 Ga0209676_100014042 403
318 3300025292 Ga0209676_1001860 Ga0209676_100186012 403
319 3300025304 Ga0209257_1000292 Ga0209257_100029248 403
320 3300025910 Ga0207684_10096437 Ga0207684_100964371 403
321 3300031901 Ga0307406_10004876 Ga0307406_100048766 403
322 3300031911 Ga0307412_10002217 Ga0307412_100022173 403
323 3300032004 Ga0307414_10030847 Ga0307414_100308472 403
324 3300032004 Ga0307414_10053668 Ga0307414_100536683 403
325 3300039447 Ga0436361_0722936 Ga0436361_0722936_927_2195 403
326 3300046512 Ga0495610_0035906 Ga0495610_0035906_1062_2315 403
327 3300046558 Ga0495633_0002060 Ga0495633_0002060_10483_11739 403
328 3300046694 Ga0495649_0000048 Ga0495649_0000048_113074_114327 403
329 3300048903 Ga0496100_0208748 Ga0496100_0208748_60_1280 403
330 3300048909 Ga0496106_0000236 Ga0496106_0000236_5893_7110 403
331 3300048910 Ga0496107_0017289 Ga0496107_0017289_3206_4426 403
332 3300048911 Ga0496108_0000902 Ga0496108_0000902_9418_10635 403
333 3300048912 Ga0496109_0000224 Ga0496109_0000224_42216_43433 403
334 3300048913 Ga0496110_0074428 Ga0496110_0074428_1606_2850 403
335 3300048915 Ga0496112_0002281 Ga0496112_0002281_3511_4728 403
336 3300048916 Ga0496113_0022653 Ga0496113_0022653_2120_3337 403
337 3300048918 Ga0496115_0003837 Ga0496115_0003837_7119_8372 403
338 3300048925 Ga0496122_0073705 Ga0496122_0073705_620_1876 403
339 3300049571 Ga0501034_0394862 Ga0501034_0394862_56_1288 403
340 3300049580 Ga0501046_0000033 Ga0501046_0000033_81975_83228 403
341 3300050490 nmdc:mga03n38_74979_c1 nmdc:mga03n38_74979_c1_37_1260 403
342 3300050492 nmdc:mga0yw44_58568_c1 nmdc:mga0yw44_58568_c1_281_1504 403
343 3300050516 nmdc:mga0sz30_21157_c1 nmdc:mga0sz30_21157_c1_1097_2320 403
344 3300053091 Ga0500647_0002985 Ga0500647_0002985_4849_6132 403
345 3300053093 Ga0500651_0039297 Ga0500651_0039297_1363_2616 403
346 3300053156 Ga0500622_0009386 Ga0500622_0009386_133_1425 403
347 3300001979 JGI24740J21852_10007775 JGI24740J21852_100077754 404
348 3300001990 JGI24737J22298_10001802 JGI24737J22298_100018027 404
349 3300002067 JGI24735J21928_10014573 JGI24735J21928_100145732 404
350 3300005336 Ga0070680_100084167 Ga0070680_1000841672 404
351 3300005539 Ga0068853_100006249 Ga0068853_1000062495 404
352 3300005539 Ga0068853_100044038 Ga0068853_1000440382 404
353 3300005539 Ga0068853_100178455 Ga0068853_1001784552 404
354 3300005563 Ga0068855_100042726 Ga0068855_1000427262 404
355 3300005577 Ga0068857_100017914 Ga0068857_1000179144 404
356 3300005577 Ga0068857_100037829 Ga0068857_1000378295 404
357 3300005578 Ga0068854_100018065 Ga0068854_1000180652 404
358 3300005578 Ga0068854_100022998 Ga0068854_1000229982 404
359 3300005614 Ga0068856_100015929 Ga0068856_1000159297 404
360 3300005614 Ga0068856_100020679 Ga0068856_1000206793 404
361 3300005616 Ga0068852_100082220 Ga0068852_1000822203 404
362 3300005834 Ga0068851_10002682 Ga0068851_100026829 404
363 3300005983 Ga0081540_1001046 Ga0081540_100104611 404
364 3300006048 Ga0075363_100072497 Ga0075363_1000724973 404
365 3300006175 Ga0070712_100079757 Ga0070712_1000797572 404
366 3300006178 Ga0075367_10010807 Ga0075367_100108077 404
367 3300009093 Ga0105240_10013995 Ga0105240_1001399510 404
368 3300009093 Ga0105240_10036311 Ga0105240_100363116 404
369 3300009093 Ga0105240_10430801 Ga0105240_104308011 404
370 3300009098 Ga0105245_10054168 Ga0105245_100541683 404
371 3300009174 Ga0105241_10009743 Ga0105241_100097436 404
372 3300009177 Ga0105248_10225181 Ga0105248_102251812 404
373 3300009545 Ga0105237_10316943 Ga0105237_103169432 404
374 3300009551 Ga0105238_10000905 Ga0105238_100009057 404
375 3300009551 Ga0105238_10011422 Ga0105238_100114224 404
376 3300010375 Ga0105239_10048612 Ga0105239_100486124 404
377 3300010375 Ga0105239_10179237 Ga0105239_101792372 404
378 3300025903 Ga0207680_10039933 Ga0207680_100399333 404
379 3300025904 Ga0207647_10000871 Ga0207647_100008716 404
380 3300025911 Ga0207654_10000058 Ga0207654_1000005837 404
381 3300025913 Ga0207695_10000453 Ga0207695_1000045323 404
382 3300025913 Ga0207695_10023280 Ga0207695_100232807 404
383 3300025914 Ga0207671_10225179 Ga0207671_102251792 404
384 3300025915 Ga0207693_10000434 Ga0207693_1000043426 404
385 3300025915 Ga0207693_10060072 Ga0207693_100600723 404
386 3300025917 Ga0207660_10126476 Ga0207660_101264762 404
387 3300025924 Ga0207694_10082128 Ga0207694_100821282 404
388 3300025927 Ga0207687_10005296 Ga0207687_100052968 404
389 3300025934 Ga0207686_10148339 Ga0207686_101483391 404
390 3300025949 Ga0207667_10020988 Ga0207667_100209887 404
391 3300025949 Ga0207667_10045340 Ga0207667_100453406 404
392 3300025986 Ga0207658_10058728 Ga0207658_100587282 404
393 3300026023 Ga0207677_10017935 Ga0207677_100179352 404
394 3300026041 Ga0207639_10021124 Ga0207639_100211243 404
395 3300026041 Ga0207639_10047997 Ga0207639_100479973 404
396 3300026078 Ga0207702_10000004 Ga0207702_10000004220 404
397 3300026078 Ga0207702_10081442 Ga0207702_100814421 404
398 3300026116 Ga0207674_10013733 Ga0207674_100137335 404
399 3300026116 Ga0207674_10032534 Ga0207674_100325345 404
400 3300026142 Ga0207698_10057221 Ga0207698_100572213 404
401 3300028023 Ga0265357_1000262 Ga0265357_10002622 404
402 3300035113 Ga0373936_0041141 Ga0373936_0041141_52_1314 404
403 3300035116 Ga0373945_0003922 Ga0373945_0003922_2039_3301 404
404 3300035170 Ga0373943_0001179 Ga0373943_0001179_878_2140 404
405 3300035171 Ga0373946_0009494 Ga0373946_0009494_1686_2948 404
406 3300035692 Ga0373935_0044940 Ga0373935_0044940_517_1779 404
407 3300035695 Ga0373927_0000863 Ga0373927_0000863_21533_22795 404
408 3300035695 Ga0373927_0011948 Ga0373927_0011948_2546_3808 404
409 3300035725 Ga0373947_0002147 Ga0373947_0002147_9280_10542 404
410 3300035725 Ga0373947_0006972 Ga0373947_0006972_2948_4210 404
411 3300037068 Ga0373925_0008281 Ga0373925_0008281_1243_2505 404
412 3300037068 Ga0373925_0142309 Ga0373925_0142309_471_1691 404
413 3300039437 Ga0436365_0840419 Ga0436365_0840419_480_1709 404
414 3300039437 Ga0436365_1336443 Ga0436365_1336443_508_1770 404
415 3300039438 Ga0436360_0873896 Ga0436360_0873896_25_1287 404
416 3300039447 Ga0436361_0500089 Ga0436361_0500089_1463_2725 404
417 3300039450 Ga0436363_0887763 Ga0436363_0887763_1792_3012 404
418 3300046462 Ga0495651_0062022 Ga0495651_0062022_439_1701 404
419 3300046476 Ga0495662_0001111 Ga0495662_0001111_484_1746 404
420 3300046477 Ga0495664_0000554 Ga0495664_0000554_8331_9593 404
421 3300046514 Ga0495618_0003921 Ga0495618_0003921_3347_4609 404
422 3300046514 Ga0495618_0127837 Ga0495618_0127837_112_1374 404
423 3300046517 Ga0495630_0006717 Ga0495630_0006717_851_2113 404
424 3300046517 Ga0495630_0032184 Ga0495630_0032184_1901_3163 404
425 3300046526 Ga0495666_0006120 Ga0495666_0006120_4411_5673 404
426 3300046529 Ga0495652_0049806 Ga0495652_0049806_1612_2874 404
427 3300046535 Ga0495586_0019585 Ga0495586_0019585_1531_2793 404
428 3300046543 Ga0495645_0003212 Ga0495645_0003212_7405_8667 404
429 3300046690 Ga0495624_0095759 Ga0495624_0095759_281_1543 404
430 3300047319 Ga0495674_0054449 Ga0495674_0054449_1823_3085 404
431 3300047320 Ga0495672_0008846 Ga0495672_0008846_1299_2519 404
432 3300047321 Ga0495676_0018139 Ga0495676_0018139_3489_4751 404
433 3300048903 Ga0496100_0114614 Ga0496100_0114614_173_1483 404
434 3300048916 Ga0496113_0083590 Ga0496113_0083590_772_2082 404
435 3300048929 Ga0496126_0023175 Ga0496126_0023175_1838_3058 404
436 3300049569 Ga0501032_0000303 Ga0501032_0000303_26726_27946 404
437 3300049570 Ga0501033_0000881 Ga0501033_0000881_6051_7271 404
438 3300049571 Ga0501034_0000250 Ga0501034_0000250_72615_73835 404
439 3300049571 Ga0501034_0222330 Ga0501034_0222330_217_1461 404
440 3300049572 Ga0501036_0000098 Ga0501036_0000098_51359_52579 404
441 3300049573 Ga0501037_0000092 Ga0501037_0000092_21802_23022 404
442 3300049574 Ga0501038_0002041 Ga0501038_0002041_11275_12495 404
443 3300049575 Ga0501039_0000085 Ga0501039_0000085_23692_24912 404
444 3300049579 Ga0501043_0000460 Ga0501043_0000460_6456_7676 404
445 3300049580 Ga0501046_0000624 Ga0501046_0000624_6038_7258 404
446 3300049580 Ga0501046_0052907 Ga0501046_0052907_54_1274 404
447 3300049581 Ga0501047_0000022 Ga0501047_0000022_178648_179868 404
448 3300049581 Ga0501047_0268507 Ga0501047_0268507_167_1387 404
449 3300049582 Ga0501048_0000292 Ga0501048_0000292_15028_16248 404
450 3300049583 Ga0501067_0003139 Ga0501067_0003139_4746_5966 404
451 3300049584 Ga0501068_0003364 Ga0501068_0003364_738_1958 404
452 3300049586 Ga0501070_0014140 Ga0501070_0014140_412_1632 404
453 3300049586 Ga0501070_0173269 Ga0501070_0173269_337_1557 404
454 3300049588 Ga0501072_0027316 Ga0501072_0027316_2544_3764 404
455 3300049589 Ga0501073_0000109 Ga0501073_0000109_20892_22112 404
456 3300049590 Ga0501074_0000250 Ga0501074_0000250_26602_27822 404
457 3300049742 Ga0501080_0006971 Ga0501080_0006971_1552_2772 404
458 3300049742 Ga0501080_0261239 Ga0501080_0261239_134_1486 404
459 3300049744 Ga0501083_0000618 Ga0501083_0000618_538_1758 404
460 3300049822 Ga0501035_0001489 Ga0501035_0001489_8420_9640 404
461 3300049823 Ga0501044_0000072 Ga0501044_0000072_65245_66465 404
462 3300049824 Ga0501045_0081425 Ga0501045_0081425_48_1268 404
463 3300050490 nmdc:mga03n38_55789_c1 nmdc:mga03n38_55789_c1_213_1475 404
464 3300050512 nmdc:mga0n895_15793_c1 nmdc:mga0n895_15793_c1_3529_4749 404
465 3300053078 Ga0495612_0003354 Ga0495612_0003354_802_2064 404
466 3300053078 Ga0495612_0036858 Ga0495612_0036858_372_1634 404
467 3300053084 Ga0495595_0001522 Ga0495595_0001522_1137_2399 404
468 3300053085 Ga0495619_0008836 Ga0495619_0008836_4307_5569 404
469 3300053085 Ga0495619_0029292 Ga0495619_0029292_493_1755 404
470 3300053093 Ga0500651_0059817 Ga0500651_0059817_1045_2352 404
471 3300053094 Ga0500566_0007133 Ga0500566_0007133_3272_4579 404
472 3300053096 Ga0500641_0024126 Ga0500641_0024126_336_1562 404
473 3300053125 Ga0500618_004828 Ga0500618_004828_1785_3092 404
474 3300053136 Ga0500559_0000398 Ga0500559_0000398_25518_26825 404
475 3300053136 Ga0500559_0000465 Ga0500559_0000465_23572_24792 404
476 3300053139 Ga0500568_0005085 Ga0500568_0005085_3110_4360 404
477 3300053157 Ga0500624_004059 Ga0500624_004059_203_1510 404
478 3300053178 Ga0500637_0037235 Ga0500637_0037235_812_2119 404
479 3300054114 Ga0501084_0001321 Ga0501084_0001321_7634_8854 404
480 3300060353 Ga0501082_0007370 Ga0501082_0007370_3915_5201 404
481 3300060353 Ga0501082_0042143 Ga0501082_0042143_964_2184 404
482 iso_pu_bacteria 2643221547 2643757928 404
483 3300005330 Ga0070690_100146333 Ga0070690_1001463331 405
484 3300005353 Ga0070669_100059546 Ga0070669_1000595462 405
485 3300005354 Ga0070675_100083141 Ga0070675_1000831412 405
486 3300005355 Ga0070671_100001856 Ga0070671_10000185616 405
487 3300005435 Ga0070714_100003288 Ga0070714_10000328812 405
488 3300005435 Ga0070714_100078156 Ga0070714_1000781562 405
489 3300005436 Ga0070713_100117010 Ga0070713_1001170102 405
490 3300005457 Ga0070662_100042252 Ga0070662_1000422522 405
491 3300005548 Ga0070665_100090650 Ga0070665_1000906502 405
492 3300005841 Ga0068863_100019233 Ga0068863_1000192335 405
493 3300005842 Ga0068858_100121676 Ga0068858_1001216761 405
494 3300006028 Ga0070717_10044309 Ga0070717_100443092 405
495 3300006847 Ga0075431_100125075 Ga0075431_1001250752 405
496 3300024227 Ga0228598_1000469 Ga0228598_10004694 405
497 3300025906 Ga0207699_10038570 Ga0207699_100385702 405
498 3300025908 Ga0207643_10081668 Ga0207643_100816682 405
499 3300025915 Ga0207693_10017239 Ga0207693_100172394 405
500 3300025929 Ga0207664_10025593 Ga0207664_100255932 405
501 3300025929 Ga0207664_10033479 Ga0207664_100334795 405
502 3300025931 Ga0207644_10010275 Ga0207644_100102754 405
503 3300025933 Ga0207706_10060739 Ga0207706_100607392 405
504 3300025986 Ga0207658_10036433 Ga0207658_100364332 405
505 3300031616 Ga0307508_10077726 Ga0307508_100777262 405
506 3300039437 Ga0436365_0160122 Ga0436365_0160122_45_1265 405
507 3300046454 Ga0495592_0044206 Ga0495592_0044206_1499_2809 405
508 3300046459 Ga0495629_0056006 Ga0495629_0056006_754_2064 405
509 3300046475 Ga0495639_0075596 Ga0495639_0075596_220_1530 405
510 3300046543 Ga0495645_0021402 Ga0495645_0021402_2725_4035 405
511 3300046675 Ga0495657_0086915 Ga0495657_0086915_586_1896 405
512 3300046679 Ga0495623_0009474 Ga0495623_0009474_605_1915 405
513 3300047322 Ga0495680_0106452 Ga0495680_0106452_658_1968 405
514 3300048911 Ga0496108_0098577 Ga0496108_0098577_847_2148 405
515 3300048915 Ga0496112_0044183 Ga0496112_0044183_976_2277 405
516 3300049586 Ga0501070_0049761 Ga0501070_0049761_1125_2480 405
517 3300053085 Ga0495619_0093107 Ga0495619_0093107_601_1911 405
518 3300005329 Ga0070683_100040594 Ga0070683_1000405942 406
519 3300005330 Ga0070690_100015826 Ga0070690_1000158265 406
520 3300005337 Ga0070682_100022863 Ga0070682_1000228631 406
521 3300005340 Ga0070689_100001113 Ga0070689_1000011134 406
522 3300005343 Ga0070687_100007702 Ga0070687_1000077024 406
523 3300005344 Ga0070661_100065128 Ga0070661_1000651282 406
524 3300005345 Ga0070692_10022160 Ga0070692_100221605 406
525 3300005347 Ga0070668_100161410 Ga0070668_1001614101 406
526 3300005354 Ga0070675_100018009 Ga0070675_1000180094 406
527 3300005355 Ga0070671_100010831 Ga0070671_1000108315 406
528 3300005356 Ga0070674_100026532 Ga0070674_1000265325 406
529 3300005364 Ga0070673_100038893 Ga0070673_1000388934 406
530 3300005365 Ga0070688_100005939 Ga0070688_1000059395 406
531 3300005367 Ga0070667_100029214 Ga0070667_1000292144 406
532 3300005439 Ga0070711_100028231 Ga0070711_1000282315 406
533 3300005455 Ga0070663_100086303 Ga0070663_1000863032 406
534 3300005456 Ga0070678_100031601 Ga0070678_1000316014 406
535 3300005459 Ga0068867_100019113 Ga0068867_1000191135 406
536 3300005466 Ga0070685_10008870 Ga0070685_100088705 406
537 3300005518 Ga0070699_100123881 Ga0070699_1001238812 406
538 3300005543 Ga0070672_100014289 Ga0070672_1000142892 406
539 3300005578 Ga0068854_100016650 Ga0068854_1000166504 406
540 3300005615 Ga0070702_100008194 Ga0070702_1000081944 406
541 3300005617 Ga0068859_100025009 Ga0068859_1000250095 406
542 3300005719 Ga0068861_100024500 Ga0068861_1000245004 406
543 3300005842 Ga0068858_100022418 Ga0068858_1000224185 406
544 3300005844 Ga0068862_100024602 Ga0068862_1000246024 406
545 3300005983 Ga0081540_1014999 Ga0081540_10149995 406
546 3300005985 Ga0081539_10012546 Ga0081539_100125465 406
547 3300006038 Ga0075365_10021515 Ga0075365_100215154 406
548 3300006042 Ga0075368_10021543 Ga0075368_100215432 406
549 3300006237 Ga0097621_100020748 Ga0097621_1000207484 406
550 3300006353 Ga0075370_10038028 Ga0075370_100380281 406
551 3300006358 Ga0068871_100016774 Ga0068871_1000167745 406
552 3300006881 Ga0068865_100025070 Ga0068865_1000250702 406
553 3300006914 Ga0075436_100185210 Ga0075436_1001852101 406
554 3300006931 Ga0097620_100025009 Ga0097620_1000250094 406
555 3300009094 Ga0111539_10089724 Ga0111539_100897245 406
556 3300009147 Ga0114129_10011617 Ga0114129_100116176 406
557 3300009176 Ga0105242_10028336 Ga0105242_100283363 406
558 3300009177 Ga0105248_10040996 Ga0105248_100409964 406
559 3300009545 Ga0105237_10028064 Ga0105237_100280644 406
560 3300009551 Ga0105238_10037417 Ga0105238_100374175 406
561 3300009553 Ga0105249_10015086 Ga0105249_100150867 406
562 3300013297 Ga0157378_10120957 Ga0157378_101209572 406
563 3300013308 Ga0157375_10035061 Ga0157375_100350614 406
564 3300014745 Ga0157377_10004874 Ga0157377_100048747 406
565 3300014968 Ga0157379_10027886 Ga0157379_100278864 406
566 3300014969 Ga0157376_10295269 Ga0157376_102952691 406
567 3300025903 Ga0207680_10008657 Ga0207680_100086574 406
568 3300025908 Ga0207643_10005672 Ga0207643_100056724 406
569 3300025918 Ga0207662_10010378 Ga0207662_100103782 406
570 3300025923 Ga0207681_10064101 Ga0207681_100641012 406
571 3300025925 Ga0207650_10031312 Ga0207650_100313122 406
572 3300025931 Ga0207644_10038217 Ga0207644_100382175 406
573 3300025932 Ga0207690_10018700 Ga0207690_100187003 406
574 3300025933 Ga0207706_10038206 Ga0207706_100382065 406
575 3300025936 Ga0207670_10017680 Ga0207670_100176804 406
576 3300025940 Ga0207691_10001627 Ga0207691_1000162720 406
577 3300025941 Ga0207711_10101018 Ga0207711_101010181 406
578 3300025942 Ga0207689_10007012 Ga0207689_1000701210 406
579 3300025945 Ga0207679_10015638 Ga0207679_100156384 406
580 3300025961 Ga0207712_10184011 Ga0207712_101840111 406
581 3300025972 Ga0207668_10007545 Ga0207668_100075455 406
582 3300025981 Ga0207640_10019201 Ga0207640_100192013 406
583 3300026035 Ga0207703_10221093 Ga0207703_102210932 406
584 3300026067 Ga0207678_10020051 Ga0207678_100200513 406
585 3300026075 Ga0207708_10001502 Ga0207708_1000150210 406
586 3300026089 Ga0207648_10006668 Ga0207648_100066686 406
587 3300026095 Ga0207676_10018586 Ga0207676_100185864 406
588 3300026121 Ga0207683_10012333 Ga0207683_100123334 406
589 3300026142 Ga0207698_10074967 Ga0207698_100749672 406
590 3300028380 Ga0268265_10011597 Ga0268265_100115974 406
591 3300031727 Ga0316576_10016776 Ga0316576_100167764 406
592 3300035725 Ga0373947_0040717 Ga0373947_0040717_1375_2658 406
593 3300037068 Ga0373925_0068818 Ga0373925_0068818_16_1299 406
594 3300039447 Ga0436361_0760231 Ga0436361_0760231_133_1401 406
595 3300044842 Ga0466957_0058841 Ga0466957_0058841_977_2197 406
596 3300045049 Ga0466959_0078594 Ga0466959_0078594_304_1524 406
597 3300045836 Ga0466958_0029784 Ga0466958_0029784_1557_2777 406
598 3300046455 Ga0495603_0101032 Ga0495603_0101032_386_1669 406
599 3300046461 Ga0495641_0066355 Ga0495641_0066355_326_1609 406
600 3300046473 Ga0495582_0005890 Ga0495582_0005890_488_1771 406
601 3300046473 Ga0495582_0034182 Ga0495582_0034182_953_2230 406
602 3300046477 Ga0495664_0082802 Ga0495664_0082802_283_1533 406
603 3300046523 Ga0495644_0015905 Ga0495644_0015905_935_2218 406
604 3300046533 Ga0495640_0143041 Ga0495640_0143041_136_1413 406
605 3300046537 Ga0495598_0000513 Ga0495598_0000513_2620_3903 406
606 3300046683 Ga0495658_0032995 Ga0495658_0032995_175_1458 406
607 3300046690 Ga0495624_0015346 Ga0495624_0015346_431_1714 406
608 3300046691 Ga0495670_0004845 Ga0495670_0004845_96_1379 406
609 3300048090 Ga0495615_0021522 Ga0495615_0021522_157_1440 406
610 3300048903 Ga0496100_0006029 Ga0496100_0006029_3383_4660 406
611 3300048904 Ga0496101_0003104 Ga0496101_0003104_1736_3013 406
612 3300048904 Ga0496101_0011363 Ga0496101_0011363_2548_3825 406
613 3300048905 Ga0496102_0008462 Ga0496102_0008462_6861_8138 406
614 3300048905 Ga0496102_0024214 Ga0496102_0024214_1730_3007 406
615 3300048906 Ga0496103_0016536 Ga0496103_0016536_334_1611 406
616 3300048907 Ga0496104_0006107 Ga0496104_0006107_1856_3133 406
617 3300048907 Ga0496104_0031473 Ga0496104_0031473_334_1611 406
618 3300048908 Ga0496105_0001999 Ga0496105_0001999_2817_4094 406
619 3300048908 Ga0496105_0005181 Ga0496105_0005181_8493_9770 406
620 3300048909 Ga0496106_0011510 Ga0496106_0011510_255_1532 406
621 3300048909 Ga0496106_0016650 Ga0496106_0016650_2238_3515 406
622 3300048910 Ga0496107_0028396 Ga0496107_0028396_1590_2867 406
623 3300048911 Ga0496108_0000347 Ga0496108_0000347_1775_3052 406
624 3300048911 Ga0496108_0013218 Ga0496108_0013218_426_1703 406
625 3300048912 Ga0496109_0005863 Ga0496109_0005863_2062_3339 406
626 3300048913 Ga0496110_0029719 Ga0496110_0029719_2062_3339 406
627 3300048913 Ga0496110_0035608 Ga0496110_0035608_2837_4114 406
628 3300048914 Ga0496111_0009006 Ga0496111_0009006_1863_3140 406
629 3300048914 Ga0496111_0021601 Ga0496111_0021601_986_2263 406
630 3300048915 Ga0496112_0002294 Ga0496112_0002294_1895_3172 406
631 3300048915 Ga0496112_0006289 Ga0496112_0006289_1881_3158 406
632 3300048916 Ga0496113_0025192 Ga0496113_0025192_598_1875 406
633 3300048916 Ga0496113_0058625 Ga0496113_0058625_1415_2692 406
634 3300048918 Ga0496115_0011128 Ga0496115_0011128_4881_6158 406
635 3300048918 Ga0496115_0018524 Ga0496115_0018524_898_2175 406
636 3300048922 Ga0496119_0000709 Ga0496119_0000709_116_1348 406
637 3300048925 Ga0496122_0002462 Ga0496122_0002462_23238_24470 406
638 3300049581 Ga0501047_0066110 Ga0501047_0066110_837_2087 406
639 3300049589 Ga0501073_0023706 Ga0501073_0023706_1766_3016 406
640 3300049590 Ga0501074_0013873 Ga0501074_0013873_3337_4587 406
641 3300049744 Ga0501083_0063674 Ga0501083_0063674_214_1464 406
642 3300049823 Ga0501044_0043948 Ga0501044_0043948_3185_4435 406
643 3300050495 nmdc:mga04h51_22073_c1 nmdc:mga04h51_22073_c1_62_1339 406
644 3300050507 nmdc:mga05p37_193198_c1 nmdc:mga05p37_193198_c1_146_1423 406
645 3300054114 Ga0501084_0012745 Ga0501084_0012745_3966_5216 406
646 3300060353 Ga0501082_0033077 Ga0501082_0033077_1459_2709 406
647 3300006871 Ga0075434_100167178 Ga0075434_1001671782 407
648 3300006871 Ga0075434_100451529 Ga0075434_1004515291 407
649 3300006880 Ga0075429_100121304 Ga0075429_1001213042 407
650 3300009147 Ga0114129_10075511 Ga0114129_100755115 407
651 3300025915 Ga0207693_10093857 Ga0207693_100938571 407
652 3300025915 Ga0207693_10216281 Ga0207693_102162811 407
653 3300039437 Ga0436365_1477994 Ga0436365_1477994_762_1991 407
654 3300050492 nmdc:mga0yw44_127155_c1 nmdc:mga0yw44_127155_c1_166_1452 407
655 3300050510 nmdc:mga06r32_64244_c1 nmdc:mga06r32_64244_c1_843_2090 407
656 3300050511 nmdc:mga08y16_64084_c1 nmdc:mga08y16_64084_c1_216_1460 407
657 3300050512 nmdc:mga0n895_84596_c1 nmdc:mga0n895_84596_c1_1766_2992 407
658 3300053077 Ga0495601_0053768 Ga0495601_0053768_302_1582 407
659 iso_pu_bacteria 2919450847 2919452663 407
660 3300005330 Ga0070690_100023017 Ga0070690_1000230172 408
661 3300005335 Ga0070666_10023846 Ga0070666_100238465 408
662 3300005365 Ga0070688_100028550 Ga0070688_1000285502 408
663 3300005367 Ga0070667_100205749 Ga0070667_1002057492 408
664 3300005439 Ga0070711_100166329 Ga0070711_1001663292 408
665 3300005535 Ga0070684_100070008 Ga0070684_1000700083 408
666 3300005548 Ga0070665_100077477 Ga0070665_1000774773 408
667 3300005840 Ga0068870_10131406 Ga0068870_101314061 408
668 3300006237 Ga0097621_100030501 Ga0097621_1000305015 408
669 3300006871 Ga0075434_100038177 Ga0075434_1000381779 408
670 3300006881 Ga0068865_100079228 Ga0068865_1000792282 408
671 3300009093 Ga0105240_10181196 Ga0105240_101811962 408
672 3300009545 Ga0105237_10184163 Ga0105237_101841632 408
673 3300014325 Ga0163163_10028878 Ga0163163_100288782 408
674 3300021388 Ga0213875_10000053 Ga0213875_1000005349 408
675 3300025901 Ga0207688_10048058 Ga0207688_100480581 408
676 3300025914 Ga0207671_10125535 Ga0207671_101255352 408
677 3300025915 Ga0207693_10013460 Ga0207693_100134604 408
678 3300025915 Ga0207693_10131435 Ga0207693_101314352 408
679 3300025916 Ga0207663_10170872 Ga0207663_101708722 408
680 3300025931 Ga0207644_10040569 Ga0207644_100405692 408
681 3300025933 Ga0207706_10065103 Ga0207706_100651032 408
682 3300025939 Ga0207665_10004784 Ga0207665_100047849 408
683 3300025941 Ga0207711_10009158 Ga0207711_100091582 408
684 3300025944 Ga0207661_10076806 Ga0207661_100768063 408
685 3300025944 Ga0207661_10145070 Ga0207661_101450702 408
686 3300025961 Ga0207712_10035724 Ga0207712_100357242 408
687 3300025986 Ga0207658_10169030 Ga0207658_101690301 408
688 3300026023 Ga0207677_10040031 Ga0207677_100400312 408
689 3300026075 Ga0207708_10074540 Ga0207708_100745402 408
690 3300026089 Ga0207648_10071352 Ga0207648_100713522 408
691 3300026121 Ga0207683_10028701 Ga0207683_100287013 408
692 3300031238 Ga0265332_10006574 Ga0265332_100065743 408
693 3300031247 Ga0265340_10015062 Ga0265340_100150625 408
694 3300031250 Ga0265331_10065198 Ga0265331_100651982 408
695 3300031711 Ga0265314_10022239 Ga0265314_100222395 408
696 3300031712 Ga0265342_10002635 Ga0265342_100026359 408
697 3300035691 Ga0373931_0011412 Ga0373931_0011412_2333_3592 408
698 3300035691 Ga0373931_0039871 Ga0373931_0039871_460_1695 408
699 3300037853 Ga0436364_0951864 Ga0436364_0951864_1344_2573 408
700 3300048905 Ga0496102_0145942 Ga0496102_0145942_355_1590 408
701 3300049569 Ga0501032_0123386 Ga0501032_0123386_56_1288 408
702 3300049574 Ga0501038_0052419 Ga0501038_0052419_1644_2876 408
703 3300049581 Ga0501047_0176737 Ga0501047_0176737_671_1903 408
704 3300050512 nmdc:mga0n895_311322_c1 nmdc:mga0n895_311322_c1_74_1309 408
705 3300053117 Ga0500593_043998 Ga0500593_043998_37_1278 408
706 3300005353 Ga0070669_100190929 Ga0070669_1001909291 409
707 3300005616 Ga0068852_100282240 Ga0068852_1002822402 409
708 3300005618 Ga0068864_100115096 Ga0068864_1001150962 409
709 3300006914 Ga0075436_100004004 Ga0075436_10000400413 409
710 3300009147 Ga0114129_10165358 Ga0114129_101653582 409
711 3300014325 Ga0163163_10054862 Ga0163163_100548622 409
712 3300025915 Ga0207693_10047329 Ga0207693_100473292 409
713 3300026095 Ga0207676_10039043 Ga0207676_100390434 409
714 3300028556 Ga0265337_1003660 Ga0265337_10036603 409
715 3300031595 Ga0265313_10045754 Ga0265313_100457542 409
716 3300035083 Ga0373926_0012322 Ga0373926_0012322_1584_2822 409
717 3300035113 Ga0373936_0003979 Ga0373936_0003979_1350_2588 409
718 3300035116 Ga0373945_0001064 Ga0373945_0001064_3082_4320 409
719 3300035117 Ga0373953_0025607 Ga0373953_0025607_354_1748 409
720 3300035118 Ga0373954_0000906 Ga0373954_0000906_5861_7099 409
721 3300035119 Ga0373956_0015622 Ga0373956_0015622_1446_2840 409
722 3300035170 Ga0373943_0003827 Ga0373943_0003827_1313_2551 409
723 3300035171 Ga0373946_0001814 Ga0373946_0001814_4769_6007 409
724 3300035172 Ga0373955_0000201 Ga0373955_0000201_4515_5753 409
725 3300035692 Ga0373935_0000068 Ga0373935_0000068_18924_20162 409
726 3300035695 Ga0373927_0005387 Ga0373927_0005387_4144_5382 409
727 3300035724 Ga0373933_0096591 Ga0373933_0096591_522_1754 409
728 3300035725 Ga0373947_0002537 Ga0373947_0002537_8316_9554 409
729 3300036401 Ga0373937_0000347 Ga0373937_0000347_6613_7851 409
730 3300036401 Ga0373937_0007729 Ga0373937_0007729_4147_5541 409
731 3300036401 Ga0373937_0048668 Ga0373937_0048668_2289_3521 409
732 3300037068 Ga0373925_0000081 Ga0373925_0000081_42676_43914 409
733 3300037068 Ga0373925_0061285 Ga0373925_0061285_156_1394 409
734 3300046454 Ga0495592_0000196 Ga0495592_0000196_29966_31204 409
735 3300046459 Ga0495629_0003904 Ga0495629_0003904_1965_3203 409
736 3300046462 Ga0495651_0000977 Ga0495651_0000977_6786_8024 409
737 3300046463 Ga0495653_0000193 Ga0495653_0000193_30021_31259 409
738 3300046477 Ga0495664_0000016 Ga0495664_0000016_104379_105617 409
739 3300046511 Ga0495608_0000121 Ga0495608_0000121_19018_20256 409
740 3300046514 Ga0495618_0000124 Ga0495618_0000124_19037_20275 409
741 3300046516 Ga0495628_0000018 Ga0495628_0000018_64300_65538 409
742 3300046517 Ga0495630_0002180 Ga0495630_0002180_7520_8758 409
743 3300046529 Ga0495652_0000005 Ga0495652_0000005_377453_378691 409
744 3300046533 Ga0495640_0000063 Ga0495640_0000063_23108_24346 409
745 3300046536 Ga0495587_0000134 Ga0495587_0000134_35912_37150 409
746 3300046543 Ga0495645_0000070 Ga0495645_0000070_40757_41995 409
747 3300046559 Ga0495667_0000023 Ga0495667_0000023_127268_128506 409
748 3300046642 Ga0495634_0000241 Ga0495634_0000241_6793_8031 409
749 3300046663 Ga0495635_0000045 Ga0495635_0000045_45105_46343 409
750 3300046675 Ga0495657_0001484 Ga0495657_0001484_18232_19470 409
751 3300046678 Ga0495599_0000107 Ga0495599_0000107_35944_37182 409
752 3300046679 Ga0495623_0000180 Ga0495623_0000180_31124_32362 409
753 3300046680 Ga0495646_0000027 Ga0495646_0000027_53569_54807 409
754 3300046683 Ga0495658_0020639 Ga0495658_0020639_962_2200 409
755 3300046809 Ga0495600_0000062 Ga0495600_0000062_30072_31310 409
756 3300047315 Ga0495581_0028604 Ga0495581_0028604_296_1534 409
757 3300047317 Ga0495604_0000014 Ga0495604_0000014_58564_59802 409
758 3300047319 Ga0495674_0000014 Ga0495674_0000014_181438_182676 409
759 3300047322 Ga0495680_0000779 Ga0495680_0000779_5304_6542 409
760 3300047444 Ga0495675_0000058 Ga0495675_0000058_35875_37113 409
761 3300047471 Ga0495684_0000059 Ga0495684_0000059_35916_37154 409
762 3300047673 Ga0495593_0005129 Ga0495593_0005129_2082_3320 409
763 3300048088 Ga0495602_0000017 Ga0495602_0000017_142044_143282 409
764 3300048089 Ga0495614_0020420 Ga0495614_0020420_702_1967 409
765 3300048915 Ga0496112_0266687 Ga0496112_0266687_123_1397 409
766 3300050507 nmdc:mga05p37_27999_c1 nmdc:mga05p37_27999_c1_1006_2247 409
767 3300050513 nmdc:mga0rr50_95527_c1 nmdc:mga0rr50_95527_c1_893_2299 409
768 3300050514 nmdc:mga08x19_40687_c1 nmdc:mga08x19_40687_c1_914_2161 409
769 3300053077 Ga0495601_0000016 Ga0495601_0000016_142044_143282 409
770 3300053077 Ga0495601_0057524 Ga0495601_0057524_1096_2358 409
771 3300053078 Ga0495612_0000041 Ga0495612_0000041_18981_20219 409
772 3300053084 Ga0495595_0000048 Ga0495595_0000048_9177_10415 409
773 3300053085 Ga0495619_0000050 Ga0495619_0000050_64201_65439 409
774 2209111006 2214772987 2213792940 410
775 3300000042 ARSoilYngRDRAFT_c00005 ARSoilYngRDRAFT_0000530 410
776 3300000043 ARcpr5yngRDRAFT_c000005 ARcpr5yngRDRAFT_00000539 410
777 3300000045 ARCol0oldRDRAFT_c00605 ARCol0oldRDRAFT_006052 410
778 3300000652 ARCol0yngRDRAFT_1000007 ARCol0yngRDRAFT_100000722 410
779 3300001977 JGI24746J21847_1000626 JGI24746J21847_10006265 410
780 3300001989 JGI24739J22299_10000027 JGI24739J22299_1000002728 410
781 3300001990 JGI24737J22298_10000240 JGI24737J22298_100002403 410
782 3300002070 JGI24750J21931_1000045 JGI24750J21931_10000453 410
783 3300002073 JGI24745J21846_1000029 JGI24745J21846_100002911 410
784 3300002075 JGI24738J21930_10001349 JGI24738J21930_100013498 410
785 3300002076 JGI24749J21850_1000664 JGI24749J21850_10006645 410
786 3300002126 JGI24035J26624_1000187 JGI24035J26624_10001878 410
787 3300002239 JGI24034J26672_10000122 JGI24034J26672_1000012213 410
788 3300002244 JGI24742J22300_10001443 JGI24742J22300_100014433 410
789 3300002459 JGI24751J29686_10005219 JGI24751J29686_100052193 410
790 3300005277 Ga0065716_1000007 Ga0065716_100000710 410
791 3300005290 Ga0065712_10001604 Ga0065712_100016045 410
792 3300005290 Ga0065712_10003002 Ga0065712_1000300210 410
793 3300005290 Ga0065712_10078142 Ga0065712_100781424 410
794 3300005293 Ga0065715_10000898 Ga0065715_100008984 410
795 3300005293 Ga0065715_10088997 Ga0065715_1008899713 410
796 3300005327 Ga0070658_10019947 Ga0070658_100199474 410
797 3300005327 Ga0070658_10045121 Ga0070658_100451212 410
798 3300005328 Ga0070676_10000146 Ga0070676_1000014617 410
799 3300005329 Ga0070683_100000116 Ga0070683_1000001168 410
800 3300005330 Ga0070690_100015659 Ga0070690_1000156593 410
801 3300005330 Ga0070690_100017738 Ga0070690_1000177383 410
802 3300005331 Ga0070670_100013395 Ga0070670_1000133958 410
803 3300005333 Ga0070677_10000151 Ga0070677_100001519 410
804 3300005334 Ga0068869_100000013 Ga0068869_10000001354 410
805 3300005335 Ga0070666_10041339 Ga0070666_100413394 410
806 3300005336 Ga0070680_100005855 Ga0070680_1000058557 410
807 3300005336 Ga0070680_100021486 Ga0070680_1000214863 410
808 3300005336 Ga0070680_100023840 Ga0070680_1000238405 410
809 3300005337 Ga0070682_100002742 Ga0070682_1000027422 410
810 3300005337 Ga0070682_100038543 Ga0070682_1000385433 410
811 3300005338 Ga0068868_100002546 Ga0068868_1000025465 410
812 3300005338 Ga0068868_100125794 Ga0068868_1001257942 410
813 3300005339 Ga0070660_100005178 Ga0070660_1000051785 410
814 3300005339 Ga0070660_100009730 Ga0070660_1000097305 410
815 3300005340 Ga0070689_100145685 Ga0070689_1001456852 410
816 3300005341 Ga0070691_10059130 Ga0070691_100591302 410
817 3300005343 Ga0070687_100003954 Ga0070687_1000039546 410
818 3300005343 Ga0070687_100004416 Ga0070687_1000044166 410
819 3300005344 Ga0070661_100000228 Ga0070661_10000022822 410
820 3300005345 Ga0070692_10001025 Ga0070692_100010253 410
821 3300005353 Ga0070669_100000368 Ga0070669_10000036816 410
822 3300005354 Ga0070675_100000752 Ga0070675_1000007522 410
823 3300005355 Ga0070671_100000142 Ga0070671_10000014241 410
824 3300005356 Ga0070674_100001056 Ga0070674_1000010569 410
825 3300005364 Ga0070673_100000045 Ga0070673_10000004539 410
826 3300005364 Ga0070673_100071329 Ga0070673_1000713293 410
827 3300005366 Ga0070659_100000183 Ga0070659_10000018324 410
828 3300005367 Ga0070667_100013162 Ga0070667_1000131628 410
829 3300005367 Ga0070667_100309758 Ga0070667_1003097581 410
830 3300005406 Ga0070703_10001614 Ga0070703_100016147 410
831 3300005436 Ga0070713_100030794 Ga0070713_1000307942 410
832 3300005437 Ga0070710_10031023 Ga0070710_100310231 410
833 3300005438 Ga0070701_10009585 Ga0070701_100095852 410
834 3300005440 Ga0070705_100060076 Ga0070705_1000600763 410
835 3300005441 Ga0070700_100041846 Ga0070700_1000418462 410
836 3300005444 Ga0070694_100026598 Ga0070694_1000265983 410
837 3300005455 Ga0070663_100001069 Ga0070663_10000106910 410
838 3300005455 Ga0070663_100037221 Ga0070663_1000372213 410
839 3300005456 Ga0070678_100001753 Ga0070678_10000175310 410
840 3300005457 Ga0070662_100063974 Ga0070662_1000639742 410
841 3300005458 Ga0070681_10009946 Ga0070681_100099465 410
842 3300005458 Ga0070681_10014427 Ga0070681_100144277 410
843 3300005458 Ga0070681_10043818 Ga0070681_100438182 410
844 3300005459 Ga0068867_100000160 Ga0068867_10000016021 410
845 3300005530 Ga0070679_100006152 Ga0070679_1000061529 410
846 3300005530 Ga0070679_100020075 Ga0070679_1000200755 410
847 3300005530 Ga0070679_100040234 Ga0070679_1000402345 410
848 3300005530 Ga0070679_100045419 Ga0070679_1000454193 410
849 3300005530 Ga0070679_100076376 Ga0070679_1000763761 410
850 3300005530 Ga0070679_100128935 Ga0070679_1001289352 410
851 3300005535 Ga0070684_100000352 Ga0070684_1000003529 410
852 3300005535 Ga0070684_100079467 Ga0070684_1000794672 410
853 3300005539 Ga0068853_100003900 Ga0068853_10000390013 410
854 3300005543 Ga0070672_100000016 Ga0070672_1000000165 410
855 3300005543 Ga0070672_100085665 Ga0070672_1000856652 410
856 3300005544 Ga0070686_100001103 Ga0070686_1000011032 410
857 3300005545 Ga0070695_100002919 Ga0070695_1000029192 410
858 3300005545 Ga0070695_100003518 Ga0070695_1000035184 410
859 3300005545 Ga0070695_100068989 Ga0070695_1000689892 410
860 3300005546 Ga0070696_100030786 Ga0070696_1000307862 410
861 3300005549 Ga0070704_100001007 Ga0070704_1000010076 410
862 3300005549 Ga0070704_100036603 Ga0070704_1000366033 410
863 3300005563 Ga0068855_100010817 Ga0068855_1000108172 410
864 3300005563 Ga0068855_100055219 Ga0068855_1000552192 410
865 3300005563 Ga0068855_100055244 Ga0068855_1000552443 410
866 3300005564 Ga0070664_100000067 Ga0070664_1000000679 410
867 3300005577 Ga0068857_100003846 Ga0068857_10000384611 410
868 3300005578 Ga0068854_100000131 Ga0068854_10000013121 410
869 3300005614 Ga0068856_100057977 Ga0068856_1000579772 410
870 3300005615 Ga0070702_100000810 Ga0070702_1000008108 410
871 3300005617 Ga0068859_100015494 Ga0068859_1000154944 410
872 3300005618 Ga0068864_100001095 Ga0068864_10000109520 410
873 3300005718 Ga0068866_10002457 Ga0068866_100024577 410
874 3300005719 Ga0068861_100000241 Ga0068861_10000024126 410
875 3300005719 Ga0068861_100084806 Ga0068861_1000848063 410
876 3300005840 Ga0068870_10000110 Ga0068870_100001109 410
877 3300005841 Ga0068863_100004900 Ga0068863_10000490013 410
878 3300005842 Ga0068858_100042243 Ga0068858_1000422434 410
879 3300005842 Ga0068858_100042547 Ga0068858_1000425473 410
880 3300005843 Ga0068860_100001050 Ga0068860_10000105029 410
881 3300005844 Ga0068862_100023587 Ga0068862_1000235872 410
882 3300005844 Ga0068862_100037899 Ga0068862_1000378993 410
883 3300005937 Ga0081455_10000002 Ga0081455_10000002313 410
884 3300006178 Ga0075367_10018295 Ga0075367_100182952 410
885 3300006237 Ga0097621_100012044 Ga0097621_1000120449 410
886 3300006237 Ga0097621_100022669 Ga0097621_1000226694 410
887 3300006358 Ga0068871_100028631 Ga0068871_1000286314 410
888 3300006358 Ga0068871_100039933 Ga0068871_1000399332 410
889 3300006852 Ga0075433_10001079 Ga0075433_1000107915 410
890 3300006871 Ga0075434_100013980 Ga0075434_10001398010 410
891 3300006881 Ga0068865_100000209 Ga0068865_1000002092 410
892 3300006931 Ga0097620_100015494 Ga0097620_1000154944 410
893 3300007076 Ga0075435_100056907 Ga0075435_1000569071 410
894 3300009011 Ga0105251_10025625 Ga0105251_100256254 410
895 3300009094 Ga0111539_10000941 Ga0111539_1000094126 410
896 3300009094 Ga0111539_10001081 Ga0111539_100010819 410
897 3300009098 Ga0105245_10000090 Ga0105245_1000009010 410
898 3300009098 Ga0105245_10240932 Ga0105245_102409321 410
899 3300009101 Ga0105247_10002972 Ga0105247_100029727 410
900 3300009101 Ga0105247_10008124 Ga0105247_100081246 410
901 3300009148 Ga0105243_10017356 Ga0105243_100173566 410
902 3300009148 Ga0105243_10044255 Ga0105243_100442554 410
903 3300009148 Ga0105243_10140875 Ga0105243_101408752 410
904 3300009174 Ga0105241_10000053 Ga0105241_1000005359 410
905 3300009176 Ga0105242_10011145 Ga0105242_1001114510 410
906 3300009176 Ga0105242_10055680 Ga0105242_100556803 410
907 3300009177 Ga0105248_10000934 Ga0105248_1000093426 410
908 3300009177 Ga0105248_10010774 Ga0105248_100107747 410
909 3300009177 Ga0105248_10179957 Ga0105248_101799572 410
910 3300009545 Ga0105237_10341401 Ga0105237_103414011 410
911 3300009551 Ga0105238_10030815 Ga0105238_100308152 410
912 3300009551 Ga0105238_10085309 Ga0105238_100853092 410
913 3300009551 Ga0105238_10099990 Ga0105238_100999903 410
914 3300009553 Ga0105249_10002035 Ga0105249_100020355 410
915 3300009553 Ga0105249_10002347 Ga0105249_100023473 410
916 3300009553 Ga0105249_10093303 Ga0105249_100933032 410
917 3300010375 Ga0105239_10002502 Ga0105239_100025025 410
918 3300010375 Ga0105239_10025540 Ga0105239_100255406 410
919 3300011119 Ga0105246_10000055 Ga0105246_100000552 410
920 3300013102 Ga0157371_10022274 Ga0157371_100222744 410
921 3300013105 Ga0157369_10070663 Ga0157369_100706632 410
922 3300013296 Ga0157374_10000476 Ga0157374_1000047631 410
923 3300013297 Ga0157378_10002229 Ga0157378_100022296 410
924 3300013306 Ga0163162_10004481 Ga0163162_100044819 410
925 3300013306 Ga0163162_10052202 Ga0163162_100522024 410
926 3300013307 Ga0157372_10004356 Ga0157372_100043568 410
927 3300013308 Ga0157375_10004478 Ga0157375_100044788 410
928 3300013308 Ga0157375_10008267 Ga0157375_100082672 410
929 3300014325 Ga0163163_10004723 Ga0163163_1000472314 410
930 3300014325 Ga0163163_10007190 Ga0163163_100071907 410
931 3300014326 Ga0157380_10006672 Ga0157380_100066726 410
932 3300014745 Ga0157377_10000987 Ga0157377_100009879 410
933 3300014968 Ga0157379_10000805 Ga0157379_1000080514 410
934 3300014968 Ga0157379_10050365 Ga0157379_100503655 410
935 3300014968 Ga0157379_10086903 Ga0157379_100869033 410
936 3300014969 Ga0157376_10000283 Ga0157376_1000028329 410
937 3300017792 Ga0163161_10000199 Ga0163161_100001997 410
938 3300020082 Ga0206353_10275763 Ga0206353_102757632 410
939 3300025271 Ga0207666_1000469 Ga0207666_10004696 410
940 3300025271 Ga0207666_1000945 Ga0207666_10009453 410
941 3300025290 Ga0207673_1000045 Ga0207673_100004512 410
942 3300025315 Ga0207697_10000245 Ga0207697_100002453 410
943 3300025315 Ga0207697_10006821 Ga0207697_100068215 410
944 3300025885 Ga0207653_10000923 Ga0207653_100009236 410
945 3300025893 Ga0207682_10000029 Ga0207682_1000002958 410
946 3300025899 Ga0207642_10003101 Ga0207642_100031014 410
947 3300025900 Ga0207710_10006518 Ga0207710_100065183 410
948 3300025900 Ga0207710_10081259 Ga0207710_100812591 410
949 3300025901 Ga0207688_10000084 Ga0207688_1000008426 410
950 3300025901 Ga0207688_10023584 Ga0207688_100235843 410
951 3300025903 Ga0207680_10018398 Ga0207680_100183983 410
952 3300025904 Ga0207647_10005096 Ga0207647_100050964 410
953 3300025904 Ga0207647_10006412 Ga0207647_100064123 410
954 3300025907 Ga0207645_10000090 Ga0207645_1000009037 410
955 3300025907 Ga0207645_10033477 Ga0207645_100334773 410
956 3300025908 Ga0207643_10000044 Ga0207643_1000004415 410
957 3300025909 Ga0207705_10026788 Ga0207705_100267883 410
958 3300025911 Ga0207654_10004275 Ga0207654_100042758 410
959 3300025912 Ga0207707_10017706 Ga0207707_100177064 410
960 3300025912 Ga0207707_10020258 Ga0207707_100202584 410
961 3300025912 Ga0207707_10097808 Ga0207707_100978082 410
962 3300025915 Ga0207693_10052546 Ga0207693_100525462 410
963 3300025917 Ga0207660_10005635 Ga0207660_100056355 410
964 3300025917 Ga0207660_10016403 Ga0207660_100164032 410
965 3300025917 Ga0207660_10036154 Ga0207660_100361542 410
966 3300025917 Ga0207660_10085235 Ga0207660_100852351 410
967 3300025918 Ga0207662_10000544 Ga0207662_100005443 410
968 3300025918 Ga0207662_10007517 Ga0207662_100075173 410
969 3300025919 Ga0207657_10002170 Ga0207657_100021703 410
970 3300025919 Ga0207657_10005961 Ga0207657_100059619 410
971 3300025919 Ga0207657_10054105 Ga0207657_100541053 410
972 3300025920 Ga0207649_10000260 Ga0207649_1000026030 410
973 3300025921 Ga0207652_10008473 Ga0207652_100084735 410
974 3300025921 Ga0207652_10011429 Ga0207652_100114294 410
975 3300025921 Ga0207652_10047793 Ga0207652_100477933 410
976 3300025923 Ga0207681_10000154 Ga0207681_1000015446 410
977 3300025923 Ga0207681_10057776 Ga0207681_100577763 410
978 3300025924 Ga0207694_10033540 Ga0207694_100335406 410
979 3300025924 Ga0207694_10076501 Ga0207694_100765013 410
980 3300025925 Ga0207650_10003395 Ga0207650_100033957 410
981 3300025926 Ga0207659_10000258 Ga0207659_1000025829 410
982 3300025926 Ga0207659_10013822 Ga0207659_100138224 410
983 3300025929 Ga0207664_10040886 Ga0207664_100408864 410
984 3300025931 Ga0207644_10027515 Ga0207644_100275152 410
985 3300025932 Ga0207690_10002042 Ga0207690_100020429 410
986 3300025932 Ga0207690_10178287 Ga0207690_101782872 410
987 3300025933 Ga0207706_10003023 Ga0207706_1000302311 410
988 3300025933 Ga0207706_10110759 Ga0207706_101107591 410
989 3300025935 Ga0207709_10000372 Ga0207709_1000037216 410
990 3300025936 Ga0207670_10004247 Ga0207670_1000424711 410
991 3300025936 Ga0207670_10026412 Ga0207670_100264123 410
992 3300025937 Ga0207669_10000019 Ga0207669_1000001954 410
993 3300025938 Ga0207704_10000759 Ga0207704_1000075913 410
994 3300025940 Ga0207691_10000882 Ga0207691_100008823 410
995 3300025940 Ga0207691_10082848 Ga0207691_100828482 410
996 3300025941 Ga0207711_10001673 Ga0207711_100016732 410
997 3300025941 Ga0207711_10021680 Ga0207711_100216806 410
998 3300025942 Ga0207689_10000228 Ga0207689_1000022840 410
999 3300025944 Ga0207661_10000107 Ga0207661_1000010723 410
1000 3300025945 Ga0207679_10000026 Ga0207679_1000002657 410
1001 3300025949 Ga0207667_10007974 Ga0207667_100079743 410
1002 3300025949 Ga0207667_10071293 Ga0207667_100712934 410
1003 3300025949 Ga0207667_10194573 Ga0207667_101945732 410
1004 3300025960 Ga0207651_10000069 Ga0207651_1000006945 410
1005 3300025961 Ga0207712_10000242 Ga0207712_1000024227 410
1006 3300025961 Ga0207712_10018876 Ga0207712_100188765 410
1007 3300025972 Ga0207668_10000049 Ga0207668_1000004929 410
1008 3300025972 Ga0207668_10052263 Ga0207668_100522632 410
1009 3300025981 Ga0207640_10000234 Ga0207640_1000023413 410
1010 3300025986 Ga0207658_10000804 Ga0207658_100008042 410
1011 3300025986 Ga0207658_10269219 Ga0207658_102692192 410
1012 3300026023 Ga0207677_10049799 Ga0207677_100497992 410
1013 3300026035 Ga0207703_10034429 Ga0207703_100344293 410
1014 3300026041 Ga0207639_10000413 Ga0207639_100004133 410
1015 3300026041 Ga0207639_10017058 Ga0207639_100170582 410
1016 3300026067 Ga0207678_10000920 Ga0207678_100009203 410
1017 3300026067 Ga0207678_10060722 Ga0207678_100607223 410
1018 3300026067 Ga0207678_10081589 Ga0207678_100815892 410
1019 3300026075 Ga0207708_10014245 Ga0207708_100142457 410
1020 3300026075 Ga0207708_10014309 Ga0207708_100143093 410
1021 3300026088 Ga0207641_10000669 Ga0207641_1000066913 410
1022 3300026089 Ga0207648_10009806 Ga0207648_100098063 410
1023 3300026089 Ga0207648_10073831 Ga0207648_100738313 410
1024 3300026095 Ga0207676_10003679 Ga0207676_100036799 410
1025 3300026095 Ga0207676_10052240 Ga0207676_100522401 410
1026 3300026116 Ga0207674_10000882 Ga0207674_1000088211 410
1027 3300026116 Ga0207674_10070999 Ga0207674_100709993 410
1028 3300026118 Ga0207675_100014892 Ga0207675_1000148923 410
1029 3300026118 Ga0207675_100056431 Ga0207675_1000564313 410
1030 3300026118 Ga0207675_100268177 Ga0207675_1002681771 410
1031 3300026121 Ga0207683_10000653 Ga0207683_1000065329 410
1032 3300026142 Ga0207698_10000977 Ga0207698_1000097715 410
1033 3300026142 Ga0207698_10194176 Ga0207698_101941762 410
1034 3300027543 Ga0209999_1009022 Ga0209999_10090222 410
1035 3300027617 Ga0210002_1001945 Ga0210002_10019454 410
1036 3300027665 Ga0209983_1003607 Ga0209983_10036076 410
1037 3300027695 Ga0209966_1000652 Ga0209966_10006524 410
1038 3300027907 Ga0207428_10000130 Ga0207428_1000013058 410
1039 3300027907 Ga0207428_10000286 Ga0207428_1000028645 410
1040 3300028380 Ga0268265_10002575 Ga0268265_100025754 410
1041 3300028381 Ga0268264_10046150 Ga0268264_100461505 410
1042 3300031241 Ga0265325_10023154 Ga0265325_100231543 410
1043 3300031250 Ga0265331_10056121 Ga0265331_100561212 410
1044 3300031595 Ga0265313_10039878 Ga0265313_100398782 410
1045 3300031711 Ga0265314_10019730 Ga0265314_100197303 410
1046 3300031712 Ga0265342_10000149 Ga0265342_1000014953 410
1047 3300034816 Ga0373930_0000159 Ga0373930_0000159_5009_6241 410
1048 3300034818 Ga0373950_0001078 Ga0373950_0001078_1573_2805 410
1049 3300034819 Ga0373958_0000305 Ga0373958_0000305_3111_4343 410
1050 3300034820 Ga0373959_0000743 Ga0373959_0000743_1032_2264 410
1051 3300034957 Ga0373938_0000024 Ga0373938_0000024_2980_4212 410
1052 3300034957 Ga0373938_0001010 Ga0373938_0001010_2411_3643 410
1053 3300035083 Ga0373926_0004308 Ga0373926_0004308_1616_2884 410
1054 3300035085 Ga0373929_0000274 Ga0373929_0000274_5534_6766 410
1055 3300035085 Ga0373929_0005708 Ga0373929_0005708_528_1760 410
1056 3300035086 Ga0373934_0013351 Ga0373934_0013351_205_1473 410
1057 3300035088 Ga0373940_0000029 Ga0373940_0000029_11673_12905 410
1058 3300035089 Ga0373944_0011320 Ga0373944_0011320_1142_2389 410
1059 3300035091 Ga0373951_0000391 Ga0373951_0000391_5545_6777 410
1060 3300035091 Ga0373951_0000779 Ga0373951_0000779_1073_2305 410
1061 3300035111 Ga0373923_0001398 Ga0373923_0001398_4489_5730 410
1062 3300035111 Ga0373923_0034751 Ga0373923_0034751_615_1883 410
1063 3300035112 Ga0373932_0000515 Ga0373932_0000515_5520_6752 410
1064 3300035112 Ga0373932_0002870 Ga0373932_0002870_1450_2682 410
1065 3300035112 Ga0373932_0025991 Ga0373932_0025991_335_1579 410
1066 3300035114 Ga0373939_0001312 Ga0373939_0001312_2917_4149 410
1067 3300035114 Ga0373939_0003941 Ga0373939_0003941_515_1747 410
1068 3300035115 Ga0373941_0001774 Ga0373941_0001774_1578_2810 410
1069 3300035115 Ga0373941_0038096 Ga0373941_0038096_125_1372 410
1070 3300035116 Ga0373945_0000654 Ga0373945_0000654_8333_9574 410
1071 3300035119 Ga0373956_0008585 Ga0373956_0008585_1695_2963 410
1072 3300035119 Ga0373956_0019147 Ga0373956_0019147_1553_2794 410
1073 3300035120 Ga0373957_0006119 Ga0373957_0006119_1648_2916 410
1074 3300035120 Ga0373957_0073568 Ga0373957_0073568_89_1330 410
1075 3300035121 Ga0373960_0000932 Ga0373960_0000932_1601_2833 410
1076 3300035121 Ga0373960_0006664 Ga0373960_0006664_1079_2326 410
1077 3300035170 Ga0373943_0061106 Ga0373943_0061106_141_1382 410
1078 3300035171 Ga0373946_0033652 Ga0373946_0033652_419_1660 410
1079 3300035207 Ga0373942_0000286 Ga0373942_0000286_7839_9071 410
1080 3300035241 Ga0373961_0000298 Ga0373961_0000298_15956_17188 410
1081 3300035241 Ga0373961_0004205 Ga0373961_0004205_1668_2900 410
1082 3300035242 Ga0373962_0000887 Ga0373962_0000887_71_1303 410
1083 3300035242 Ga0373962_0001502 Ga0373962_0001502_1003_2235 410
1084 3300035691 Ga0373931_0001002 Ga0373931_0001002_9368_10600 410
1085 3300035691 Ga0373931_0027265 Ga0373931_0027265_304_1575 410
1086 3300035692 Ga0373935_0023692 Ga0373935_0023692_2347_3609 410
1087 3300035692 Ga0373935_0044129 Ga0373935_0044129_555_1823 410
1088 3300035695 Ga0373927_0026187 Ga0373927_0026187_1266_2534 410
1089 3300035724 Ga0373933_0037084 Ga0373933_0037084_1025_2266 410
1090 3300037068 Ga0373925_0005678 Ga0373925_0005678_3942_5189 410
1091 3300037068 Ga0373925_0007759 Ga0373925_0007759_4542_5804 410
1092 3300037068 Ga0373925_0009149 Ga0373925_0009149_5264_6505 410
1093 3300037068 Ga0373925_0053408 Ga0373925_0053408_619_1887 410
1094 3300044712 Ga0453684_0094777 Ga0453684_0094777_1298_2530 410
1095 3300045051 Ga0451576_0013266 Ga0451576_0013266_1402_2634 410
1096 3300046452 Ga0495617_024736 Ga0495617_024736_688_1929 410
1097 3300046454 Ga0495592_0030502 Ga0495592_0030502_1786_3027 410
1098 3300046459 Ga0495629_0001034 Ga0495629_0001034_4598_5845 410
1099 3300046459 Ga0495629_0010656 Ga0495629_0010656_4286_5527 410
1100 3300046459 Ga0495629_0054088 Ga0495629_0054088_487_1728 410
1101 3300046462 Ga0495651_0168341 Ga0495651_0168341_78_1319 410
1102 3300046463 Ga0495653_0010589 Ga0495653_0010589_4967_6235 410
1103 3300046473 Ga0495582_0004213 Ga0495582_0004213_5053_6300 410
1104 3300046475 Ga0495639_0009208 Ga0495639_0009208_1290_2531 410
1105 3300046476 Ga0495662_0002749 Ga0495662_0002749_4589_5830 410
1106 3300046476 Ga0495662_0006973 Ga0495662_0006973_539_1807 410
1107 3300046477 Ga0495664_0036496 Ga0495664_0036496_1045_2286 410
1108 3300046491 Ga0495584_0006458 Ga0495584_0006458_727_1968 410
1109 3300046492 Ga0495585_0000744 Ga0495585_0000744_3042_4283 410
1110 3300046499 Ga0495594_0008772 Ga0495594_0008772_143_1390 410
1111 3300046501 Ga0495607_0027003 Ga0495607_0027003_440_1681 410
1112 3300046506 Ga0495583_0038328 Ga0495583_0038328_458_1699 410
1113 3300046511 Ga0495608_0037362 Ga0495608_0037362_1654_2922 410
1114 3300046513 Ga0495616_0110694 Ga0495616_0110694_15_1256 410
1115 3300046517 Ga0495630_0018839 Ga0495630_0018839_1903_3144 410
1116 3300046523 Ga0495644_0002708 Ga0495644_0002708_229_1470 410
1117 3300046525 Ga0495663_0013219 Ga0495663_0013219_617_1858 410
1118 3300046529 Ga0495652_0019100 Ga0495652_0019100_201_1469 410
1119 3300046533 Ga0495640_0069336 Ga0495640_0069336_326_1594 410
1120 3300046533 Ga0495640_0165006 Ga0495640_0165006_99_1340 410
1121 3300046535 Ga0495586_0051648 Ga0495586_0051648_394_1635 410
1122 3300046536 Ga0495587_0007597 Ga0495587_0007597_4965_6233 410
1123 3300046537 Ga0495598_0009308 Ga0495598_0009308_538_1779 410
1124 3300046538 Ga0495609_0043795 Ga0495609_0043795_27_1268 410
1125 3300046559 Ga0495667_0005008 Ga0495667_0005008_1186_2454 410
1126 3300046642 Ga0495634_0014117 Ga0495634_0014117_3451_4719 410
1127 3300046663 Ga0495635_0035648 Ga0495635_0035648_1563_2831 410
1128 3300046664 Ga0495659_0002311 Ga0495659_0002311_4778_6019 410
1129 3300046674 Ga0495588_0034636 Ga0495588_0034636_76_1317 410
1130 3300046675 Ga0495657_0007068 Ga0495657_0007068_3623_4891 410
1131 3300046679 Ga0495623_0002513 Ga0495623_0002513_5869_7137 410
1132 3300046680 Ga0495646_0080435 Ga0495646_0080435_445_1686 410
1133 3300046681 Ga0495647_0004735 Ga0495647_0004735_2017_3258 410
1134 3300046689 Ga0495613_0009605 Ga0495613_0009605_1675_2922 410
1135 3300046690 Ga0495624_0053973 Ga0495624_0053973_976_2217 410
1136 3300046691 Ga0495670_0003165 Ga0495670_0003165_5040_6281 410
1137 3300046809 Ga0495600_0006032 Ga0495600_0006032_4753_6021 410
1138 3300046809 Ga0495600_0028982 Ga0495600_0028982_1913_3154 410
1139 3300046809 Ga0495600_0196222 Ga0495600_0196222_33_1274 410
1140 3300047315 Ga0495581_0034460 Ga0495581_0034460_1334_2602 410
1141 3300047315 Ga0495581_0039498 Ga0495581_0039498_275_1516 410
1142 3300047317 Ga0495604_0000613 Ga0495604_0000613_1126_2394 410
1143 3300047317 Ga0495604_0017410 Ga0495604_0017410_356_1597 410
1144 3300047319 Ga0495674_0020715 Ga0495674_0020715_4706_5947 410
1145 3300047319 Ga0495674_0108485 Ga0495674_0108485_304_1572 410
1146 3300047319 Ga0495674_0158694 Ga0495674_0158694_460_1701 410
1147 3300047322 Ga0495680_0004120 Ga0495680_0004120_11773_13014 410
1148 3300047322 Ga0495680_0005491 Ga0495680_0005491_2784_4052 410
1149 3300047322 Ga0495680_0014092 Ga0495680_0014092_476_1717 410
1150 3300047444 Ga0495675_0016655 Ga0495675_0016655_271_1539 410
1151 3300047471 Ga0495684_0000136 Ga0495684_0000136_48390_49631 410
1152 3300047673 Ga0495593_0061722 Ga0495593_0061722_325_1593 410
1153 3300048089 Ga0495614_0024753 Ga0495614_0024753_937_2178 410
1154 3300048903 Ga0496100_0000237 Ga0496100_0000237_10891_12123 410
1155 3300048904 Ga0496101_0000697 Ga0496101_0000697_17781_19013 410
1156 3300048904 Ga0496101_0013493 Ga0496101_0013493_3338_4606 410
1157 3300048904 Ga0496101_0175674 Ga0496101_0175674_286_1554 410
1158 3300048905 Ga0496102_0064232 Ga0496102_0064232_1051_2283 410
1159 3300048905 Ga0496102_0085685 Ga0496102_0085685_29_1297 410
1160 3300048905 Ga0496102_0133343 Ga0496102_0133343_1022_2290 410
1161 3300048905 Ga0496102_0133444 Ga0496102_0133444_86_1333 410
1162 3300048905 Ga0496102_0214057 Ga0496102_0214057_81_1313 410
1163 3300048906 Ga0496103_0080031 Ga0496103_0080031_177_1409 410
1164 3300048907 Ga0496104_0014689 Ga0496104_0014689_2251_3519 410
1165 3300048907 Ga0496104_0021017 Ga0496104_0021017_1599_2831 410
1166 3300048908 Ga0496105_0006825 Ga0496105_0006825_4309_5577 410
1167 3300048909 Ga0496106_0002012 Ga0496106_0002012_4367_5599 410
1168 3300048909 Ga0496106_0009101 Ga0496106_0009101_1361_2593 410
1169 3300048909 Ga0496106_0076915 Ga0496106_0076915_175_1443 410
1170 3300048910 Ga0496107_0000327 Ga0496107_0000327_13399_14631 410
1171 3300048910 Ga0496107_0014384 Ga0496107_0014384_2129_3397 410
1172 3300048910 Ga0496107_0030947 Ga0496107_0030947_1549_2781 410
1173 3300048910 Ga0496107_0078701 Ga0496107_0078701_993_2240 410
1174 3300048910 Ga0496107_0097708 Ga0496107_0097708_870_2138 410
1175 3300048911 Ga0496108_0005173 Ga0496108_0005173_2426_3658 410
1176 3300048912 Ga0496109_0000925 Ga0496109_0000925_3493_4725 410
1177 3300048912 Ga0496109_0008656 Ga0496109_0008656_3575_4807 410
1178 3300048913 Ga0496110_0010097 Ga0496110_0010097_2880_4112 410
1179 3300048913 Ga0496110_0055430 Ga0496110_0055430_1357_2589 410
1180 3300048913 Ga0496110_0250584 Ga0496110_0250584_82_1329 410
1181 3300048914 Ga0496111_0031448 Ga0496111_0031448_944_2176 410
1182 3300048915 Ga0496112_0005249 Ga0496112_0005249_2509_3741 410
1183 3300048915 Ga0496112_0133343 Ga0496112_0133343_841_2088 410
1184 3300048915 Ga0496112_0134740 Ga0496112_0134740_993_2240 410
1185 3300048915 Ga0496112_0209861 Ga0496112_0209861_334_1566 410
1186 3300048916 Ga0496113_0018979 Ga0496113_0018979_2043_3275 410
1187 3300048916 Ga0496113_0038764 Ga0496113_0038764_1824_3056 410
1188 3300048917 Ga0496114_0054406 Ga0496114_0054406_508_1740 410
1189 3300049568 Ga0501031_0058475 Ga0501031_0058475_479_1738 410
1190 3300049571 Ga0501034_0118961 Ga0501034_0118961_928_2163 410
1191 3300049575 Ga0501039_0058135 Ga0501039_0058135_185_1444 410
1192 3300049577 Ga0501041_0016276 Ga0501041_0016276_1013_2272 410
1193 3300049580 Ga0501046_0045146 Ga0501046_0045146_570_1829 410
1194 3300049581 Ga0501047_0082865 Ga0501047_0082865_1622_2860 410
1195 3300049586 Ga0501070_0020252 Ga0501070_0020252_3058_4296 410
1196 3300049590 Ga0501074_0053274 Ga0501074_0053274_290_1525 410
1197 3300049742 Ga0501080_0113678 Ga0501080_0113678_274_1509 410
1198 3300049743 Ga0501081_0103323 Ga0501081_0103323_117_1376 410
1199 3300049822 Ga0501035_0054468 Ga0501035_0054468_1808_3046 410
1200 3300049823 Ga0501044_0024914 Ga0501044_0024914_4624_5859 410
1201 3300050511 nmdc:mga08y16_14375_c1 nmdc:mga08y16_14375_c1_1893_3125 410
1202 3300050512 nmdc:mga0n895_552_c1 nmdc:mga0n895_552_c1_11010_12242 410
1203 3300050513 nmdc:mga0rr50_157675_c1 nmdc:mga0rr50_157675_c1_225_1457 410
1204 3300050513 nmdc:mga0rr50_33063_c1 nmdc:mga0rr50_33063_c1_1359_2627 410
1205 3300050515 nmdc:mga0a205_2568_c1 nmdc:mga0a205_2568_c1_1675_2907 410
1206 3300053077 Ga0495601_0002664 Ga0495601_0002664_3585_4826 410
1207 3300053077 Ga0495601_0007172 Ga0495601_0007172_756_2024 410
1208 3300053077 Ga0495601_0054340 Ga0495601_0054340_577_1818 410
1209 3300053078 Ga0495612_0010956 Ga0495612_0010956_2028_3269 410
1210 3300053078 Ga0495612_0015875 Ga0495612_0015875_664_1905 410
1211 3300053078 Ga0495612_0019036 Ga0495612_0019036_1154_2422 410
1212 3300053084 Ga0495595_0008969 Ga0495595_0008969_1807_3048 410
1213 3300053084 Ga0495595_0010099 Ga0495595_0010099_1218_2459 410
1214 3300053085 Ga0495619_0000518 Ga0495619_0000518_11381_12628 410
1215 3300053085 Ga0495619_0001220 Ga0495619_0001220_15395_16636 410
1216 3300053085 Ga0495619_0001244 Ga0495619_0001244_11655_12896 410
1217 3300053085 Ga0495619_0025575 Ga0495619_0025575_1874_3142 410

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

67

409

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k22-assembly1.cif.gz_B-2 structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis 0.8817 8 364
7mwa-assembly1.cif.gz_A crystal structure of 2-octaprenyl-6-methoxyphenol hydroxylase ubih from acinetobacter baumannii, apoenzyme 0.8744 10 377
4k22-assembly1.cif.gz_B-2 structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis 0.8699 8 364
4k22-assembly1.cif.gz_A-2 structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis 0.8697 8 367
7mwa-assembly1.cif.gz_B-2 crystal structure of 2-octaprenyl-6-methoxyphenol hydroxylase ubih from acinetobacter baumannii, apoenzyme 0.8678 8 377
ID Description Score Start End Superfamily
af_K7LAM2_371_510_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9499 266 399 3.50.50.60
af_Q54EN1_358_493_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9477 266 396 3.50.50.60
af_Q5AHZ4_349_480_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.945 274 396 3.50.50.60
4k22B02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.9371 192 275 3.30.9.10
af_Q8R1S0_347_476_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9142 274 395 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1S6XS37-F1-model_v4 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-) 0.9849 65 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A0X6ZUC7-F1-model_v4 2-octaprenyl-6-methoxyphenyl hydroxylase 0.9814 8 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A353GDC4-F1-model_v4 Ubiquinone biosynthesis hydroxylase 0.9794 8 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A561QIG5-F1-model_v4 2-octaprenyl-6-methoxyphenol hydroxylase 0.9793 8 410 GO:0004497
GO:0006744
GO:0016705
GO:0071949
AF-A0A2A6L0G5-F1-model_v4 deleted 0.979 8 410

Feature Viewer

pLDDT pTM Quality
84.76 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map