F491815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1217 | 495 | 1190 | 412 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_95527_c1|nmdc:mga0rr50_95527_c1_893_2299 |
| Length | 468 |
| Sequence | LTAEGIVTCSEWRLTRMSRRRSHRFPTDMLQRKTEPECYAAPSRGSSGTEALRMADGREQNPERVDRVEVLIAGAGFAGLALAXXXRQALGHAFAVAVVDPVLGRPVADARASAIAAAARRMFEALGVWDAVAPRAEPILDMVITDSKLGDAVRPAFLTFAGEVEEGEPFAHMVENGDVLAALSAAAQREGVALIADAVTDFSADSRKVTARLKSGAAIEAKLLVAADGARSAIRERAGIATVGWPYGQSAIVTTVAHERPHHGRAEEHFLPAGPFAILPLPENRSSIVWTESAAEAERIMALPDADFHAELEQRFGLHLGEIAVAGPRRAFSLGFAVARSFVAERLALVGDAAHAIHPIAGQGLNMGLRDVAALAEAIVDAARLGLDPGGATVLNRYQRWRRFDTMAMGLATDGLNRLFSNRSDVLRLARDLGLGLVERMPGLKRLFIREAAGLTGEVPKLLRGEAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 3 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 4 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 5 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 6 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 7 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 8 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 9 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 10 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 11 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 12 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 13 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 14 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 15 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 16 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 17 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 18 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 19 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 20 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 21 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 22 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 23 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 24 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 25 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 26 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 27 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 29 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 30 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 31 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 32 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 37 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 38 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 39 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 40 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 41 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 42 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 43 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 44 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 113 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 114 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 115 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 116 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 117 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 123 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 124 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 127 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 128 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 136 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 137 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 141 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 142 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 159 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 179 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 180 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 181 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 258 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 261 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 262 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 263 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 264 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 265 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 267 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 268 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 269 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 270 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 271 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 272 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 273 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 274 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 275 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 276 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 277 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 278 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 279 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 281 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 282 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 283 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 285 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 286 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 289 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 294 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 296 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 300 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 304 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 306 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 307 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 308 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 309 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 310 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 311 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 312 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 313 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 314 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 315 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 316 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 317 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 318 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 319 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 320 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 321 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 322 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 323 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 324 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 325 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 326 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 327 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 330 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 404 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 405 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 406 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 407 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 408 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 411 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 412 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 413 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 417 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 418 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 419 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 420 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 421 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 422 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 423 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 424 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 425 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 452 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 453 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 461 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 462 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 480 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 481 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 482 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 483 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 485 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 487 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 489 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 490 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 491 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 492 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 494 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 495 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.62 |
| Metatranscriptomes | 0.16 |
| Isolates | 2.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.78 |
| Nodule | 0.08 |
| Rhizoplane | 8.63 |
| Rhizosphere | 83.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214772987 | 2209111006 | Bacteria | 12126 |
| 2 | ARSoilYngRDRAFT_c00005 | 3300000042 | Bacteria | 35497 |
| 3 | ARcpr5yngRDRAFT_c000005 | 3300000043 | Bacteria | 45740 |
| 4 | ARCol0oldRDRAFT_c00605 | 3300000045 | Bacteria | 3172 |
| 5 | ARCol0yngRDRAFT_1000007 | 3300000652 | Bacteria | 46089 |
| 6 | JGI24736J21556_1001465 | 3300001904 | Bacteria | 4327 |
| 7 | JGI24741J21665_1000079 | 3300001915 | Bacteria | 24144 |
| 8 | JGI24746J21847_1000626 | 3300001977 | Bacteria | 5404 |
| 9 | JGI24740J21852_10003959 | 3300001979 | Bacteria | 6428 |
| 10 | JGI24740J21852_10007775 | 3300001979 | Bacteria | 4329 |
| 11 | JGI24739J22299_10000027 | 3300001989 | Bacteria | 42306 |
| 12 | JGI24739J22299_10000379 | 3300001989 | Bacteria | 15355 |
| 13 | JGI24737J22298_10000240 | 3300001990 | Bacteria | 18284 |
| 14 | JGI24737J22298_10001802 | 3300001990 | Bacteria | 7672 |
| 15 | JGI24735J21928_10000880 | 3300002067 | Bacteria | 10738 |
| 16 | JGI24735J21928_10014573 | 3300002067 | Bacteria | 2461 |
| 17 | JGI24750J21931_1000045 | 3300002070 | Bacteria | 16505 |
| 18 | JGI24745J21846_1000029 | 3300002073 | Bacteria | 9373 |
| 19 | JGI24738J21930_10001349 | 3300002075 | Bacteria | 6810 |
| 20 | JGI24738J21930_10003527 | 3300002075 | Bacteria | 3937 |
| 21 | JGI24749J21850_1000664 | 3300002076 | Bacteria | 4992 |
| 22 | JGI24035J26624_1000187 | 3300002126 | Bacteria | 5724 |
| 23 | JGI24034J26672_10000122 | 3300002239 | Bacteria | 11943 |
| 24 | JGI24742J22300_10001443 | 3300002244 | Bacteria | 3743 |
| 25 | JGI24751J29686_10005219 | 3300002459 | Bacteria | 2643 |
| 26 | Ga0006562J51391_1067863 | 3300003578 | Bacteria | 10050 |
| 27 | Ga0055536_1002707 | 3300003781 | Bacteria | 9833 |
| 28 | Ga0065716_1000007 | 3300005277 | Bacteria | 8171 |
| 29 | Ga0065704_10134305 | 3300005289 | Bacteria | 1583 |
| 30 | Ga0065712_10001604 | 3300005290 | Bacteria | 8865 |
| 31 | Ga0065712_10003002 | 3300005290 | Bacteria | 9868 |
| 32 | Ga0065712_10078142 | 3300005290 | Bacteria | 3388 |
| 33 | Ga0065715_10000898 | 3300005293 | Bacteria | 17267 |
| 34 | Ga0065715_10088997 | 3300005293 | Bacteria | 17726 |
| 35 | Ga0070658_10019947 | 3300005327 | Bacteria | 5370 |
| 36 | Ga0070658_10045121 | 3300005327 | Bacteria | 3563 |
| 37 | Ga0070676_10000146 | 3300005328 | Bacteria | 27770 |
| 38 | Ga0070683_100000116 | 3300005329 | Bacteria | 51956 |
| 39 | Ga0070683_100040594 | 3300005329 | Bacteria | 4280 |
| 40 | Ga0070690_100015659 | 3300005330 | Bacteria | 4529 |
| 41 | Ga0070690_100015826 | 3300005330 | Bacteria | 4506 |
| 42 | Ga0070690_100017738 | 3300005330 | Bacteria | 4288 |
| 43 | Ga0070690_100023017 | 3300005330 | Bacteria | 3816 |
| 44 | Ga0070690_100146333 | 3300005330 | Bacteria | 1608 |
| 45 | Ga0070670_100013395 | 3300005331 | Bacteria | 7024 |
| 46 | Ga0070677_10000151 | 3300005333 | Bacteria | 23336 |
| 47 | Ga0068869_100000013 | 3300005334 | Bacteria | 73970 |
| 48 | Ga0070666_10023846 | 3300005335 | Bacteria | 3983 |
| 49 | Ga0070666_10041339 | 3300005335 | Bacteria | 3080 |
| 50 | Ga0070680_100005855 | 3300005336 | Bacteria | 9327 |
| 51 | Ga0070680_100018386 | 3300005336 | Bacteria | 5521 |
| 52 | Ga0070680_100021486 | 3300005336 | Bacteria | 5130 |
| 53 | Ga0070680_100023840 | 3300005336 | Bacteria | 4884 |
| 54 | Ga0070680_100084167 | 3300005336 | Bacteria | 2627 |
| 55 | Ga0070682_100002742 | 3300005337 | Bacteria | 9757 |
| 56 | Ga0070682_100022863 | 3300005337 | Bacteria | 3708 |
| 57 | Ga0070682_100038543 | 3300005337 | Bacteria | 2931 |
| 58 | Ga0068868_100002546 | 3300005338 | Bacteria | 12666 |
| 59 | Ga0068868_100125794 | 3300005338 | Bacteria | 2094 |
| 60 | Ga0070660_100005178 | 3300005339 | Bacteria | 9017 |
| 61 | Ga0070660_100009730 | 3300005339 | Bacteria | 6776 |
| 62 | Ga0070689_100001113 | 3300005340 | Bacteria | 16894 |
| 63 | Ga0070689_100145685 | 3300005340 | Bacteria | 1907 |
| 64 | Ga0070691_10059130 | 3300005341 | Bacteria | 1841 |
| 65 | Ga0070687_100003954 | 3300005343 | Bacteria | 5839 |
| 66 | Ga0070687_100004416 | 3300005343 | Bacteria | 5605 |
| 67 | Ga0070687_100007702 | 3300005343 | Bacteria | 4511 |
| 68 | Ga0070661_100000228 | 3300005344 | Bacteria | 46622 |
| 69 | Ga0070661_100065128 | 3300005344 | Bacteria | 2678 |
| 70 | Ga0070692_10001025 | 3300005345 | Bacteria | 9626 |
| 71 | Ga0070692_10022160 | 3300005345 | Bacteria | 3101 |
| 72 | Ga0070668_100077535 | 3300005347 | Bacteria | 2598 |
| 73 | Ga0070668_100161410 | 3300005347 | Bacteria | 1819 |
| 74 | Ga0070668_100218410 | 3300005347 | Bacteria | 1571 |
| 75 | Ga0070669_100000368 | 3300005353 | Bacteria | 34899 |
| 76 | Ga0070669_100059546 | 3300005353 | Bacteria | 2804 |
| 77 | Ga0070669_100165881 | 3300005353 | Bacteria | 1719 |
| 78 | Ga0070669_100190929 | 3300005353 | Bacteria | 1607 |
| 79 | Ga0070675_100000752 | 3300005354 | Bacteria | 22581 |
| 80 | Ga0070675_100018009 | 3300005354 | Bacteria | 5622 |
| 81 | Ga0070675_100083141 | 3300005354 | Bacteria | 2672 |
| 82 | Ga0070671_100000142 | 3300005355 | Bacteria | 46386 |
| 83 | Ga0070671_100001856 | 3300005355 | Bacteria | 16117 |
| 84 | Ga0070671_100007494 | 3300005355 | Bacteria | 8722 |
| 85 | Ga0070671_100010831 | 3300005355 | Bacteria | 7316 |
| 86 | Ga0070671_100050533 | 3300005355 | Bacteria | 3458 |
| 87 | Ga0070674_100001056 | 3300005356 | Bacteria | 14403 |
| 88 | Ga0070674_100026532 | 3300005356 | Bacteria | 3786 |
| 89 | Ga0070673_100000045 | 3300005364 | Bacteria | 50756 |
| 90 | Ga0070673_100038893 | 3300005364 | Bacteria | 3637 |
| 91 | Ga0070673_100071329 | 3300005364 | Bacteria | 2791 |
| 92 | Ga0070688_100005939 | 3300005365 | Bacteria | 6468 |
| 93 | Ga0070688_100028550 | 3300005365 | Bacteria | 3332 |
| 94 | Ga0070659_100000183 | 3300005366 | Bacteria | 47789 |
| 95 | Ga0070667_100013162 | 3300005367 | Bacteria | 6838 |
| 96 | Ga0070667_100029214 | 3300005367 | Bacteria | 4593 |
| 97 | Ga0070667_100205749 | 3300005367 | Bacteria | 1748 |
| 98 | Ga0070667_100309758 | 3300005367 | Bacteria | 1423 |
| 99 | Ga0070703_10001614 | 3300005406 | Bacteria | 6702 |
| 100 | Ga0070714_100003288 | 3300005435 | Bacteria | 12043 |
| 101 | Ga0070714_100078156 | 3300005435 | Bacteria | 2875 |
| 102 | Ga0070714_100092438 | 3300005435 | Bacteria | 2652 |
| 103 | Ga0070713_100030794 | 3300005436 | Bacteria | 4266 |
| 104 | Ga0070713_100105678 | 3300005436 | Bacteria | 2446 |
| 105 | Ga0070713_100117010 | 3300005436 | Bacteria | 2332 |
| 106 | Ga0070710_10009606 | 3300005437 | Bacteria | 4737 |
| 107 | Ga0070710_10031023 | 3300005437 | Bacteria | 2880 |
| 108 | Ga0070701_10009585 | 3300005438 | Bacteria | 4247 |
| 109 | Ga0070711_100028231 | 3300005439 | Bacteria | 3691 |
| 110 | Ga0070711_100166329 | 3300005439 | Bacteria | 1677 |
| 111 | Ga0070705_100060076 | 3300005440 | Bacteria | 2253 |
| 112 | Ga0070700_100041846 | 3300005441 | Bacteria | 2810 |
| 113 | Ga0070694_100026598 | 3300005444 | Bacteria | 3751 |
| 114 | Ga0070694_100114519 | 3300005444 | Bacteria | 1926 |
| 115 | Ga0070708_100131067 | 3300005445 | Bacteria | 2320 |
| 116 | Ga0070663_100001069 | 3300005455 | Bacteria | 14988 |
| 117 | Ga0070663_100037221 | 3300005455 | Bacteria | 3386 |
| 118 | Ga0070663_100086303 | 3300005455 | Bacteria | 2317 |
| 119 | Ga0070678_100001753 | 3300005456 | Bacteria | 11676 |
| 120 | Ga0070678_100031601 | 3300005456 | Bacteria | 3655 |
| 121 | Ga0070662_100042252 | 3300005457 | Bacteria | 3256 |
| 122 | Ga0070662_100063974 | 3300005457 | Bacteria | 2692 |
| 123 | Ga0070681_10009946 | 3300005458 | Bacteria | 9373 |
| 124 | Ga0070681_10014427 | 3300005458 | Bacteria | 7864 |
| 125 | Ga0070681_10041751 | 3300005458 | Bacteria | 4598 |
| 126 | Ga0070681_10043818 | 3300005458 | Bacteria | 4479 |
| 127 | Ga0068867_100000160 | 3300005459 | Bacteria | 43656 |
| 128 | Ga0068867_100019113 | 3300005459 | Bacteria | 4879 |
| 129 | Ga0070685_10008870 | 3300005466 | Bacteria | 5185 |
| 130 | Ga0070685_10114232 | 3300005466 | Bacteria | 1668 |
| 131 | Ga0070706_100221789 | 3300005467 | Bacteria | 1765 |
| 132 | Ga0070699_100123881 | 3300005518 | Bacteria | 2274 |
| 133 | Ga0070679_100006152 | 3300005530 | Bacteria | 11169 |
| 134 | Ga0070679_100020075 | 3300005530 | Bacteria | 6512 |
| 135 | Ga0070679_100040234 | 3300005530 | Bacteria | 4650 |
| 136 | Ga0070679_100045419 | 3300005530 | Bacteria | 4377 |
| 137 | Ga0070679_100062201 | 3300005530 | Bacteria | 3721 |
| 138 | Ga0070679_100076376 | 3300005530 | Bacteria | 3340 |
| 139 | Ga0070679_100128935 | 3300005530 | Bacteria | 2511 |
| 140 | Ga0070684_100000352 | 3300005535 | Bacteria | 31642 |
| 141 | Ga0070684_100070008 | 3300005535 | Bacteria | 3086 |
| 142 | Ga0070684_100079467 | 3300005535 | Bacteria | 2899 |
| 143 | Ga0070697_100036459 | 3300005536 | Bacteria | 3973 |
| 144 | Ga0068853_100003900 | 3300005539 | Bacteria | 11434 |
| 145 | Ga0068853_100006249 | 3300005539 | Bacteria | 9441 |
| 146 | Ga0068853_100044038 | 3300005539 | Bacteria | 3820 |
| 147 | Ga0068853_100178455 | 3300005539 | Bacteria | 1925 |
| 148 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 149 | Ga0070672_100014289 | 3300005543 | Bacteria | 5624 |
| 150 | Ga0070672_100078359 | 3300005543 | Bacteria | 2644 |
| 151 | Ga0070672_100085665 | 3300005543 | Bacteria | 2533 |
| 152 | Ga0070686_100001103 | 3300005544 | Bacteria | 15541 |
| 153 | Ga0070695_100002919 | 3300005545 | Bacteria | 9946 |
| 154 | Ga0070695_100003518 | 3300005545 | Bacteria | 9150 |
| 155 | Ga0070695_100012328 | 3300005545 | Bacteria | 5125 |
| 156 | Ga0070695_100068989 | 3300005545 | Bacteria | 2310 |
| 157 | Ga0070696_100030786 | 3300005546 | Bacteria | 3675 |
| 158 | Ga0070665_100077477 | 3300005548 | Bacteria | 3331 |
| 159 | Ga0070665_100090650 | 3300005548 | Bacteria | 3063 |
| 160 | Ga0070704_100001007 | 3300005549 | Bacteria | 14414 |
| 161 | Ga0070704_100036603 | 3300005549 | Bacteria | 3346 |
| 162 | Ga0068855_100010817 | 3300005563 | Bacteria | 11018 |
| 163 | Ga0068855_100042726 | 3300005563 | Bacteria | 5371 |
| 164 | Ga0068855_100055219 | 3300005563 | Bacteria | 4666 |
| 165 | Ga0068855_100055244 | 3300005563 | Bacteria | 4665 |
| 166 | Ga0068855_100384727 | 3300005563 | Bacteria | 1540 |
| 167 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 168 | Ga0068857_100003846 | 3300005577 | Bacteria | 12629 |
| 169 | Ga0068857_100017914 | 3300005577 | Bacteria | 6211 |
| 170 | Ga0068857_100037829 | 3300005577 | Bacteria | 4275 |
| 171 | Ga0068854_100000131 | 3300005578 | Bacteria | 51521 |
| 172 | Ga0068854_100016650 | 3300005578 | Bacteria | 4905 |
| 173 | Ga0068854_100018065 | 3300005578 | Bacteria | 4728 |
| 174 | Ga0068854_100022998 | 3300005578 | Bacteria | 4253 |
| 175 | Ga0068854_100114930 | 3300005578 | Bacteria | 2035 |
| 176 | Ga0068856_100015929 | 3300005614 | Bacteria | 7268 |
| 177 | Ga0068856_100020679 | 3300005614 | Bacteria | 6394 |
| 178 | Ga0068856_100024647 | 3300005614 | Bacteria | 5857 |
| 179 | Ga0068856_100057977 | 3300005614 | Bacteria | 3824 |
| 180 | Ga0070702_100000810 | 3300005615 | Bacteria | 11975 |
| 181 | Ga0070702_100008194 | 3300005615 | Bacteria | 5047 |
| 182 | Ga0068852_100082220 | 3300005616 | Bacteria | 2861 |
| 183 | Ga0068852_100282240 | 3300005616 | Bacteria | 1601 |
| 184 | Ga0068859_100015494 | 3300005617 | Bacteria | 7660 |
| 185 | Ga0068859_100025009 | 3300005617 | Bacteria | 5993 |
| 186 | Ga0068859_100327190 | 3300005617 | Bacteria | 1627 |
| 187 | Ga0068864_100001095 | 3300005618 | Bacteria | 22704 |
| 188 | Ga0068864_100047681 | 3300005618 | Bacteria | 3681 |
| 189 | Ga0068864_100115096 | 3300005618 | Bacteria | 2398 |
| 190 | Ga0068866_10002457 | 3300005718 | Bacteria | 7644 |
| 191 | Ga0068861_100000241 | 3300005719 | Bacteria | 30096 |
| 192 | Ga0068861_100024500 | 3300005719 | Bacteria | 4365 |
| 193 | Ga0068861_100084806 | 3300005719 | Bacteria | 2487 |
| 194 | Ga0068861_100204099 | 3300005719 | Bacteria | 1661 |
| 195 | Ga0068851_10002682 | 3300005834 | Bacteria | 7840 |
| 196 | Ga0068870_10000110 | 3300005840 | Bacteria | 27850 |
| 197 | Ga0068870_10131406 | 3300005840 | Bacteria | 1455 |
| 198 | Ga0068863_100004900 | 3300005841 | Bacteria | 13190 |
| 199 | Ga0068863_100019233 | 3300005841 | Bacteria | 6535 |
| 200 | Ga0068858_100022418 | 3300005842 | Bacteria | 5894 |
| 201 | Ga0068858_100039621 | 3300005842 | Bacteria | 4369 |
| 202 | Ga0068858_100042243 | 3300005842 | Bacteria | 4227 |
| 203 | Ga0068858_100042547 | 3300005842 | Bacteria | 4212 |
| 204 | Ga0068858_100079228 | 3300005842 | Bacteria | 3053 |
| 205 | Ga0068858_100121676 | 3300005842 | Bacteria | 2441 |
| 206 | Ga0068860_100001050 | 3300005843 | Bacteria | 30441 |
| 207 | Ga0068860_100373840 | 3300005843 | Bacteria | 1406 |
| 208 | Ga0068862_100023587 | 3300005844 | Bacteria | 5156 |
| 209 | Ga0068862_100024602 | 3300005844 | Bacteria | 5054 |
| 210 | Ga0068862_100037899 | 3300005844 | Bacteria | 4087 |
| 211 | Ga0068862_100191564 | 3300005844 | Bacteria | 1840 |
| 212 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 213 | Ga0081540_1001046 | 3300005983 | Bacteria | 24692 |
| 214 | Ga0081540_1014999 | 3300005983 | Bacteria | 4924 |
| 215 | Ga0081540_1020079 | 3300005983 | Bacteria | 4032 |
| 216 | Ga0081539_10012546 | 3300005985 | Bacteria | 6513 |
| 217 | Ga0070717_10044309 | 3300006028 | Bacteria | 3632 |
| 218 | Ga0070717_10145022 | 3300006028 | Bacteria | 2050 |
| 219 | Ga0075365_10021515 | 3300006038 | Bacteria | 4025 |
| 220 | Ga0075365_10100994 | 3300006038 | Bacteria | 1975 |
| 221 | Ga0075365_10130557 | 3300006038 | Bacteria | 1738 |
| 222 | Ga0075368_10000081 | 3300006042 | Bacteria | 23248 |
| 223 | Ga0075368_10021543 | 3300006042 | Bacteria | 2449 |
| 224 | Ga0075368_10041013 | 3300006042 | Bacteria | 1818 |
| 225 | Ga0075363_100072497 | 3300006048 | Bacteria | 1873 |
| 226 | Ga0075363_100108057 | 3300006048 | Bacteria | 1544 |
| 227 | Ga0075364_10052321 | 3300006051 | Bacteria | 2668 |
| 228 | Ga0070712_100004886 | 3300006175 | Bacteria | 8290 |
| 229 | Ga0070712_100079757 | 3300006175 | Bacteria | 2367 |
| 230 | Ga0075367_10001178 | 3300006178 | Bacteria | 10965 |
| 231 | Ga0075367_10010807 | 3300006178 | Bacteria | 4809 |
| 232 | Ga0075367_10018295 | 3300006178 | Bacteria | 3864 |
| 233 | Ga0075369_10028880 | 3300006186 | Bacteria | 2327 |
| 234 | Ga0097621_100012044 | 3300006237 | Bacteria | 6400 |
| 235 | Ga0097621_100020748 | 3300006237 | Bacteria | 5068 |
| 236 | Ga0097621_100022669 | 3300006237 | Bacteria | 4877 |
| 237 | Ga0097621_100030501 | 3300006237 | Bacteria | 4269 |
| 238 | Ga0075370_10038028 | 3300006353 | Bacteria | 2708 |
| 239 | Ga0075370_10089375 | 3300006353 | Bacteria | 1776 |
| 240 | Ga0068871_100016774 | 3300006358 | Bacteria | 5527 |
| 241 | Ga0068871_100028631 | 3300006358 | Bacteria | 4369 |
| 242 | Ga0068871_100039933 | 3300006358 | Bacteria | 3757 |
| 243 | Ga0075430_100006643 | 3300006846 | Bacteria | 9750 |
| 244 | Ga0075431_100125075 | 3300006847 | Bacteria | 2653 |
| 245 | Ga0075433_10001079 | 3300006852 | Bacteria | 19637 |
| 246 | Ga0075433_10351223 | 3300006852 | Bacteria | 1303 |
| 247 | Ga0075434_100013980 | 3300006871 | Bacteria | 7660 |
| 248 | Ga0075434_100019228 | 3300006871 | Bacteria | 6608 |
| 249 | Ga0075434_100038177 | 3300006871 | Bacteria | 4757 |
| 250 | Ga0075434_100073207 | 3300006871 | Bacteria | 3419 |
| 251 | Ga0075434_100167178 | 3300006871 | Bacteria | 2219 |
| 252 | Ga0075434_100451529 | 3300006871 | Bacteria | 1307 |
| 253 | Ga0075429_100121304 | 3300006880 | Bacteria | 2285 |
| 254 | Ga0068865_100000209 | 3300006881 | Bacteria | 32559 |
| 255 | Ga0068865_100025070 | 3300006881 | Bacteria | 3919 |
| 256 | Ga0068865_100079228 | 3300006881 | Bacteria | 2352 |
| 257 | Ga0075436_100004004 | 3300006914 | Bacteria | 10108 |
| 258 | Ga0075436_100185210 | 3300006914 | Bacteria | 1472 |
| 259 | Ga0097620_100015494 | 3300006931 | Bacteria | 7660 |
| 260 | Ga0097620_100025009 | 3300006931 | Bacteria | 5993 |
| 261 | Ga0097620_100327185 | 3300006931 | Bacteria | 1627 |
| 262 | Ga0075435_100056907 | 3300007076 | Bacteria | 3162 |
| 263 | Ga0105251_10025625 | 3300009011 | Bacteria | 3013 |
| 264 | Ga0105240_10013995 | 3300009093 | Bacteria | 10978 |
| 265 | Ga0105240_10036311 | 3300009093 | Bacteria | 6342 |
| 266 | Ga0105240_10181196 | 3300009093 | Bacteria | 2486 |
| 267 | Ga0105240_10430801 | 3300009093 | Bacteria | 1480 |
| 268 | Ga0111539_10000941 | 3300009094 | Bacteria | 38137 |
| 269 | Ga0111539_10001081 | 3300009094 | Bacteria | 36017 |
| 270 | Ga0111539_10084487 | 3300009094 | Bacteria | 3732 |
| 271 | Ga0111539_10089724 | 3300009094 | Bacteria | 3612 |
| 272 | Ga0111539_10119085 | 3300009094 | Bacteria | 3094 |
| 273 | Ga0105245_10000090 | 3300009098 | Bacteria | 90378 |
| 274 | Ga0105245_10054168 | 3300009098 | Bacteria | 3602 |
| 275 | Ga0105245_10240932 | 3300009098 | Bacteria | 1753 |
| 276 | Ga0105247_10002972 | 3300009101 | Bacteria | 11243 |
| 277 | Ga0105247_10008124 | 3300009101 | Bacteria | 6409 |
| 278 | Ga0114129_10011617 | 3300009147 | Bacteria | 12537 |
| 279 | Ga0114129_10075511 | 3300009147 | Bacteria | 4692 |
| 280 | Ga0114129_10165358 | 3300009147 | Bacteria | 3020 |
| 281 | Ga0105243_10017356 | 3300009148 | Bacteria | 5440 |
| 282 | Ga0105243_10044255 | 3300009148 | Bacteria | 3492 |
| 283 | Ga0105243_10140875 | 3300009148 | Bacteria | 2057 |
| 284 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 285 | Ga0105241_10009743 | 3300009174 | Bacteria | 7061 |
| 286 | Ga0105242_10011145 | 3300009176 | Bacteria | 6909 |
| 287 | Ga0105242_10028336 | 3300009176 | Bacteria | 4458 |
| 288 | Ga0105242_10055680 | 3300009176 | Bacteria | 3235 |
| 289 | Ga0105248_10000934 | 3300009177 | Bacteria | 32542 |
| 290 | Ga0105248_10010774 | 3300009177 | Bacteria | 10093 |
| 291 | Ga0105248_10037593 | 3300009177 | Bacteria | 5416 |
| 292 | Ga0105248_10040996 | 3300009177 | Bacteria | 5191 |
| 293 | Ga0105248_10179957 | 3300009177 | Bacteria | 2382 |
| 294 | Ga0105248_10225181 | 3300009177 | Bacteria | 2111 |
| 295 | Ga0105237_10028064 | 3300009545 | Bacteria | 5734 |
| 296 | Ga0105237_10034377 | 3300009545 | Bacteria | 5133 |
| 297 | Ga0105237_10184163 | 3300009545 | Bacteria | 2088 |
| 298 | Ga0105237_10316943 | 3300009545 | Bacteria | 1563 |
| 299 | Ga0105237_10341401 | 3300009545 | Bacteria | 1502 |
| 300 | Ga0105238_10000905 | 3300009551 | Bacteria | 30512 |
| 301 | Ga0105238_10011422 | 3300009551 | Bacteria | 8944 |
| 302 | Ga0105238_10030815 | 3300009551 | Bacteria | 5458 |
| 303 | Ga0105238_10037417 | 3300009551 | Bacteria | 4933 |
| 304 | Ga0105238_10085309 | 3300009551 | Bacteria | 3146 |
| 305 | Ga0105238_10099990 | 3300009551 | Bacteria | 2883 |
| 306 | Ga0105249_10002035 | 3300009553 | Bacteria | 17539 |
| 307 | Ga0105249_10002347 | 3300009553 | Bacteria | 16449 |
| 308 | Ga0105249_10015086 | 3300009553 | Bacteria | 6835 |
| 309 | Ga0105249_10093303 | 3300009553 | Bacteria | 2819 |
| 310 | Ga0105249_10317834 | 3300009553 | Bacteria | 1567 |
| 311 | Ga0105148_100011 | 3300009978 | Bacteria | 30290 |
| 312 | Ga0099796_10010230 | 3300010159 | Bacteria | 2572 |
| 313 | Ga0105239_10002502 | 3300010375 | Bacteria | 23393 |
| 314 | Ga0105239_10025540 | 3300010375 | Bacteria | 6502 |
| 315 | Ga0105239_10048612 | 3300010375 | Bacteria | 4651 |
| 316 | Ga0105239_10179237 | 3300010375 | Bacteria | 2370 |
| 317 | Ga0105239_10396815 | 3300010375 | Bacteria | 1561 |
| 318 | Ga0105246_10000055 | 3300011119 | Bacteria | 45431 |
| 319 | Ga0157373_10051024 | 3300013100 | Bacteria | 2946 |
| 320 | Ga0157371_10001665 | 3300013102 | Bacteria | 22686 |
| 321 | Ga0157371_10022274 | 3300013102 | Bacteria | 4646 |
| 322 | Ga0157370_10038949 | 3300013104 | Bacteria | 4597 |
| 323 | Ga0157370_10044244 | 3300013104 | Bacteria | 4281 |
| 324 | Ga0157369_10044416 | 3300013105 | Bacteria | 4837 |
| 325 | Ga0157369_10070663 | 3300013105 | Bacteria | 3750 |
| 326 | Ga0157374_10000476 | 3300013296 | Bacteria | 36354 |
| 327 | Ga0157378_10002229 | 3300013297 | Bacteria | 17200 |
| 328 | Ga0157378_10120957 | 3300013297 | Bacteria | 2413 |
| 329 | Ga0157378_10126805 | 3300013297 | Bacteria | 2358 |
| 330 | Ga0163162_10004481 | 3300013306 | Bacteria | 13458 |
| 331 | Ga0163162_10052202 | 3300013306 | Bacteria | 4105 |
| 332 | Ga0157372_10004356 | 3300013307 | Bacteria | 15118 |
| 333 | Ga0157372_10181124 | 3300013307 | Bacteria | 2439 |
| 334 | Ga0157375_10004478 | 3300013308 | Bacteria | 12137 |
| 335 | Ga0157375_10008267 | 3300013308 | Bacteria | 9111 |
| 336 | Ga0157375_10035061 | 3300013308 | Bacteria | 4786 |
| 337 | Ga0163163_10004723 | 3300014325 | Bacteria | 11673 |
| 338 | Ga0163163_10007190 | 3300014325 | Bacteria | 9802 |
| 339 | Ga0163163_10028878 | 3300014325 | Bacteria | 5331 |
| 340 | Ga0163163_10054862 | 3300014325 | Bacteria | 3938 |
| 341 | Ga0157380_10006672 | 3300014326 | Bacteria | 8147 |
| 342 | Ga0157380_10278078 | 3300014326 | Bacteria | 1530 |
| 343 | Ga0157377_10000987 | 3300014745 | Bacteria | 12004 |
| 344 | Ga0157377_10004874 | 3300014745 | Bacteria | 6241 |
| 345 | Ga0157379_10000805 | 3300014968 | Bacteria | 25414 |
| 346 | Ga0157379_10027886 | 3300014968 | Bacteria | 5026 |
| 347 | Ga0157379_10050365 | 3300014968 | Bacteria | 3718 |
| 348 | Ga0157379_10086903 | 3300014968 | Bacteria | 2804 |
| 349 | Ga0157376_10000283 | 3300014969 | Bacteria | 34227 |
| 350 | Ga0157376_10295269 | 3300014969 | Bacteria | 1532 |
| 351 | Ga0157376_10304377 | 3300014969 | Bacteria | 1510 |
| 352 | Ga0163161_10000199 | 3300017792 | Bacteria | 55004 |
| 353 | Ga0163161_10000897 | 3300017792 | Bacteria | 23133 |
| 354 | Ga0206353_10275763 | 3300020082 | Bacteria | 3326 |
| 355 | Ga0213875_10000053 | 3300021388 | Bacteria | 141791 |
| 356 | Ga0213875_10003884 | 3300021388 | Bacteria | 8364 |
| 357 | Ga0224572_1001790 | 3300024225 | Bacteria | 3295 |
| 358 | Ga0228598_1000469 | 3300024227 | Bacteria | 8230 |
| 359 | Ga0207666_1000469 | 3300025271 | Bacteria | 5162 |
| 360 | Ga0207666_1000945 | 3300025271 | Bacteria | 3444 |
| 361 | Ga0207673_1000045 | 3300025290 | Bacteria | 9922 |
| 362 | Ga0209676_1000140 | 3300025292 | Bacteria | 176735 |
| 363 | Ga0209676_1001860 | 3300025292 | Bacteria | 17366 |
| 364 | Ga0209257_1000292 | 3300025304 | Bacteria | 110440 |
| 365 | Ga0207697_10000245 | 3300025315 | Bacteria | 29793 |
| 366 | Ga0207697_10006821 | 3300025315 | Bacteria | 5133 |
| 367 | Ga0207653_10000923 | 3300025885 | Bacteria | 9730 |
| 368 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 369 | Ga0207642_10003101 | 3300025899 | Bacteria | 5210 |
| 370 | Ga0207710_10006518 | 3300025900 | Bacteria | 4976 |
| 371 | Ga0207710_10081259 | 3300025900 | Bacteria | 1504 |
| 372 | Ga0207688_10000084 | 3300025901 | Bacteria | 35752 |
| 373 | Ga0207688_10023584 | 3300025901 | Bacteria | 3370 |
| 374 | Ga0207688_10048058 | 3300025901 | Bacteria | 2384 |
| 375 | Ga0207680_10008657 | 3300025903 | Bacteria | 5010 |
| 376 | Ga0207680_10018398 | 3300025903 | Bacteria | 3714 |
| 377 | Ga0207680_10039933 | 3300025903 | Bacteria | 2727 |
| 378 | Ga0207647_10000871 | 3300025904 | Bacteria | 23364 |
| 379 | Ga0207647_10005096 | 3300025904 | Bacteria | 9685 |
| 380 | Ga0207647_10006412 | 3300025904 | Bacteria | 8553 |
| 381 | Ga0207647_10033960 | 3300025904 | Bacteria | 3260 |
| 382 | Ga0207699_10038570 | 3300025906 | Bacteria | 2739 |
| 383 | Ga0207645_10000090 | 3300025907 | Bacteria | 65569 |
| 384 | Ga0207645_10033477 | 3300025907 | Bacteria | 3303 |
| 385 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 386 | Ga0207643_10005672 | 3300025908 | Bacteria | 6678 |
| 387 | Ga0207643_10081668 | 3300025908 | Bacteria | 1873 |
| 388 | Ga0207705_10026788 | 3300025909 | Bacteria | 4109 |
| 389 | Ga0207684_10096437 | 3300025910 | Bacteria | 2524 |
| 390 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 391 | Ga0207654_10004275 | 3300025911 | Bacteria | 7208 |
| 392 | Ga0207707_10017706 | 3300025912 | Bacteria | 6216 |
| 393 | Ga0207707_10020258 | 3300025912 | Bacteria | 5806 |
| 394 | Ga0207707_10097808 | 3300025912 | Bacteria | 2565 |
| 395 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 396 | Ga0207695_10002758 | 3300025913 | Bacteria | 25593 |
| 397 | Ga0207695_10023280 | 3300025913 | Bacteria | 7004 |
| 398 | Ga0207671_10125535 | 3300025914 | Bacteria | 1965 |
| 399 | Ga0207671_10225179 | 3300025914 | Bacteria | 1470 |
| 400 | Ga0207693_10000434 | 3300025915 | Bacteria | 38124 |
| 401 | Ga0207693_10002841 | 3300025915 | Bacteria | 15002 |
| 402 | Ga0207693_10013460 | 3300025915 | Bacteria | 6596 |
| 403 | Ga0207693_10017239 | 3300025915 | Bacteria | 5760 |
| 404 | Ga0207693_10047329 | 3300025915 | Bacteria | 3379 |
| 405 | Ga0207693_10052546 | 3300025915 | Bacteria | 3196 |
| 406 | Ga0207693_10060072 | 3300025915 | Bacteria | 2978 |
| 407 | Ga0207693_10093857 | 3300025915 | Bacteria | 2352 |
| 408 | Ga0207693_10131435 | 3300025915 | Bacteria | 1968 |
| 409 | Ga0207693_10216281 | 3300025915 | Bacteria | 1506 |
| 410 | Ga0207663_10170872 | 3300025916 | Bacteria | 1544 |
| 411 | Ga0207660_10005635 | 3300025917 | Bacteria | 8131 |
| 412 | Ga0207660_10016403 | 3300025917 | Bacteria | 4902 |
| 413 | Ga0207660_10036154 | 3300025917 | Bacteria | 3433 |
| 414 | Ga0207660_10085235 | 3300025917 | Bacteria | 2330 |
| 415 | Ga0207660_10126476 | 3300025917 | Bacteria | 1941 |
| 416 | Ga0207662_10000544 | 3300025918 | Bacteria | 16706 |
| 417 | Ga0207662_10007517 | 3300025918 | Bacteria | 5932 |
| 418 | Ga0207662_10010378 | 3300025918 | Bacteria | 5142 |
| 419 | Ga0207657_10002170 | 3300025919 | Bacteria | 21251 |
| 420 | Ga0207657_10005961 | 3300025919 | Bacteria | 12679 |
| 421 | Ga0207657_10054105 | 3300025919 | Bacteria | 3473 |
| 422 | Ga0207649_10000260 | 3300025920 | Bacteria | 41709 |
| 423 | Ga0207652_10008473 | 3300025921 | Bacteria | 8274 |
| 424 | Ga0207652_10011429 | 3300025921 | Bacteria | 7157 |
| 425 | Ga0207652_10047793 | 3300025921 | Bacteria | 3656 |
| 426 | Ga0207681_10000154 | 3300025923 | Bacteria | 57555 |
| 427 | Ga0207681_10029640 | 3300025923 | Bacteria | 3558 |
| 428 | Ga0207681_10057776 | 3300025923 | Bacteria | 2653 |
| 429 | Ga0207681_10064101 | 3300025923 | Bacteria | 2536 |
| 430 | Ga0207694_10033540 | 3300025924 | Bacteria | 3933 |
| 431 | Ga0207694_10076501 | 3300025924 | Bacteria | 2621 |
| 432 | Ga0207694_10082128 | 3300025924 | Bacteria | 2533 |
| 433 | Ga0207650_10003395 | 3300025925 | Bacteria | 10954 |
| 434 | Ga0207650_10013514 | 3300025925 | Bacteria | 5656 |
| 435 | Ga0207650_10031312 | 3300025925 | Bacteria | 3840 |
| 436 | Ga0207659_10000258 | 3300025926 | Bacteria | 32465 |
| 437 | Ga0207659_10013822 | 3300025926 | Bacteria | 5187 |
| 438 | Ga0207659_10176117 | 3300025926 | Bacteria | 1691 |
| 439 | Ga0207687_10005296 | 3300025927 | Bacteria | 8548 |
| 440 | Ga0207664_10025593 | 3300025929 | Bacteria | 4449 |
| 441 | Ga0207664_10033479 | 3300025929 | Bacteria | 3948 |
| 442 | Ga0207664_10040886 | 3300025929 | Bacteria | 3609 |
| 443 | Ga0207644_10010275 | 3300025931 | Bacteria | 6168 |
| 444 | Ga0207644_10011534 | 3300025931 | Bacteria | 5851 |
| 445 | Ga0207644_10027515 | 3300025931 | Bacteria | 3928 |
| 446 | Ga0207644_10038217 | 3300025931 | Bacteria | 3380 |
| 447 | Ga0207644_10040569 | 3300025931 | Bacteria | 3290 |
| 448 | Ga0207690_10002042 | 3300025932 | Bacteria | 12377 |
| 449 | Ga0207690_10018700 | 3300025932 | Bacteria | 4251 |
| 450 | Ga0207690_10178287 | 3300025932 | Bacteria | 1598 |
| 451 | Ga0207706_10003023 | 3300025933 | Bacteria | 16211 |
| 452 | Ga0207706_10018867 | 3300025933 | Bacteria | 6204 |
| 453 | Ga0207706_10038206 | 3300025933 | Bacteria | 4258 |
| 454 | Ga0207706_10060739 | 3300025933 | Bacteria | 3329 |
| 455 | Ga0207706_10065103 | 3300025933 | Bacteria | 3210 |
| 456 | Ga0207706_10110759 | 3300025933 | Bacteria | 2415 |
| 457 | Ga0207706_10151650 | 3300025933 | Bacteria | 2038 |
| 458 | Ga0207686_10148339 | 3300025934 | Bacteria | 1630 |
| 459 | Ga0207709_10000372 | 3300025935 | Bacteria | 45219 |
| 460 | Ga0207670_10004247 | 3300025936 | Bacteria | 7686 |
| 461 | Ga0207670_10017680 | 3300025936 | Bacteria | 4313 |
| 462 | Ga0207670_10026412 | 3300025936 | Bacteria | 3658 |
| 463 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 464 | Ga0207704_10000759 | 3300025938 | Bacteria | 14236 |
| 465 | Ga0207665_10004784 | 3300025939 | Bacteria | 9011 |
| 466 | Ga0207665_10161814 | 3300025939 | Bacteria | 1611 |
| 467 | Ga0207691_10000882 | 3300025940 | Bacteria | 29793 |
| 468 | Ga0207691_10001627 | 3300025940 | Bacteria | 22294 |
| 469 | Ga0207691_10047049 | 3300025940 | Bacteria | 3962 |
| 470 | Ga0207691_10082848 | 3300025940 | Bacteria | 2880 |
| 471 | Ga0207691_10305640 | 3300025940 | Bacteria | 1366 |
| 472 | Ga0207711_10001673 | 3300025941 | Bacteria | 20423 |
| 473 | Ga0207711_10009158 | 3300025941 | Bacteria | 8271 |
| 474 | Ga0207711_10013414 | 3300025941 | Bacteria | 6808 |
| 475 | Ga0207711_10021680 | 3300025941 | Bacteria | 5367 |
| 476 | Ga0207711_10101018 | 3300025941 | Bacteria | 2552 |
| 477 | Ga0207689_10000228 | 3300025942 | Bacteria | 50020 |
| 478 | Ga0207689_10007012 | 3300025942 | Bacteria | 9907 |
| 479 | Ga0207661_10000107 | 3300025944 | Bacteria | 52429 |
| 480 | Ga0207661_10076806 | 3300025944 | Bacteria | 2744 |
| 481 | Ga0207661_10145070 | 3300025944 | Bacteria | 2047 |
| 482 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 483 | Ga0207679_10015638 | 3300025945 | Bacteria | 5020 |
| 484 | Ga0207667_10007974 | 3300025949 | Bacteria | 12629 |
| 485 | Ga0207667_10020988 | 3300025949 | Bacteria | 7244 |
| 486 | Ga0207667_10045340 | 3300025949 | Bacteria | 4657 |
| 487 | Ga0207667_10071293 | 3300025949 | Bacteria | 3613 |
| 488 | Ga0207667_10194573 | 3300025949 | Bacteria | 2080 |
| 489 | Ga0207651_10000069 | 3300025960 | Bacteria | 46408 |
| 490 | Ga0207712_10000242 | 3300025961 | Bacteria | 53794 |
| 491 | Ga0207712_10018876 | 3300025961 | Bacteria | 4497 |
| 492 | Ga0207712_10035724 | 3300025961 | Bacteria | 3379 |
| 493 | Ga0207712_10184011 | 3300025961 | Bacteria | 1644 |
| 494 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 495 | Ga0207668_10007545 | 3300025972 | Bacteria | 6475 |
| 496 | Ga0207668_10052263 | 3300025972 | Bacteria | 2826 |
| 497 | Ga0207640_10000234 | 3300025981 | Bacteria | 38057 |
| 498 | Ga0207640_10019201 | 3300025981 | Bacteria | 4034 |
| 499 | Ga0207658_10000804 | 3300025986 | Bacteria | 26394 |
| 500 | Ga0207658_10036433 | 3300025986 | Bacteria | 3527 |
| 501 | Ga0207658_10058728 | 3300025986 | Bacteria | 2864 |
| 502 | Ga0207658_10169030 | 3300025986 | Bacteria | 1799 |
| 503 | Ga0207658_10269219 | 3300025986 | Bacteria | 1455 |
| 504 | Ga0207677_10017935 | 3300026023 | Bacteria | 4237 |
| 505 | Ga0207677_10040031 | 3300026023 | Bacteria | 3086 |
| 506 | Ga0207677_10049799 | 3300026023 | Bacteria | 2829 |
| 507 | Ga0207703_10034429 | 3300026035 | Bacteria | 4019 |
| 508 | Ga0207703_10054666 | 3300026035 | Bacteria | 3248 |
| 509 | Ga0207703_10221093 | 3300026035 | Bacteria | 1693 |
| 510 | Ga0207639_10000323 | 3300026041 | Bacteria | 33257 |
| 511 | Ga0207639_10000413 | 3300026041 | Bacteria | 29583 |
| 512 | Ga0207639_10017058 | 3300026041 | Bacteria | 5145 |
| 513 | Ga0207639_10021124 | 3300026041 | Bacteria | 4671 |
| 514 | Ga0207639_10047997 | 3300026041 | Bacteria | 3229 |
| 515 | Ga0207678_10000068 | 3300026067 | Bacteria | 81610 |
| 516 | Ga0207678_10000920 | 3300026067 | Bacteria | 26941 |
| 517 | Ga0207678_10020051 | 3300026067 | Bacteria | 5874 |
| 518 | Ga0207678_10060722 | 3300026067 | Bacteria | 3251 |
| 519 | Ga0207678_10081589 | 3300026067 | Bacteria | 2768 |
| 520 | Ga0207708_10001502 | 3300026075 | Bacteria | 17383 |
| 521 | Ga0207708_10014245 | 3300026075 | Bacteria | 5946 |
| 522 | Ga0207708_10014309 | 3300026075 | Bacteria | 5934 |
| 523 | Ga0207708_10074540 | 3300026075 | Bacteria | 2601 |
| 524 | Ga0207708_10110697 | 3300026075 | Bacteria | 2131 |
| 525 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 526 | Ga0207702_10001343 | 3300026078 | Bacteria | 24595 |
| 527 | Ga0207702_10081442 | 3300026078 | Bacteria | 2811 |
| 528 | Ga0207641_10000669 | 3300026088 | Bacteria | 37271 |
| 529 | Ga0207641_10202093 | 3300026088 | Bacteria | 1833 |
| 530 | Ga0207648_10006668 | 3300026089 | Bacteria | 11454 |
| 531 | Ga0207648_10009806 | 3300026089 | Bacteria | 9148 |
| 532 | Ga0207648_10071352 | 3300026089 | Bacteria | 3027 |
| 533 | Ga0207648_10073831 | 3300026089 | Bacteria | 2972 |
| 534 | Ga0207676_10003679 | 3300026095 | Bacteria | 10839 |
| 535 | Ga0207676_10018586 | 3300026095 | Bacteria | 5056 |
| 536 | Ga0207676_10039043 | 3300026095 | Bacteria | 3628 |
| 537 | Ga0207676_10052240 | 3300026095 | Bacteria | 3194 |
| 538 | Ga0207674_10000882 | 3300026116 | Bacteria | 39274 |
| 539 | Ga0207674_10013733 | 3300026116 | Bacteria | 8965 |
| 540 | Ga0207674_10015731 | 3300026116 | Bacteria | 8300 |
| 541 | Ga0207674_10032534 | 3300026116 | Bacteria | 5470 |
| 542 | Ga0207674_10070999 | 3300026116 | Bacteria | 3500 |
| 543 | Ga0207675_100014892 | 3300026118 | Bacteria | 7259 |
| 544 | Ga0207675_100056431 | 3300026118 | Bacteria | 3663 |
| 545 | Ga0207675_100248502 | 3300026118 | Bacteria | 1721 |
| 546 | Ga0207675_100268177 | 3300026118 | Bacteria | 1656 |
| 547 | Ga0207683_10000653 | 3300026121 | Bacteria | 31779 |
| 548 | Ga0207683_10012333 | 3300026121 | Bacteria | 7294 |
| 549 | Ga0207683_10028701 | 3300026121 | Bacteria | 4813 |
| 550 | Ga0207698_10000977 | 3300026142 | Bacteria | 16625 |
| 551 | Ga0207698_10057221 | 3300026142 | Bacteria | 3015 |
| 552 | Ga0207698_10074967 | 3300026142 | Bacteria | 2701 |
| 553 | Ga0207698_10194176 | 3300026142 | Bacteria | 1812 |
| 554 | Ga0209999_1009022 | 3300027543 | Bacteria | 1803 |
| 555 | Ga0210002_1001945 | 3300027617 | Bacteria | 2964 |
| 556 | Ga0209983_1003607 | 3300027665 | Bacteria | 3283 |
| 557 | Ga0209966_1000652 | 3300027695 | Bacteria | 7751 |
| 558 | Ga0209813_10000087 | 3300027866 | Bacteria | 34252 |
| 559 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 560 | Ga0207428_10000286 | 3300027907 | Bacteria | 68250 |
| 561 | Ga0207428_10049012 | 3300027907 | Bacteria | 3386 |
| 562 | Ga0265357_1000262 | 3300028023 | Bacteria | 2700 |
| 563 | Ga0268265_10002575 | 3300028380 | Bacteria | 13532 |
| 564 | Ga0268265_10011597 | 3300028380 | Bacteria | 5959 |
| 565 | Ga0268265_10167932 | 3300028380 | Bacteria | 1872 |
| 566 | Ga0268265_10248948 | 3300028380 | Bacteria | 1573 |
| 567 | Ga0268264_10046150 | 3300028381 | Bacteria | 3618 |
| 568 | Ga0265337_1003660 | 3300028556 | Bacteria | 6589 |
| 569 | Ga0265330_10008622 | 3300031235 | Bacteria | 4898 |
| 570 | Ga0265332_10006574 | 3300031238 | Bacteria | 5271 |
| 571 | Ga0265332_10074841 | 3300031238 | Bacteria | 1440 |
| 572 | Ga0265325_10001319 | 3300031241 | Bacteria | 17563 |
| 573 | Ga0265325_10023154 | 3300031241 | Bacteria | 3396 |
| 574 | Ga0265340_10001848 | 3300031247 | Bacteria | 12085 |
| 575 | Ga0265340_10015062 | 3300031247 | Bacteria | 4025 |
| 576 | Ga0265340_10022161 | 3300031247 | Bacteria | 3250 |
| 577 | Ga0265340_10042126 | 3300031247 | Bacteria | 2243 |
| 578 | Ga0265339_10000033 | 3300031249 | Bacteria | 130595 |
| 579 | Ga0265339_10009902 | 3300031249 | Bacteria | 5952 |
| 580 | Ga0265339_10030179 | 3300031249 | Bacteria | 3071 |
| 581 | Ga0265331_10056121 | 3300031250 | Bacteria | 1871 |
| 582 | Ga0265331_10065198 | 3300031250 | Bacteria | 1713 |
| 583 | Ga0307408_100130805 | 3300031548 | Bacteria | 1957 |
| 584 | Ga0265313_10000049 | 3300031595 | Bacteria | 111617 |
| 585 | Ga0265313_10005321 | 3300031595 | Bacteria | 9514 |
| 586 | Ga0265313_10009363 | 3300031595 | Bacteria | 6366 |
| 587 | Ga0265313_10023313 | 3300031595 | Bacteria | 3336 |
| 588 | Ga0265313_10039878 | 3300031595 | Bacteria | 2326 |
| 589 | Ga0265313_10044294 | 3300031595 | Bacteria | 2173 |
| 590 | Ga0265313_10045754 | 3300031595 | Bacteria | 2129 |
| 591 | Ga0265313_10072321 | 3300031595 | Bacteria | 1585 |
| 592 | Ga0307508_10077726 | 3300031616 | Bacteria | 2898 |
| 593 | Ga0265314_10019730 | 3300031711 | Bacteria | 5215 |
| 594 | Ga0265314_10022239 | 3300031711 | Bacteria | 4859 |
| 595 | Ga0265314_10031505 | 3300031711 | Bacteria | 3912 |
| 596 | Ga0265342_10000149 | 3300031712 | Bacteria | 79177 |
| 597 | Ga0265342_10001524 | 3300031712 | Bacteria | 21423 |
| 598 | Ga0265342_10002635 | 3300031712 | Bacteria | 15340 |
| 599 | Ga0265342_10038344 | 3300031712 | Bacteria | 2918 |
| 600 | Ga0316576_10016776 | 3300031727 | Bacteria | 4960 |
| 601 | Ga0307413_10043361 | 3300031824 | Bacteria | 2651 |
| 602 | Ga0307413_10098092 | 3300031824 | Bacteria | 1928 |
| 603 | Ga0307410_10030984 | 3300031852 | Bacteria | 3425 |
| 604 | Ga0307410_10079395 | 3300031852 | Bacteria | 2299 |
| 605 | Ga0307406_10004876 | 3300031901 | Bacteria | 7308 |
| 606 | Ga0307406_10018783 | 3300031901 | Bacteria | 4046 |
| 607 | Ga0307406_10024626 | 3300031901 | Bacteria | 3596 |
| 608 | Ga0307412_10002217 | 3300031911 | Bacteria | 10785 |
| 609 | Ga0307412_10016299 | 3300031911 | Bacteria | 4424 |
| 610 | Ga0307409_100010670 | 3300031995 | Bacteria | 5732 |
| 611 | Ga0307414_10000384 | 3300032004 | Bacteria | 24016 |
| 612 | Ga0307414_10014276 | 3300032004 | Bacteria | 4756 |
| 613 | Ga0307414_10016354 | 3300032004 | Bacteria | 4508 |
| 614 | Ga0307414_10030847 | 3300032004 | Bacteria | 3507 |
| 615 | Ga0307414_10053668 | 3300032004 | Bacteria | 2812 |
| 616 | Ga0307411_10174874 | 3300032005 | Bacteria | 1623 |
| 617 | Ga0307415_100079976 | 3300032126 | Bacteria | 2330 |
| 618 | Ga0307510_10088528 | 3300033180 | Bacteria | 2955 |
| 619 | Ga0373930_0000159 | 3300034816 | Bacteria | 7789 |
| 620 | Ga0373950_0001078 | 3300034818 | Bacteria | 3484 |
| 621 | Ga0373958_0000305 | 3300034819 | Bacteria | 5913 |
| 622 | Ga0373959_0000743 | 3300034820 | Bacteria | 5561 |
| 623 | Ga0373938_0000024 | 3300034957 | Bacteria | 19333 |
| 624 | Ga0373938_0001010 | 3300034957 | Bacteria | 4532 |
| 625 | Ga0373926_0004308 | 3300035083 | Bacteria | 4658 |
| 626 | Ga0373926_0012322 | 3300035083 | Bacteria | 2889 |
| 627 | Ga0373929_0000274 | 3300035085 | Bacteria | 9537 |
| 628 | Ga0373929_0005708 | 3300035085 | Bacteria | 2245 |
| 629 | Ga0373934_0013351 | 3300035086 | Bacteria | 3106 |
| 630 | Ga0373940_0000029 | 3300035088 | Bacteria | 15347 |
| 631 | Ga0373944_0011320 | 3300035089 | Bacteria | 2442 |
| 632 | Ga0373951_0000391 | 3300035091 | Bacteria | 13023 |
| 633 | Ga0373951_0000779 | 3300035091 | Bacteria | 8707 |
| 634 | Ga0373923_0001398 | 3300035111 | Bacteria | 6876 |
| 635 | Ga0373923_0034751 | 3300035111 | Bacteria | 2048 |
| 636 | Ga0373932_0000515 | 3300035112 | Bacteria | 11900 |
| 637 | Ga0373932_0002870 | 3300035112 | Bacteria | 4257 |
| 638 | Ga0373932_0025991 | 3300035112 | Bacteria | 1590 |
| 639 | Ga0373936_0003979 | 3300035113 | Bacteria | 5569 |
| 640 | Ga0373936_0041141 | 3300035113 | Bacteria | 1853 |
| 641 | Ga0373939_0001312 | 3300035114 | Bacteria | 6041 |
| 642 | Ga0373939_0003941 | 3300035114 | Bacteria | 3491 |
| 643 | Ga0373941_0001774 | 3300035115 | Bacteria | 4647 |
| 644 | Ga0373941_0038096 | 3300035115 | Bacteria | 1470 |
| 645 | Ga0373945_0000654 | 3300035116 | Bacteria | 10019 |
| 646 | Ga0373945_0001064 | 3300035116 | Bacteria | 8252 |
| 647 | Ga0373945_0003922 | 3300035116 | Bacteria | 4704 |
| 648 | Ga0373953_0025607 | 3300035117 | Bacteria | 2255 |
| 649 | Ga0373954_0000906 | 3300035118 | Bacteria | 11525 |
| 650 | Ga0373956_0008585 | 3300035119 | Bacteria | 4139 |
| 651 | Ga0373956_0015622 | 3300035119 | Bacteria | 3182 |
| 652 | Ga0373956_0019147 | 3300035119 | Bacteria | 2902 |
| 653 | Ga0373957_0006119 | 3300035120 | Bacteria | 3774 |
| 654 | Ga0373957_0073568 | 3300035120 | Bacteria | 1340 |
| 655 | Ga0373960_0000932 | 3300035121 | Bacteria | 6250 |
| 656 | Ga0373960_0006664 | 3300035121 | Bacteria | 2716 |
| 657 | Ga0373943_0001179 | 3300035170 | Bacteria | 11669 |
| 658 | Ga0373943_0003827 | 3300035170 | Bacteria | 6840 |
| 659 | Ga0373943_0061106 | 3300035170 | Bacteria | 1882 |
| 660 | Ga0373946_0001814 | 3300035171 | Bacteria | 7457 |
| 661 | Ga0373946_0009494 | 3300035171 | Bacteria | 3585 |
| 662 | Ga0373946_0033652 | 3300035171 | Bacteria | 2064 |
| 663 | Ga0373955_0000201 | 3300035172 | Bacteria | 24761 |
| 664 | Ga0373942_0000286 | 3300035207 | Bacteria | 13700 |
| 665 | Ga0373961_0000298 | 3300035241 | Bacteria | 22185 |
| 666 | Ga0373961_0004205 | 3300035241 | Bacteria | 3494 |
| 667 | Ga0373962_0000887 | 3300035242 | Bacteria | 6842 |
| 668 | Ga0373962_0001502 | 3300035242 | Bacteria | 5520 |
| 669 | Ga0373931_0001002 | 3300035691 | Bacteria | 11946 |
| 670 | Ga0373931_0011412 | 3300035691 | Bacteria | 4293 |
| 671 | Ga0373931_0027265 | 3300035691 | Bacteria | 2915 |
| 672 | Ga0373931_0039871 | 3300035691 | Bacteria | 2461 |
| 673 | Ga0373931_0122606 | 3300035691 | Bacteria | 1487 |
| 674 | Ga0373935_0000068 | 3300035692 | Bacteria | 43997 |
| 675 | Ga0373935_0023692 | 3300035692 | Bacteria | 3773 |
| 676 | Ga0373935_0044129 | 3300035692 | Bacteria | 2808 |
| 677 | Ga0373935_0044940 | 3300035692 | Bacteria | 2785 |
| 678 | Ga0373927_0000863 | 3300035695 | Bacteria | 23082 |
| 679 | Ga0373927_0005387 | 3300035695 | Bacteria | 8840 |
| 680 | Ga0373927_0011948 | 3300035695 | Bacteria | 5778 |
| 681 | Ga0373927_0026187 | 3300035695 | Bacteria | 3811 |
| 682 | Ga0373927_0114486 | 3300035695 | Bacteria | 1758 |
| 683 | Ga0373933_0037084 | 3300035724 | Bacteria | 2858 |
| 684 | Ga0373933_0096591 | 3300035724 | Bacteria | 1829 |
| 685 | Ga0373947_0002147 | 3300035725 | Bacteria | 11983 |
| 686 | Ga0373947_0002537 | 3300035725 | Bacteria | 10978 |
| 687 | Ga0373947_0006972 | 3300035725 | Bacteria | 6544 |
| 688 | Ga0373947_0040717 | 3300035725 | Bacteria | 2768 |
| 689 | Ga0373937_0000347 | 3300036401 | Bacteria | 43749 |
| 690 | Ga0373937_0007729 | 3300036401 | Bacteria | 9319 |
| 691 | Ga0373937_0048668 | 3300036401 | Bacteria | 3881 |
| 692 | Ga0373925_0000081 | 3300037068 | Bacteria | 102407 |
| 693 | Ga0373925_0005678 | 3300037068 | Bacteria | 9276 |
| 694 | Ga0373925_0007759 | 3300037068 | Bacteria | 7811 |
| 695 | Ga0373925_0008281 | 3300037068 | Bacteria | 7566 |
| 696 | Ga0373925_0009149 | 3300037068 | Bacteria | 7208 |
| 697 | Ga0373925_0053408 | 3300037068 | Bacteria | 3020 |
| 698 | Ga0373925_0061285 | 3300037068 | Bacteria | 2826 |
| 699 | Ga0373925_0068818 | 3300037068 | Bacteria | 2673 |
| 700 | Ga0373925_0142309 | 3300037068 | Bacteria | 1878 |
| 701 | Ga0395899_0014213 | 3300037312 | Bacteria | 6075 |
| 702 | Ga0395900_0273709 | 3300037418 | Bacteria | 1682 |
| 703 | Ga0395898_0001457 | 3300037466 | Bacteria | 33463 |
| 704 | Ga0395898_0011440 | 3300037466 | Bacteria | 9216 |
| 705 | Ga0436364_0094686 | 3300037853 | Bacteria | 72452 |
| 706 | Ga0436364_0596981 | 3300037853 | Bacteria | 1423 |
| 707 | Ga0436364_0951864 | 3300037853 | Bacteria | 9370 |
| 708 | Ga0395901_0284451 | 3300038443 | Bacteria | 1717 |
| 709 | Ga0400483_117325 | 3300039062 | Bacteria | 2450 |
| 710 | Ga0436365_0160122 | 3300039437 | Bacteria | 1369 |
| 711 | Ga0436365_0840419 | 3300039437 | Bacteria | 3388 |
| 712 | Ga0436365_1336443 | 3300039437 | Bacteria | 3131 |
| 713 | Ga0436365_1477994 | 3300039437 | Bacteria | 2193 |
| 714 | Ga0436360_0873896 | 3300039438 | Bacteria | 2917 |
| 715 | Ga0436361_0500089 | 3300039447 | Bacteria | 2831 |
| 716 | Ga0436361_0722936 | 3300039447 | Bacteria | 24347 |
| 717 | Ga0436361_0760231 | 3300039447 | Bacteria | 2204 |
| 718 | Ga0436363_0138398 | 3300039450 | Bacteria | 1347 |
| 719 | Ga0436363_0887763 | 3300039450 | Bacteria | 3617 |
| 720 | Ga0450901_003385 | 3300042533 | Bacteria | 1668 |
| 721 | Ga0453684_0043018 | 3300044712 | Bacteria | 6078 |
| 722 | Ga0453684_0094777 | 3300044712 | Bacteria | 3671 |
| 723 | Ga0466957_0058841 | 3300044842 | Bacteria | 2354 |
| 724 | Ga0466959_0078594 | 3300045049 | Bacteria | 2379 |
| 725 | Ga0451576_0013266 | 3300045051 | Bacteria | 9221 |
| 726 | Ga0466958_0029784 | 3300045836 | Bacteria | 3239 |
| 727 | Ga0495617_024736 | 3300046452 | Bacteria | 2026 |
| 728 | Ga0495627_029130 | 3300046453 | Bacteria | 1758 |
| 729 | Ga0495592_0000196 | 3300046454 | Bacteria | 51625 |
| 730 | Ga0495592_0030502 | 3300046454 | Bacteria | 4078 |
| 731 | Ga0495592_0044206 | 3300046454 | Bacteria | 3329 |
| 732 | Ga0495603_0101032 | 3300046455 | Bacteria | 1683 |
| 733 | Ga0495629_0001034 | 3300046459 | Bacteria | 22308 |
| 734 | Ga0495629_0003904 | 3300046459 | Bacteria | 11215 |
| 735 | Ga0495629_0010656 | 3300046459 | Bacteria | 6687 |
| 736 | Ga0495629_0054088 | 3300046459 | Bacteria | 2808 |
| 737 | Ga0495629_0056006 | 3300046459 | Bacteria | 2757 |
| 738 | Ga0495638_0000068 | 3300046460 | Bacteria | 167596 |
| 739 | Ga0495641_0066355 | 3300046461 | Bacteria | 1624 |
| 740 | Ga0495651_0000977 | 3300046462 | Bacteria | 22167 |
| 741 | Ga0495651_0062022 | 3300046462 | Bacteria | 2861 |
| 742 | Ga0495651_0168341 | 3300046462 | Bacteria | 1563 |
| 743 | Ga0495653_0000193 | 3300046463 | Bacteria | 49516 |
| 744 | Ga0495653_0010589 | 3300046463 | Bacteria | 7551 |
| 745 | Ga0495653_0044231 | 3300046463 | Bacteria | 3457 |
| 746 | Ga0495582_0004213 | 3300046473 | Bacteria | 8090 |
| 747 | Ga0495582_0005890 | 3300046473 | Bacteria | 6830 |
| 748 | Ga0495582_0034182 | 3300046473 | Bacteria | 2795 |
| 749 | Ga0495639_0009208 | 3300046475 | Bacteria | 4233 |
| 750 | Ga0495639_0075596 | 3300046475 | Bacteria | 1562 |
| 751 | Ga0495662_0001111 | 3300046476 | Bacteria | 13243 |
| 752 | Ga0495662_0002749 | 3300046476 | Bacteria | 8890 |
| 753 | Ga0495662_0006973 | 3300046476 | Bacteria | 5615 |
| 754 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 755 | Ga0495664_0000554 | 3300046477 | Bacteria | 18816 |
| 756 | Ga0495664_0036496 | 3300046477 | Bacteria | 2897 |
| 757 | Ga0495664_0082802 | 3300046477 | Bacteria | 1925 |
| 758 | Ga0495584_0005586 | 3300046491 | Bacteria | 6648 |
| 759 | Ga0495584_0006458 | 3300046491 | Bacteria | 6135 |
| 760 | Ga0495584_0099823 | 3300046491 | Bacteria | 1467 |
| 761 | Ga0495585_0000744 | 3300046492 | Bacteria | 28955 |
| 762 | Ga0495594_0008772 | 3300046499 | Bacteria | 5213 |
| 763 | Ga0495607_0027003 | 3300046501 | Bacteria | 3556 |
| 764 | Ga0495583_0038328 | 3300046506 | Bacteria | 2265 |
| 765 | Ga0495608_0000121 | 3300046511 | Bacteria | 56189 |
| 766 | Ga0495608_0037362 | 3300046511 | Bacteria | 3266 |
| 767 | Ga0495610_0000083 | 3300046512 | Bacteria | 112946 |
| 768 | Ga0495610_0035906 | 3300046512 | Bacteria | 2539 |
| 769 | Ga0495616_0110694 | 3300046513 | Bacteria | 1276 |
| 770 | Ga0495618_0000124 | 3300046514 | Bacteria | 56215 |
| 771 | Ga0495618_0003921 | 3300046514 | Bacteria | 9181 |
| 772 | Ga0495618_0127837 | 3300046514 | Bacteria | 1626 |
| 773 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 774 | Ga0495628_0101785 | 3300046516 | Bacteria | 2216 |
| 775 | Ga0495630_0002180 | 3300046517 | Bacteria | 13643 |
| 776 | Ga0495630_0006717 | 3300046517 | Bacteria | 8198 |
| 777 | Ga0495630_0018839 | 3300046517 | Bacteria | 5073 |
| 778 | Ga0495630_0032184 | 3300046517 | Bacteria | 3906 |
| 779 | Ga0495630_0100532 | 3300046517 | Bacteria | 2188 |
| 780 | Ga0495632_0000023 | 3300046519 | Bacteria | 180933 |
| 781 | Ga0495637_0000836 | 3300046520 | Bacteria | 20354 |
| 782 | Ga0495637_0002707 | 3300046520 | Bacteria | 9657 |
| 783 | Ga0495643_0000038 | 3300046522 | Bacteria | 236010 |
| 784 | Ga0495644_0002708 | 3300046523 | Bacteria | 7027 |
| 785 | Ga0495644_0015905 | 3300046523 | Bacteria | 2883 |
| 786 | Ga0495648_0014476 | 3300046524 | Bacteria | 5773 |
| 787 | Ga0495663_0000019 | 3300046525 | Bacteria | 129361 |
| 788 | Ga0495663_0013219 | 3300046525 | Bacteria | 2308 |
| 789 | Ga0495666_0006120 | 3300046526 | Bacteria | 6055 |
| 790 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 791 | Ga0495652_0019100 | 3300046529 | Bacteria | 6104 |
| 792 | Ga0495652_0049806 | 3300046529 | Bacteria | 3584 |
| 793 | Ga0495640_0000063 | 3300046533 | Bacteria | 60255 |
| 794 | Ga0495640_0069336 | 3300046533 | Bacteria | 2371 |
| 795 | Ga0495640_0143041 | 3300046533 | Bacteria | 1541 |
| 796 | Ga0495640_0165006 | 3300046533 | Unclassified | 1417 |
| 797 | Ga0495586_0019585 | 3300046535 | Bacteria | 3604 |
| 798 | Ga0495586_0051648 | 3300046535 | Bacteria | 2225 |
| 799 | Ga0495587_0000134 | 3300046536 | Bacteria | 56076 |
| 800 | Ga0495587_0007597 | 3300046536 | Bacteria | 7015 |
| 801 | Ga0495598_0000513 | 3300046537 | Bacteria | 7181 |
| 802 | Ga0495598_0009308 | 3300046537 | Bacteria | 2319 |
| 803 | Ga0495609_0043795 | 3300046538 | Bacteria | 2009 |
| 804 | Ga0495645_0000070 | 3300046543 | Bacteria | 71823 |
| 805 | Ga0495645_0003212 | 3300046543 | Bacteria | 11086 |
| 806 | Ga0495645_0021402 | 3300046543 | Bacteria | 4674 |
| 807 | Ga0495633_0000568 | 3300046558 | Bacteria | 35912 |
| 808 | Ga0495633_0000772 | 3300046558 | Bacteria | 28691 |
| 809 | Ga0495633_0002060 | 3300046558 | Bacteria | 14494 |
| 810 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 811 | Ga0495667_0005008 | 3300046559 | Bacteria | 8957 |
| 812 | Ga0495634_0000241 | 3300046642 | Bacteria | 51268 |
| 813 | Ga0495634_0014117 | 3300046642 | Bacteria | 5767 |
| 814 | Ga0495635_0000045 | 3300046663 | Bacteria | 82266 |
| 815 | Ga0495635_0035648 | 3300046663 | Bacteria | 3449 |
| 816 | Ga0495659_0002311 | 3300046664 | Bacteria | 6167 |
| 817 | Ga0495588_0034636 | 3300046674 | Bacteria | 2555 |
| 818 | Ga0495657_0001484 | 3300046675 | Bacteria | 20216 |
| 819 | Ga0495657_0007068 | 3300046675 | Bacteria | 8708 |
| 820 | Ga0495657_0086915 | 3300046675 | Bacteria | 2013 |
| 821 | Ga0495599_0000107 | 3300046678 | Bacteria | 56178 |
| 822 | Ga0495623_0000180 | 3300046679 | Bacteria | 39869 |
| 823 | Ga0495623_0002513 | 3300046679 | Bacteria | 12140 |
| 824 | Ga0495623_0009474 | 3300046679 | Bacteria | 6323 |
| 825 | Ga0495646_0000027 | 3300046680 | Bacteria | 97629 |
| 826 | Ga0495646_0080435 | 3300046680 | Bacteria | 1900 |
| 827 | Ga0495647_0004735 | 3300046681 | Bacteria | 4438 |
| 828 | Ga0495658_0020639 | 3300046683 | Bacteria | 3461 |
| 829 | Ga0495658_0032995 | 3300046683 | Bacteria | 2832 |
| 830 | Ga0495613_0009605 | 3300046689 | Bacteria | 7187 |
| 831 | Ga0495624_0015346 | 3300046690 | Bacteria | 5175 |
| 832 | Ga0495624_0053973 | 3300046690 | Bacteria | 2535 |
| 833 | Ga0495624_0095759 | 3300046690 | Bacteria | 1829 |
| 834 | Ga0495670_0003165 | 3300046691 | Bacteria | 8106 |
| 835 | Ga0495670_0004845 | 3300046691 | Bacteria | 6606 |
| 836 | Ga0495671_0000027 | 3300046692 | Bacteria | 236011 |
| 837 | Ga0495649_0000048 | 3300046694 | Bacteria | 118180 |
| 838 | Ga0495600_0000062 | 3300046809 | Bacteria | 61420 |
| 839 | Ga0495600_0006032 | 3300046809 | Bacteria | 7336 |
| 840 | Ga0495600_0028982 | 3300046809 | Bacteria | 3583 |
| 841 | Ga0495600_0196222 | 3300046809 | Bacteria | 1297 |
| 842 | Ga0495581_0028604 | 3300047315 | Bacteria | 3231 |
| 843 | Ga0495581_0034460 | 3300047315 | Bacteria | 2929 |
| 844 | Ga0495581_0039498 | 3300047315 | Bacteria | 2732 |
| 845 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 846 | Ga0495604_0000613 | 3300047317 | Bacteria | 30609 |
| 847 | Ga0495604_0017410 | 3300047317 | Bacteria | 5752 |
| 848 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 849 | Ga0495674_0020715 | 3300047319 | Bacteria | 6089 |
| 850 | Ga0495674_0054449 | 3300047319 | Bacteria | 3513 |
| 851 | Ga0495674_0108485 | 3300047319 | Bacteria | 2355 |
| 852 | Ga0495674_0158694 | 3300047319 | Bacteria | 1893 |
| 853 | Ga0495672_0008846 | 3300047320 | Bacteria | 7366 |
| 854 | Ga0495676_0018139 | 3300047321 | Bacteria | 6208 |
| 855 | Ga0495680_0000779 | 3300047322 | Bacteria | 35728 |
| 856 | Ga0495680_0004120 | 3300047322 | Bacteria | 13973 |
| 857 | Ga0495680_0005491 | 3300047322 | Bacteria | 11919 |
| 858 | Ga0495680_0014092 | 3300047322 | Bacteria | 6946 |
| 859 | Ga0495680_0106452 | 3300047322 | Bacteria | 2084 |
| 860 | Ga0495680_0214928 | 3300047322 | Bacteria | 1375 |
| 861 | Ga0495675_0000058 | 3300047444 | Bacteria | 77587 |
| 862 | Ga0495675_0016655 | 3300047444 | Bacteria | 4646 |
| 863 | Ga0495681_0000279 | 3300047470 | Bacteria | 40888 |
| 864 | Ga0495681_0001314 | 3300047470 | Bacteria | 18798 |
| 865 | Ga0495684_0000059 | 3300047471 | Bacteria | 77947 |
| 866 | Ga0495684_0000136 | 3300047471 | Bacteria | 54014 |
| 867 | Ga0495686_0043393 | 3300047472 | Bacteria | 2851 |
| 868 | Ga0495686_0135686 | 3300047472 | Bacteria | 1455 |
| 869 | Ga0495593_0005129 | 3300047673 | Bacteria | 7741 |
| 870 | Ga0495593_0061722 | 3300047673 | Bacteria | 1960 |
| 871 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 872 | Ga0495614_0020420 | 3300048089 | Bacteria | 2865 |
| 873 | Ga0495614_0024753 | 3300048089 | Bacteria | 2591 |
| 874 | Ga0495615_0021522 | 3300048090 | Bacteria | 1456 |
| 875 | Ga0496100_0000237 | 3300048903 | Bacteria | 28937 |
| 876 | Ga0496100_0006029 | 3300048903 | Bacteria | 6579 |
| 877 | Ga0496100_0025954 | 3300048903 | Bacteria | 3587 |
| 878 | Ga0496100_0075119 | 3300048903 | Bacteria | 2266 |
| 879 | Ga0496100_0114614 | 3300048903 | Bacteria | 1878 |
| 880 | Ga0496100_0208748 | 3300048903 | Bacteria | 1427 |
| 881 | Ga0496101_0000697 | 3300048904 | Bacteria | 20240 |
| 882 | Ga0496101_0003104 | 3300048904 | Bacteria | 10272 |
| 883 | Ga0496101_0011363 | 3300048904 | Bacteria | 5905 |
| 884 | Ga0496101_0013493 | 3300048904 | Bacteria | 5475 |
| 885 | Ga0496101_0087126 | 3300048904 | Bacteria | 2317 |
| 886 | Ga0496101_0163654 | 3300048904 | Bacteria | 1707 |
| 887 | Ga0496101_0175674 | 3300048904 | Bacteria | 1647 |
| 888 | Ga0496102_0004386 | 3300048905 | Bacteria | 11921 |
| 889 | Ga0496102_0008462 | 3300048905 | Bacteria | 8821 |
| 890 | Ga0496102_0024214 | 3300048905 | Bacteria | 5396 |
| 891 | Ga0496102_0064232 | 3300048905 | Bacteria | 3362 |
| 892 | Ga0496102_0085685 | 3300048905 | Bacteria | 2909 |
| 893 | Ga0496102_0100039 | 3300048905 | Bacteria | 2692 |
| 894 | Ga0496102_0133343 | 3300048905 | Bacteria | 2326 |
| 895 | Ga0496102_0133444 | 3300048905 | Bacteria | 2325 |
| 896 | Ga0496102_0145942 | 3300048905 | Bacteria | 2221 |
| 897 | Ga0496102_0214057 | 3300048905 | Bacteria | 1816 |
| 898 | Ga0496103_0016536 | 3300048906 | Bacteria | 4402 |
| 899 | Ga0496103_0080031 | 3300048906 | Bacteria | 2054 |
| 900 | Ga0496104_0006107 | 3300048907 | Bacteria | 10574 |
| 901 | Ga0496104_0014689 | 3300048907 | Bacteria | 7074 |
| 902 | Ga0496104_0021017 | 3300048907 | Bacteria | 5989 |
| 903 | Ga0496104_0031473 | 3300048907 | Bacteria | 4934 |
| 904 | Ga0496104_0035169 | 3300048907 | Bacteria | 4677 |
| 905 | Ga0496104_0065269 | 3300048907 | Bacteria | 3454 |
| 906 | Ga0496104_0195705 | 3300048907 | Bacteria | 1934 |
| 907 | Ga0496105_0001999 | 3300048908 | Bacteria | 14708 |
| 908 | Ga0496105_0005181 | 3300048908 | Bacteria | 9880 |
| 909 | Ga0496105_0006825 | 3300048908 | Bacteria | 8779 |
| 910 | Ga0496105_0157161 | 3300048908 | Bacteria | 1867 |
| 911 | Ga0496105_0185565 | 3300048908 | Unclassified | 1702 |
| 912 | Ga0496106_0000236 | 3300048909 | Bacteria | 38678 |
| 913 | Ga0496106_0002012 | 3300048909 | Bacteria | 15288 |
| 914 | Ga0496106_0009101 | 3300048909 | Bacteria | 7338 |
| 915 | Ga0496106_0011510 | 3300048909 | Bacteria | 6542 |
| 916 | Ga0496106_0016650 | 3300048909 | Bacteria | 5438 |
| 917 | Ga0496106_0076915 | 3300048909 | Bacteria | 2558 |
| 918 | Ga0496107_0000327 | 3300048910 | Bacteria | 25714 |
| 919 | Ga0496107_0014384 | 3300048910 | Bacteria | 5541 |
| 920 | Ga0496107_0017289 | 3300048910 | Bacteria | 5071 |
| 921 | Ga0496107_0028396 | 3300048910 | Bacteria | 3975 |
| 922 | Ga0496107_0030947 | 3300048910 | Bacteria | 3816 |
| 923 | Ga0496107_0053577 | 3300048910 | Bacteria | 2910 |
| 924 | Ga0496107_0078701 | 3300048910 | Bacteria | 2402 |
| 925 | Ga0496107_0091247 | 3300048910 | Bacteria | 2226 |
| 926 | Ga0496107_0097708 | 3300048910 | Bacteria | 2150 |
| 927 | Ga0496108_0000347 | 3300048911 | Bacteria | 39108 |
| 928 | Ga0496108_0000902 | 3300048911 | Bacteria | 23152 |
| 929 | Ga0496108_0001376 | 3300048911 | Bacteria | 19132 |
| 930 | Ga0496108_0005173 | 3300048911 | Bacteria | 10547 |
| 931 | Ga0496108_0013218 | 3300048911 | Bacteria | 6727 |
| 932 | Ga0496108_0045907 | 3300048911 | Bacteria | 3649 |
| 933 | Ga0496108_0098577 | 3300048911 | Bacteria | 2491 |
| 934 | Ga0496108_0119819 | 3300048911 | Bacteria | 2256 |
| 935 | Ga0496108_0161783 | 3300048911 | Bacteria | 1935 |
| 936 | Ga0496109_0000224 | 3300048912 | Bacteria | 55854 |
| 937 | Ga0496109_0000925 | 3300048912 | Bacteria | 24421 |
| 938 | Ga0496109_0005863 | 3300048912 | Bacteria | 10300 |
| 939 | Ga0496109_0008656 | 3300048912 | Bacteria | 8661 |
| 940 | Ga0496109_0025751 | 3300048912 | Bacteria | 5243 |
| 941 | Ga0496109_0031922 | 3300048912 | Bacteria | 4731 |
| 942 | Ga0496109_0118634 | 3300048912 | Bacteria | 2463 |
| 943 | Ga0496109_0346498 | 3300048912 | Bacteria | 1403 |
| 944 | Ga0496110_0010097 | 3300048913 | Bacteria | 7666 |
| 945 | Ga0496110_0029719 | 3300048913 | Bacteria | 4706 |
| 946 | Ga0496110_0035608 | 3300048913 | Bacteria | 4319 |
| 947 | Ga0496110_0055430 | 3300048913 | Bacteria | 3488 |
| 948 | Ga0496110_0059966 | 3300048913 | Bacteria | 3355 |
| 949 | Ga0496110_0074428 | 3300048913 | Bacteria | 3016 |
| 950 | Ga0496110_0136555 | 3300048913 | Bacteria | 2216 |
| 951 | Ga0496110_0250584 | 3300048913 | Bacteria | 1611 |
| 952 | Ga0496111_0009006 | 3300048914 | Bacteria | 6640 |
| 953 | Ga0496111_0021601 | 3300048914 | Bacteria | 4497 |
| 954 | Ga0496111_0031448 | 3300048914 | Bacteria | 3781 |
| 955 | Ga0496111_0069902 | 3300048914 | Bacteria | 2553 |
| 956 | Ga0496111_0070351 | 3300048914 | Bacteria | 2545 |
| 957 | Ga0496111_0179786 | 3300048914 | Bacteria | 1572 |
| 958 | Ga0496112_0002281 | 3300048915 | Bacteria | 15339 |
| 959 | Ga0496112_0002294 | 3300048915 | Bacteria | 15311 |
| 960 | Ga0496112_0005249 | 3300048915 | Bacteria | 11155 |
| 961 | Ga0496112_0006289 | 3300048915 | Bacteria | 10415 |
| 962 | Ga0496112_0044183 | 3300048915 | Bacteria | 4365 |
| 963 | Ga0496112_0133343 | 3300048915 | Bacteria | 2454 |
| 964 | Ga0496112_0134740 | 3300048915 | Bacteria | 2440 |
| 965 | Ga0496112_0188480 | 3300048915 | Bacteria | 2025 |
| 966 | Ga0496112_0209861 | 3300048915 | Bacteria | 1905 |
| 967 | Ga0496112_0266687 | 3300048915 | Bacteria | 1661 |
| 968 | Ga0496113_0018979 | 3300048916 | Bacteria | 4801 |
| 969 | Ga0496113_0022653 | 3300048916 | Bacteria | 4448 |
| 970 | Ga0496113_0025192 | 3300048916 | Bacteria | 4237 |
| 971 | Ga0496113_0038764 | 3300048916 | Bacteria | 3505 |
| 972 | Ga0496113_0058625 | 3300048916 | Bacteria | 2897 |
| 973 | Ga0496113_0083590 | 3300048916 | Bacteria | 2450 |
| 974 | Ga0496114_0038158 | 3300048917 | Bacteria | 3974 |
| 975 | Ga0496114_0054406 | 3300048917 | Bacteria | 3337 |
| 976 | Ga0496115_0003837 | 3300048918 | Bacteria | 10833 |
| 977 | Ga0496115_0011128 | 3300048918 | Bacteria | 6741 |
| 978 | Ga0496115_0018524 | 3300048918 | Bacteria | 5348 |
| 979 | Ga0496115_0022496 | 3300048918 | Bacteria | 4885 |
| 980 | Ga0496116_0013402 | 3300048919 | Bacteria | 6612 |
| 981 | Ga0496116_0036936 | 3300048919 | Bacteria | 3413 |
| 982 | Ga0496117_0008437 | 3300048920 | Bacteria | 9781 |
| 983 | Ga0496119_0000709 | 3300048922 | Bacteria | 44727 |
| 984 | Ga0496121_0000997 | 3300048924 | Bacteria | 50601 |
| 985 | Ga0496122_0002462 | 3300048925 | Bacteria | 26201 |
| 986 | Ga0496122_0014017 | 3300048925 | Bacteria | 7787 |
| 987 | Ga0496122_0073705 | 3300048925 | Bacteria | 2419 |
| 988 | Ga0496123_0058162 | 3300048926 | Bacteria | 2510 |
| 989 | Ga0496123_0167756 | 3300048926 | Bacteria | 1162 |
| 990 | Ga0496124_0037793 | 3300048927 | Bacteria | 4196 |
| 991 | Ga0496124_0046604 | 3300048927 | Bacteria | 3711 |
| 992 | Ga0496125_0001108 | 3300048928 | Bacteria | 41389 |
| 993 | Ga0496125_0012656 | 3300048928 | Bacteria | 8351 |
| 994 | Ga0496125_0039327 | 3300048928 | Bacteria | 4075 |
| 995 | Ga0496126_0023175 | 3300048929 | Bacteria | 6019 |
| 996 | Ga0495678_041432 | 3300049459 | Bacteria | 1843 |
| 997 | Ga0501031_0020670 | 3300049568 | Bacteria | 4293 |
| 998 | Ga0501031_0058475 | 3300049568 | Bacteria | 2512 |
| 999 | Ga0501032_0000303 | 3300049569 | Bacteria | 41504 |
| 1000 | Ga0501032_0087939 | 3300049569 | Bacteria | 2063 |
| 1001 | Ga0501032_0123386 | 3300049569 | Bacteria | 1712 |
| 1002 | Ga0501033_0000881 | 3300049570 | Bacteria | 27428 |
| 1003 | Ga0501033_0005988 | 3300049570 | Bacteria | 9539 |
| 1004 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 1005 | Ga0501034_0111025 | 3300049571 | Bacteria | 2732 |
| 1006 | Ga0501034_0118961 | 3300049571 | Bacteria | 2629 |
| 1007 | Ga0501034_0222330 | 3300049571 | Bacteria | 1840 |
| 1008 | Ga0501034_0394862 | 3300049571 | Bacteria | 1307 |
| 1009 | Ga0501036_0000098 | 3300049572 | Bacteria | 54252 |
| 1010 | Ga0501036_0133576 | 3300049572 | Bacteria | 2094 |
| 1011 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 1012 | Ga0501037_0063493 | 3300049573 | Bacteria | 2692 |
| 1013 | Ga0501037_0069341 | 3300049573 | Bacteria | 2567 |
| 1014 | Ga0501038_0002041 | 3300049574 | Bacteria | 18682 |
| 1015 | Ga0501038_0050472 | 3300049574 | Bacteria | 3594 |
| 1016 | Ga0501038_0052419 | 3300049574 | Bacteria | 3518 |
| 1017 | Ga0501038_0151076 | 3300049574 | Bacteria | 1893 |
| 1018 | Ga0501039_0000085 | 3300049575 | Bacteria | 70306 |
| 1019 | Ga0501039_0058135 | 3300049575 | Bacteria | 2995 |
| 1020 | Ga0501039_0154908 | 3300049575 | Bacteria | 1800 |
| 1021 | Ga0501040_0010464 | 3300049576 | Bacteria | 6066 |
| 1022 | Ga0501040_0188160 | 3300049576 | Bacteria | 1465 |
| 1023 | Ga0501041_0016047 | 3300049577 | Bacteria | 4450 |
| 1024 | Ga0501041_0016276 | 3300049577 | Bacteria | 4421 |
| 1025 | Ga0501042_0020429 | 3300049578 | Bacteria | 4609 |
| 1026 | Ga0501043_0000460 | 3300049579 | Bacteria | 36273 |
| 1027 | Ga0501043_0077737 | 3300049579 | Bacteria | 2607 |
| 1028 | Ga0501043_0192161 | 3300049579 | Bacteria | 1587 |
| 1029 | Ga0501046_0000033 | 3300049580 | Bacteria | 174675 |
| 1030 | Ga0501046_0000624 | 3300049580 | Bacteria | 34712 |
| 1031 | Ga0501046_0045146 | 3300049580 | Bacteria | 3502 |
| 1032 | Ga0501046_0052907 | 3300049580 | Bacteria | 3199 |
| 1033 | Ga0501046_0084981 | 3300049580 | Bacteria | 2440 |
| 1034 | Ga0501046_0143179 | 3300049580 | Bacteria | 1807 |
| 1035 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 1036 | Ga0501047_0061466 | 3300049581 | Bacteria | 3624 |
| 1037 | Ga0501047_0066110 | 3300049581 | Bacteria | 3485 |
| 1038 | Ga0501047_0082865 | 3300049581 | Bacteria | 3083 |
| 1039 | Ga0501047_0085660 | 3300049581 | Bacteria | 3028 |
| 1040 | Ga0501047_0176737 | 3300049581 | Bacteria | 2002 |
| 1041 | Ga0501047_0268507 | 3300049581 | Bacteria | 1552 |
| 1042 | Ga0501048_0000292 | 3300049582 | Bacteria | 34134 |
| 1043 | Ga0501048_0173710 | 3300049582 | Bacteria | 1527 |
| 1044 | Ga0501048_0178656 | 3300049582 | Bacteria | 1504 |
| 1045 | Ga0501067_0003139 | 3300049583 | Bacteria | 9123 |
| 1046 | Ga0501067_0029418 | 3300049583 | Bacteria | 3044 |
| 1047 | Ga0501067_0084919 | 3300049583 | Bacteria | 1756 |
| 1048 | Ga0501068_0003364 | 3300049584 | Bacteria | 8588 |
| 1049 | Ga0501068_0054371 | 3300049584 | Bacteria | 2425 |
| 1050 | Ga0501068_0151515 | 3300049584 | Bacteria | 1457 |
| 1051 | Ga0501070_0014140 | 3300049586 | Bacteria | 6717 |
| 1052 | Ga0501070_0020252 | 3300049586 | Bacteria | 5579 |
| 1053 | Ga0501070_0049761 | 3300049586 | Bacteria | 3480 |
| 1054 | Ga0501070_0055000 | 3300049586 | Bacteria | 3299 |
| 1055 | Ga0501070_0173269 | 3300049586 | Bacteria | 1777 |
| 1056 | Ga0501071_0045980 | 3300049587 | Bacteria | 3135 |
| 1057 | Ga0501071_0086331 | 3300049587 | Bacteria | 2301 |
| 1058 | Ga0501071_0099093 | 3300049587 | Bacteria | 2147 |
| 1059 | Ga0501072_0027316 | 3300049588 | Bacteria | 4453 |
| 1060 | Ga0501072_0054742 | 3300049588 | Bacteria | 3144 |
| 1061 | Ga0501072_0111234 | 3300049588 | Bacteria | 2180 |
| 1062 | Ga0501073_0000109 | 3300049589 | Bacteria | 53094 |
| 1063 | Ga0501073_0023706 | 3300049589 | Bacteria | 4405 |
| 1064 | Ga0501073_0044455 | 3300049589 | Bacteria | 3130 |
| 1065 | Ga0501073_0046982 | 3300049589 | Bacteria | 3035 |
| 1066 | Ga0501073_0062686 | 3300049589 | Bacteria | 2593 |
| 1067 | Ga0501074_0000250 | 3300049590 | Bacteria | 30239 |
| 1068 | Ga0501074_0013873 | 3300049590 | Bacteria | 5857 |
| 1069 | Ga0501074_0049283 | 3300049590 | Bacteria | 3041 |
| 1070 | Ga0501074_0053274 | 3300049590 | Bacteria | 2919 |
| 1071 | Ga0501074_0080618 | 3300049590 | Bacteria | 2335 |
| 1072 | Ga0501075_0039262 | 3300049591 | Bacteria | 3543 |
| 1073 | Ga0501076_0091458 | 3300049592 | Bacteria | 2447 |
| 1074 | Ga0501076_0175704 | 3300049592 | Bacteria | 1745 |
| 1075 | Ga0501077_0056525 | 3300049593 | Bacteria | 2491 |
| 1076 | Ga0501077_0197258 | 3300049593 | Bacteria | 1279 |
| 1077 | Ga0501223_000086 | 3300049663 | Bacteria | 27446 |
| 1078 | Ga0501225_0000034 | 3300049705 | Bacteria | 46629 |
| 1079 | Ga0501225_0004061 | 3300049705 | Bacteria | 4381 |
| 1080 | Ga0501079_0005234 | 3300049741 | Bacteria | 9642 |
| 1081 | Ga0501080_0006971 | 3300049742 | Bacteria | 10198 |
| 1082 | Ga0501080_0011399 | 3300049742 | Bacteria | 8142 |
| 1083 | Ga0501080_0025088 | 3300049742 | Bacteria | 5532 |
| 1084 | Ga0501080_0113678 | 3300049742 | Bacteria | 2510 |
| 1085 | Ga0501080_0133642 | 3300049742 | Bacteria | 2296 |
| 1086 | Ga0501080_0261239 | 3300049742 | Bacteria | 1578 |
| 1087 | Ga0501080_0317699 | 3300049742 | Bacteria | 1410 |
| 1088 | Ga0501081_0008911 | 3300049743 | Bacteria | 6518 |
| 1089 | Ga0501081_0055428 | 3300049743 | Bacteria | 2739 |
| 1090 | Ga0501081_0100093 | 3300049743 | Bacteria | 2048 |
| 1091 | Ga0501081_0103323 | 3300049743 | Bacteria | 2016 |
| 1092 | Ga0501083_0000618 | 3300049744 | Bacteria | 22913 |
| 1093 | Ga0501083_0003365 | 3300049744 | Bacteria | 11191 |
| 1094 | Ga0501083_0021302 | 3300049744 | Bacteria | 4504 |
| 1095 | Ga0501083_0063674 | 3300049744 | Bacteria | 2459 |
| 1096 | Ga0501083_0143314 | 3300049744 | Bacteria | 1564 |
| 1097 | Ga0501035_0001489 | 3300049822 | Bacteria | 23988 |
| 1098 | Ga0501035_0021051 | 3300049822 | Bacteria | 5995 |
| 1099 | Ga0501035_0054468 | 3300049822 | Bacteria | 3574 |
| 1100 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 1101 | Ga0501044_0024914 | 3300049823 | Bacteria | 6345 |
| 1102 | Ga0501044_0043948 | 3300049823 | Bacteria | 4640 |
| 1103 | Ga0501044_0064936 | 3300049823 | Bacteria | 3723 |
| 1104 | Ga0501044_0257729 | 3300049823 | Bacteria | 1683 |
| 1105 | Ga0501045_0041254 | 3300049824 | Bacteria | 3358 |
| 1106 | Ga0501045_0081425 | 3300049824 | Bacteria | 2387 |
| 1107 | nmdc:mga03n38_55789_c1 | 3300050490 | Bacteria | 1781 |
| 1108 | nmdc:mga03n38_74979_c1 | 3300050490 | Bacteria | 1575 |
| 1109 | nmdc:mga00v17_268007_c1 | 3300050491 | Bacteria | 1108 |
| 1110 | nmdc:mga0yw44_127155_c1 | 3300050492 | Bacteria | 1647 |
| 1111 | nmdc:mga0yw44_58568_c1 | 3300050492 | Bacteria | 2354 |
| 1112 | nmdc:mga0yw44_86222_c1 | 3300050492 | Bacteria | 1977 |
| 1113 | nmdc:mga06z11_191_c1 | 3300050494 | Bacteria | 24617 |
| 1114 | nmdc:mga04h51_1507_c1 | 3300050495 | Bacteria | 5395 |
| 1115 | nmdc:mga04h51_22073_c1 | 3300050495 | Bacteria | 1922 |
| 1116 | nmdc:mga05p37_193198_c1 | 3300050507 | Bacteria | 2470 |
| 1117 | nmdc:mga05p37_27999_c1 | 3300050507 | Bacteria | 6865 |
| 1118 | nmdc:mga09592_14616_c1 | 3300050508 | Bacteria | 6407 |
| 1119 | nmdc:mga0qj67_350211_c1 | 3300050509 | Bacteria | 1194 |
| 1120 | nmdc:mga0qj67_392_c1 | 3300050509 | Bacteria | 30232 |
| 1121 | nmdc:mga06r32_51949_c1 | 3300050510 | Bacteria | 3924 |
| 1122 | nmdc:mga06r32_64244_c1 | 3300050510 | Bacteria | 3539 |
| 1123 | nmdc:mga08y16_14375_c1 | 3300050511 | Bacteria | 8333 |
| 1124 | nmdc:mga08y16_64084_c1 | 3300050511 | Bacteria | 3838 |
| 1125 | nmdc:mga08y16_66523_c1 | 3300050511 | Bacteria | 3761 |
| 1126 | nmdc:mga0n895_111546_c1 | 3300050512 | Bacteria | 2751 |
| 1127 | nmdc:mga0n895_15793_c1 | 3300050512 | Bacteria | 6903 |
| 1128 | nmdc:mga0n895_311322_c1 | 3300050512 | Bacteria | 1596 |
| 1129 | nmdc:mga0n895_552_c1 | 3300050512 | Bacteria | 25634 |
| 1130 | nmdc:mga0n895_84596_c1 | 3300050512 | Bacteria | 3165 |
| 1131 | nmdc:mga0rr50_157675_c1 | 3300050513 | Bacteria | 1840 |
| 1132 | nmdc:mga0rr50_33063_c1 | 3300050513 | Bacteria | 3692 |
| 1133 | nmdc:mga0rr50_95527_c1 | 3300050513 | Bacteria | 2323 |
| 1134 | nmdc:mga08x19_40687_c1 | 3300050514 | Bacteria | 2959 |
| 1135 | nmdc:mga0a205_2568_c1 | 3300050515 | Bacteria | 16009 |
| 1136 | nmdc:mga0sz30_21157_c1 | 3300050516 | Bacteria | 2630 |
| 1137 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 1138 | Ga0495601_0002664 | 3300053077 | Bacteria | 10122 |
| 1139 | Ga0495601_0007172 | 3300053077 | Bacteria | 6538 |
| 1140 | Ga0495601_0011070 | 3300053077 | Bacteria | 5390 |
| 1141 | Ga0495601_0053768 | 3300053077 | Bacteria | 2546 |
| 1142 | Ga0495601_0054340 | 3300053077 | Bacteria | 2533 |
| 1143 | Ga0495601_0057524 | 3300053077 | Bacteria | 2463 |
| 1144 | Ga0495612_0000041 | 3300053078 | Bacteria | 62752 |
| 1145 | Ga0495612_0003354 | 3300053078 | Bacteria | 6637 |
| 1146 | Ga0495612_0010956 | 3300053078 | Bacteria | 3661 |
| 1147 | Ga0495612_0015875 | 3300053078 | Bacteria | 3018 |
| 1148 | Ga0495612_0019036 | 3300053078 | Bacteria | 2748 |
| 1149 | Ga0495612_0036858 | 3300053078 | Bacteria | 1985 |
| 1150 | Ga0495595_0000048 | 3300053084 | Bacteria | 60581 |
| 1151 | Ga0495595_0001522 | 3300053084 | Bacteria | 9051 |
| 1152 | Ga0495595_0008969 | 3300053084 | Bacteria | 4125 |
| 1153 | Ga0495595_0010099 | 3300053084 | Bacteria | 3918 |
| 1154 | Ga0495619_0000050 | 3300053085 | Bacteria | 101361 |
| 1155 | Ga0495619_0000518 | 3300053085 | Bacteria | 25614 |
| 1156 | Ga0495619_0001220 | 3300053085 | Bacteria | 16844 |
| 1157 | Ga0495619_0001244 | 3300053085 | Bacteria | 16678 |
| 1158 | Ga0495619_0008836 | 3300053085 | Bacteria | 6369 |
| 1159 | Ga0495619_0025575 | 3300053085 | Bacteria | 3792 |
| 1160 | Ga0495619_0029292 | 3300053085 | Bacteria | 3556 |
| 1161 | Ga0495619_0093107 | 3300053085 | Bacteria | 2042 |
| 1162 | Ga0500647_0002985 | 3300053091 | Bacteria | 6478 |
| 1163 | Ga0500651_0039297 | 3300053093 | Bacteria | 2979 |
| 1164 | Ga0500651_0059817 | 3300053093 | Bacteria | 2382 |
| 1165 | Ga0500566_0007133 | 3300053094 | Bacteria | 6620 |
| 1166 | Ga0500641_0024126 | 3300053096 | Bacteria | 2343 |
| 1167 | Ga0500556_0001106 | 3300053104 | Bacteria | 13430 |
| 1168 | Ga0500593_043998 | 3300053117 | Bacteria | 1992 |
| 1169 | Ga0500618_004828 | 3300053125 | Bacteria | 4214 |
| 1170 | Ga0500618_010582 | 3300053125 | Bacteria | 2472 |
| 1171 | Ga0500559_0000398 | 3300053136 | Bacteria | 31511 |
| 1172 | Ga0500559_0000465 | 3300053136 | Bacteria | 28853 |
| 1173 | Ga0500568_0005085 | 3300053139 | Bacteria | 6878 |
| 1174 | Ga0500622_0009386 | 3300053156 | Bacteria | 5414 |
| 1175 | Ga0500624_004059 | 3300053157 | Bacteria | 1920 |
| 1176 | Ga0500637_0037235 | 3300053178 | Bacteria | 2734 |
| 1177 | Ga0500645_001143 | 3300053730 | Bacteria | 14378 |
| 1178 | Ga0501084_0001321 | 3300054114 | Bacteria | 19525 |
| 1179 | Ga0501084_0012745 | 3300054114 | Bacteria | 6964 |
| 1180 | Ga0501084_0013172 | 3300054114 | Bacteria | 6841 |
| 1181 | Ga0501084_0014344 | 3300054114 | Bacteria | 6565 |
| 1182 | Ga0501082_0007370 | 3300060353 | Bacteria | 9492 |
| 1183 | Ga0501082_0010751 | 3300060353 | Bacteria | 7878 |
| 1184 | Ga0501082_0033077 | 3300060353 | Bacteria | 4459 |
| 1185 | Ga0501082_0042143 | 3300060353 | Bacteria | 3935 |
| 1186 | Ga0501082_0056526 | 3300060353 | Bacteria | 3380 |
| 1187 | Ga0501082_0081619 | 3300060353 | Bacteria | 2790 |
| 1188 | Ga0501082_0094166 | 3300060353 | Bacteria | 2588 |
| 1189 | Ga0501082_0110314 | 3300060353 | Bacteria | 2382 |
| 1190 | Ga0501082_0168915 | 3300060353 | Bacteria | 1901 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0101785 | Ga0495628_0101785_1159_2193 | 327 |
| 2 | 3300050491 | nmdc:mga00v17_268007_c1 | nmdc:mga00v17_268007_c1_50_1084 | 327 |
| 3 | 3300050509 | nmdc:mga0qj67_350211_c1 | nmdc:mga0qj67_350211_c1_14_1054 | 327 |
| 4 | 3300031711 | Ga0265314_10031505 | Ga0265314_100315051 | 328 |
| 5 | 3300049583 | Ga0501067_0084919 | Ga0501067_0084919_354_1568 | 335 |
| 6 | 3300049742 | Ga0501080_0011399 | Ga0501080_0011399_4475_5689 | 335 |
| 7 | 3300005355 | Ga0070671_100050533 | Ga0070671_1000505333 | 340 |
| 8 | 3300048913 | Ga0496110_0136555 | Ga0496110_0136555_1157_2191 | 340 |
| 9 | 3300048926 | Ga0496123_0167756 | Ga0496123_0167756_102_1136 | 340 |
| 10 | 3300049572 | Ga0501036_0133576 | Ga0501036_0133576_1025_2065 | 341 |
| 11 | 3300049571 | Ga0501034_0111025 | Ga0501034_0111025_1644_2696 | 344 |
| 12 | 3300042533 | Ga0450901_003385 | Ga0450901_003385_13_1083 | 346 |
| 13 | 3300033180 | Ga0307510_10088528 | Ga0307510_100885282 | 358 |
| 14 | 3300048912 | Ga0496109_0346498 | Ga0496109_0346498_50_1147 | 362 |
| 15 | 3300049569 | Ga0501032_0087939 | Ga0501032_0087939_355_1590 | 364 |
| 16 | 3300049573 | Ga0501037_0069341 | Ga0501037_0069341_197_1432 | 365 |
| 17 | 3300049579 | Ga0501043_0192161 | Ga0501043_0192161_63_1328 | 365 |
| 18 | 3300049581 | Ga0501047_0061466 | Ga0501047_0061466_14_1249 | 365 |
| 19 | 3300049589 | Ga0501073_0046982 | Ga0501073_0046982_1021_2256 | 365 |
| 20 | 3300049742 | Ga0501080_0133642 | Ga0501080_0133642_572_1837 | 365 |
| 21 | 3300049592 | Ga0501076_0091458 | Ga0501076_0091458_1297_2427 | 368 |
| 22 | 3300048911 | Ga0496108_0045907 | Ga0496108_0045907_2190_3326 | 371 |
| 23 | 3300046517 | Ga0495630_0100532 | Ga0495630_0100532_658_1917 | 373 |
| 24 | 3300049590 | Ga0501074_0049283 | Ga0501074_0049283_1747_2982 | 373 |
| 25 | 3300031595 | Ga0265313_10023313 | Ga0265313_100233131 | 374 |
| 26 | 3300049574 | Ga0501038_0050472 | Ga0501038_0050472_887_2152 | 374 |
| 27 | 3300037466 | Ga0395898_0001457 | Ga0395898_0001457_16170_17363 | 377 |
| 28 | 3300031595 | Ga0265313_10044294 | Ga0265313_100442942 | 378 |
| 29 | 3300005436 | Ga0070713_100105678 | Ga0070713_1001056782 | 379 |
| 30 | 3300048928 | Ga0496125_0001108 | Ga0496125_0001108_2743_3993 | 380 |
| 31 | 3300031247 | Ga0265340_10042126 | Ga0265340_100421264 | 381 |
| 32 | 3300039450 | Ga0436363_0138398 | Ga0436363_0138398_54_1268 | 381 |
| 33 | 3300014969 | Ga0157376_10304377 | Ga0157376_103043772 | 384 |
| 34 | 3300049593 | Ga0501077_0197258 | Ga0501077_0197258_11_1189 | 384 |
| 35 | 3300053125 | Ga0500618_010582 | Ga0500618_010582_240_1460 | 384 |
| 36 | 3300035691 | Ga0373931_0122606 | Ga0373931_0122606_13_1281 | 385 |
| 37 | 3300005467 | Ga0070706_100221789 | Ga0070706_1002217891 | 386 |
| 38 | 3300009177 | Ga0105248_10037593 | Ga0105248_100375933 | 388 |
| 39 | 3300025931 | Ga0207644_10011534 | Ga0207644_100115342 | 388 |
| 40 | 3300025941 | Ga0207711_10013414 | Ga0207711_100134148 | 388 |
| 41 | 3300037312 | Ga0395899_0014213 | Ga0395899_0014213_1732_2946 | 388 |
| 42 | 3300037418 | Ga0395900_0273709 | Ga0395900_0273709_179_1393 | 388 |
| 43 | 3300037466 | Ga0395898_0011440 | Ga0395898_0011440_88_1302 | 388 |
| 44 | 3300038443 | Ga0395901_0284451 | Ga0395901_0284451_86_1300 | 388 |
| 45 | 3300048903 | Ga0496100_0025954 | Ga0496100_0025954_1017_2231 | 388 |
| 46 | 3300025939 | Ga0207665_10161814 | Ga0207665_101618141 | 389 |
| 47 | 3300037853 | Ga0436364_0596981 | Ga0436364_0596981_94_1314 | 389 |
| 48 | 3300049586 | Ga0501070_0055000 | Ga0501070_0055000_1365_2600 | 390 |
| 49 | 3300049742 | Ga0501080_0317699 | Ga0501080_0317699_125_1360 | 390 |
| 50 | 3300021388 | Ga0213875_10003884 | Ga0213875_100038847 | 391 |
| 51 | 3300031247 | Ga0265340_10001848 | Ga0265340_100018482 | 391 |
| 52 | 3300037853 | Ga0436364_0094686 | Ga0436364_0094686_68308_69555 | 391 |
| 53 | 3300049575 | Ga0501039_0154908 | Ga0501039_0154908_112_1347 | 391 |
| 54 | iso_pu_bacteria | 2512564014 | 2512642554 | 391 |
| 55 | iso_pu_bacteria | 2775507255 | 2778125464 | 391 |
| 56 | iso_pu_bacteria | 2808606401 | 2809063335 | 391 |
| 57 | iso_pu_bacteria | 2808606404 | 2809079229 | 391 |
| 58 | iso_pu_bacteria | 2808606405 | 2809083397 | 391 |
| 59 | iso_pu_bacteria | 2880518877 | 2880520605 | 391 |
| 60 | 3300005578 | Ga0068854_100114930 | Ga0068854_1001149302 | 393 |
| 61 | 3300010375 | Ga0105239_10396815 | Ga0105239_103968151 | 394 |
| 62 | 3300031595 | Ga0265313_10072321 | Ga0265313_100723212 | 394 |
| 63 | 3300001904 | JGI24736J21556_1001465 | JGI24736J21556_10014655 | 395 |
| 64 | 3300001915 | JGI24741J21665_1000079 | JGI24741J21665_100007913 | 395 |
| 65 | 3300001979 | JGI24740J21852_10003959 | JGI24740J21852_100039598 | 395 |
| 66 | 3300001989 | JGI24739J22299_10000379 | JGI24739J22299_1000037912 | 395 |
| 67 | 3300002067 | JGI24735J21928_10000880 | JGI24735J21928_100008805 | 395 |
| 68 | 3300002075 | JGI24738J21930_10003527 | JGI24738J21930_100035276 | 395 |
| 69 | 3300005289 | Ga0065704_10134305 | Ga0065704_101343051 | 395 |
| 70 | 3300005353 | Ga0070669_100165881 | Ga0070669_1001658811 | 395 |
| 71 | 3300005355 | Ga0070671_100007494 | Ga0070671_1000074941 | 395 |
| 72 | 3300005466 | Ga0070685_10114232 | Ga0070685_101142321 | 395 |
| 73 | 3300005543 | Ga0070672_100078359 | Ga0070672_1000783592 | 395 |
| 74 | 3300005614 | Ga0068856_100024647 | Ga0068856_1000246474 | 395 |
| 75 | 3300005618 | Ga0068864_100047681 | Ga0068864_1000476814 | 395 |
| 76 | 3300005842 | Ga0068858_100079228 | Ga0068858_1000792283 | 395 |
| 77 | 3300005843 | Ga0068860_100373840 | Ga0068860_1003738401 | 395 |
| 78 | 3300005844 | Ga0068862_100191564 | Ga0068862_1001915642 | 395 |
| 79 | 3300006038 | Ga0075365_10100994 | Ga0075365_101009942 | 395 |
| 80 | 3300006042 | Ga0075368_10000081 | Ga0075368_100000816 | 395 |
| 81 | 3300006178 | Ga0075367_10001178 | Ga0075367_100011788 | 395 |
| 82 | 3300009545 | Ga0105237_10034377 | Ga0105237_100343772 | 395 |
| 83 | 3300009978 | Ga0105148_100011 | Ga0105148_1000117 | 395 |
| 84 | 3300013100 | Ga0157373_10051024 | Ga0157373_100510243 | 395 |
| 85 | 3300013104 | Ga0157370_10044244 | Ga0157370_100442445 | 395 |
| 86 | 3300013307 | Ga0157372_10181124 | Ga0157372_101811243 | 395 |
| 87 | 3300017792 | Ga0163161_10000897 | Ga0163161_1000089713 | 395 |
| 88 | 3300024225 | Ga0224572_1001790 | Ga0224572_10017902 | 395 |
| 89 | 3300025904 | Ga0207647_10033960 | Ga0207647_100339603 | 395 |
| 90 | 3300025923 | Ga0207681_10029640 | Ga0207681_100296402 | 395 |
| 91 | 3300025925 | Ga0207650_10013514 | Ga0207650_100135143 | 395 |
| 92 | 3300025933 | Ga0207706_10018867 | Ga0207706_100188673 | 395 |
| 93 | 3300025940 | Ga0207691_10047049 | Ga0207691_100470492 | 395 |
| 94 | 3300026035 | Ga0207703_10054666 | Ga0207703_100546663 | 395 |
| 95 | 3300026041 | Ga0207639_10000323 | Ga0207639_1000032322 | 395 |
| 96 | 3300026067 | Ga0207678_10000068 | Ga0207678_1000006844 | 395 |
| 97 | 3300026078 | Ga0207702_10001343 | Ga0207702_1000134320 | 395 |
| 98 | 3300026116 | Ga0207674_10015731 | Ga0207674_100157315 | 395 |
| 99 | 3300027866 | Ga0209813_10000087 | Ga0209813_100000874 | 395 |
| 100 | 3300031249 | Ga0265339_10009902 | Ga0265339_100099025 | 395 |
| 101 | 3300031548 | Ga0307408_100130805 | Ga0307408_1001308052 | 395 |
| 102 | 3300031712 | Ga0265342_10001524 | Ga0265342_100015249 | 395 |
| 103 | 3300031824 | Ga0307413_10043361 | Ga0307413_100433613 | 395 |
| 104 | 3300031824 | Ga0307413_10098092 | Ga0307413_100980922 | 395 |
| 105 | 3300031852 | Ga0307410_10030984 | Ga0307410_100309843 | 395 |
| 106 | 3300031852 | Ga0307410_10079395 | Ga0307410_100793952 | 395 |
| 107 | 3300031901 | Ga0307406_10018783 | Ga0307406_100187834 | 395 |
| 108 | 3300031901 | Ga0307406_10024626 | Ga0307406_100246262 | 395 |
| 109 | 3300031911 | Ga0307412_10016299 | Ga0307412_100162992 | 395 |
| 110 | 3300031995 | Ga0307409_100010670 | Ga0307409_1000106702 | 395 |
| 111 | 3300032004 | Ga0307414_10000384 | Ga0307414_1000038419 | 395 |
| 112 | 3300032004 | Ga0307414_10016354 | Ga0307414_100163546 | 395 |
| 113 | 3300032005 | Ga0307411_10174874 | Ga0307411_101748741 | 395 |
| 114 | 3300032126 | Ga0307415_100079976 | Ga0307415_1000799762 | 395 |
| 115 | 3300039062 | Ga0400483_117325 | Ga0400483_117325_835_2073 | 395 |
| 116 | 3300046453 | Ga0495627_029130 | Ga0495627_029130_162_1370 | 395 |
| 117 | 3300046460 | Ga0495638_0000068 | Ga0495638_0000068_38674_39891 | 395 |
| 118 | 3300046491 | Ga0495584_0099823 | Ga0495584_0099823_145_1344 | 395 |
| 119 | 3300046512 | Ga0495610_0000083 | Ga0495610_0000083_67987_69195 | 395 |
| 120 | 3300046519 | Ga0495632_0000023 | Ga0495632_0000023_30150_31358 | 395 |
| 121 | 3300046520 | Ga0495637_0000836 | Ga0495637_0000836_10537_11745 | 395 |
| 122 | 3300046520 | Ga0495637_0002707 | Ga0495637_0002707_4487_5695 | 395 |
| 123 | 3300046522 | Ga0495643_0000038 | Ga0495643_0000038_30780_31988 | 395 |
| 124 | 3300046524 | Ga0495648_0014476 | Ga0495648_0014476_3278_4486 | 395 |
| 125 | 3300046525 | Ga0495663_0000019 | Ga0495663_0000019_30150_31358 | 395 |
| 126 | 3300046558 | Ga0495633_0000568 | Ga0495633_0000568_25683_26891 | 395 |
| 127 | 3300046558 | Ga0495633_0000772 | Ga0495633_0000772_10292_11500 | 395 |
| 128 | 3300046692 | Ga0495671_0000027 | Ga0495671_0000027_204024_205232 | 395 |
| 129 | 3300047470 | Ga0495681_0000279 | Ga0495681_0000279_27196_28404 | 395 |
| 130 | 3300047470 | Ga0495681_0001314 | Ga0495681_0001314_9429_10637 | 395 |
| 131 | 3300047472 | Ga0495686_0043393 | Ga0495686_0043393_134_1342 | 395 |
| 132 | 3300047472 | Ga0495686_0135686 | Ga0495686_0135686_117_1325 | 395 |
| 133 | 3300048904 | Ga0496101_0163654 | Ga0496101_0163654_343_1563 | 395 |
| 134 | 3300048910 | Ga0496107_0053577 | Ga0496107_0053577_805_2025 | 395 |
| 135 | 3300048911 | Ga0496108_0001376 | Ga0496108_0001376_9123_10331 | 395 |
| 136 | 3300048911 | Ga0496108_0161783 | Ga0496108_0161783_315_1523 | 395 |
| 137 | 3300048912 | Ga0496109_0031922 | Ga0496109_0031922_874_2082 | 395 |
| 138 | 3300048912 | Ga0496109_0118634 | Ga0496109_0118634_439_1659 | 395 |
| 139 | 3300048913 | Ga0496110_0059966 | Ga0496110_0059966_893_2113 | 395 |
| 140 | 3300048914 | Ga0496111_0069902 | Ga0496111_0069902_84_1292 | 395 |
| 141 | 3300048914 | Ga0496111_0070351 | Ga0496111_0070351_366_1586 | 395 |
| 142 | 3300048914 | Ga0496111_0179786 | Ga0496111_0179786_183_1391 | 395 |
| 143 | 3300048919 | Ga0496116_0036936 | Ga0496116_0036936_1375_2583 | 395 |
| 144 | 3300048920 | Ga0496117_0008437 | Ga0496117_0008437_7209_8417 | 395 |
| 145 | 3300048924 | Ga0496121_0000997 | Ga0496121_0000997_20524_21732 | 395 |
| 146 | 3300048925 | Ga0496122_0014017 | Ga0496122_0014017_6541_7749 | 395 |
| 147 | 3300048926 | Ga0496123_0058162 | Ga0496123_0058162_912_2120 | 395 |
| 148 | 3300048927 | Ga0496124_0037793 | Ga0496124_0037793_1961_3169 | 395 |
| 149 | 3300048927 | Ga0496124_0046604 | Ga0496124_0046604_218_1426 | 395 |
| 150 | 3300048928 | Ga0496125_0012656 | Ga0496125_0012656_6583_7791 | 395 |
| 151 | 3300048928 | Ga0496125_0039327 | Ga0496125_0039327_629_1837 | 395 |
| 152 | 3300049459 | Ga0495678_041432 | Ga0495678_041432_306_1514 | 395 |
| 153 | 3300049663 | Ga0501223_000086 | Ga0501223_000086_8883_10091 | 395 |
| 154 | 3300049705 | Ga0501225_0000034 | Ga0501225_0000034_9195_10403 | 395 |
| 155 | 3300049705 | Ga0501225_0004061 | Ga0501225_0004061_1103_2311 | 395 |
| 156 | 3300050492 | nmdc:mga0yw44_86222_c1 | nmdc:mga0yw44_86222_c1_703_1920 | 395 |
| 157 | 3300050494 | nmdc:mga06z11_191_c1 | nmdc:mga06z11_191_c1_2473_3681 | 395 |
| 158 | 3300050495 | nmdc:mga04h51_1507_c1 | nmdc:mga04h51_1507_c1_1751_2959 | 395 |
| 159 | iso_pu_bacteria | 2897803580 | 2897808820 | 395 |
| 160 | 3300031238 | Ga0265332_10074841 | Ga0265332_100748411 | 396 |
| 161 | 3300060353 | Ga0501082_0081619 | Ga0501082_0081619_397_1611 | 396 |
| 162 | 3300003578 | Ga0006562J51391_1067863 | Ga0006562J51391_10678635 | 397 |
| 163 | 3300031235 | Ga0265330_10008622 | Ga0265330_100086226 | 397 |
| 164 | 3300031249 | Ga0265339_10030179 | Ga0265339_100301793 | 397 |
| 165 | 3300031595 | Ga0265313_10009363 | Ga0265313_100093632 | 397 |
| 166 | 3300049583 | Ga0501067_0029418 | Ga0501067_0029418_159_1376 | 397 |
| 167 | 3300053104 | Ga0500556_0001106 | Ga0500556_0001106_7672_8904 | 397 |
| 168 | iso_pu_bacteria | 2522572158 | 2523103374 | 397 |
| 169 | 3300005347 | Ga0070668_100077535 | Ga0070668_1000775353 | 398 |
| 170 | 3300005444 | Ga0070694_100114519 | Ga0070694_1001145192 | 398 |
| 171 | 3300005545 | Ga0070695_100012328 | Ga0070695_1000123281 | 398 |
| 172 | 3300005563 | Ga0068855_100384727 | Ga0068855_1003847271 | 398 |
| 173 | 3300005617 | Ga0068859_100327190 | Ga0068859_1003271901 | 398 |
| 174 | 3300005842 | Ga0068858_100039621 | Ga0068858_1000396214 | 398 |
| 175 | 3300006852 | Ga0075433_10351223 | Ga0075433_103512231 | 398 |
| 176 | 3300006871 | Ga0075434_100073207 | Ga0075434_1000732074 | 398 |
| 177 | 3300006931 | Ga0097620_100327185 | Ga0097620_1003271851 | 398 |
| 178 | 3300009094 | Ga0111539_10119085 | Ga0111539_101190851 | 398 |
| 179 | 3300009553 | Ga0105249_10317834 | Ga0105249_103178342 | 398 |
| 180 | 3300013297 | Ga0157378_10126805 | Ga0157378_101268053 | 398 |
| 181 | 3300014326 | Ga0157380_10278078 | Ga0157380_102780781 | 398 |
| 182 | 3300025933 | Ga0207706_10151650 | Ga0207706_101516502 | 398 |
| 183 | 3300026075 | Ga0207708_10110697 | Ga0207708_101106972 | 398 |
| 184 | 3300028380 | Ga0268265_10248948 | Ga0268265_102489481 | 398 |
| 185 | 3300048903 | Ga0496100_0075119 | Ga0496100_0075119_407_1639 | 398 |
| 186 | 3300048904 | Ga0496101_0087126 | Ga0496101_0087126_638_1870 | 398 |
| 187 | 3300048905 | Ga0496102_0004386 | Ga0496102_0004386_850_2082 | 398 |
| 188 | 3300048910 | Ga0496107_0091247 | Ga0496107_0091247_964_2196 | 398 |
| 189 | 3300048912 | Ga0496109_0025751 | Ga0496109_0025751_1124_2356 | 398 |
| 190 | 3300049568 | Ga0501031_0020670 | Ga0501031_0020670_329_1561 | 398 |
| 191 | 3300049573 | Ga0501037_0063493 | Ga0501037_0063493_733_1965 | 398 |
| 192 | 3300049574 | Ga0501038_0151076 | Ga0501038_0151076_192_1424 | 398 |
| 193 | 3300049576 | Ga0501040_0010464 | Ga0501040_0010464_3303_4535 | 398 |
| 194 | 3300049578 | Ga0501042_0020429 | Ga0501042_0020429_2745_3977 | 398 |
| 195 | 3300049580 | Ga0501046_0084981 | Ga0501046_0084981_532_1764 | 398 |
| 196 | 3300049584 | Ga0501068_0054371 | Ga0501068_0054371_85_1317 | 398 |
| 197 | 3300049584 | Ga0501068_0151515 | Ga0501068_0151515_193_1425 | 398 |
| 198 | 3300049587 | Ga0501071_0099093 | Ga0501071_0099093_725_1957 | 398 |
| 199 | 3300049743 | Ga0501081_0008911 | Ga0501081_0008911_2053_3285 | 398 |
| 200 | 3300049822 | Ga0501035_0021051 | Ga0501035_0021051_2847_4079 | 398 |
| 201 | 3300049823 | Ga0501044_0064936 | Ga0501044_0064936_36_1241 | 398 |
| 202 | 3300049823 | Ga0501044_0257729 | Ga0501044_0257729_96_1328 | 398 |
| 203 | 3300049824 | Ga0501045_0041254 | Ga0501045_0041254_1936_3168 | 398 |
| 204 | 3300050510 | nmdc:mga06r32_51949_c1 | nmdc:mga06r32_51949_c1_55_1287 | 398 |
| 205 | 3300050512 | nmdc:mga0n895_111546_c1 | nmdc:mga0n895_111546_c1_1262_2494 | 398 |
| 206 | 3300054114 | Ga0501084_0013172 | Ga0501084_0013172_5407_6639 | 398 |
| 207 | 3300060353 | Ga0501082_0056526 | Ga0501082_0056526_53_1285 | 398 |
| 208 | iso_pu_bacteria | 2597490356 | 2599102682 | 398 |
| 209 | iso_pu_bacteria | 2846952575 | 2846955403 | 398 |
| 210 | iso_pu_bacteria | 2848858292 | 2848861046 | 398 |
| 211 | iso_pu_bacteria | 2941485952 | 2941488062 | 398 |
| 212 | 3300031249 | Ga0265339_10000033 | Ga0265339_1000003379 | 399 |
| 213 | 3300031595 | Ga0265313_10000049 | Ga0265313_1000004920 | 399 |
| 214 | 3300044712 | Ga0453684_0043018 | Ga0453684_0043018_1906_3159 | 399 |
| 215 | 3300046463 | Ga0495653_0044231 | Ga0495653_0044231_2125_3333 | 399 |
| 216 | 3300046491 | Ga0495584_0005586 | Ga0495584_0005586_1008_2246 | 399 |
| 217 | 3300049576 | Ga0501040_0188160 | Ga0501040_0188160_31_1278 | 399 |
| 218 | 3300049577 | Ga0501041_0016047 | Ga0501041_0016047_792_2039 | 399 |
| 219 | 3300049579 | Ga0501043_0077737 | Ga0501043_0077737_980_2227 | 399 |
| 220 | 3300049580 | Ga0501046_0143179 | Ga0501046_0143179_284_1531 | 399 |
| 221 | 3300049582 | Ga0501048_0173710 | Ga0501048_0173710_117_1361 | 399 |
| 222 | 3300049582 | Ga0501048_0178656 | Ga0501048_0178656_10_1257 | 399 |
| 223 | 3300049587 | Ga0501071_0045980 | Ga0501071_0045980_954_2198 | 399 |
| 224 | 3300049587 | Ga0501071_0086331 | Ga0501071_0086331_727_1974 | 399 |
| 225 | 3300049588 | Ga0501072_0054742 | Ga0501072_0054742_1365_2609 | 399 |
| 226 | 3300049588 | Ga0501072_0111234 | Ga0501072_0111234_767_2014 | 399 |
| 227 | 3300049590 | Ga0501074_0080618 | Ga0501074_0080618_554_1798 | 399 |
| 228 | 3300049591 | Ga0501075_0039262 | Ga0501075_0039262_1379_2626 | 399 |
| 229 | 3300049592 | Ga0501076_0175704 | Ga0501076_0175704_123_1370 | 399 |
| 230 | 3300049593 | Ga0501077_0056525 | Ga0501077_0056525_694_1938 | 399 |
| 231 | 3300049741 | Ga0501079_0005234 | Ga0501079_0005234_266_1513 | 399 |
| 232 | 3300049743 | Ga0501081_0055428 | Ga0501081_0055428_271_1518 | 399 |
| 233 | 3300049743 | Ga0501081_0100093 | Ga0501081_0100093_239_1486 | 399 |
| 234 | 3300049744 | Ga0501083_0143314 | Ga0501083_0143314_276_1523 | 399 |
| 235 | 3300060353 | Ga0501082_0110314 | Ga0501082_0110314_564_1808 | 399 |
| 236 | 3300060353 | Ga0501082_0168915 | Ga0501082_0168915_521_1768 | 399 |
| 237 | iso_pu_bacteria | 2511231221 | 2512038276 | 399 |
| 238 | iso_pu_bacteria | 2643221574 | 2643884552 | 399 |
| 239 | iso_pu_bacteria | 2643221663 | 2644351387 | 399 |
| 240 | iso_pu_bacteria | 2643221699 | 2644549064 | 399 |
| 241 | iso_pu_bacteria | 2643221699 | 2644553206 | 399 |
| 242 | iso_pu_bacteria | 2928972540 | 2928974528 | 399 |
| 243 | iso_pu_bacteria | 2977240413 | 2977243451 | 399 |
| 244 | iso_pu_bacteria | 8054002106 | 8054002866 | 399 |
| 245 | 3300005719 | Ga0068861_100204099 | Ga0068861_1002040992 | 400 |
| 246 | 3300026088 | Ga0207641_10202093 | Ga0207641_102020932 | 400 |
| 247 | 3300026118 | Ga0207675_100248502 | Ga0207675_1002485022 | 400 |
| 248 | 3300049581 | Ga0501047_0085660 | Ga0501047_0085660_1771_3009 | 400 |
| 249 | 3300049589 | Ga0501073_0044455 | Ga0501073_0044455_876_2105 | 400 |
| 250 | 3300049589 | Ga0501073_0062686 | Ga0501073_0062686_1349_2578 | 400 |
| 251 | 3300060353 | Ga0501082_0094166 | Ga0501082_0094166_782_2011 | 400 |
| 252 | iso_pu_bacteria | 2523231067 | 2523468637 | 400 |
| 253 | iso_pu_bacteria | 2738543031 | 2739349867 | 400 |
| 254 | 3300025913 | Ga0207695_10002758 | Ga0207695_1000275813 | 401 |
| 255 | 3300031241 | Ga0265325_10001319 | Ga0265325_1000131921 | 401 |
| 256 | 3300031247 | Ga0265340_10022161 | Ga0265340_100221615 | 401 |
| 257 | 3300031595 | Ga0265313_10005321 | Ga0265313_100053217 | 401 |
| 258 | 3300031712 | Ga0265342_10038344 | Ga0265342_100383442 | 401 |
| 259 | 3300048905 | Ga0496102_0100039 | Ga0496102_0100039_885_2135 | 401 |
| 260 | 3300048907 | Ga0496104_0035169 | Ga0496104_0035169_2920_4170 | 401 |
| 261 | 3300048907 | Ga0496104_0195705 | Ga0496104_0195705_647_1888 | 401 |
| 262 | 3300048908 | Ga0496105_0157161 | Ga0496105_0157161_356_1597 | 401 |
| 263 | 3300048908 | Ga0496105_0185565 | Ga0496105_0185565_146_1396 | 401 |
| 264 | 3300048911 | Ga0496108_0119819 | Ga0496108_0119819_182_1432 | 401 |
| 265 | 3300048915 | Ga0496112_0188480 | Ga0496112_0188480_717_1967 | 401 |
| 266 | 3300048917 | Ga0496114_0038158 | Ga0496114_0038158_561_1802 | 401 |
| 267 | 3300048918 | Ga0496115_0022496 | Ga0496115_0022496_2020_3270 | 401 |
| 268 | 3300049742 | Ga0501080_0025088 | Ga0501080_0025088_2007_3275 | 401 |
| 269 | 3300049744 | Ga0501083_0003365 | Ga0501083_0003365_9700_10950 | 401 |
| 270 | 3300053077 | Ga0495601_0011070 | Ga0495601_0011070_3013_4254 | 401 |
| 271 | 3300053730 | Ga0500645_001143 | Ga0500645_001143_8763_10025 | 401 |
| 272 | 3300054114 | Ga0501084_0014344 | Ga0501084_0014344_3491_4759 | 401 |
| 273 | 3300060353 | Ga0501082_0010751 | Ga0501082_0010751_782_2050 | 401 |
| 274 | iso_pu_bacteria | 2643221651 | 2644290964 | 401 |
| 275 | iso_pu_bacteria | 2919073203 | 2919073820 | 401 |
| 276 | iso_pu_bacteria | 8016557553 | 8016557647 | 401 |
| 277 | 3300005336 | Ga0070680_100018386 | Ga0070680_1000183862 | 402 |
| 278 | 3300005347 | Ga0070668_100218410 | Ga0070668_1002184101 | 402 |
| 279 | 3300005435 | Ga0070714_100092438 | Ga0070714_1000924382 | 402 |
| 280 | 3300005437 | Ga0070710_10009606 | Ga0070710_100096066 | 402 |
| 281 | 3300005458 | Ga0070681_10041751 | Ga0070681_100417512 | 402 |
| 282 | 3300005530 | Ga0070679_100062201 | Ga0070679_1000622015 | 402 |
| 283 | 3300005983 | Ga0081540_1020079 | Ga0081540_10200792 | 402 |
| 284 | 3300006038 | Ga0075365_10130557 | Ga0075365_101305572 | 402 |
| 285 | 3300006042 | Ga0075368_10041013 | Ga0075368_100410132 | 402 |
| 286 | 3300006175 | Ga0070712_100004886 | Ga0070712_1000048864 | 402 |
| 287 | 3300006846 | Ga0075430_100006643 | Ga0075430_1000066437 | 402 |
| 288 | 3300006871 | Ga0075434_100019228 | Ga0075434_1000192285 | 402 |
| 289 | 3300009094 | Ga0111539_10084487 | Ga0111539_100844871 | 402 |
| 290 | 3300025915 | Ga0207693_10002841 | Ga0207693_100028414 | 402 |
| 291 | 3300025926 | Ga0207659_10176117 | Ga0207659_101761171 | 402 |
| 292 | 3300025940 | Ga0207691_10305640 | Ga0207691_103056401 | 402 |
| 293 | 3300027907 | Ga0207428_10049012 | Ga0207428_100490125 | 402 |
| 294 | 3300028380 | Ga0268265_10167932 | Ga0268265_101679322 | 402 |
| 295 | 3300032004 | Ga0307414_10014276 | Ga0307414_100142762 | 402 |
| 296 | 3300035695 | Ga0373927_0114486 | Ga0373927_0114486_491_1711 | 402 |
| 297 | 3300047322 | Ga0495680_0214928 | Ga0495680_0214928_62_1306 | 402 |
| 298 | 3300048907 | Ga0496104_0065269 | Ga0496104_0065269_1674_2933 | 402 |
| 299 | 3300048919 | Ga0496116_0013402 | Ga0496116_0013402_4096_5346 | 402 |
| 300 | 3300049570 | Ga0501033_0005988 | Ga0501033_0005988_1508_2755 | 402 |
| 301 | 3300049744 | Ga0501083_0021302 | Ga0501083_0021302_1003_2217 | 402 |
| 302 | 3300050508 | nmdc:mga09592_14616_c1 | nmdc:mga09592_14616_c1_4475_5701 | 402 |
| 303 | 3300050509 | nmdc:mga0qj67_392_c1 | nmdc:mga0qj67_392_c1_1927_3168 | 402 |
| 304 | 3300050511 | nmdc:mga08y16_66523_c1 | nmdc:mga08y16_66523_c1_512_1756 | 402 |
| 305 | 3300003781 | Ga0055536_1002707 | Ga0055536_10027072 | 403 |
| 306 | 3300005445 | Ga0070708_100131067 | Ga0070708_1001310672 | 403 |
| 307 | 3300005536 | Ga0070697_100036459 | Ga0070697_1000364594 | 403 |
| 308 | 3300006028 | Ga0070717_10145022 | Ga0070717_101450222 | 403 |
| 309 | 3300006048 | Ga0075363_100108057 | Ga0075363_1001080571 | 403 |
| 310 | 3300006051 | Ga0075364_10052321 | Ga0075364_100523212 | 403 |
| 311 | 3300006186 | Ga0075369_10028880 | Ga0075369_100288802 | 403 |
| 312 | 3300006353 | Ga0075370_10089375 | Ga0075370_100893751 | 403 |
| 313 | 3300010159 | Ga0099796_10010230 | Ga0099796_100102303 | 403 |
| 314 | 3300013102 | Ga0157371_10001665 | Ga0157371_100016655 | 403 |
| 315 | 3300013104 | Ga0157370_10038949 | Ga0157370_100389493 | 403 |
| 316 | 3300013105 | Ga0157369_10044416 | Ga0157369_100444164 | 403 |
| 317 | 3300025292 | Ga0209676_1000140 | Ga0209676_100014042 | 403 |
| 318 | 3300025292 | Ga0209676_1001860 | Ga0209676_100186012 | 403 |
| 319 | 3300025304 | Ga0209257_1000292 | Ga0209257_100029248 | 403 |
| 320 | 3300025910 | Ga0207684_10096437 | Ga0207684_100964371 | 403 |
| 321 | 3300031901 | Ga0307406_10004876 | Ga0307406_100048766 | 403 |
| 322 | 3300031911 | Ga0307412_10002217 | Ga0307412_100022173 | 403 |
| 323 | 3300032004 | Ga0307414_10030847 | Ga0307414_100308472 | 403 |
| 324 | 3300032004 | Ga0307414_10053668 | Ga0307414_100536683 | 403 |
| 325 | 3300039447 | Ga0436361_0722936 | Ga0436361_0722936_927_2195 | 403 |
| 326 | 3300046512 | Ga0495610_0035906 | Ga0495610_0035906_1062_2315 | 403 |
| 327 | 3300046558 | Ga0495633_0002060 | Ga0495633_0002060_10483_11739 | 403 |
| 328 | 3300046694 | Ga0495649_0000048 | Ga0495649_0000048_113074_114327 | 403 |
| 329 | 3300048903 | Ga0496100_0208748 | Ga0496100_0208748_60_1280 | 403 |
| 330 | 3300048909 | Ga0496106_0000236 | Ga0496106_0000236_5893_7110 | 403 |
| 331 | 3300048910 | Ga0496107_0017289 | Ga0496107_0017289_3206_4426 | 403 |
| 332 | 3300048911 | Ga0496108_0000902 | Ga0496108_0000902_9418_10635 | 403 |
| 333 | 3300048912 | Ga0496109_0000224 | Ga0496109_0000224_42216_43433 | 403 |
| 334 | 3300048913 | Ga0496110_0074428 | Ga0496110_0074428_1606_2850 | 403 |
| 335 | 3300048915 | Ga0496112_0002281 | Ga0496112_0002281_3511_4728 | 403 |
| 336 | 3300048916 | Ga0496113_0022653 | Ga0496113_0022653_2120_3337 | 403 |
| 337 | 3300048918 | Ga0496115_0003837 | Ga0496115_0003837_7119_8372 | 403 |
| 338 | 3300048925 | Ga0496122_0073705 | Ga0496122_0073705_620_1876 | 403 |
| 339 | 3300049571 | Ga0501034_0394862 | Ga0501034_0394862_56_1288 | 403 |
| 340 | 3300049580 | Ga0501046_0000033 | Ga0501046_0000033_81975_83228 | 403 |
| 341 | 3300050490 | nmdc:mga03n38_74979_c1 | nmdc:mga03n38_74979_c1_37_1260 | 403 |
| 342 | 3300050492 | nmdc:mga0yw44_58568_c1 | nmdc:mga0yw44_58568_c1_281_1504 | 403 |
| 343 | 3300050516 | nmdc:mga0sz30_21157_c1 | nmdc:mga0sz30_21157_c1_1097_2320 | 403 |
| 344 | 3300053091 | Ga0500647_0002985 | Ga0500647_0002985_4849_6132 | 403 |
| 345 | 3300053093 | Ga0500651_0039297 | Ga0500651_0039297_1363_2616 | 403 |
| 346 | 3300053156 | Ga0500622_0009386 | Ga0500622_0009386_133_1425 | 403 |
| 347 | 3300001979 | JGI24740J21852_10007775 | JGI24740J21852_100077754 | 404 |
| 348 | 3300001990 | JGI24737J22298_10001802 | JGI24737J22298_100018027 | 404 |
| 349 | 3300002067 | JGI24735J21928_10014573 | JGI24735J21928_100145732 | 404 |
| 350 | 3300005336 | Ga0070680_100084167 | Ga0070680_1000841672 | 404 |
| 351 | 3300005539 | Ga0068853_100006249 | Ga0068853_1000062495 | 404 |
| 352 | 3300005539 | Ga0068853_100044038 | Ga0068853_1000440382 | 404 |
| 353 | 3300005539 | Ga0068853_100178455 | Ga0068853_1001784552 | 404 |
| 354 | 3300005563 | Ga0068855_100042726 | Ga0068855_1000427262 | 404 |
| 355 | 3300005577 | Ga0068857_100017914 | Ga0068857_1000179144 | 404 |
| 356 | 3300005577 | Ga0068857_100037829 | Ga0068857_1000378295 | 404 |
| 357 | 3300005578 | Ga0068854_100018065 | Ga0068854_1000180652 | 404 |
| 358 | 3300005578 | Ga0068854_100022998 | Ga0068854_1000229982 | 404 |
| 359 | 3300005614 | Ga0068856_100015929 | Ga0068856_1000159297 | 404 |
| 360 | 3300005614 | Ga0068856_100020679 | Ga0068856_1000206793 | 404 |
| 361 | 3300005616 | Ga0068852_100082220 | Ga0068852_1000822203 | 404 |
| 362 | 3300005834 | Ga0068851_10002682 | Ga0068851_100026829 | 404 |
| 363 | 3300005983 | Ga0081540_1001046 | Ga0081540_100104611 | 404 |
| 364 | 3300006048 | Ga0075363_100072497 | Ga0075363_1000724973 | 404 |
| 365 | 3300006175 | Ga0070712_100079757 | Ga0070712_1000797572 | 404 |
| 366 | 3300006178 | Ga0075367_10010807 | Ga0075367_100108077 | 404 |
| 367 | 3300009093 | Ga0105240_10013995 | Ga0105240_1001399510 | 404 |
| 368 | 3300009093 | Ga0105240_10036311 | Ga0105240_100363116 | 404 |
| 369 | 3300009093 | Ga0105240_10430801 | Ga0105240_104308011 | 404 |
| 370 | 3300009098 | Ga0105245_10054168 | Ga0105245_100541683 | 404 |
| 371 | 3300009174 | Ga0105241_10009743 | Ga0105241_100097436 | 404 |
| 372 | 3300009177 | Ga0105248_10225181 | Ga0105248_102251812 | 404 |
| 373 | 3300009545 | Ga0105237_10316943 | Ga0105237_103169432 | 404 |
| 374 | 3300009551 | Ga0105238_10000905 | Ga0105238_100009057 | 404 |
| 375 | 3300009551 | Ga0105238_10011422 | Ga0105238_100114224 | 404 |
| 376 | 3300010375 | Ga0105239_10048612 | Ga0105239_100486124 | 404 |
| 377 | 3300010375 | Ga0105239_10179237 | Ga0105239_101792372 | 404 |
| 378 | 3300025903 | Ga0207680_10039933 | Ga0207680_100399333 | 404 |
| 379 | 3300025904 | Ga0207647_10000871 | Ga0207647_100008716 | 404 |
| 380 | 3300025911 | Ga0207654_10000058 | Ga0207654_1000005837 | 404 |
| 381 | 3300025913 | Ga0207695_10000453 | Ga0207695_1000045323 | 404 |
| 382 | 3300025913 | Ga0207695_10023280 | Ga0207695_100232807 | 404 |
| 383 | 3300025914 | Ga0207671_10225179 | Ga0207671_102251792 | 404 |
| 384 | 3300025915 | Ga0207693_10000434 | Ga0207693_1000043426 | 404 |
| 385 | 3300025915 | Ga0207693_10060072 | Ga0207693_100600723 | 404 |
| 386 | 3300025917 | Ga0207660_10126476 | Ga0207660_101264762 | 404 |
| 387 | 3300025924 | Ga0207694_10082128 | Ga0207694_100821282 | 404 |
| 388 | 3300025927 | Ga0207687_10005296 | Ga0207687_100052968 | 404 |
| 389 | 3300025934 | Ga0207686_10148339 | Ga0207686_101483391 | 404 |
| 390 | 3300025949 | Ga0207667_10020988 | Ga0207667_100209887 | 404 |
| 391 | 3300025949 | Ga0207667_10045340 | Ga0207667_100453406 | 404 |
| 392 | 3300025986 | Ga0207658_10058728 | Ga0207658_100587282 | 404 |
| 393 | 3300026023 | Ga0207677_10017935 | Ga0207677_100179352 | 404 |
| 394 | 3300026041 | Ga0207639_10021124 | Ga0207639_100211243 | 404 |
| 395 | 3300026041 | Ga0207639_10047997 | Ga0207639_100479973 | 404 |
| 396 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004220 | 404 |
| 397 | 3300026078 | Ga0207702_10081442 | Ga0207702_100814421 | 404 |
| 398 | 3300026116 | Ga0207674_10013733 | Ga0207674_100137335 | 404 |
| 399 | 3300026116 | Ga0207674_10032534 | Ga0207674_100325345 | 404 |
| 400 | 3300026142 | Ga0207698_10057221 | Ga0207698_100572213 | 404 |
| 401 | 3300028023 | Ga0265357_1000262 | Ga0265357_10002622 | 404 |
| 402 | 3300035113 | Ga0373936_0041141 | Ga0373936_0041141_52_1314 | 404 |
| 403 | 3300035116 | Ga0373945_0003922 | Ga0373945_0003922_2039_3301 | 404 |
| 404 | 3300035170 | Ga0373943_0001179 | Ga0373943_0001179_878_2140 | 404 |
| 405 | 3300035171 | Ga0373946_0009494 | Ga0373946_0009494_1686_2948 | 404 |
| 406 | 3300035692 | Ga0373935_0044940 | Ga0373935_0044940_517_1779 | 404 |
| 407 | 3300035695 | Ga0373927_0000863 | Ga0373927_0000863_21533_22795 | 404 |
| 408 | 3300035695 | Ga0373927_0011948 | Ga0373927_0011948_2546_3808 | 404 |
| 409 | 3300035725 | Ga0373947_0002147 | Ga0373947_0002147_9280_10542 | 404 |
| 410 | 3300035725 | Ga0373947_0006972 | Ga0373947_0006972_2948_4210 | 404 |
| 411 | 3300037068 | Ga0373925_0008281 | Ga0373925_0008281_1243_2505 | 404 |
| 412 | 3300037068 | Ga0373925_0142309 | Ga0373925_0142309_471_1691 | 404 |
| 413 | 3300039437 | Ga0436365_0840419 | Ga0436365_0840419_480_1709 | 404 |
| 414 | 3300039437 | Ga0436365_1336443 | Ga0436365_1336443_508_1770 | 404 |
| 415 | 3300039438 | Ga0436360_0873896 | Ga0436360_0873896_25_1287 | 404 |
| 416 | 3300039447 | Ga0436361_0500089 | Ga0436361_0500089_1463_2725 | 404 |
| 417 | 3300039450 | Ga0436363_0887763 | Ga0436363_0887763_1792_3012 | 404 |
| 418 | 3300046462 | Ga0495651_0062022 | Ga0495651_0062022_439_1701 | 404 |
| 419 | 3300046476 | Ga0495662_0001111 | Ga0495662_0001111_484_1746 | 404 |
| 420 | 3300046477 | Ga0495664_0000554 | Ga0495664_0000554_8331_9593 | 404 |
| 421 | 3300046514 | Ga0495618_0003921 | Ga0495618_0003921_3347_4609 | 404 |
| 422 | 3300046514 | Ga0495618_0127837 | Ga0495618_0127837_112_1374 | 404 |
| 423 | 3300046517 | Ga0495630_0006717 | Ga0495630_0006717_851_2113 | 404 |
| 424 | 3300046517 | Ga0495630_0032184 | Ga0495630_0032184_1901_3163 | 404 |
| 425 | 3300046526 | Ga0495666_0006120 | Ga0495666_0006120_4411_5673 | 404 |
| 426 | 3300046529 | Ga0495652_0049806 | Ga0495652_0049806_1612_2874 | 404 |
| 427 | 3300046535 | Ga0495586_0019585 | Ga0495586_0019585_1531_2793 | 404 |
| 428 | 3300046543 | Ga0495645_0003212 | Ga0495645_0003212_7405_8667 | 404 |
| 429 | 3300046690 | Ga0495624_0095759 | Ga0495624_0095759_281_1543 | 404 |
| 430 | 3300047319 | Ga0495674_0054449 | Ga0495674_0054449_1823_3085 | 404 |
| 431 | 3300047320 | Ga0495672_0008846 | Ga0495672_0008846_1299_2519 | 404 |
| 432 | 3300047321 | Ga0495676_0018139 | Ga0495676_0018139_3489_4751 | 404 |
| 433 | 3300048903 | Ga0496100_0114614 | Ga0496100_0114614_173_1483 | 404 |
| 434 | 3300048916 | Ga0496113_0083590 | Ga0496113_0083590_772_2082 | 404 |
| 435 | 3300048929 | Ga0496126_0023175 | Ga0496126_0023175_1838_3058 | 404 |
| 436 | 3300049569 | Ga0501032_0000303 | Ga0501032_0000303_26726_27946 | 404 |
| 437 | 3300049570 | Ga0501033_0000881 | Ga0501033_0000881_6051_7271 | 404 |
| 438 | 3300049571 | Ga0501034_0000250 | Ga0501034_0000250_72615_73835 | 404 |
| 439 | 3300049571 | Ga0501034_0222330 | Ga0501034_0222330_217_1461 | 404 |
| 440 | 3300049572 | Ga0501036_0000098 | Ga0501036_0000098_51359_52579 | 404 |
| 441 | 3300049573 | Ga0501037_0000092 | Ga0501037_0000092_21802_23022 | 404 |
| 442 | 3300049574 | Ga0501038_0002041 | Ga0501038_0002041_11275_12495 | 404 |
| 443 | 3300049575 | Ga0501039_0000085 | Ga0501039_0000085_23692_24912 | 404 |
| 444 | 3300049579 | Ga0501043_0000460 | Ga0501043_0000460_6456_7676 | 404 |
| 445 | 3300049580 | Ga0501046_0000624 | Ga0501046_0000624_6038_7258 | 404 |
| 446 | 3300049580 | Ga0501046_0052907 | Ga0501046_0052907_54_1274 | 404 |
| 447 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_178648_179868 | 404 |
| 448 | 3300049581 | Ga0501047_0268507 | Ga0501047_0268507_167_1387 | 404 |
| 449 | 3300049582 | Ga0501048_0000292 | Ga0501048_0000292_15028_16248 | 404 |
| 450 | 3300049583 | Ga0501067_0003139 | Ga0501067_0003139_4746_5966 | 404 |
| 451 | 3300049584 | Ga0501068_0003364 | Ga0501068_0003364_738_1958 | 404 |
| 452 | 3300049586 | Ga0501070_0014140 | Ga0501070_0014140_412_1632 | 404 |
| 453 | 3300049586 | Ga0501070_0173269 | Ga0501070_0173269_337_1557 | 404 |
| 454 | 3300049588 | Ga0501072_0027316 | Ga0501072_0027316_2544_3764 | 404 |
| 455 | 3300049589 | Ga0501073_0000109 | Ga0501073_0000109_20892_22112 | 404 |
| 456 | 3300049590 | Ga0501074_0000250 | Ga0501074_0000250_26602_27822 | 404 |
| 457 | 3300049742 | Ga0501080_0006971 | Ga0501080_0006971_1552_2772 | 404 |
| 458 | 3300049742 | Ga0501080_0261239 | Ga0501080_0261239_134_1486 | 404 |
| 459 | 3300049744 | Ga0501083_0000618 | Ga0501083_0000618_538_1758 | 404 |
| 460 | 3300049822 | Ga0501035_0001489 | Ga0501035_0001489_8420_9640 | 404 |
| 461 | 3300049823 | Ga0501044_0000072 | Ga0501044_0000072_65245_66465 | 404 |
| 462 | 3300049824 | Ga0501045_0081425 | Ga0501045_0081425_48_1268 | 404 |
| 463 | 3300050490 | nmdc:mga03n38_55789_c1 | nmdc:mga03n38_55789_c1_213_1475 | 404 |
| 464 | 3300050512 | nmdc:mga0n895_15793_c1 | nmdc:mga0n895_15793_c1_3529_4749 | 404 |
| 465 | 3300053078 | Ga0495612_0003354 | Ga0495612_0003354_802_2064 | 404 |
| 466 | 3300053078 | Ga0495612_0036858 | Ga0495612_0036858_372_1634 | 404 |
| 467 | 3300053084 | Ga0495595_0001522 | Ga0495595_0001522_1137_2399 | 404 |
| 468 | 3300053085 | Ga0495619_0008836 | Ga0495619_0008836_4307_5569 | 404 |
| 469 | 3300053085 | Ga0495619_0029292 | Ga0495619_0029292_493_1755 | 404 |
| 470 | 3300053093 | Ga0500651_0059817 | Ga0500651_0059817_1045_2352 | 404 |
| 471 | 3300053094 | Ga0500566_0007133 | Ga0500566_0007133_3272_4579 | 404 |
| 472 | 3300053096 | Ga0500641_0024126 | Ga0500641_0024126_336_1562 | 404 |
| 473 | 3300053125 | Ga0500618_004828 | Ga0500618_004828_1785_3092 | 404 |
| 474 | 3300053136 | Ga0500559_0000398 | Ga0500559_0000398_25518_26825 | 404 |
| 475 | 3300053136 | Ga0500559_0000465 | Ga0500559_0000465_23572_24792 | 404 |
| 476 | 3300053139 | Ga0500568_0005085 | Ga0500568_0005085_3110_4360 | 404 |
| 477 | 3300053157 | Ga0500624_004059 | Ga0500624_004059_203_1510 | 404 |
| 478 | 3300053178 | Ga0500637_0037235 | Ga0500637_0037235_812_2119 | 404 |
| 479 | 3300054114 | Ga0501084_0001321 | Ga0501084_0001321_7634_8854 | 404 |
| 480 | 3300060353 | Ga0501082_0007370 | Ga0501082_0007370_3915_5201 | 404 |
| 481 | 3300060353 | Ga0501082_0042143 | Ga0501082_0042143_964_2184 | 404 |
| 482 | iso_pu_bacteria | 2643221547 | 2643757928 | 404 |
| 483 | 3300005330 | Ga0070690_100146333 | Ga0070690_1001463331 | 405 |
| 484 | 3300005353 | Ga0070669_100059546 | Ga0070669_1000595462 | 405 |
| 485 | 3300005354 | Ga0070675_100083141 | Ga0070675_1000831412 | 405 |
| 486 | 3300005355 | Ga0070671_100001856 | Ga0070671_10000185616 | 405 |
| 487 | 3300005435 | Ga0070714_100003288 | Ga0070714_10000328812 | 405 |
| 488 | 3300005435 | Ga0070714_100078156 | Ga0070714_1000781562 | 405 |
| 489 | 3300005436 | Ga0070713_100117010 | Ga0070713_1001170102 | 405 |
| 490 | 3300005457 | Ga0070662_100042252 | Ga0070662_1000422522 | 405 |
| 491 | 3300005548 | Ga0070665_100090650 | Ga0070665_1000906502 | 405 |
| 492 | 3300005841 | Ga0068863_100019233 | Ga0068863_1000192335 | 405 |
| 493 | 3300005842 | Ga0068858_100121676 | Ga0068858_1001216761 | 405 |
| 494 | 3300006028 | Ga0070717_10044309 | Ga0070717_100443092 | 405 |
| 495 | 3300006847 | Ga0075431_100125075 | Ga0075431_1001250752 | 405 |
| 496 | 3300024227 | Ga0228598_1000469 | Ga0228598_10004694 | 405 |
| 497 | 3300025906 | Ga0207699_10038570 | Ga0207699_100385702 | 405 |
| 498 | 3300025908 | Ga0207643_10081668 | Ga0207643_100816682 | 405 |
| 499 | 3300025915 | Ga0207693_10017239 | Ga0207693_100172394 | 405 |
| 500 | 3300025929 | Ga0207664_10025593 | Ga0207664_100255932 | 405 |
| 501 | 3300025929 | Ga0207664_10033479 | Ga0207664_100334795 | 405 |
| 502 | 3300025931 | Ga0207644_10010275 | Ga0207644_100102754 | 405 |
| 503 | 3300025933 | Ga0207706_10060739 | Ga0207706_100607392 | 405 |
| 504 | 3300025986 | Ga0207658_10036433 | Ga0207658_100364332 | 405 |
| 505 | 3300031616 | Ga0307508_10077726 | Ga0307508_100777262 | 405 |
| 506 | 3300039437 | Ga0436365_0160122 | Ga0436365_0160122_45_1265 | 405 |
| 507 | 3300046454 | Ga0495592_0044206 | Ga0495592_0044206_1499_2809 | 405 |
| 508 | 3300046459 | Ga0495629_0056006 | Ga0495629_0056006_754_2064 | 405 |
| 509 | 3300046475 | Ga0495639_0075596 | Ga0495639_0075596_220_1530 | 405 |
| 510 | 3300046543 | Ga0495645_0021402 | Ga0495645_0021402_2725_4035 | 405 |
| 511 | 3300046675 | Ga0495657_0086915 | Ga0495657_0086915_586_1896 | 405 |
| 512 | 3300046679 | Ga0495623_0009474 | Ga0495623_0009474_605_1915 | 405 |
| 513 | 3300047322 | Ga0495680_0106452 | Ga0495680_0106452_658_1968 | 405 |
| 514 | 3300048911 | Ga0496108_0098577 | Ga0496108_0098577_847_2148 | 405 |
| 515 | 3300048915 | Ga0496112_0044183 | Ga0496112_0044183_976_2277 | 405 |
| 516 | 3300049586 | Ga0501070_0049761 | Ga0501070_0049761_1125_2480 | 405 |
| 517 | 3300053085 | Ga0495619_0093107 | Ga0495619_0093107_601_1911 | 405 |
| 518 | 3300005329 | Ga0070683_100040594 | Ga0070683_1000405942 | 406 |
| 519 | 3300005330 | Ga0070690_100015826 | Ga0070690_1000158265 | 406 |
| 520 | 3300005337 | Ga0070682_100022863 | Ga0070682_1000228631 | 406 |
| 521 | 3300005340 | Ga0070689_100001113 | Ga0070689_1000011134 | 406 |
| 522 | 3300005343 | Ga0070687_100007702 | Ga0070687_1000077024 | 406 |
| 523 | 3300005344 | Ga0070661_100065128 | Ga0070661_1000651282 | 406 |
| 524 | 3300005345 | Ga0070692_10022160 | Ga0070692_100221605 | 406 |
| 525 | 3300005347 | Ga0070668_100161410 | Ga0070668_1001614101 | 406 |
| 526 | 3300005354 | Ga0070675_100018009 | Ga0070675_1000180094 | 406 |
| 527 | 3300005355 | Ga0070671_100010831 | Ga0070671_1000108315 | 406 |
| 528 | 3300005356 | Ga0070674_100026532 | Ga0070674_1000265325 | 406 |
| 529 | 3300005364 | Ga0070673_100038893 | Ga0070673_1000388934 | 406 |
| 530 | 3300005365 | Ga0070688_100005939 | Ga0070688_1000059395 | 406 |
| 531 | 3300005367 | Ga0070667_100029214 | Ga0070667_1000292144 | 406 |
| 532 | 3300005439 | Ga0070711_100028231 | Ga0070711_1000282315 | 406 |
| 533 | 3300005455 | Ga0070663_100086303 | Ga0070663_1000863032 | 406 |
| 534 | 3300005456 | Ga0070678_100031601 | Ga0070678_1000316014 | 406 |
| 535 | 3300005459 | Ga0068867_100019113 | Ga0068867_1000191135 | 406 |
| 536 | 3300005466 | Ga0070685_10008870 | Ga0070685_100088705 | 406 |
| 537 | 3300005518 | Ga0070699_100123881 | Ga0070699_1001238812 | 406 |
| 538 | 3300005543 | Ga0070672_100014289 | Ga0070672_1000142892 | 406 |
| 539 | 3300005578 | Ga0068854_100016650 | Ga0068854_1000166504 | 406 |
| 540 | 3300005615 | Ga0070702_100008194 | Ga0070702_1000081944 | 406 |
| 541 | 3300005617 | Ga0068859_100025009 | Ga0068859_1000250095 | 406 |
| 542 | 3300005719 | Ga0068861_100024500 | Ga0068861_1000245004 | 406 |
| 543 | 3300005842 | Ga0068858_100022418 | Ga0068858_1000224185 | 406 |
| 544 | 3300005844 | Ga0068862_100024602 | Ga0068862_1000246024 | 406 |
| 545 | 3300005983 | Ga0081540_1014999 | Ga0081540_10149995 | 406 |
| 546 | 3300005985 | Ga0081539_10012546 | Ga0081539_100125465 | 406 |
| 547 | 3300006038 | Ga0075365_10021515 | Ga0075365_100215154 | 406 |
| 548 | 3300006042 | Ga0075368_10021543 | Ga0075368_100215432 | 406 |
| 549 | 3300006237 | Ga0097621_100020748 | Ga0097621_1000207484 | 406 |
| 550 | 3300006353 | Ga0075370_10038028 | Ga0075370_100380281 | 406 |
| 551 | 3300006358 | Ga0068871_100016774 | Ga0068871_1000167745 | 406 |
| 552 | 3300006881 | Ga0068865_100025070 | Ga0068865_1000250702 | 406 |
| 553 | 3300006914 | Ga0075436_100185210 | Ga0075436_1001852101 | 406 |
| 554 | 3300006931 | Ga0097620_100025009 | Ga0097620_1000250094 | 406 |
| 555 | 3300009094 | Ga0111539_10089724 | Ga0111539_100897245 | 406 |
| 556 | 3300009147 | Ga0114129_10011617 | Ga0114129_100116176 | 406 |
| 557 | 3300009176 | Ga0105242_10028336 | Ga0105242_100283363 | 406 |
| 558 | 3300009177 | Ga0105248_10040996 | Ga0105248_100409964 | 406 |
| 559 | 3300009545 | Ga0105237_10028064 | Ga0105237_100280644 | 406 |
| 560 | 3300009551 | Ga0105238_10037417 | Ga0105238_100374175 | 406 |
| 561 | 3300009553 | Ga0105249_10015086 | Ga0105249_100150867 | 406 |
| 562 | 3300013297 | Ga0157378_10120957 | Ga0157378_101209572 | 406 |
| 563 | 3300013308 | Ga0157375_10035061 | Ga0157375_100350614 | 406 |
| 564 | 3300014745 | Ga0157377_10004874 | Ga0157377_100048747 | 406 |
| 565 | 3300014968 | Ga0157379_10027886 | Ga0157379_100278864 | 406 |
| 566 | 3300014969 | Ga0157376_10295269 | Ga0157376_102952691 | 406 |
| 567 | 3300025903 | Ga0207680_10008657 | Ga0207680_100086574 | 406 |
| 568 | 3300025908 | Ga0207643_10005672 | Ga0207643_100056724 | 406 |
| 569 | 3300025918 | Ga0207662_10010378 | Ga0207662_100103782 | 406 |
| 570 | 3300025923 | Ga0207681_10064101 | Ga0207681_100641012 | 406 |
| 571 | 3300025925 | Ga0207650_10031312 | Ga0207650_100313122 | 406 |
| 572 | 3300025931 | Ga0207644_10038217 | Ga0207644_100382175 | 406 |
| 573 | 3300025932 | Ga0207690_10018700 | Ga0207690_100187003 | 406 |
| 574 | 3300025933 | Ga0207706_10038206 | Ga0207706_100382065 | 406 |
| 575 | 3300025936 | Ga0207670_10017680 | Ga0207670_100176804 | 406 |
| 576 | 3300025940 | Ga0207691_10001627 | Ga0207691_1000162720 | 406 |
| 577 | 3300025941 | Ga0207711_10101018 | Ga0207711_101010181 | 406 |
| 578 | 3300025942 | Ga0207689_10007012 | Ga0207689_1000701210 | 406 |
| 579 | 3300025945 | Ga0207679_10015638 | Ga0207679_100156384 | 406 |
| 580 | 3300025961 | Ga0207712_10184011 | Ga0207712_101840111 | 406 |
| 581 | 3300025972 | Ga0207668_10007545 | Ga0207668_100075455 | 406 |
| 582 | 3300025981 | Ga0207640_10019201 | Ga0207640_100192013 | 406 |
| 583 | 3300026035 | Ga0207703_10221093 | Ga0207703_102210932 | 406 |
| 584 | 3300026067 | Ga0207678_10020051 | Ga0207678_100200513 | 406 |
| 585 | 3300026075 | Ga0207708_10001502 | Ga0207708_1000150210 | 406 |
| 586 | 3300026089 | Ga0207648_10006668 | Ga0207648_100066686 | 406 |
| 587 | 3300026095 | Ga0207676_10018586 | Ga0207676_100185864 | 406 |
| 588 | 3300026121 | Ga0207683_10012333 | Ga0207683_100123334 | 406 |
| 589 | 3300026142 | Ga0207698_10074967 | Ga0207698_100749672 | 406 |
| 590 | 3300028380 | Ga0268265_10011597 | Ga0268265_100115974 | 406 |
| 591 | 3300031727 | Ga0316576_10016776 | Ga0316576_100167764 | 406 |
| 592 | 3300035725 | Ga0373947_0040717 | Ga0373947_0040717_1375_2658 | 406 |
| 593 | 3300037068 | Ga0373925_0068818 | Ga0373925_0068818_16_1299 | 406 |
| 594 | 3300039447 | Ga0436361_0760231 | Ga0436361_0760231_133_1401 | 406 |
| 595 | 3300044842 | Ga0466957_0058841 | Ga0466957_0058841_977_2197 | 406 |
| 596 | 3300045049 | Ga0466959_0078594 | Ga0466959_0078594_304_1524 | 406 |
| 597 | 3300045836 | Ga0466958_0029784 | Ga0466958_0029784_1557_2777 | 406 |
| 598 | 3300046455 | Ga0495603_0101032 | Ga0495603_0101032_386_1669 | 406 |
| 599 | 3300046461 | Ga0495641_0066355 | Ga0495641_0066355_326_1609 | 406 |
| 600 | 3300046473 | Ga0495582_0005890 | Ga0495582_0005890_488_1771 | 406 |
| 601 | 3300046473 | Ga0495582_0034182 | Ga0495582_0034182_953_2230 | 406 |
| 602 | 3300046477 | Ga0495664_0082802 | Ga0495664_0082802_283_1533 | 406 |
| 603 | 3300046523 | Ga0495644_0015905 | Ga0495644_0015905_935_2218 | 406 |
| 604 | 3300046533 | Ga0495640_0143041 | Ga0495640_0143041_136_1413 | 406 |
| 605 | 3300046537 | Ga0495598_0000513 | Ga0495598_0000513_2620_3903 | 406 |
| 606 | 3300046683 | Ga0495658_0032995 | Ga0495658_0032995_175_1458 | 406 |
| 607 | 3300046690 | Ga0495624_0015346 | Ga0495624_0015346_431_1714 | 406 |
| 608 | 3300046691 | Ga0495670_0004845 | Ga0495670_0004845_96_1379 | 406 |
| 609 | 3300048090 | Ga0495615_0021522 | Ga0495615_0021522_157_1440 | 406 |
| 610 | 3300048903 | Ga0496100_0006029 | Ga0496100_0006029_3383_4660 | 406 |
| 611 | 3300048904 | Ga0496101_0003104 | Ga0496101_0003104_1736_3013 | 406 |
| 612 | 3300048904 | Ga0496101_0011363 | Ga0496101_0011363_2548_3825 | 406 |
| 613 | 3300048905 | Ga0496102_0008462 | Ga0496102_0008462_6861_8138 | 406 |
| 614 | 3300048905 | Ga0496102_0024214 | Ga0496102_0024214_1730_3007 | 406 |
| 615 | 3300048906 | Ga0496103_0016536 | Ga0496103_0016536_334_1611 | 406 |
| 616 | 3300048907 | Ga0496104_0006107 | Ga0496104_0006107_1856_3133 | 406 |
| 617 | 3300048907 | Ga0496104_0031473 | Ga0496104_0031473_334_1611 | 406 |
| 618 | 3300048908 | Ga0496105_0001999 | Ga0496105_0001999_2817_4094 | 406 |
| 619 | 3300048908 | Ga0496105_0005181 | Ga0496105_0005181_8493_9770 | 406 |
| 620 | 3300048909 | Ga0496106_0011510 | Ga0496106_0011510_255_1532 | 406 |
| 621 | 3300048909 | Ga0496106_0016650 | Ga0496106_0016650_2238_3515 | 406 |
| 622 | 3300048910 | Ga0496107_0028396 | Ga0496107_0028396_1590_2867 | 406 |
| 623 | 3300048911 | Ga0496108_0000347 | Ga0496108_0000347_1775_3052 | 406 |
| 624 | 3300048911 | Ga0496108_0013218 | Ga0496108_0013218_426_1703 | 406 |
| 625 | 3300048912 | Ga0496109_0005863 | Ga0496109_0005863_2062_3339 | 406 |
| 626 | 3300048913 | Ga0496110_0029719 | Ga0496110_0029719_2062_3339 | 406 |
| 627 | 3300048913 | Ga0496110_0035608 | Ga0496110_0035608_2837_4114 | 406 |
| 628 | 3300048914 | Ga0496111_0009006 | Ga0496111_0009006_1863_3140 | 406 |
| 629 | 3300048914 | Ga0496111_0021601 | Ga0496111_0021601_986_2263 | 406 |
| 630 | 3300048915 | Ga0496112_0002294 | Ga0496112_0002294_1895_3172 | 406 |
| 631 | 3300048915 | Ga0496112_0006289 | Ga0496112_0006289_1881_3158 | 406 |
| 632 | 3300048916 | Ga0496113_0025192 | Ga0496113_0025192_598_1875 | 406 |
| 633 | 3300048916 | Ga0496113_0058625 | Ga0496113_0058625_1415_2692 | 406 |
| 634 | 3300048918 | Ga0496115_0011128 | Ga0496115_0011128_4881_6158 | 406 |
| 635 | 3300048918 | Ga0496115_0018524 | Ga0496115_0018524_898_2175 | 406 |
| 636 | 3300048922 | Ga0496119_0000709 | Ga0496119_0000709_116_1348 | 406 |
| 637 | 3300048925 | Ga0496122_0002462 | Ga0496122_0002462_23238_24470 | 406 |
| 638 | 3300049581 | Ga0501047_0066110 | Ga0501047_0066110_837_2087 | 406 |
| 639 | 3300049589 | Ga0501073_0023706 | Ga0501073_0023706_1766_3016 | 406 |
| 640 | 3300049590 | Ga0501074_0013873 | Ga0501074_0013873_3337_4587 | 406 |
| 641 | 3300049744 | Ga0501083_0063674 | Ga0501083_0063674_214_1464 | 406 |
| 642 | 3300049823 | Ga0501044_0043948 | Ga0501044_0043948_3185_4435 | 406 |
| 643 | 3300050495 | nmdc:mga04h51_22073_c1 | nmdc:mga04h51_22073_c1_62_1339 | 406 |
| 644 | 3300050507 | nmdc:mga05p37_193198_c1 | nmdc:mga05p37_193198_c1_146_1423 | 406 |
| 645 | 3300054114 | Ga0501084_0012745 | Ga0501084_0012745_3966_5216 | 406 |
| 646 | 3300060353 | Ga0501082_0033077 | Ga0501082_0033077_1459_2709 | 406 |
| 647 | 3300006871 | Ga0075434_100167178 | Ga0075434_1001671782 | 407 |
| 648 | 3300006871 | Ga0075434_100451529 | Ga0075434_1004515291 | 407 |
| 649 | 3300006880 | Ga0075429_100121304 | Ga0075429_1001213042 | 407 |
| 650 | 3300009147 | Ga0114129_10075511 | Ga0114129_100755115 | 407 |
| 651 | 3300025915 | Ga0207693_10093857 | Ga0207693_100938571 | 407 |
| 652 | 3300025915 | Ga0207693_10216281 | Ga0207693_102162811 | 407 |
| 653 | 3300039437 | Ga0436365_1477994 | Ga0436365_1477994_762_1991 | 407 |
| 654 | 3300050492 | nmdc:mga0yw44_127155_c1 | nmdc:mga0yw44_127155_c1_166_1452 | 407 |
| 655 | 3300050510 | nmdc:mga06r32_64244_c1 | nmdc:mga06r32_64244_c1_843_2090 | 407 |
| 656 | 3300050511 | nmdc:mga08y16_64084_c1 | nmdc:mga08y16_64084_c1_216_1460 | 407 |
| 657 | 3300050512 | nmdc:mga0n895_84596_c1 | nmdc:mga0n895_84596_c1_1766_2992 | 407 |
| 658 | 3300053077 | Ga0495601_0053768 | Ga0495601_0053768_302_1582 | 407 |
| 659 | iso_pu_bacteria | 2919450847 | 2919452663 | 407 |
| 660 | 3300005330 | Ga0070690_100023017 | Ga0070690_1000230172 | 408 |
| 661 | 3300005335 | Ga0070666_10023846 | Ga0070666_100238465 | 408 |
| 662 | 3300005365 | Ga0070688_100028550 | Ga0070688_1000285502 | 408 |
| 663 | 3300005367 | Ga0070667_100205749 | Ga0070667_1002057492 | 408 |
| 664 | 3300005439 | Ga0070711_100166329 | Ga0070711_1001663292 | 408 |
| 665 | 3300005535 | Ga0070684_100070008 | Ga0070684_1000700083 | 408 |
| 666 | 3300005548 | Ga0070665_100077477 | Ga0070665_1000774773 | 408 |
| 667 | 3300005840 | Ga0068870_10131406 | Ga0068870_101314061 | 408 |
| 668 | 3300006237 | Ga0097621_100030501 | Ga0097621_1000305015 | 408 |
| 669 | 3300006871 | Ga0075434_100038177 | Ga0075434_1000381779 | 408 |
| 670 | 3300006881 | Ga0068865_100079228 | Ga0068865_1000792282 | 408 |
| 671 | 3300009093 | Ga0105240_10181196 | Ga0105240_101811962 | 408 |
| 672 | 3300009545 | Ga0105237_10184163 | Ga0105237_101841632 | 408 |
| 673 | 3300014325 | Ga0163163_10028878 | Ga0163163_100288782 | 408 |
| 674 | 3300021388 | Ga0213875_10000053 | Ga0213875_1000005349 | 408 |
| 675 | 3300025901 | Ga0207688_10048058 | Ga0207688_100480581 | 408 |
| 676 | 3300025914 | Ga0207671_10125535 | Ga0207671_101255352 | 408 |
| 677 | 3300025915 | Ga0207693_10013460 | Ga0207693_100134604 | 408 |
| 678 | 3300025915 | Ga0207693_10131435 | Ga0207693_101314352 | 408 |
| 679 | 3300025916 | Ga0207663_10170872 | Ga0207663_101708722 | 408 |
| 680 | 3300025931 | Ga0207644_10040569 | Ga0207644_100405692 | 408 |
| 681 | 3300025933 | Ga0207706_10065103 | Ga0207706_100651032 | 408 |
| 682 | 3300025939 | Ga0207665_10004784 | Ga0207665_100047849 | 408 |
| 683 | 3300025941 | Ga0207711_10009158 | Ga0207711_100091582 | 408 |
| 684 | 3300025944 | Ga0207661_10076806 | Ga0207661_100768063 | 408 |
| 685 | 3300025944 | Ga0207661_10145070 | Ga0207661_101450702 | 408 |
| 686 | 3300025961 | Ga0207712_10035724 | Ga0207712_100357242 | 408 |
| 687 | 3300025986 | Ga0207658_10169030 | Ga0207658_101690301 | 408 |
| 688 | 3300026023 | Ga0207677_10040031 | Ga0207677_100400312 | 408 |
| 689 | 3300026075 | Ga0207708_10074540 | Ga0207708_100745402 | 408 |
| 690 | 3300026089 | Ga0207648_10071352 | Ga0207648_100713522 | 408 |
| 691 | 3300026121 | Ga0207683_10028701 | Ga0207683_100287013 | 408 |
| 692 | 3300031238 | Ga0265332_10006574 | Ga0265332_100065743 | 408 |
| 693 | 3300031247 | Ga0265340_10015062 | Ga0265340_100150625 | 408 |
| 694 | 3300031250 | Ga0265331_10065198 | Ga0265331_100651982 | 408 |
| 695 | 3300031711 | Ga0265314_10022239 | Ga0265314_100222395 | 408 |
| 696 | 3300031712 | Ga0265342_10002635 | Ga0265342_100026359 | 408 |
| 697 | 3300035691 | Ga0373931_0011412 | Ga0373931_0011412_2333_3592 | 408 |
| 698 | 3300035691 | Ga0373931_0039871 | Ga0373931_0039871_460_1695 | 408 |
| 699 | 3300037853 | Ga0436364_0951864 | Ga0436364_0951864_1344_2573 | 408 |
| 700 | 3300048905 | Ga0496102_0145942 | Ga0496102_0145942_355_1590 | 408 |
| 701 | 3300049569 | Ga0501032_0123386 | Ga0501032_0123386_56_1288 | 408 |
| 702 | 3300049574 | Ga0501038_0052419 | Ga0501038_0052419_1644_2876 | 408 |
| 703 | 3300049581 | Ga0501047_0176737 | Ga0501047_0176737_671_1903 | 408 |
| 704 | 3300050512 | nmdc:mga0n895_311322_c1 | nmdc:mga0n895_311322_c1_74_1309 | 408 |
| 705 | 3300053117 | Ga0500593_043998 | Ga0500593_043998_37_1278 | 408 |
| 706 | 3300005353 | Ga0070669_100190929 | Ga0070669_1001909291 | 409 |
| 707 | 3300005616 | Ga0068852_100282240 | Ga0068852_1002822402 | 409 |
| 708 | 3300005618 | Ga0068864_100115096 | Ga0068864_1001150962 | 409 |
| 709 | 3300006914 | Ga0075436_100004004 | Ga0075436_10000400413 | 409 |
| 710 | 3300009147 | Ga0114129_10165358 | Ga0114129_101653582 | 409 |
| 711 | 3300014325 | Ga0163163_10054862 | Ga0163163_100548622 | 409 |
| 712 | 3300025915 | Ga0207693_10047329 | Ga0207693_100473292 | 409 |
| 713 | 3300026095 | Ga0207676_10039043 | Ga0207676_100390434 | 409 |
| 714 | 3300028556 | Ga0265337_1003660 | Ga0265337_10036603 | 409 |
| 715 | 3300031595 | Ga0265313_10045754 | Ga0265313_100457542 | 409 |
| 716 | 3300035083 | Ga0373926_0012322 | Ga0373926_0012322_1584_2822 | 409 |
| 717 | 3300035113 | Ga0373936_0003979 | Ga0373936_0003979_1350_2588 | 409 |
| 718 | 3300035116 | Ga0373945_0001064 | Ga0373945_0001064_3082_4320 | 409 |
| 719 | 3300035117 | Ga0373953_0025607 | Ga0373953_0025607_354_1748 | 409 |
| 720 | 3300035118 | Ga0373954_0000906 | Ga0373954_0000906_5861_7099 | 409 |
| 721 | 3300035119 | Ga0373956_0015622 | Ga0373956_0015622_1446_2840 | 409 |
| 722 | 3300035170 | Ga0373943_0003827 | Ga0373943_0003827_1313_2551 | 409 |
| 723 | 3300035171 | Ga0373946_0001814 | Ga0373946_0001814_4769_6007 | 409 |
| 724 | 3300035172 | Ga0373955_0000201 | Ga0373955_0000201_4515_5753 | 409 |
| 725 | 3300035692 | Ga0373935_0000068 | Ga0373935_0000068_18924_20162 | 409 |
| 726 | 3300035695 | Ga0373927_0005387 | Ga0373927_0005387_4144_5382 | 409 |
| 727 | 3300035724 | Ga0373933_0096591 | Ga0373933_0096591_522_1754 | 409 |
| 728 | 3300035725 | Ga0373947_0002537 | Ga0373947_0002537_8316_9554 | 409 |
| 729 | 3300036401 | Ga0373937_0000347 | Ga0373937_0000347_6613_7851 | 409 |
| 730 | 3300036401 | Ga0373937_0007729 | Ga0373937_0007729_4147_5541 | 409 |
| 731 | 3300036401 | Ga0373937_0048668 | Ga0373937_0048668_2289_3521 | 409 |
| 732 | 3300037068 | Ga0373925_0000081 | Ga0373925_0000081_42676_43914 | 409 |
| 733 | 3300037068 | Ga0373925_0061285 | Ga0373925_0061285_156_1394 | 409 |
| 734 | 3300046454 | Ga0495592_0000196 | Ga0495592_0000196_29966_31204 | 409 |
| 735 | 3300046459 | Ga0495629_0003904 | Ga0495629_0003904_1965_3203 | 409 |
| 736 | 3300046462 | Ga0495651_0000977 | Ga0495651_0000977_6786_8024 | 409 |
| 737 | 3300046463 | Ga0495653_0000193 | Ga0495653_0000193_30021_31259 | 409 |
| 738 | 3300046477 | Ga0495664_0000016 | Ga0495664_0000016_104379_105617 | 409 |
| 739 | 3300046511 | Ga0495608_0000121 | Ga0495608_0000121_19018_20256 | 409 |
| 740 | 3300046514 | Ga0495618_0000124 | Ga0495618_0000124_19037_20275 | 409 |
| 741 | 3300046516 | Ga0495628_0000018 | Ga0495628_0000018_64300_65538 | 409 |
| 742 | 3300046517 | Ga0495630_0002180 | Ga0495630_0002180_7520_8758 | 409 |
| 743 | 3300046529 | Ga0495652_0000005 | Ga0495652_0000005_377453_378691 | 409 |
| 744 | 3300046533 | Ga0495640_0000063 | Ga0495640_0000063_23108_24346 | 409 |
| 745 | 3300046536 | Ga0495587_0000134 | Ga0495587_0000134_35912_37150 | 409 |
| 746 | 3300046543 | Ga0495645_0000070 | Ga0495645_0000070_40757_41995 | 409 |
| 747 | 3300046559 | Ga0495667_0000023 | Ga0495667_0000023_127268_128506 | 409 |
| 748 | 3300046642 | Ga0495634_0000241 | Ga0495634_0000241_6793_8031 | 409 |
| 749 | 3300046663 | Ga0495635_0000045 | Ga0495635_0000045_45105_46343 | 409 |
| 750 | 3300046675 | Ga0495657_0001484 | Ga0495657_0001484_18232_19470 | 409 |
| 751 | 3300046678 | Ga0495599_0000107 | Ga0495599_0000107_35944_37182 | 409 |
| 752 | 3300046679 | Ga0495623_0000180 | Ga0495623_0000180_31124_32362 | 409 |
| 753 | 3300046680 | Ga0495646_0000027 | Ga0495646_0000027_53569_54807 | 409 |
| 754 | 3300046683 | Ga0495658_0020639 | Ga0495658_0020639_962_2200 | 409 |
| 755 | 3300046809 | Ga0495600_0000062 | Ga0495600_0000062_30072_31310 | 409 |
| 756 | 3300047315 | Ga0495581_0028604 | Ga0495581_0028604_296_1534 | 409 |
| 757 | 3300047317 | Ga0495604_0000014 | Ga0495604_0000014_58564_59802 | 409 |
| 758 | 3300047319 | Ga0495674_0000014 | Ga0495674_0000014_181438_182676 | 409 |
| 759 | 3300047322 | Ga0495680_0000779 | Ga0495680_0000779_5304_6542 | 409 |
| 760 | 3300047444 | Ga0495675_0000058 | Ga0495675_0000058_35875_37113 | 409 |
| 761 | 3300047471 | Ga0495684_0000059 | Ga0495684_0000059_35916_37154 | 409 |
| 762 | 3300047673 | Ga0495593_0005129 | Ga0495593_0005129_2082_3320 | 409 |
| 763 | 3300048088 | Ga0495602_0000017 | Ga0495602_0000017_142044_143282 | 409 |
| 764 | 3300048089 | Ga0495614_0020420 | Ga0495614_0020420_702_1967 | 409 |
| 765 | 3300048915 | Ga0496112_0266687 | Ga0496112_0266687_123_1397 | 409 |
| 766 | 3300050507 | nmdc:mga05p37_27999_c1 | nmdc:mga05p37_27999_c1_1006_2247 | 409 |
| 767 | 3300050513 | nmdc:mga0rr50_95527_c1 | nmdc:mga0rr50_95527_c1_893_2299 | 409 |
| 768 | 3300050514 | nmdc:mga08x19_40687_c1 | nmdc:mga08x19_40687_c1_914_2161 | 409 |
| 769 | 3300053077 | Ga0495601_0000016 | Ga0495601_0000016_142044_143282 | 409 |
| 770 | 3300053077 | Ga0495601_0057524 | Ga0495601_0057524_1096_2358 | 409 |
| 771 | 3300053078 | Ga0495612_0000041 | Ga0495612_0000041_18981_20219 | 409 |
| 772 | 3300053084 | Ga0495595_0000048 | Ga0495595_0000048_9177_10415 | 409 |
| 773 | 3300053085 | Ga0495619_0000050 | Ga0495619_0000050_64201_65439 | 409 |
| 774 | 2209111006 | 2214772987 | 2213792940 | 410 |
| 775 | 3300000042 | ARSoilYngRDRAFT_c00005 | ARSoilYngRDRAFT_0000530 | 410 |
| 776 | 3300000043 | ARcpr5yngRDRAFT_c000005 | ARcpr5yngRDRAFT_00000539 | 410 |
| 777 | 3300000045 | ARCol0oldRDRAFT_c00605 | ARCol0oldRDRAFT_006052 | 410 |
| 778 | 3300000652 | ARCol0yngRDRAFT_1000007 | ARCol0yngRDRAFT_100000722 | 410 |
| 779 | 3300001977 | JGI24746J21847_1000626 | JGI24746J21847_10006265 | 410 |
| 780 | 3300001989 | JGI24739J22299_10000027 | JGI24739J22299_1000002728 | 410 |
| 781 | 3300001990 | JGI24737J22298_10000240 | JGI24737J22298_100002403 | 410 |
| 782 | 3300002070 | JGI24750J21931_1000045 | JGI24750J21931_10000453 | 410 |
| 783 | 3300002073 | JGI24745J21846_1000029 | JGI24745J21846_100002911 | 410 |
| 784 | 3300002075 | JGI24738J21930_10001349 | JGI24738J21930_100013498 | 410 |
| 785 | 3300002076 | JGI24749J21850_1000664 | JGI24749J21850_10006645 | 410 |
| 786 | 3300002126 | JGI24035J26624_1000187 | JGI24035J26624_10001878 | 410 |
| 787 | 3300002239 | JGI24034J26672_10000122 | JGI24034J26672_1000012213 | 410 |
| 788 | 3300002244 | JGI24742J22300_10001443 | JGI24742J22300_100014433 | 410 |
| 789 | 3300002459 | JGI24751J29686_10005219 | JGI24751J29686_100052193 | 410 |
| 790 | 3300005277 | Ga0065716_1000007 | Ga0065716_100000710 | 410 |
| 791 | 3300005290 | Ga0065712_10001604 | Ga0065712_100016045 | 410 |
| 792 | 3300005290 | Ga0065712_10003002 | Ga0065712_1000300210 | 410 |
| 793 | 3300005290 | Ga0065712_10078142 | Ga0065712_100781424 | 410 |
| 794 | 3300005293 | Ga0065715_10000898 | Ga0065715_100008984 | 410 |
| 795 | 3300005293 | Ga0065715_10088997 | Ga0065715_1008899713 | 410 |
| 796 | 3300005327 | Ga0070658_10019947 | Ga0070658_100199474 | 410 |
| 797 | 3300005327 | Ga0070658_10045121 | Ga0070658_100451212 | 410 |
| 798 | 3300005328 | Ga0070676_10000146 | Ga0070676_1000014617 | 410 |
| 799 | 3300005329 | Ga0070683_100000116 | Ga0070683_1000001168 | 410 |
| 800 | 3300005330 | Ga0070690_100015659 | Ga0070690_1000156593 | 410 |
| 801 | 3300005330 | Ga0070690_100017738 | Ga0070690_1000177383 | 410 |
| 802 | 3300005331 | Ga0070670_100013395 | Ga0070670_1000133958 | 410 |
| 803 | 3300005333 | Ga0070677_10000151 | Ga0070677_100001519 | 410 |
| 804 | 3300005334 | Ga0068869_100000013 | Ga0068869_10000001354 | 410 |
| 805 | 3300005335 | Ga0070666_10041339 | Ga0070666_100413394 | 410 |
| 806 | 3300005336 | Ga0070680_100005855 | Ga0070680_1000058557 | 410 |
| 807 | 3300005336 | Ga0070680_100021486 | Ga0070680_1000214863 | 410 |
| 808 | 3300005336 | Ga0070680_100023840 | Ga0070680_1000238405 | 410 |
| 809 | 3300005337 | Ga0070682_100002742 | Ga0070682_1000027422 | 410 |
| 810 | 3300005337 | Ga0070682_100038543 | Ga0070682_1000385433 | 410 |
| 811 | 3300005338 | Ga0068868_100002546 | Ga0068868_1000025465 | 410 |
| 812 | 3300005338 | Ga0068868_100125794 | Ga0068868_1001257942 | 410 |
| 813 | 3300005339 | Ga0070660_100005178 | Ga0070660_1000051785 | 410 |
| 814 | 3300005339 | Ga0070660_100009730 | Ga0070660_1000097305 | 410 |
| 815 | 3300005340 | Ga0070689_100145685 | Ga0070689_1001456852 | 410 |
| 816 | 3300005341 | Ga0070691_10059130 | Ga0070691_100591302 | 410 |
| 817 | 3300005343 | Ga0070687_100003954 | Ga0070687_1000039546 | 410 |
| 818 | 3300005343 | Ga0070687_100004416 | Ga0070687_1000044166 | 410 |
| 819 | 3300005344 | Ga0070661_100000228 | Ga0070661_10000022822 | 410 |
| 820 | 3300005345 | Ga0070692_10001025 | Ga0070692_100010253 | 410 |
| 821 | 3300005353 | Ga0070669_100000368 | Ga0070669_10000036816 | 410 |
| 822 | 3300005354 | Ga0070675_100000752 | Ga0070675_1000007522 | 410 |
| 823 | 3300005355 | Ga0070671_100000142 | Ga0070671_10000014241 | 410 |
| 824 | 3300005356 | Ga0070674_100001056 | Ga0070674_1000010569 | 410 |
| 825 | 3300005364 | Ga0070673_100000045 | Ga0070673_10000004539 | 410 |
| 826 | 3300005364 | Ga0070673_100071329 | Ga0070673_1000713293 | 410 |
| 827 | 3300005366 | Ga0070659_100000183 | Ga0070659_10000018324 | 410 |
| 828 | 3300005367 | Ga0070667_100013162 | Ga0070667_1000131628 | 410 |
| 829 | 3300005367 | Ga0070667_100309758 | Ga0070667_1003097581 | 410 |
| 830 | 3300005406 | Ga0070703_10001614 | Ga0070703_100016147 | 410 |
| 831 | 3300005436 | Ga0070713_100030794 | Ga0070713_1000307942 | 410 |
| 832 | 3300005437 | Ga0070710_10031023 | Ga0070710_100310231 | 410 |
| 833 | 3300005438 | Ga0070701_10009585 | Ga0070701_100095852 | 410 |
| 834 | 3300005440 | Ga0070705_100060076 | Ga0070705_1000600763 | 410 |
| 835 | 3300005441 | Ga0070700_100041846 | Ga0070700_1000418462 | 410 |
| 836 | 3300005444 | Ga0070694_100026598 | Ga0070694_1000265983 | 410 |
| 837 | 3300005455 | Ga0070663_100001069 | Ga0070663_10000106910 | 410 |
| 838 | 3300005455 | Ga0070663_100037221 | Ga0070663_1000372213 | 410 |
| 839 | 3300005456 | Ga0070678_100001753 | Ga0070678_10000175310 | 410 |
| 840 | 3300005457 | Ga0070662_100063974 | Ga0070662_1000639742 | 410 |
| 841 | 3300005458 | Ga0070681_10009946 | Ga0070681_100099465 | 410 |
| 842 | 3300005458 | Ga0070681_10014427 | Ga0070681_100144277 | 410 |
| 843 | 3300005458 | Ga0070681_10043818 | Ga0070681_100438182 | 410 |
| 844 | 3300005459 | Ga0068867_100000160 | Ga0068867_10000016021 | 410 |
| 845 | 3300005530 | Ga0070679_100006152 | Ga0070679_1000061529 | 410 |
| 846 | 3300005530 | Ga0070679_100020075 | Ga0070679_1000200755 | 410 |
| 847 | 3300005530 | Ga0070679_100040234 | Ga0070679_1000402345 | 410 |
| 848 | 3300005530 | Ga0070679_100045419 | Ga0070679_1000454193 | 410 |
| 849 | 3300005530 | Ga0070679_100076376 | Ga0070679_1000763761 | 410 |
| 850 | 3300005530 | Ga0070679_100128935 | Ga0070679_1001289352 | 410 |
| 851 | 3300005535 | Ga0070684_100000352 | Ga0070684_1000003529 | 410 |
| 852 | 3300005535 | Ga0070684_100079467 | Ga0070684_1000794672 | 410 |
| 853 | 3300005539 | Ga0068853_100003900 | Ga0068853_10000390013 | 410 |
| 854 | 3300005543 | Ga0070672_100000016 | Ga0070672_1000000165 | 410 |
| 855 | 3300005543 | Ga0070672_100085665 | Ga0070672_1000856652 | 410 |
| 856 | 3300005544 | Ga0070686_100001103 | Ga0070686_1000011032 | 410 |
| 857 | 3300005545 | Ga0070695_100002919 | Ga0070695_1000029192 | 410 |
| 858 | 3300005545 | Ga0070695_100003518 | Ga0070695_1000035184 | 410 |
| 859 | 3300005545 | Ga0070695_100068989 | Ga0070695_1000689892 | 410 |
| 860 | 3300005546 | Ga0070696_100030786 | Ga0070696_1000307862 | 410 |
| 861 | 3300005549 | Ga0070704_100001007 | Ga0070704_1000010076 | 410 |
| 862 | 3300005549 | Ga0070704_100036603 | Ga0070704_1000366033 | 410 |
| 863 | 3300005563 | Ga0068855_100010817 | Ga0068855_1000108172 | 410 |
| 864 | 3300005563 | Ga0068855_100055219 | Ga0068855_1000552192 | 410 |
| 865 | 3300005563 | Ga0068855_100055244 | Ga0068855_1000552443 | 410 |
| 866 | 3300005564 | Ga0070664_100000067 | Ga0070664_1000000679 | 410 |
| 867 | 3300005577 | Ga0068857_100003846 | Ga0068857_10000384611 | 410 |
| 868 | 3300005578 | Ga0068854_100000131 | Ga0068854_10000013121 | 410 |
| 869 | 3300005614 | Ga0068856_100057977 | Ga0068856_1000579772 | 410 |
| 870 | 3300005615 | Ga0070702_100000810 | Ga0070702_1000008108 | 410 |
| 871 | 3300005617 | Ga0068859_100015494 | Ga0068859_1000154944 | 410 |
| 872 | 3300005618 | Ga0068864_100001095 | Ga0068864_10000109520 | 410 |
| 873 | 3300005718 | Ga0068866_10002457 | Ga0068866_100024577 | 410 |
| 874 | 3300005719 | Ga0068861_100000241 | Ga0068861_10000024126 | 410 |
| 875 | 3300005719 | Ga0068861_100084806 | Ga0068861_1000848063 | 410 |
| 876 | 3300005840 | Ga0068870_10000110 | Ga0068870_100001109 | 410 |
| 877 | 3300005841 | Ga0068863_100004900 | Ga0068863_10000490013 | 410 |
| 878 | 3300005842 | Ga0068858_100042243 | Ga0068858_1000422434 | 410 |
| 879 | 3300005842 | Ga0068858_100042547 | Ga0068858_1000425473 | 410 |
| 880 | 3300005843 | Ga0068860_100001050 | Ga0068860_10000105029 | 410 |
| 881 | 3300005844 | Ga0068862_100023587 | Ga0068862_1000235872 | 410 |
| 882 | 3300005844 | Ga0068862_100037899 | Ga0068862_1000378993 | 410 |
| 883 | 3300005937 | Ga0081455_10000002 | Ga0081455_10000002313 | 410 |
| 884 | 3300006178 | Ga0075367_10018295 | Ga0075367_100182952 | 410 |
| 885 | 3300006237 | Ga0097621_100012044 | Ga0097621_1000120449 | 410 |
| 886 | 3300006237 | Ga0097621_100022669 | Ga0097621_1000226694 | 410 |
| 887 | 3300006358 | Ga0068871_100028631 | Ga0068871_1000286314 | 410 |
| 888 | 3300006358 | Ga0068871_100039933 | Ga0068871_1000399332 | 410 |
| 889 | 3300006852 | Ga0075433_10001079 | Ga0075433_1000107915 | 410 |
| 890 | 3300006871 | Ga0075434_100013980 | Ga0075434_10001398010 | 410 |
| 891 | 3300006881 | Ga0068865_100000209 | Ga0068865_1000002092 | 410 |
| 892 | 3300006931 | Ga0097620_100015494 | Ga0097620_1000154944 | 410 |
| 893 | 3300007076 | Ga0075435_100056907 | Ga0075435_1000569071 | 410 |
| 894 | 3300009011 | Ga0105251_10025625 | Ga0105251_100256254 | 410 |
| 895 | 3300009094 | Ga0111539_10000941 | Ga0111539_1000094126 | 410 |
| 896 | 3300009094 | Ga0111539_10001081 | Ga0111539_100010819 | 410 |
| 897 | 3300009098 | Ga0105245_10000090 | Ga0105245_1000009010 | 410 |
| 898 | 3300009098 | Ga0105245_10240932 | Ga0105245_102409321 | 410 |
| 899 | 3300009101 | Ga0105247_10002972 | Ga0105247_100029727 | 410 |
| 900 | 3300009101 | Ga0105247_10008124 | Ga0105247_100081246 | 410 |
| 901 | 3300009148 | Ga0105243_10017356 | Ga0105243_100173566 | 410 |
| 902 | 3300009148 | Ga0105243_10044255 | Ga0105243_100442554 | 410 |
| 903 | 3300009148 | Ga0105243_10140875 | Ga0105243_101408752 | 410 |
| 904 | 3300009174 | Ga0105241_10000053 | Ga0105241_1000005359 | 410 |
| 905 | 3300009176 | Ga0105242_10011145 | Ga0105242_1001114510 | 410 |
| 906 | 3300009176 | Ga0105242_10055680 | Ga0105242_100556803 | 410 |
| 907 | 3300009177 | Ga0105248_10000934 | Ga0105248_1000093426 | 410 |
| 908 | 3300009177 | Ga0105248_10010774 | Ga0105248_100107747 | 410 |
| 909 | 3300009177 | Ga0105248_10179957 | Ga0105248_101799572 | 410 |
| 910 | 3300009545 | Ga0105237_10341401 | Ga0105237_103414011 | 410 |
| 911 | 3300009551 | Ga0105238_10030815 | Ga0105238_100308152 | 410 |
| 912 | 3300009551 | Ga0105238_10085309 | Ga0105238_100853092 | 410 |
| 913 | 3300009551 | Ga0105238_10099990 | Ga0105238_100999903 | 410 |
| 914 | 3300009553 | Ga0105249_10002035 | Ga0105249_100020355 | 410 |
| 915 | 3300009553 | Ga0105249_10002347 | Ga0105249_100023473 | 410 |
| 916 | 3300009553 | Ga0105249_10093303 | Ga0105249_100933032 | 410 |
| 917 | 3300010375 | Ga0105239_10002502 | Ga0105239_100025025 | 410 |
| 918 | 3300010375 | Ga0105239_10025540 | Ga0105239_100255406 | 410 |
| 919 | 3300011119 | Ga0105246_10000055 | Ga0105246_100000552 | 410 |
| 920 | 3300013102 | Ga0157371_10022274 | Ga0157371_100222744 | 410 |
| 921 | 3300013105 | Ga0157369_10070663 | Ga0157369_100706632 | 410 |
| 922 | 3300013296 | Ga0157374_10000476 | Ga0157374_1000047631 | 410 |
| 923 | 3300013297 | Ga0157378_10002229 | Ga0157378_100022296 | 410 |
| 924 | 3300013306 | Ga0163162_10004481 | Ga0163162_100044819 | 410 |
| 925 | 3300013306 | Ga0163162_10052202 | Ga0163162_100522024 | 410 |
| 926 | 3300013307 | Ga0157372_10004356 | Ga0157372_100043568 | 410 |
| 927 | 3300013308 | Ga0157375_10004478 | Ga0157375_100044788 | 410 |
| 928 | 3300013308 | Ga0157375_10008267 | Ga0157375_100082672 | 410 |
| 929 | 3300014325 | Ga0163163_10004723 | Ga0163163_1000472314 | 410 |
| 930 | 3300014325 | Ga0163163_10007190 | Ga0163163_100071907 | 410 |
| 931 | 3300014326 | Ga0157380_10006672 | Ga0157380_100066726 | 410 |
| 932 | 3300014745 | Ga0157377_10000987 | Ga0157377_100009879 | 410 |
| 933 | 3300014968 | Ga0157379_10000805 | Ga0157379_1000080514 | 410 |
| 934 | 3300014968 | Ga0157379_10050365 | Ga0157379_100503655 | 410 |
| 935 | 3300014968 | Ga0157379_10086903 | Ga0157379_100869033 | 410 |
| 936 | 3300014969 | Ga0157376_10000283 | Ga0157376_1000028329 | 410 |
| 937 | 3300017792 | Ga0163161_10000199 | Ga0163161_100001997 | 410 |
| 938 | 3300020082 | Ga0206353_10275763 | Ga0206353_102757632 | 410 |
| 939 | 3300025271 | Ga0207666_1000469 | Ga0207666_10004696 | 410 |
| 940 | 3300025271 | Ga0207666_1000945 | Ga0207666_10009453 | 410 |
| 941 | 3300025290 | Ga0207673_1000045 | Ga0207673_100004512 | 410 |
| 942 | 3300025315 | Ga0207697_10000245 | Ga0207697_100002453 | 410 |
| 943 | 3300025315 | Ga0207697_10006821 | Ga0207697_100068215 | 410 |
| 944 | 3300025885 | Ga0207653_10000923 | Ga0207653_100009236 | 410 |
| 945 | 3300025893 | Ga0207682_10000029 | Ga0207682_1000002958 | 410 |
| 946 | 3300025899 | Ga0207642_10003101 | Ga0207642_100031014 | 410 |
| 947 | 3300025900 | Ga0207710_10006518 | Ga0207710_100065183 | 410 |
| 948 | 3300025900 | Ga0207710_10081259 | Ga0207710_100812591 | 410 |
| 949 | 3300025901 | Ga0207688_10000084 | Ga0207688_1000008426 | 410 |
| 950 | 3300025901 | Ga0207688_10023584 | Ga0207688_100235843 | 410 |
| 951 | 3300025903 | Ga0207680_10018398 | Ga0207680_100183983 | 410 |
| 952 | 3300025904 | Ga0207647_10005096 | Ga0207647_100050964 | 410 |
| 953 | 3300025904 | Ga0207647_10006412 | Ga0207647_100064123 | 410 |
| 954 | 3300025907 | Ga0207645_10000090 | Ga0207645_1000009037 | 410 |
| 955 | 3300025907 | Ga0207645_10033477 | Ga0207645_100334773 | 410 |
| 956 | 3300025908 | Ga0207643_10000044 | Ga0207643_1000004415 | 410 |
| 957 | 3300025909 | Ga0207705_10026788 | Ga0207705_100267883 | 410 |
| 958 | 3300025911 | Ga0207654_10004275 | Ga0207654_100042758 | 410 |
| 959 | 3300025912 | Ga0207707_10017706 | Ga0207707_100177064 | 410 |
| 960 | 3300025912 | Ga0207707_10020258 | Ga0207707_100202584 | 410 |
| 961 | 3300025912 | Ga0207707_10097808 | Ga0207707_100978082 | 410 |
| 962 | 3300025915 | Ga0207693_10052546 | Ga0207693_100525462 | 410 |
| 963 | 3300025917 | Ga0207660_10005635 | Ga0207660_100056355 | 410 |
| 964 | 3300025917 | Ga0207660_10016403 | Ga0207660_100164032 | 410 |
| 965 | 3300025917 | Ga0207660_10036154 | Ga0207660_100361542 | 410 |
| 966 | 3300025917 | Ga0207660_10085235 | Ga0207660_100852351 | 410 |
| 967 | 3300025918 | Ga0207662_10000544 | Ga0207662_100005443 | 410 |
| 968 | 3300025918 | Ga0207662_10007517 | Ga0207662_100075173 | 410 |
| 969 | 3300025919 | Ga0207657_10002170 | Ga0207657_100021703 | 410 |
| 970 | 3300025919 | Ga0207657_10005961 | Ga0207657_100059619 | 410 |
| 971 | 3300025919 | Ga0207657_10054105 | Ga0207657_100541053 | 410 |
| 972 | 3300025920 | Ga0207649_10000260 | Ga0207649_1000026030 | 410 |
| 973 | 3300025921 | Ga0207652_10008473 | Ga0207652_100084735 | 410 |
| 974 | 3300025921 | Ga0207652_10011429 | Ga0207652_100114294 | 410 |
| 975 | 3300025921 | Ga0207652_10047793 | Ga0207652_100477933 | 410 |
| 976 | 3300025923 | Ga0207681_10000154 | Ga0207681_1000015446 | 410 |
| 977 | 3300025923 | Ga0207681_10057776 | Ga0207681_100577763 | 410 |
| 978 | 3300025924 | Ga0207694_10033540 | Ga0207694_100335406 | 410 |
| 979 | 3300025924 | Ga0207694_10076501 | Ga0207694_100765013 | 410 |
| 980 | 3300025925 | Ga0207650_10003395 | Ga0207650_100033957 | 410 |
| 981 | 3300025926 | Ga0207659_10000258 | Ga0207659_1000025829 | 410 |
| 982 | 3300025926 | Ga0207659_10013822 | Ga0207659_100138224 | 410 |
| 983 | 3300025929 | Ga0207664_10040886 | Ga0207664_100408864 | 410 |
| 984 | 3300025931 | Ga0207644_10027515 | Ga0207644_100275152 | 410 |
| 985 | 3300025932 | Ga0207690_10002042 | Ga0207690_100020429 | 410 |
| 986 | 3300025932 | Ga0207690_10178287 | Ga0207690_101782872 | 410 |
| 987 | 3300025933 | Ga0207706_10003023 | Ga0207706_1000302311 | 410 |
| 988 | 3300025933 | Ga0207706_10110759 | Ga0207706_101107591 | 410 |
| 989 | 3300025935 | Ga0207709_10000372 | Ga0207709_1000037216 | 410 |
| 990 | 3300025936 | Ga0207670_10004247 | Ga0207670_1000424711 | 410 |
| 991 | 3300025936 | Ga0207670_10026412 | Ga0207670_100264123 | 410 |
| 992 | 3300025937 | Ga0207669_10000019 | Ga0207669_1000001954 | 410 |
| 993 | 3300025938 | Ga0207704_10000759 | Ga0207704_1000075913 | 410 |
| 994 | 3300025940 | Ga0207691_10000882 | Ga0207691_100008823 | 410 |
| 995 | 3300025940 | Ga0207691_10082848 | Ga0207691_100828482 | 410 |
| 996 | 3300025941 | Ga0207711_10001673 | Ga0207711_100016732 | 410 |
| 997 | 3300025941 | Ga0207711_10021680 | Ga0207711_100216806 | 410 |
| 998 | 3300025942 | Ga0207689_10000228 | Ga0207689_1000022840 | 410 |
| 999 | 3300025944 | Ga0207661_10000107 | Ga0207661_1000010723 | 410 |
| 1000 | 3300025945 | Ga0207679_10000026 | Ga0207679_1000002657 | 410 |
| 1001 | 3300025949 | Ga0207667_10007974 | Ga0207667_100079743 | 410 |
| 1002 | 3300025949 | Ga0207667_10071293 | Ga0207667_100712934 | 410 |
| 1003 | 3300025949 | Ga0207667_10194573 | Ga0207667_101945732 | 410 |
| 1004 | 3300025960 | Ga0207651_10000069 | Ga0207651_1000006945 | 410 |
| 1005 | 3300025961 | Ga0207712_10000242 | Ga0207712_1000024227 | 410 |
| 1006 | 3300025961 | Ga0207712_10018876 | Ga0207712_100188765 | 410 |
| 1007 | 3300025972 | Ga0207668_10000049 | Ga0207668_1000004929 | 410 |
| 1008 | 3300025972 | Ga0207668_10052263 | Ga0207668_100522632 | 410 |
| 1009 | 3300025981 | Ga0207640_10000234 | Ga0207640_1000023413 | 410 |
| 1010 | 3300025986 | Ga0207658_10000804 | Ga0207658_100008042 | 410 |
| 1011 | 3300025986 | Ga0207658_10269219 | Ga0207658_102692192 | 410 |
| 1012 | 3300026023 | Ga0207677_10049799 | Ga0207677_100497992 | 410 |
| 1013 | 3300026035 | Ga0207703_10034429 | Ga0207703_100344293 | 410 |
| 1014 | 3300026041 | Ga0207639_10000413 | Ga0207639_100004133 | 410 |
| 1015 | 3300026041 | Ga0207639_10017058 | Ga0207639_100170582 | 410 |
| 1016 | 3300026067 | Ga0207678_10000920 | Ga0207678_100009203 | 410 |
| 1017 | 3300026067 | Ga0207678_10060722 | Ga0207678_100607223 | 410 |
| 1018 | 3300026067 | Ga0207678_10081589 | Ga0207678_100815892 | 410 |
| 1019 | 3300026075 | Ga0207708_10014245 | Ga0207708_100142457 | 410 |
| 1020 | 3300026075 | Ga0207708_10014309 | Ga0207708_100143093 | 410 |
| 1021 | 3300026088 | Ga0207641_10000669 | Ga0207641_1000066913 | 410 |
| 1022 | 3300026089 | Ga0207648_10009806 | Ga0207648_100098063 | 410 |
| 1023 | 3300026089 | Ga0207648_10073831 | Ga0207648_100738313 | 410 |
| 1024 | 3300026095 | Ga0207676_10003679 | Ga0207676_100036799 | 410 |
| 1025 | 3300026095 | Ga0207676_10052240 | Ga0207676_100522401 | 410 |
| 1026 | 3300026116 | Ga0207674_10000882 | Ga0207674_1000088211 | 410 |
| 1027 | 3300026116 | Ga0207674_10070999 | Ga0207674_100709993 | 410 |
| 1028 | 3300026118 | Ga0207675_100014892 | Ga0207675_1000148923 | 410 |
| 1029 | 3300026118 | Ga0207675_100056431 | Ga0207675_1000564313 | 410 |
| 1030 | 3300026118 | Ga0207675_100268177 | Ga0207675_1002681771 | 410 |
| 1031 | 3300026121 | Ga0207683_10000653 | Ga0207683_1000065329 | 410 |
| 1032 | 3300026142 | Ga0207698_10000977 | Ga0207698_1000097715 | 410 |
| 1033 | 3300026142 | Ga0207698_10194176 | Ga0207698_101941762 | 410 |
| 1034 | 3300027543 | Ga0209999_1009022 | Ga0209999_10090222 | 410 |
| 1035 | 3300027617 | Ga0210002_1001945 | Ga0210002_10019454 | 410 |
| 1036 | 3300027665 | Ga0209983_1003607 | Ga0209983_10036076 | 410 |
| 1037 | 3300027695 | Ga0209966_1000652 | Ga0209966_10006524 | 410 |
| 1038 | 3300027907 | Ga0207428_10000130 | Ga0207428_1000013058 | 410 |
| 1039 | 3300027907 | Ga0207428_10000286 | Ga0207428_1000028645 | 410 |
| 1040 | 3300028380 | Ga0268265_10002575 | Ga0268265_100025754 | 410 |
| 1041 | 3300028381 | Ga0268264_10046150 | Ga0268264_100461505 | 410 |
| 1042 | 3300031241 | Ga0265325_10023154 | Ga0265325_100231543 | 410 |
| 1043 | 3300031250 | Ga0265331_10056121 | Ga0265331_100561212 | 410 |
| 1044 | 3300031595 | Ga0265313_10039878 | Ga0265313_100398782 | 410 |
| 1045 | 3300031711 | Ga0265314_10019730 | Ga0265314_100197303 | 410 |
| 1046 | 3300031712 | Ga0265342_10000149 | Ga0265342_1000014953 | 410 |
| 1047 | 3300034816 | Ga0373930_0000159 | Ga0373930_0000159_5009_6241 | 410 |
| 1048 | 3300034818 | Ga0373950_0001078 | Ga0373950_0001078_1573_2805 | 410 |
| 1049 | 3300034819 | Ga0373958_0000305 | Ga0373958_0000305_3111_4343 | 410 |
| 1050 | 3300034820 | Ga0373959_0000743 | Ga0373959_0000743_1032_2264 | 410 |
| 1051 | 3300034957 | Ga0373938_0000024 | Ga0373938_0000024_2980_4212 | 410 |
| 1052 | 3300034957 | Ga0373938_0001010 | Ga0373938_0001010_2411_3643 | 410 |
| 1053 | 3300035083 | Ga0373926_0004308 | Ga0373926_0004308_1616_2884 | 410 |
| 1054 | 3300035085 | Ga0373929_0000274 | Ga0373929_0000274_5534_6766 | 410 |
| 1055 | 3300035085 | Ga0373929_0005708 | Ga0373929_0005708_528_1760 | 410 |
| 1056 | 3300035086 | Ga0373934_0013351 | Ga0373934_0013351_205_1473 | 410 |
| 1057 | 3300035088 | Ga0373940_0000029 | Ga0373940_0000029_11673_12905 | 410 |
| 1058 | 3300035089 | Ga0373944_0011320 | Ga0373944_0011320_1142_2389 | 410 |
| 1059 | 3300035091 | Ga0373951_0000391 | Ga0373951_0000391_5545_6777 | 410 |
| 1060 | 3300035091 | Ga0373951_0000779 | Ga0373951_0000779_1073_2305 | 410 |
| 1061 | 3300035111 | Ga0373923_0001398 | Ga0373923_0001398_4489_5730 | 410 |
| 1062 | 3300035111 | Ga0373923_0034751 | Ga0373923_0034751_615_1883 | 410 |
| 1063 | 3300035112 | Ga0373932_0000515 | Ga0373932_0000515_5520_6752 | 410 |
| 1064 | 3300035112 | Ga0373932_0002870 | Ga0373932_0002870_1450_2682 | 410 |
| 1065 | 3300035112 | Ga0373932_0025991 | Ga0373932_0025991_335_1579 | 410 |
| 1066 | 3300035114 | Ga0373939_0001312 | Ga0373939_0001312_2917_4149 | 410 |
| 1067 | 3300035114 | Ga0373939_0003941 | Ga0373939_0003941_515_1747 | 410 |
| 1068 | 3300035115 | Ga0373941_0001774 | Ga0373941_0001774_1578_2810 | 410 |
| 1069 | 3300035115 | Ga0373941_0038096 | Ga0373941_0038096_125_1372 | 410 |
| 1070 | 3300035116 | Ga0373945_0000654 | Ga0373945_0000654_8333_9574 | 410 |
| 1071 | 3300035119 | Ga0373956_0008585 | Ga0373956_0008585_1695_2963 | 410 |
| 1072 | 3300035119 | Ga0373956_0019147 | Ga0373956_0019147_1553_2794 | 410 |
| 1073 | 3300035120 | Ga0373957_0006119 | Ga0373957_0006119_1648_2916 | 410 |
| 1074 | 3300035120 | Ga0373957_0073568 | Ga0373957_0073568_89_1330 | 410 |
| 1075 | 3300035121 | Ga0373960_0000932 | Ga0373960_0000932_1601_2833 | 410 |
| 1076 | 3300035121 | Ga0373960_0006664 | Ga0373960_0006664_1079_2326 | 410 |
| 1077 | 3300035170 | Ga0373943_0061106 | Ga0373943_0061106_141_1382 | 410 |
| 1078 | 3300035171 | Ga0373946_0033652 | Ga0373946_0033652_419_1660 | 410 |
| 1079 | 3300035207 | Ga0373942_0000286 | Ga0373942_0000286_7839_9071 | 410 |
| 1080 | 3300035241 | Ga0373961_0000298 | Ga0373961_0000298_15956_17188 | 410 |
| 1081 | 3300035241 | Ga0373961_0004205 | Ga0373961_0004205_1668_2900 | 410 |
| 1082 | 3300035242 | Ga0373962_0000887 | Ga0373962_0000887_71_1303 | 410 |
| 1083 | 3300035242 | Ga0373962_0001502 | Ga0373962_0001502_1003_2235 | 410 |
| 1084 | 3300035691 | Ga0373931_0001002 | Ga0373931_0001002_9368_10600 | 410 |
| 1085 | 3300035691 | Ga0373931_0027265 | Ga0373931_0027265_304_1575 | 410 |
| 1086 | 3300035692 | Ga0373935_0023692 | Ga0373935_0023692_2347_3609 | 410 |
| 1087 | 3300035692 | Ga0373935_0044129 | Ga0373935_0044129_555_1823 | 410 |
| 1088 | 3300035695 | Ga0373927_0026187 | Ga0373927_0026187_1266_2534 | 410 |
| 1089 | 3300035724 | Ga0373933_0037084 | Ga0373933_0037084_1025_2266 | 410 |
| 1090 | 3300037068 | Ga0373925_0005678 | Ga0373925_0005678_3942_5189 | 410 |
| 1091 | 3300037068 | Ga0373925_0007759 | Ga0373925_0007759_4542_5804 | 410 |
| 1092 | 3300037068 | Ga0373925_0009149 | Ga0373925_0009149_5264_6505 | 410 |
| 1093 | 3300037068 | Ga0373925_0053408 | Ga0373925_0053408_619_1887 | 410 |
| 1094 | 3300044712 | Ga0453684_0094777 | Ga0453684_0094777_1298_2530 | 410 |
| 1095 | 3300045051 | Ga0451576_0013266 | Ga0451576_0013266_1402_2634 | 410 |
| 1096 | 3300046452 | Ga0495617_024736 | Ga0495617_024736_688_1929 | 410 |
| 1097 | 3300046454 | Ga0495592_0030502 | Ga0495592_0030502_1786_3027 | 410 |
| 1098 | 3300046459 | Ga0495629_0001034 | Ga0495629_0001034_4598_5845 | 410 |
| 1099 | 3300046459 | Ga0495629_0010656 | Ga0495629_0010656_4286_5527 | 410 |
| 1100 | 3300046459 | Ga0495629_0054088 | Ga0495629_0054088_487_1728 | 410 |
| 1101 | 3300046462 | Ga0495651_0168341 | Ga0495651_0168341_78_1319 | 410 |
| 1102 | 3300046463 | Ga0495653_0010589 | Ga0495653_0010589_4967_6235 | 410 |
| 1103 | 3300046473 | Ga0495582_0004213 | Ga0495582_0004213_5053_6300 | 410 |
| 1104 | 3300046475 | Ga0495639_0009208 | Ga0495639_0009208_1290_2531 | 410 |
| 1105 | 3300046476 | Ga0495662_0002749 | Ga0495662_0002749_4589_5830 | 410 |
| 1106 | 3300046476 | Ga0495662_0006973 | Ga0495662_0006973_539_1807 | 410 |
| 1107 | 3300046477 | Ga0495664_0036496 | Ga0495664_0036496_1045_2286 | 410 |
| 1108 | 3300046491 | Ga0495584_0006458 | Ga0495584_0006458_727_1968 | 410 |
| 1109 | 3300046492 | Ga0495585_0000744 | Ga0495585_0000744_3042_4283 | 410 |
| 1110 | 3300046499 | Ga0495594_0008772 | Ga0495594_0008772_143_1390 | 410 |
| 1111 | 3300046501 | Ga0495607_0027003 | Ga0495607_0027003_440_1681 | 410 |
| 1112 | 3300046506 | Ga0495583_0038328 | Ga0495583_0038328_458_1699 | 410 |
| 1113 | 3300046511 | Ga0495608_0037362 | Ga0495608_0037362_1654_2922 | 410 |
| 1114 | 3300046513 | Ga0495616_0110694 | Ga0495616_0110694_15_1256 | 410 |
| 1115 | 3300046517 | Ga0495630_0018839 | Ga0495630_0018839_1903_3144 | 410 |
| 1116 | 3300046523 | Ga0495644_0002708 | Ga0495644_0002708_229_1470 | 410 |
| 1117 | 3300046525 | Ga0495663_0013219 | Ga0495663_0013219_617_1858 | 410 |
| 1118 | 3300046529 | Ga0495652_0019100 | Ga0495652_0019100_201_1469 | 410 |
| 1119 | 3300046533 | Ga0495640_0069336 | Ga0495640_0069336_326_1594 | 410 |
| 1120 | 3300046533 | Ga0495640_0165006 | Ga0495640_0165006_99_1340 | 410 |
| 1121 | 3300046535 | Ga0495586_0051648 | Ga0495586_0051648_394_1635 | 410 |
| 1122 | 3300046536 | Ga0495587_0007597 | Ga0495587_0007597_4965_6233 | 410 |
| 1123 | 3300046537 | Ga0495598_0009308 | Ga0495598_0009308_538_1779 | 410 |
| 1124 | 3300046538 | Ga0495609_0043795 | Ga0495609_0043795_27_1268 | 410 |
| 1125 | 3300046559 | Ga0495667_0005008 | Ga0495667_0005008_1186_2454 | 410 |
| 1126 | 3300046642 | Ga0495634_0014117 | Ga0495634_0014117_3451_4719 | 410 |
| 1127 | 3300046663 | Ga0495635_0035648 | Ga0495635_0035648_1563_2831 | 410 |
| 1128 | 3300046664 | Ga0495659_0002311 | Ga0495659_0002311_4778_6019 | 410 |
| 1129 | 3300046674 | Ga0495588_0034636 | Ga0495588_0034636_76_1317 | 410 |
| 1130 | 3300046675 | Ga0495657_0007068 | Ga0495657_0007068_3623_4891 | 410 |
| 1131 | 3300046679 | Ga0495623_0002513 | Ga0495623_0002513_5869_7137 | 410 |
| 1132 | 3300046680 | Ga0495646_0080435 | Ga0495646_0080435_445_1686 | 410 |
| 1133 | 3300046681 | Ga0495647_0004735 | Ga0495647_0004735_2017_3258 | 410 |
| 1134 | 3300046689 | Ga0495613_0009605 | Ga0495613_0009605_1675_2922 | 410 |
| 1135 | 3300046690 | Ga0495624_0053973 | Ga0495624_0053973_976_2217 | 410 |
| 1136 | 3300046691 | Ga0495670_0003165 | Ga0495670_0003165_5040_6281 | 410 |
| 1137 | 3300046809 | Ga0495600_0006032 | Ga0495600_0006032_4753_6021 | 410 |
| 1138 | 3300046809 | Ga0495600_0028982 | Ga0495600_0028982_1913_3154 | 410 |
| 1139 | 3300046809 | Ga0495600_0196222 | Ga0495600_0196222_33_1274 | 410 |
| 1140 | 3300047315 | Ga0495581_0034460 | Ga0495581_0034460_1334_2602 | 410 |
| 1141 | 3300047315 | Ga0495581_0039498 | Ga0495581_0039498_275_1516 | 410 |
| 1142 | 3300047317 | Ga0495604_0000613 | Ga0495604_0000613_1126_2394 | 410 |
| 1143 | 3300047317 | Ga0495604_0017410 | Ga0495604_0017410_356_1597 | 410 |
| 1144 | 3300047319 | Ga0495674_0020715 | Ga0495674_0020715_4706_5947 | 410 |
| 1145 | 3300047319 | Ga0495674_0108485 | Ga0495674_0108485_304_1572 | 410 |
| 1146 | 3300047319 | Ga0495674_0158694 | Ga0495674_0158694_460_1701 | 410 |
| 1147 | 3300047322 | Ga0495680_0004120 | Ga0495680_0004120_11773_13014 | 410 |
| 1148 | 3300047322 | Ga0495680_0005491 | Ga0495680_0005491_2784_4052 | 410 |
| 1149 | 3300047322 | Ga0495680_0014092 | Ga0495680_0014092_476_1717 | 410 |
| 1150 | 3300047444 | Ga0495675_0016655 | Ga0495675_0016655_271_1539 | 410 |
| 1151 | 3300047471 | Ga0495684_0000136 | Ga0495684_0000136_48390_49631 | 410 |
| 1152 | 3300047673 | Ga0495593_0061722 | Ga0495593_0061722_325_1593 | 410 |
| 1153 | 3300048089 | Ga0495614_0024753 | Ga0495614_0024753_937_2178 | 410 |
| 1154 | 3300048903 | Ga0496100_0000237 | Ga0496100_0000237_10891_12123 | 410 |
| 1155 | 3300048904 | Ga0496101_0000697 | Ga0496101_0000697_17781_19013 | 410 |
| 1156 | 3300048904 | Ga0496101_0013493 | Ga0496101_0013493_3338_4606 | 410 |
| 1157 | 3300048904 | Ga0496101_0175674 | Ga0496101_0175674_286_1554 | 410 |
| 1158 | 3300048905 | Ga0496102_0064232 | Ga0496102_0064232_1051_2283 | 410 |
| 1159 | 3300048905 | Ga0496102_0085685 | Ga0496102_0085685_29_1297 | 410 |
| 1160 | 3300048905 | Ga0496102_0133343 | Ga0496102_0133343_1022_2290 | 410 |
| 1161 | 3300048905 | Ga0496102_0133444 | Ga0496102_0133444_86_1333 | 410 |
| 1162 | 3300048905 | Ga0496102_0214057 | Ga0496102_0214057_81_1313 | 410 |
| 1163 | 3300048906 | Ga0496103_0080031 | Ga0496103_0080031_177_1409 | 410 |
| 1164 | 3300048907 | Ga0496104_0014689 | Ga0496104_0014689_2251_3519 | 410 |
| 1165 | 3300048907 | Ga0496104_0021017 | Ga0496104_0021017_1599_2831 | 410 |
| 1166 | 3300048908 | Ga0496105_0006825 | Ga0496105_0006825_4309_5577 | 410 |
| 1167 | 3300048909 | Ga0496106_0002012 | Ga0496106_0002012_4367_5599 | 410 |
| 1168 | 3300048909 | Ga0496106_0009101 | Ga0496106_0009101_1361_2593 | 410 |
| 1169 | 3300048909 | Ga0496106_0076915 | Ga0496106_0076915_175_1443 | 410 |
| 1170 | 3300048910 | Ga0496107_0000327 | Ga0496107_0000327_13399_14631 | 410 |
| 1171 | 3300048910 | Ga0496107_0014384 | Ga0496107_0014384_2129_3397 | 410 |
| 1172 | 3300048910 | Ga0496107_0030947 | Ga0496107_0030947_1549_2781 | 410 |
| 1173 | 3300048910 | Ga0496107_0078701 | Ga0496107_0078701_993_2240 | 410 |
| 1174 | 3300048910 | Ga0496107_0097708 | Ga0496107_0097708_870_2138 | 410 |
| 1175 | 3300048911 | Ga0496108_0005173 | Ga0496108_0005173_2426_3658 | 410 |
| 1176 | 3300048912 | Ga0496109_0000925 | Ga0496109_0000925_3493_4725 | 410 |
| 1177 | 3300048912 | Ga0496109_0008656 | Ga0496109_0008656_3575_4807 | 410 |
| 1178 | 3300048913 | Ga0496110_0010097 | Ga0496110_0010097_2880_4112 | 410 |
| 1179 | 3300048913 | Ga0496110_0055430 | Ga0496110_0055430_1357_2589 | 410 |
| 1180 | 3300048913 | Ga0496110_0250584 | Ga0496110_0250584_82_1329 | 410 |
| 1181 | 3300048914 | Ga0496111_0031448 | Ga0496111_0031448_944_2176 | 410 |
| 1182 | 3300048915 | Ga0496112_0005249 | Ga0496112_0005249_2509_3741 | 410 |
| 1183 | 3300048915 | Ga0496112_0133343 | Ga0496112_0133343_841_2088 | 410 |
| 1184 | 3300048915 | Ga0496112_0134740 | Ga0496112_0134740_993_2240 | 410 |
| 1185 | 3300048915 | Ga0496112_0209861 | Ga0496112_0209861_334_1566 | 410 |
| 1186 | 3300048916 | Ga0496113_0018979 | Ga0496113_0018979_2043_3275 | 410 |
| 1187 | 3300048916 | Ga0496113_0038764 | Ga0496113_0038764_1824_3056 | 410 |
| 1188 | 3300048917 | Ga0496114_0054406 | Ga0496114_0054406_508_1740 | 410 |
| 1189 | 3300049568 | Ga0501031_0058475 | Ga0501031_0058475_479_1738 | 410 |
| 1190 | 3300049571 | Ga0501034_0118961 | Ga0501034_0118961_928_2163 | 410 |
| 1191 | 3300049575 | Ga0501039_0058135 | Ga0501039_0058135_185_1444 | 410 |
| 1192 | 3300049577 | Ga0501041_0016276 | Ga0501041_0016276_1013_2272 | 410 |
| 1193 | 3300049580 | Ga0501046_0045146 | Ga0501046_0045146_570_1829 | 410 |
| 1194 | 3300049581 | Ga0501047_0082865 | Ga0501047_0082865_1622_2860 | 410 |
| 1195 | 3300049586 | Ga0501070_0020252 | Ga0501070_0020252_3058_4296 | 410 |
| 1196 | 3300049590 | Ga0501074_0053274 | Ga0501074_0053274_290_1525 | 410 |
| 1197 | 3300049742 | Ga0501080_0113678 | Ga0501080_0113678_274_1509 | 410 |
| 1198 | 3300049743 | Ga0501081_0103323 | Ga0501081_0103323_117_1376 | 410 |
| 1199 | 3300049822 | Ga0501035_0054468 | Ga0501035_0054468_1808_3046 | 410 |
| 1200 | 3300049823 | Ga0501044_0024914 | Ga0501044_0024914_4624_5859 | 410 |
| 1201 | 3300050511 | nmdc:mga08y16_14375_c1 | nmdc:mga08y16_14375_c1_1893_3125 | 410 |
| 1202 | 3300050512 | nmdc:mga0n895_552_c1 | nmdc:mga0n895_552_c1_11010_12242 | 410 |
| 1203 | 3300050513 | nmdc:mga0rr50_157675_c1 | nmdc:mga0rr50_157675_c1_225_1457 | 410 |
| 1204 | 3300050513 | nmdc:mga0rr50_33063_c1 | nmdc:mga0rr50_33063_c1_1359_2627 | 410 |
| 1205 | 3300050515 | nmdc:mga0a205_2568_c1 | nmdc:mga0a205_2568_c1_1675_2907 | 410 |
| 1206 | 3300053077 | Ga0495601_0002664 | Ga0495601_0002664_3585_4826 | 410 |
| 1207 | 3300053077 | Ga0495601_0007172 | Ga0495601_0007172_756_2024 | 410 |
| 1208 | 3300053077 | Ga0495601_0054340 | Ga0495601_0054340_577_1818 | 410 |
| 1209 | 3300053078 | Ga0495612_0010956 | Ga0495612_0010956_2028_3269 | 410 |
| 1210 | 3300053078 | Ga0495612_0015875 | Ga0495612_0015875_664_1905 | 410 |
| 1211 | 3300053078 | Ga0495612_0019036 | Ga0495612_0019036_1154_2422 | 410 |
| 1212 | 3300053084 | Ga0495595_0008969 | Ga0495595_0008969_1807_3048 | 410 |
| 1213 | 3300053084 | Ga0495595_0010099 | Ga0495595_0010099_1218_2459 | 410 |
| 1214 | 3300053085 | Ga0495619_0000518 | Ga0495619_0000518_11381_12628 | 410 |
| 1215 | 3300053085 | Ga0495619_0001220 | Ga0495619_0001220_15395_16636 | 410 |
| 1216 | 3300053085 | Ga0495619_0001244 | Ga0495619_0001244_11655_12896 | 410 |
| 1217 | 3300053085 | Ga0495619_0025575 | Ga0495619_0025575_1874_3142 | 410 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k22-assembly1.cif.gz_B-2 | structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis | 0.8817 | 8 | 364 |
| 7mwa-assembly1.cif.gz_A | crystal structure of 2-octaprenyl-6-methoxyphenol hydroxylase ubih from acinetobacter baumannii, apoenzyme | 0.8744 | 10 | 377 |
| 4k22-assembly1.cif.gz_B-2 | structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis | 0.8699 | 8 | 364 |
| 4k22-assembly1.cif.gz_A-2 | structure of the c-terminal truncated form of e.coli c5-hydroxylase ubii involved in ubiquinone (q8) biosynthesis | 0.8697 | 8 | 367 |
| 7mwa-assembly1.cif.gz_B-2 | crystal structure of 2-octaprenyl-6-methoxyphenol hydroxylase ubih from acinetobacter baumannii, apoenzyme | 0.8678 | 8 | 377 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LAM2_371_510_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9499 | 266 | 399 | 3.50.50.60 |
| af_Q54EN1_358_493_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9477 | 266 | 396 | 3.50.50.60 |
| af_Q5AHZ4_349_480_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.945 | 274 | 396 | 3.50.50.60 |
| 4k22B02 | Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 | 0.9371 | 192 | 275 | 3.30.9.10 |
| af_Q8R1S0_347_476_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9142 | 274 | 395 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S6XS37-F1-model_v4 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-) | 0.9849 | 65 | 410 |
GO:0004497
GO:0006744 GO:0016705 GO:0071949 |
| AF-A0A0X6ZUC7-F1-model_v4 | 2-octaprenyl-6-methoxyphenyl hydroxylase | 0.9814 | 8 | 410 |
GO:0004497
GO:0006744 GO:0016705 GO:0071949 |
| AF-A0A353GDC4-F1-model_v4 | Ubiquinone biosynthesis hydroxylase | 0.9794 | 8 | 410 |
GO:0004497
GO:0006744 GO:0016705 GO:0071949 |
| AF-A0A561QIG5-F1-model_v4 | 2-octaprenyl-6-methoxyphenol hydroxylase | 0.9793 | 8 | 410 |
GO:0004497
GO:0006744 GO:0016705 GO:0071949 |
| AF-A0A2A6L0G5-F1-model_v4 | deleted | 0.979 | 8 | 410 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar