F491785
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1215 | 843 | 637 | 365 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10229856|Ga0207674_102298562 |
| Length | 429 |
| Sequence | MTRRPDPSASPAVRRWVRSDRRDRTGSAAPTAARSPRSVGEDHGAGGTTSDIFEKALLRRTMAHVQVTDLDAYYGSFKAVEGVSLGIEPRSVTAFIGPSGCGKSTLLAMIAGLESVTSGEIHIGNRLVNSVPPKDRDIAMVFQSYALYPTMTVRQNITFGMESRGVPKADQAEAVKHVAALLQIEALLGRKPGQLSGGQRQRVAMGRALVRDPKLFLFDEPLSNLDAKLRVDMRTEIKKLHNRVGKTTVYVTHDQVEAMTLASRIAVMHQGSVQQFDAAQMIYSRPANMFVAGFMGSPAMNFIPAELGEAAGRPCVTVRTTDGGTAALELAQPVPAGAPRNVVLGVRPEHIYRFSDDLKQRKRAIAEVKAPVELVEPTGAETLAVLRFGDLEVTGRFDPDSAPRMGETMTLGIDMARACLFDPTTRSLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 7 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 8 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 9 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 10 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 11 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 12 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 13 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 14 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 18 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 19 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 20 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 21 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 22 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 23 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 24 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 25 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 26 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 27 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 28 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 29 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 30 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 31 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 32 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 33 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 34 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 35 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 36 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 37 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 38 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 39 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 40 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 41 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 42 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 43 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 44 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 45 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 46 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 47 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 48 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 49 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 50 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 51 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 52 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 53 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 54 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 55 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 56 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 57 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 58 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 59 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 60 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 61 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 62 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 63 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 64 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 65 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 66 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 67 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 68 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 69 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 70 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 71 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 72 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 73 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 74 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 75 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 76 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 77 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 78 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 79 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 80 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 81 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 82 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 83 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 84 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 85 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 86 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 87 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 88 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 89 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 90 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 91 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 92 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 93 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 94 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 95 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 96 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 97 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 98 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 99 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 100 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 101 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 102 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 103 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 104 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 105 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 106 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 107 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 108 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 109 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 110 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 111 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 112 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 113 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 114 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 115 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 116 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 117 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 118 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 119 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 120 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 121 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 122 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 123 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 124 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 125 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 126 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 127 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 128 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 129 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 130 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 131 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 132 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 133 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 134 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 135 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 136 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 137 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 138 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 139 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 140 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 141 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 142 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 143 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 144 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 145 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 146 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 147 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 148 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 149 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 150 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 151 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 152 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 153 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 154 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 155 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 156 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 157 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 158 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 159 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 160 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 161 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 162 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 163 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 164 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 165 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 166 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 167 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 168 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 169 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 170 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 171 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 172 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 173 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 174 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 175 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 176 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 177 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 178 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 179 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 180 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 181 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 182 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 183 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 184 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 185 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 186 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 187 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 188 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 189 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 190 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 191 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 192 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 193 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 194 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 195 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 196 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 197 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 198 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 199 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 200 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 201 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 202 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 203 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 204 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 205 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 206 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 207 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 208 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 209 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 210 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 211 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 212 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 213 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 214 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 215 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 216 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 217 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 218 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 219 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 220 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 221 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 222 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 223 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 224 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 225 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 226 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 227 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 228 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 229 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 230 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 231 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 232 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 233 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 234 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 235 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 236 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 237 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 238 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 239 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 240 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 241 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 242 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 243 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 244 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 245 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 246 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 247 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 248 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 249 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 250 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 251 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 252 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 253 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 254 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 255 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 256 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 257 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 258 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 259 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 260 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 261 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 262 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 263 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 264 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 265 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 266 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 267 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 268 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 269 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 270 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 271 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 272 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 273 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 274 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 275 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 276 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 277 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 278 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 279 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 280 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 281 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 282 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 283 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 284 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 285 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 286 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 287 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 288 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 289 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 290 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 291 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 292 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 293 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 294 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 295 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 296 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 297 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 298 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 299 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 300 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 301 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 302 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 303 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 304 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 305 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 306 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 307 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 308 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 309 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 310 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 311 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 312 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 313 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 314 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 315 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 316 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 317 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 318 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 319 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 320 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 321 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 322 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 323 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 324 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 325 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 326 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 327 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 328 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 329 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 330 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 331 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 332 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 333 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 334 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 335 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 336 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 337 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 338 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 339 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 340 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 341 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 342 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 343 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 344 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 345 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 346 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 347 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 348 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 349 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 350 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 351 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 352 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 353 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 354 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 355 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 356 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 357 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 358 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 359 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 360 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 361 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 362 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 363 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 364 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 365 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 366 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 367 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 368 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 369 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 370 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 371 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 372 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 373 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 374 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 375 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 376 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 377 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 378 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 379 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 380 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 381 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 382 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 383 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 384 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 385 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 386 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 387 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 388 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 389 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 390 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 391 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 392 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 393 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 394 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 395 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 396 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 397 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 398 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 399 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 400 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 401 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 402 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 403 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 404 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 405 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 406 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 407 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 408 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 409 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 410 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 411 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 412 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 413 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 414 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 415 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 416 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 417 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 418 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 419 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 420 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 421 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 422 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 423 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 424 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 425 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 426 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 427 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 428 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 429 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 430 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 431 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 432 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 433 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 434 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 435 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 436 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 437 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 438 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 439 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 440 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 441 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 442 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 443 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 444 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 445 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 446 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 447 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 448 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 449 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 450 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 451 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 452 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 453 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 454 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 455 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 456 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 457 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 458 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 459 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 460 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 461 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 462 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 463 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 464 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 465 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 466 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 467 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 468 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 469 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 470 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 471 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 472 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 473 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 474 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 475 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 476 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 477 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 478 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 479 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 480 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 481 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 482 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 483 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 484 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 485 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 486 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 487 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 488 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 489 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 490 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 491 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 492 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 493 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 494 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 495 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 497 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 498 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 500 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 501 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 502 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 503 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 504 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 505 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 506 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 507 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 508 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 509 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 510 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 511 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 512 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 513 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 514 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 515 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 516 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 517 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 518 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 519 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 520 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 521 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 522 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 523 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 524 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 525 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 526 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 527 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 528 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 529 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 530 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 531 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 532 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 533 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 534 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 535 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 537 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 538 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 539 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 542 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 544 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 546 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 547 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 548 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 549 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 550 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 551 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 552 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 553 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 556 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 557 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 558 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 562 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 563 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 564 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 565 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 566 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 567 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 568 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 569 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 570 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 571 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 572 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 573 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 574 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 575 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 578 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 579 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 580 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 582 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 583 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 584 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 585 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 586 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 588 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 589 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 590 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 591 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 592 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 593 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 594 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 595 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 601 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 630 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 631 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 632 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 634 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 635 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 636 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 637 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 638 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 639 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 640 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 641 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 642 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 643 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 644 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 645 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 646 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 647 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 648 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 649 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 650 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 651 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 652 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 653 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 654 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 655 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 656 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 657 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 658 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 659 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 660 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 661 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 662 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 663 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 664 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 665 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 666 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 667 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 668 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 669 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 670 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 671 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 672 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 673 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 674 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 675 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 676 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 677 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 678 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 679 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 721 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 722 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 723 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 724 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 725 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 726 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 727 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 728 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 729 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 730 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 731 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 732 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 733 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 734 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 735 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 736 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 737 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 738 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 739 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 740 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 741 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 742 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 743 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 744 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 745 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 746 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 747 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 748 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 749 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 750 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 751 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 752 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 753 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 754 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 755 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 756 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 757 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 758 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 759 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 760 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 761 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 762 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 763 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 764 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 765 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 766 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 767 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 768 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 769 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 770 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 771 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 772 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 773 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 774 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 775 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 776 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 777 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 778 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 779 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 780 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 781 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 782 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 783 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 785 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 786 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 787 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 788 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 789 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 790 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 791 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 792 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 793 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 794 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 795 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 796 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 797 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 798 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 799 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 800 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 801 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 802 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 803 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 804 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 805 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 806 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 807 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 808 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 809 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 810 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 811 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 812 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 813 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 814 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 815 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 816 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 817 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 818 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 819 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 820 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 821 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 822 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 823 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 824 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 825 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 826 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 827 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 828 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 829 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 830 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 831 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 832 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 833 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 834 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 835 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 836 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 837 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 838 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 839 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 840 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 841 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 842 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 843 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.18 |
| Metatranscriptomes | 0.25 |
| Isolates | 47.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13 |
| Nodule | 35.88 |
| Rhizoplane | 3.54 |
| Rhizosphere | 30.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10014042 | 3300001989 | Bacteria | 2917 |
| 2 | JGI25155J39150_1000017 | 3300002704 | Bacteria | 159274 |
| 3 | JGI25156J39149_1000034 | 3300002705 | Bacteria | 114036 |
| 4 | JGI25162J39368_1001729 | 3300002737 | Bacteria | 10530 |
| 5 | JGI25154J39366_1000034 | 3300002738 | Bacteria | 176764 |
| 6 | JGI25158J39367_1000032 | 3300002739 | Bacteria | 30976 |
| 7 | JGI25157J39369_1000137 | 3300002741 | Bacteria | 61333 |
| 8 | JGI25157J39369_1000744 | 3300002741 | Bacteria | 17229 |
| 9 | JGI25152J39213_1001331 | 3300002773 | Bacteria | 10900 |
| 10 | JGI25152J39213_1004173 | 3300002773 | Bacteria | 4656 |
| 11 | JGI25152J39213_1004522 | 3300002773 | Bacteria | 4356 |
| 12 | JGI25150J39212_1000093 | 3300002774 | Bacteria | 51048 |
| 13 | JGI25150J39212_1004918 | 3300002774 | Bacteria | 2909 |
| 14 | JGI25159J45721_1000017 | 3300002987 | Bacteria | 136127 |
| 15 | JGI25159J45721_1000123 | 3300002987 | Bacteria | 36902 |
| 16 | JGI25159J45721_1001871 | 3300002987 | Bacteria | 8415 |
| 17 | JGI25151J46595_10000007 | 3300003187 | Bacteria | 411751 |
| 18 | JGI25151J46595_10002246 | 3300003187 | Bacteria | 11862 |
| 19 | JGI25151J46595_10004050 | 3300003187 | Bacteria | 7860 |
| 20 | JGI25151J46595_10008237 | 3300003187 | Bacteria | 5029 |
| 21 | JGI25151J46595_10039171 | 3300003187 | Bacteria | 1754 |
| 22 | JGI25165J46597_1000821 | 3300003214 | Bacteria | 23315 |
| 23 | JGI25165J46597_1001523 | 3300003214 | Bacteria | 11677 |
| 24 | JGI25153J46596_10001186 | 3300003215 | Bacteria | 15742 |
| 25 | JGI25153J46596_10001306 | 3300003215 | Bacteria | 14934 |
| 26 | JGI25153J46596_10004193 | 3300003215 | Bacteria | 7819 |
| 27 | JGI25153J46596_10005439 | 3300003215 | Bacteria | 6684 |
| 28 | JGI25153J46596_10008984 | 3300003215 | Bacteria | 4706 |
| 29 | JGI25153J46596_10009234 | 3300003215 | Bacteria | 4613 |
| 30 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 31 | JGI25160J50197_1000027 | 3300003354 | Bacteria | 182809 |
| 32 | JGI25160J50197_1007119 | 3300003354 | Bacteria | 4413 |
| 33 | JGI25160J50197_1007183 | 3300003354 | Bacteria | 4388 |
| 34 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 35 | JGI25161J50226_1000129 | 3300003374 | Bacteria | 53598 |
| 36 | JGI25161J50226_1009580 | 3300003374 | Bacteria | 1367 |
| 37 | Ga0006562J51391_1007525 | 3300003578 | Bacteria | 6084 |
| 38 | Ga0055542_1000516 | 3300003762 | Bacteria | 34984 |
| 39 | Ga0055526_1000297 | 3300003771 | Bacteria | 41523 |
| 40 | Ga0055526_1005794 | 3300003771 | Bacteria | 6957 |
| 41 | Ga0055526_1009740 | 3300003771 | Bacteria | 4572 |
| 42 | Ga0055526_1021898 | 3300003771 | Bacteria | 2200 |
| 43 | Ga0055524_1000873 | 3300003775 | Bacteria | 19631 |
| 44 | Ga0055524_1016513 | 3300003775 | Bacteria | 2644 |
| 45 | Ga0055536_1007476 | 3300003781 | Bacteria | 4877 |
| 46 | Ga0055528_1000186 | 3300003790 | Bacteria | 52663 |
| 47 | Ga0055528_1001399 | 3300003790 | Bacteria | 14796 |
| 48 | Ga0055528_1014982 | 3300003790 | Bacteria | 2826 |
| 49 | Ga0055540_1004099 | 3300003792 | Bacteria | 6749 |
| 50 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 51 | Ga0055543_1000029 | 3300004625 | Bacteria | 131452 |
| 52 | Ga0055543_1000403 | 3300004625 | Bacteria | 27596 |
| 53 | Ga0065165_1000122 | 3300005262 | Bacteria | 132524 |
| 54 | Ga0065165_1000341 | 3300005262 | Bacteria | 76483 |
| 55 | Ga0065165_1020856 | 3300005262 | Bacteria | 2292 |
| 56 | Ga0065165_1047781 | 3300005262 | Bacteria | 1233 |
| 57 | Ga0068869_100106214 | 3300005334 | Bacteria | 2131 |
| 58 | Ga0070666_10016166 | 3300005335 | Bacteria | 4770 |
| 59 | Ga0068868_100002162 | 3300005338 | Bacteria | 13565 |
| 60 | Ga0070660_100005489 | 3300005339 | Bacteria | 8782 |
| 61 | Ga0070660_100008737 | 3300005339 | Bacteria | 7093 |
| 62 | Ga0070660_100009363 | 3300005339 | Bacteria | 6883 |
| 63 | Ga0070661_100034358 | 3300005344 | Bacteria | 3677 |
| 64 | Ga0070668_100011445 | 3300005347 | Bacteria | 6605 |
| 65 | Ga0070671_100024553 | 3300005355 | Bacteria | 4936 |
| 66 | Ga0070709_10002006 | 3300005434 | Bacteria | 11075 |
| 67 | Ga0070709_10070301 | 3300005434 | Bacteria | 2256 |
| 68 | Ga0070710_10004005 | 3300005437 | Bacteria | 6984 |
| 69 | Ga0070711_100075003 | 3300005439 | Bacteria | 2393 |
| 70 | Ga0070708_100037445 | 3300005445 | Bacteria | 4232 |
| 71 | Ga0070663_100061703 | 3300005455 | Bacteria | 2700 |
| 72 | Ga0070662_100031433 | 3300005457 | Bacteria | 3726 |
| 73 | Ga0070685_10101656 | 3300005466 | Bacteria | 1756 |
| 74 | Ga0070706_100102693 | 3300005467 | Bacteria | 2658 |
| 75 | Ga0070706_100111759 | 3300005467 | Bacteria | 2543 |
| 76 | Ga0070706_100363808 | 3300005467 | Bacteria | 1348 |
| 77 | Ga0070707_100152678 | 3300005468 | Bacteria | 2249 |
| 78 | Ga0070698_100005977 | 3300005471 | Bacteria | 13268 |
| 79 | Ga0070697_100018053 | 3300005536 | Bacteria | 5558 |
| 80 | Ga0068853_100010540 | 3300005539 | Bacteria | 7474 |
| 81 | Ga0068853_100033270 | 3300005539 | Bacteria | 4373 |
| 82 | Ga0068853_100040462 | 3300005539 | Bacteria | 3977 |
| 83 | Ga0068853_100181162 | 3300005539 | Bacteria | 1911 |
| 84 | Ga0068855_100026237 | 3300005563 | Bacteria | 6971 |
| 85 | Ga0068855_100085523 | 3300005563 | Bacteria | 3648 |
| 86 | Ga0068855_100130103 | 3300005563 | Bacteria | 2875 |
| 87 | Ga0068855_100279615 | 3300005563 | Bacteria | 1854 |
| 88 | Ga0068855_100435867 | 3300005563 | Bacteria | 1432 |
| 89 | Ga0070664_100327360 | 3300005564 | Bacteria | 1389 |
| 90 | Ga0068856_100066976 | 3300005614 | Bacteria | 3549 |
| 91 | Ga0068856_100267704 | 3300005614 | Bacteria | 1724 |
| 92 | Ga0070702_100031259 | 3300005615 | Bacteria | 2911 |
| 93 | Ga0068852_100304547 | 3300005616 | Bacteria | 1543 |
| 94 | Ga0068859_100043431 | 3300005617 | Bacteria | 4517 |
| 95 | Ga0068861_100146643 | 3300005719 | Bacteria | 1932 |
| 96 | Ga0068858_100021932 | 3300005842 | Bacteria | 5963 |
| 97 | Ga0068862_100164631 | 3300005844 | Bacteria | 1982 |
| 98 | Ga0081540_1002724 | 3300005983 | Bacteria | 14381 |
| 99 | Ga0075365_10017568 | 3300006038 | Bacteria | 4379 |
| 100 | Ga0070712_100008084 | 3300006175 | Bacteria | 6603 |
| 101 | Ga0070712_100015177 | 3300006175 | Bacteria | 4955 |
| 102 | Ga0070712_100085714 | 3300006175 | Bacteria | 2294 |
| 103 | Ga0075367_10006691 | 3300006178 | Bacteria | 5846 |
| 104 | Ga0075367_10020528 | 3300006178 | Bacteria | 3681 |
| 105 | Ga0075369_10001249 | 3300006186 | Bacteria | 8641 |
| 106 | Ga0075369_10004629 | 3300006186 | Bacteria | 5102 |
| 107 | Ga0075366_10028154 | 3300006195 | Bacteria | 3297 |
| 108 | Ga0075366_10034043 | 3300006195 | Bacteria | 3001 |
| 109 | Ga0075370_10064590 | 3300006353 | Bacteria | 2088 |
| 110 | Ga0068871_100282872 | 3300006358 | Bacteria | 1451 |
| 111 | Ga0075428_100400839 | 3300006844 | Bacteria | 1470 |
| 112 | Ga0075430_100016596 | 3300006846 | Bacteria | 6271 |
| 113 | Ga0075430_100206456 | 3300006846 | Bacteria | 1630 |
| 114 | Ga0075431_100014366 | 3300006847 | Bacteria | 8008 |
| 115 | Ga0075431_100015726 | 3300006847 | Bacteria | 7672 |
| 116 | Ga0075431_100361722 | 3300006847 | Bacteria | 1457 |
| 117 | Ga0075431_100361723 | 3300006847 | Bacteria | 1457 |
| 118 | Ga0075434_100000506 | 3300006871 | Bacteria | 29511 |
| 119 | Ga0075429_100012911 | 3300006880 | Bacteria | 7247 |
| 120 | Ga0075429_100267726 | 3300006880 | Bacteria | 1496 |
| 121 | Ga0097620_100043430 | 3300006931 | Bacteria | 4517 |
| 122 | Ga0079104_1002943 | 3300006946 | Bacteria | 8438 |
| 123 | Ga0079104_1003729 | 3300006946 | Bacteria | 6891 |
| 124 | Ga0105251_10001618 | 3300009011 | Bacteria | 19132 |
| 125 | Ga0105244_10020973 | 3300009036 | Bacteria | 3620 |
| 126 | Ga0105240_10000216 | 3300009093 | Bacteria | 115800 |
| 127 | Ga0105240_10000365 | 3300009093 | Bacteria | 84843 |
| 128 | Ga0105240_10002442 | 3300009093 | Bacteria | 29876 |
| 129 | Ga0105240_10256218 | 3300009093 | Bacteria | 2021 |
| 130 | Ga0111539_10120386 | 3300009094 | Bacteria | 3075 |
| 131 | Ga0105245_10016610 | 3300009098 | Bacteria | 6424 |
| 132 | Ga0105245_10194629 | 3300009098 | Bacteria | 1944 |
| 133 | Ga0114129_10016902 | 3300009147 | Bacteria | 10388 |
| 134 | Ga0105241_10009211 | 3300009174 | Bacteria | 7262 |
| 135 | Ga0105241_10100487 | 3300009174 | Bacteria | 2299 |
| 136 | Ga0105248_10072915 | 3300009177 | Bacteria | 3859 |
| 137 | Ga0105237_10000536 | 3300009545 | Bacteria | 53573 |
| 138 | Ga0105237_10001312 | 3300009545 | Bacteria | 33037 |
| 139 | Ga0105237_10001836 | 3300009545 | Bacteria | 27312 |
| 140 | Ga0105237_10048283 | 3300009545 | Bacteria | 4279 |
| 141 | Ga0105237_10085855 | 3300009545 | Bacteria | 3137 |
| 142 | Ga0105238_10005908 | 3300009551 | Bacteria | 12125 |
| 143 | Ga0105238_10017215 | 3300009551 | Bacteria | 7342 |
| 144 | Ga0105238_10053246 | 3300009551 | Bacteria | 4067 |
| 145 | Ga0105238_10063681 | 3300009551 | Bacteria | 3688 |
| 146 | Ga0105249_10034408 | 3300009553 | Bacteria | 4592 |
| 147 | Ga0105249_10257555 | 3300009553 | Bacteria | 1732 |
| 148 | Ga0123341_1000188 | 3300009765 | Bacteria | 31454 |
| 149 | Ga0123342_1002765 | 3300009766 | Bacteria | 28880 |
| 150 | Ga0105239_10001156 | 3300010375 | Bacteria | 36262 |
| 151 | Ga0105239_10003602 | 3300010375 | Bacteria | 18922 |
| 152 | Ga0105239_10048123 | 3300010375 | Bacteria | 4675 |
| 153 | Ga0105239_10135236 | 3300010375 | Bacteria | 2744 |
| 154 | Ga0105246_10011277 | 3300011119 | Bacteria | 5544 |
| 155 | Ga0157322_1000019 | 3300012490 | Bacteria | 2783 |
| 156 | Ga0157370_10000183 | 3300013104 | Bacteria | 78649 |
| 157 | Ga0157370_10198145 | 3300013104 | Bacteria | 1863 |
| 158 | Ga0157369_10000943 | 3300013105 | Bacteria | 36946 |
| 159 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 160 | Ga0157374_10041999 | 3300013296 | Bacteria | 4217 |
| 161 | Ga0157378_10179202 | 3300013297 | Bacteria | 1992 |
| 162 | Ga0163162_10300864 | 3300013306 | Bacteria | 1736 |
| 163 | Ga0157372_10028512 | 3300013307 | Bacteria | 6093 |
| 164 | Ga0163163_10007069 | 3300014325 | Bacteria | 9866 |
| 165 | Ga0157379_10018982 | 3300014968 | Bacteria | 6070 |
| 166 | Ga0182007_10001098 | 3300015262 | Bacteria | 14707 |
| 167 | Ga0182005_1004037 | 3300015265 | Bacteria | 4817 |
| 168 | Ga0182005_1017068 | 3300015265 | Bacteria | 2010 |
| 169 | Ga0183363_1117 | 3300015690 | Bacteria | 21180 |
| 170 | Ga0214544_1000079 | 3300021320 | Bacteria | 121742 |
| 171 | Ga0214542_1000064 | 3300021321 | Bacteria | 127681 |
| 172 | Ga0214542_1014176 | 3300021321 | Bacteria | 9068 |
| 173 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 174 | Ga0214543_1000063 | 3300021327 | Bacteria | 127694 |
| 175 | Ga0213872_10010481 | 3300021361 | Bacteria | 4410 |
| 176 | Ga0213872_10026621 | 3300021361 | Bacteria | 2656 |
| 177 | Ga0213872_10031082 | 3300021361 | Bacteria | 2447 |
| 178 | Ga0213872_10046881 | 3300021361 | Bacteria | 1966 |
| 179 | Ga0213876_10002106 | 3300021384 | Bacteria | 11774 |
| 180 | Ga0213875_10007310 | 3300021388 | Bacteria | 5714 |
| 181 | Ga0213871_10001938 | 3300021441 | Bacteria | 3661 |
| 182 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 183 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 184 | Ga0209435_100023 | 3300025206 | Bacteria | 201972 |
| 185 | Ga0209436_100026 | 3300025208 | Bacteria | 90859 |
| 186 | Ga0209436_105669 | 3300025208 | Bacteria | 2831 |
| 187 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 188 | Ga0207425_1000018 | 3300025245 | Bacteria | 411841 |
| 189 | Ga0207425_1000366 | 3300025245 | Bacteria | 31282 |
| 190 | Ga0207425_1001182 | 3300025245 | Bacteria | 11622 |
| 191 | Ga0207425_1007116 | 3300025245 | Bacteria | 2988 |
| 192 | Ga0209646_1000080 | 3300025246 | Bacteria | 201975 |
| 193 | Ga0209026_1000076 | 3300025250 | Bacteria | 201975 |
| 194 | Ga0209026_1000116 | 3300025250 | Bacteria | 133228 |
| 195 | Ga0209677_100216 | 3300025253 | Bacteria | 42627 |
| 196 | Ga0209148_1000078 | 3300025254 | Bacteria | 296101 |
| 197 | Ga0209759_1000059 | 3300025256 | Bacteria | 201975 |
| 198 | Ga0209759_1000153 | 3300025256 | Bacteria | 119494 |
| 199 | Ga0209129_1000026 | 3300025258 | Bacteria | 411839 |
| 200 | Ga0209129_1000164 | 3300025258 | Bacteria | 98984 |
| 201 | Ga0209129_1000203 | 3300025258 | Bacteria | 70739 |
| 202 | Ga0209129_1000507 | 3300025258 | Bacteria | 28094 |
| 203 | Ga0209129_1001741 | 3300025258 | Bacteria | 11687 |
| 204 | Ga0209129_1003097 | 3300025258 | Bacteria | 7482 |
| 205 | Ga0209129_1005338 | 3300025258 | Bacteria | 4588 |
| 206 | Ga0209129_1007119 | 3300025258 | Bacteria | 3411 |
| 207 | Ga0209233_1000062 | 3300025261 | Bacteria | 399685 |
| 208 | Ga0209233_1000428 | 3300025261 | Bacteria | 30724 |
| 209 | Ga0209233_1000488 | 3300025261 | Bacteria | 24083 |
| 210 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 211 | Ga0209673_1003018 | 3300025273 | Bacteria | 10435 |
| 212 | Ga0209673_1006039 | 3300025273 | Bacteria | 5952 |
| 213 | Ga0209673_1008001 | 3300025273 | Bacteria | 4765 |
| 214 | Ga0209673_1016820 | 3300025273 | Bacteria | 2720 |
| 215 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 216 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 217 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 218 | Ga0209130_1004603 | 3300025284 | Bacteria | 5155 |
| 219 | Ga0209130_1011935 | 3300025284 | Bacteria | 2300 |
| 220 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 221 | Ga0209676_1003791 | 3300025292 | Bacteria | 8943 |
| 222 | Ga0209676_1029819 | 3300025292 | Bacteria | 1678 |
| 223 | Ga0209025_1000035 | 3300025294 | Bacteria | 411841 |
| 224 | Ga0209025_1000052 | 3300025294 | Bacteria | 324648 |
| 225 | Ga0209025_1000591 | 3300025294 | Bacteria | 65471 |
| 226 | Ga0209025_1001447 | 3300025294 | Bacteria | 31156 |
| 227 | Ga0209025_1002696 | 3300025294 | Bacteria | 18090 |
| 228 | Ga0209025_1005002 | 3300025294 | Bacteria | 11075 |
| 229 | Ga0209025_1012317 | 3300025294 | Bacteria | 5499 |
| 230 | Ga0209025_1012720 | 3300025294 | Bacteria | 5364 |
| 231 | Ga0209025_1027546 | 3300025294 | Bacteria | 2815 |
| 232 | Ga0209564_1000062 | 3300025295 | Bacteria | 321275 |
| 233 | Ga0209564_1000193 | 3300025295 | Bacteria | 141731 |
| 234 | Ga0209564_1000207 | 3300025295 | Bacteria | 135313 |
| 235 | Ga0209564_1000379 | 3300025295 | Bacteria | 81420 |
| 236 | Ga0209564_1012022 | 3300025295 | Bacteria | 3815 |
| 237 | Ga0209564_1034858 | 3300025295 | Bacteria | 1468 |
| 238 | Ga0209758_1000040 | 3300025297 | Bacteria | 411841 |
| 239 | Ga0209758_1000072 | 3300025297 | Bacteria | 277776 |
| 240 | Ga0209758_1000280 | 3300025297 | Bacteria | 101103 |
| 241 | Ga0209758_1000586 | 3300025297 | Bacteria | 56819 |
| 242 | Ga0209758_1000906 | 3300025297 | Bacteria | 40219 |
| 243 | Ga0209758_1001057 | 3300025297 | Bacteria | 35976 |
| 244 | Ga0209758_1022648 | 3300025297 | Bacteria | 2870 |
| 245 | Ga0209758_1035653 | 3300025297 | Bacteria | 1957 |
| 246 | Ga0209050_1000772 | 3300025298 | Bacteria | 45952 |
| 247 | Ga0209050_1015956 | 3300025298 | Bacteria | 3109 |
| 248 | Ga0209050_1018518 | 3300025298 | Bacteria | 2701 |
| 249 | Ga0209256_1000343 | 3300025299 | Bacteria | 75902 |
| 250 | Ga0209256_1000893 | 3300025299 | Bacteria | 36710 |
| 251 | Ga0209256_1000943 | 3300025299 | Bacteria | 35287 |
| 252 | Ga0209256_1001510 | 3300025299 | Bacteria | 23567 |
| 253 | Ga0209256_1001680 | 3300025299 | Bacteria | 21453 |
| 254 | Ga0209256_1028022 | 3300025299 | Bacteria | 1596 |
| 255 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 256 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 257 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 258 | Ga0207426_1000094 | 3300025302 | Bacteria | 275293 |
| 259 | Ga0207426_1004911 | 3300025302 | Bacteria | 6312 |
| 260 | Ga0207426_1014520 | 3300025302 | Bacteria | 2883 |
| 261 | Ga0209051_1005642 | 3300025303 | Bacteria | 7246 |
| 262 | Ga0209051_1006175 | 3300025303 | Bacteria | 6802 |
| 263 | Ga0209051_1029156 | 3300025303 | Bacteria | 2165 |
| 264 | Ga0209051_1036723 | 3300025303 | Bacteria | 1806 |
| 265 | Ga0209257_1004341 | 3300025304 | Bacteria | 11076 |
| 266 | Ga0209257_1007258 | 3300025304 | Bacteria | 6771 |
| 267 | Ga0209257_1027515 | 3300025304 | Bacteria | 1891 |
| 268 | Ga0207713_1030896 | 3300025735 | Bacteria | 2378 |
| 269 | Ga0207692_10003598 | 3300025898 | Bacteria | 6066 |
| 270 | Ga0207692_10073388 | 3300025898 | Bacteria | 1810 |
| 271 | Ga0207680_10054909 | 3300025903 | Bacteria | 2399 |
| 272 | Ga0207647_10011076 | 3300025904 | Bacteria | 6338 |
| 273 | Ga0207699_10006930 | 3300025906 | Bacteria | 5517 |
| 274 | Ga0207705_10005139 | 3300025909 | Bacteria | 9807 |
| 275 | Ga0207684_10018600 | 3300025910 | Bacteria | 5948 |
| 276 | Ga0207695_10000319 | 3300025913 | Bacteria | 116116 |
| 277 | Ga0207695_10000492 | 3300025913 | Bacteria | 84474 |
| 278 | Ga0207695_10014292 | 3300025913 | Bacteria | 9415 |
| 279 | Ga0207695_10090854 | 3300025913 | Bacteria | 3068 |
| 280 | Ga0207695_10156628 | 3300025913 | Bacteria | 2212 |
| 281 | Ga0207671_10000078 | 3300025914 | Bacteria | 150705 |
| 282 | Ga0207671_10004703 | 3300025914 | Bacteria | 12904 |
| 283 | Ga0207671_10006804 | 3300025914 | Bacteria | 10101 |
| 284 | Ga0207693_10067430 | 3300025915 | Bacteria | 2802 |
| 285 | Ga0207663_10020893 | 3300025916 | Bacteria | 3716 |
| 286 | Ga0207663_10036590 | 3300025916 | Bacteria | 2954 |
| 287 | Ga0207657_10000364 | 3300025919 | Bacteria | 47699 |
| 288 | Ga0207657_10002381 | 3300025919 | Bacteria | 20347 |
| 289 | Ga0207657_10007827 | 3300025919 | Bacteria | 10907 |
| 290 | Ga0207657_10109199 | 3300025919 | Bacteria | 2287 |
| 291 | Ga0207649_10066866 | 3300025920 | Bacteria | 2280 |
| 292 | Ga0207646_10011044 | 3300025922 | Bacteria | 8769 |
| 293 | Ga0207646_10131280 | 3300025922 | Bacteria | 2255 |
| 294 | Ga0207694_10011973 | 3300025924 | Bacteria | 6541 |
| 295 | Ga0207694_10039302 | 3300025924 | Bacteria | 3641 |
| 296 | Ga0207687_10000198 | 3300025927 | Bacteria | 40595 |
| 297 | Ga0207706_10047804 | 3300025933 | Bacteria | 3785 |
| 298 | Ga0207706_10287017 | 3300025933 | Bacteria | 1435 |
| 299 | Ga0207686_10070615 | 3300025934 | Bacteria | 2245 |
| 300 | Ga0207665_10003339 | 3300025939 | Bacteria | 10757 |
| 301 | Ga0207665_10078090 | 3300025939 | Bacteria | 2273 |
| 302 | Ga0207711_10016459 | 3300025941 | Bacteria | 6144 |
| 303 | Ga0207689_10042424 | 3300025942 | Bacteria | 3763 |
| 304 | Ga0207667_10086550 | 3300025949 | Bacteria | 3243 |
| 305 | Ga0207667_10134289 | 3300025949 | Bacteria | 2548 |
| 306 | Ga0207651_10134720 | 3300025960 | Bacteria | 1898 |
| 307 | Ga0207712_10052957 | 3300025961 | Bacteria | 2845 |
| 308 | Ga0207668_10027489 | 3300025972 | Bacteria | 3705 |
| 309 | Ga0207640_10260119 | 3300025981 | Bacteria | 1352 |
| 310 | Ga0207658_10113575 | 3300025986 | Bacteria | 2146 |
| 311 | Ga0207703_10028528 | 3300026035 | Bacteria | 4400 |
| 312 | Ga0207678_10021567 | 3300026067 | Bacteria | 5649 |
| 313 | Ga0207678_10082023 | 3300026067 | Bacteria | 2760 |
| 314 | Ga0207702_10031816 | 3300026078 | Bacteria | 4400 |
| 315 | Ga0207676_10028233 | 3300026095 | Bacteria | 4190 |
| 316 | Ga0207674_10229856 | 3300026116 | Bacteria | 1802 |
| 317 | Ga0207698_10360158 | 3300026142 | Bacteria | 1377 |
| 318 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 319 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 320 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 321 | Ga0209813_10003842 | 3300027866 | Bacteria | 3552 |
| 322 | Ga0268266_10000606 | 3300028379 | Bacteria | 48985 |
| 323 | Ga0268266_10103921 | 3300028379 | Bacteria | 2508 |
| 324 | Ga0268266_10180066 | 3300028379 | Bacteria | 1924 |
| 325 | Ga0307515_10000492 | 3300028794 | Bacteria | 94501 |
| 326 | Ga0307515_10005063 | 3300028794 | Bacteria | 26793 |
| 327 | Ga0307515_10013300 | 3300028794 | Bacteria | 15392 |
| 328 | Ga0307515_10014438 | 3300028794 | Bacteria | 14642 |
| 329 | Ga0307515_10033162 | 3300028794 | Bacteria | 8514 |
| 330 | Ga0307515_10089826 | 3300028794 | Bacteria | 3861 |
| 331 | Ga0307515_10166444 | 3300028794 | Bacteria | 2220 |
| 332 | Ga0307513_10020228 | 3300031456 | Bacteria | 7896 |
| 333 | Ga0307513_10037125 | 3300031456 | Bacteria | 5425 |
| 334 | Ga0307513_10134374 | 3300031456 | Bacteria | 2412 |
| 335 | Ga0307513_10153197 | 3300031456 | Bacteria | 2210 |
| 336 | Ga0307509_10000011 | 3300031507 | Bacteria | 298257 |
| 337 | Ga0307509_10001831 | 3300031507 | Bacteria | 35184 |
| 338 | Ga0307509_10089607 | 3300031507 | Bacteria | 3154 |
| 339 | Ga0307508_10000611 | 3300031616 | Bacteria | 42821 |
| 340 | Ga0307508_10163951 | 3300031616 | Bacteria | 1826 |
| 341 | Ga0307514_10052088 | 3300031649 | Bacteria | 3167 |
| 342 | Ga0307516_10009603 | 3300031730 | Bacteria | 10771 |
| 343 | Ga0307516_10125160 | 3300031730 | Bacteria | 2356 |
| 344 | Ga0307405_10010861 | 3300031731 | Bacteria | 4743 |
| 345 | Ga0307406_10011730 | 3300031901 | Bacteria | 4975 |
| 346 | Ga0307406_10048916 | 3300031901 | Bacteria | 2674 |
| 347 | Ga0307412_10005001 | 3300031911 | Bacteria | 7414 |
| 348 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 349 | Ga0307409_100154992 | 3300031995 | Bacteria | 1995 |
| 350 | Ga0307414_10029891 | 3300032004 | Bacteria | 3552 |
| 351 | Ga0307414_10087297 | 3300032004 | Bacteria | 2304 |
| 352 | Ga0307507_10027458 | 3300033179 | Bacteria | 6101 |
| 353 | Ga0307510_10014283 | 3300033180 | Bacteria | 9402 |
| 354 | Ga0307510_10204709 | 3300033180 | Bacteria | 1503 |
| 355 | Ga0307510_10223121 | 3300033180 | Bacteria | 1394 |
| 356 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 357 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 358 | Ga0373949_0000171 | 3300035090 | Bacteria | 24781 |
| 359 | Ga0373935_0268845 | 3300035692 | Bacteria | 1198 |
| 360 | Ga0373927_0019135 | 3300035695 | Bacteria | 4490 |
| 361 | Ga0373937_0065488 | 3300036401 | Bacteria | 3345 |
| 362 | Ga0395899_0000595 | 3300037312 | Bacteria | 37965 |
| 363 | Ga0395899_0027264 | 3300037312 | Bacteria | 4308 |
| 364 | Ga0395900_0032955 | 3300037418 | Bacteria | 5331 |
| 365 | Ga0395898_0091936 | 3300037466 | Bacteria | 2918 |
| 366 | Ga0395905_0000328 | 3300037471 | Bacteria | 68234 |
| 367 | Ga0395905_0007705 | 3300037471 | Bacteria | 10685 |
| 368 | Ga0395905_0116208 | 3300037471 | Bacteria | 2514 |
| 369 | Ga0395905_0116468 | 3300037471 | Bacteria | 2512 |
| 370 | Ga0436364_0990550 | 3300037853 | Bacteria | 10081 |
| 371 | Ga0436364_1103499 | 3300037853 | Bacteria | 2020 |
| 372 | Ga0395901_0099516 | 3300038443 | Bacteria | 3049 |
| 373 | Ga0395901_0146933 | 3300038443 | Bacteria | 2478 |
| 374 | Ga0395901_0160315 | 3300038443 | Bacteria | 2362 |
| 375 | Ga0400483_172841 | 3300039062 | Bacteria | 1244 |
| 376 | Ga0400483_190117 | 3300039062 | Bacteria | 3465 |
| 377 | Ga0436365_1009141 | 3300039437 | Bacteria | 1687 |
| 378 | Ga0436365_1772086 | 3300039437 | Bacteria | 47437 |
| 379 | Ga0436360_0402304 | 3300039438 | Bacteria | 3123 |
| 380 | Ga0436360_0800328 | 3300039438 | Bacteria | 5062 |
| 381 | Ga0436360_0934493 | 3300039438 | Bacteria | 5449 |
| 382 | Ga0436360_1023635 | 3300039438 | Bacteria | 2732 |
| 383 | Ga0436360_1270075 | 3300039438 | Bacteria | 1258 |
| 384 | Ga0436360_1350032 | 3300039438 | Bacteria | 1537 |
| 385 | Ga0436361_0048400 | 3300039447 | Bacteria | 6342 |
| 386 | Ga0436361_0546753 | 3300039447 | Bacteria | 1760 |
| 387 | Ga0436361_0626061 | 3300039447 | Bacteria | 1213 |
| 388 | Ga0436361_0715372 | 3300039447 | Bacteria | 6119 |
| 389 | Ga0436361_1014632 | 3300039447 | Bacteria | 1464 |
| 390 | Ga0436361_1173504 | 3300039447 | Bacteria | 10656 |
| 391 | Ga0436361_1195026 | 3300039447 | Bacteria | 5295 |
| 392 | Ga0436363_0799550 | 3300039450 | Bacteria | 5510 |
| 393 | Ga0436363_0918794 | 3300039450 | Bacteria | 3561 |
| 394 | Ga0436362_0741073 | 3300039453 | Bacteria | 2345 |
| 395 | Ga0436362_1126090 | 3300039453 | Bacteria | 4730 |
| 396 | Ga0439436_0002384 | 3300041404 | Bacteria | 5635 |
| 397 | Ga0439439_0005514 | 3300041406 | Bacteria | 2892 |
| 398 | Ga0439465_0021522 | 3300041413 | Bacteria | 2022 |
| 399 | Ga0451791_0837071 | 3300041451 | Bacteria | 1316 |
| 400 | Ga0451847_0087747 | 3300041503 | Bacteria | 2253 |
| 401 | Ga0439445_0039807 | 3300042004 | Bacteria | 1246 |
| 402 | Ga0439452_025987 | 3300042010 | Bacteria | 1481 |
| 403 | Ga0439435_0000837 | 3300042436 | Bacteria | 5260 |
| 404 | Ga0439435_0033690 | 3300042436 | Bacteria | 1404 |
| 405 | Ga0466972_0006044 | 3300044658 | Bacteria | 6084 |
| 406 | Ga0466964_0002201 | 3300044706 | Bacteria | 6899 |
| 407 | Ga0466960_0010694 | 3300044901 | Bacteria | 3817 |
| 408 | Ga0466959_0105573 | 3300045049 | Bacteria | 2014 |
| 409 | Ga0451576_0006467 | 3300045051 | Bacteria | 14358 |
| 410 | Ga0466958_0057519 | 3300045836 | Bacteria | 2363 |
| 411 | Ga0495592_0002447 | 3300046454 | Bacteria | 13094 |
| 412 | Ga0495603_0008586 | 3300046455 | Bacteria | 6175 |
| 413 | Ga0495590_0056563 | 3300046457 | Bacteria | 1371 |
| 414 | Ga0495629_0132576 | 3300046459 | Bacteria | 1735 |
| 415 | Ga0495638_0020323 | 3300046460 | Bacteria | 4387 |
| 416 | Ga0495638_0143729 | 3300046460 | Bacteria | 1390 |
| 417 | Ga0495641_0090235 | 3300046461 | Bacteria | 1369 |
| 418 | Ga0495651_0010066 | 3300046462 | Bacteria | 7265 |
| 419 | Ga0495653_0076344 | 3300046463 | Bacteria | 2491 |
| 420 | Ga0495650_0005824 | 3300046471 | Bacteria | 7854 |
| 421 | Ga0495580_0095521 | 3300046472 | Bacteria | 2067 |
| 422 | Ga0495583_0014902 | 3300046506 | Bacteria | 4256 |
| 423 | Ga0495583_0038412 | 3300046506 | Bacteria | 2262 |
| 424 | Ga0495606_0012400 | 3300046507 | Bacteria | 6837 |
| 425 | Ga0495606_0023785 | 3300046507 | Bacteria | 4430 |
| 426 | Ga0495610_0025163 | 3300046512 | Bacteria | 3201 |
| 427 | Ga0495610_0090074 | 3300046512 | Bacteria | 1392 |
| 428 | Ga0495620_0036984 | 3300046515 | Bacteria | 2179 |
| 429 | Ga0495628_0192005 | 3300046516 | Bacteria | 1542 |
| 430 | Ga0495631_0041670 | 3300046518 | Bacteria | 2031 |
| 431 | Ga0495632_0052400 | 3300046519 | Bacteria | 2006 |
| 432 | Ga0495643_0007132 | 3300046522 | Bacteria | 7253 |
| 433 | Ga0495644_0043159 | 3300046523 | Bacteria | 1697 |
| 434 | Ga0495648_0047211 | 3300046524 | Bacteria | 2663 |
| 435 | Ga0495586_0053676 | 3300046535 | Bacteria | 2184 |
| 436 | Ga0495633_0088317 | 3300046558 | Bacteria | 1441 |
| 437 | Ga0495625_0010086 | 3300046660 | Bacteria | 7851 |
| 438 | Ga0495635_0027085 | 3300046663 | Bacteria | 3988 |
| 439 | Ga0495599_0025465 | 3300046678 | Bacteria | 3703 |
| 440 | Ga0495623_0001445 | 3300046679 | Bacteria | 16111 |
| 441 | Ga0495624_0024180 | 3300046690 | Bacteria | 3999 |
| 442 | Ga0495670_0031251 | 3300046691 | Bacteria | 2646 |
| 443 | Ga0495649_0156001 | 3300046694 | Bacteria | 1198 |
| 444 | Ga0495581_0011439 | 3300047315 | Bacteria | 5137 |
| 445 | Ga0495604_0012138 | 3300047317 | Bacteria | 6851 |
| 446 | Ga0495674_0004081 | 3300047319 | Bacteria | 14127 |
| 447 | Ga0495674_0016631 | 3300047319 | Bacteria | 6863 |
| 448 | Ga0495672_0110063 | 3300047320 | Bacteria | 1480 |
| 449 | Ga0495676_0011102 | 3300047321 | Bacteria | 8138 |
| 450 | Ga0495680_0012563 | 3300047322 | Bacteria | 7445 |
| 451 | Ga0495683_0040527 | 3300047323 | Bacteria | 2353 |
| 452 | Ga0495675_0002082 | 3300047444 | Bacteria | 11942 |
| 453 | Ga0495679_002038 | 3300047446 | Bacteria | 10678 |
| 454 | Ga0495686_0078144 | 3300047472 | Bacteria | 2026 |
| 455 | Ga0495602_0034456 | 3300048088 | Bacteria | 4736 |
| 456 | Ga0495626_0090436 | 3300048091 | Bacteria | 1346 |
| 457 | Ga0496100_0030431 | 3300048903 | Bacteria | 3348 |
| 458 | Ga0496100_0031823 | 3300048903 | Bacteria | 3283 |
| 459 | Ga0496100_0053457 | 3300048903 | Bacteria | 2630 |
| 460 | Ga0496100_0143516 | 3300048903 | Bacteria | 1695 |
| 461 | Ga0496101_0017519 | 3300048904 | Bacteria | 4858 |
| 462 | Ga0496101_0063227 | 3300048904 | Bacteria | 2694 |
| 463 | Ga0496101_0091302 | 3300048904 | Bacteria | 2266 |
| 464 | Ga0496101_0215283 | 3300048904 | Bacteria | 1489 |
| 465 | Ga0496102_0006183 | 3300048905 | Bacteria | 10207 |
| 466 | Ga0496103_0030754 | 3300048906 | Bacteria | 3268 |
| 467 | Ga0496103_0146721 | 3300048906 | Bacteria | 1510 |
| 468 | Ga0496104_0092944 | 3300048907 | Bacteria | 2884 |
| 469 | Ga0496104_0106082 | 3300048907 | Bacteria | 2692 |
| 470 | Ga0496104_0398004 | 3300048907 | Bacteria | 1289 |
| 471 | Ga0496105_0007751 | 3300048908 | Bacteria | 8330 |
| 472 | Ga0496105_0048743 | 3300048908 | Bacteria | 3496 |
| 473 | Ga0496106_0001119 | 3300048909 | Bacteria | 19846 |
| 474 | Ga0496106_0004024 | 3300048909 | Bacteria | 10991 |
| 475 | Ga0496106_0004253 | 3300048909 | Bacteria | 10656 |
| 476 | Ga0496106_0162318 | 3300048909 | Bacteria | 1768 |
| 477 | Ga0496107_0087727 | 3300048910 | Bacteria | 2271 |
| 478 | Ga0496108_0005196 | 3300048911 | Bacteria | 10518 |
| 479 | Ga0496108_0034298 | 3300048911 | Bacteria | 4216 |
| 480 | Ga0496108_0071351 | 3300048911 | Bacteria | 2930 |
| 481 | Ga0496109_0017192 | 3300048912 | Bacteria | 6334 |
| 482 | Ga0496110_0000410 | 3300048913 | Bacteria | 29170 |
| 483 | Ga0496110_0182863 | 3300048913 | Bacteria | 1903 |
| 484 | Ga0496111_0006067 | 3300048914 | Bacteria | 7808 |
| 485 | Ga0496111_0099206 | 3300048914 | Bacteria | 2139 |
| 486 | Ga0496111_0105720 | 3300048914 | Bacteria | 2071 |
| 487 | Ga0496112_0062382 | 3300048915 | Bacteria | 3676 |
| 488 | Ga0496112_0104502 | 3300048915 | Bacteria | 2802 |
| 489 | Ga0496114_0011650 | 3300048917 | Bacteria | 7033 |
| 490 | Ga0496114_0037876 | 3300048917 | Bacteria | 3989 |
| 491 | Ga0496114_0109930 | 3300048917 | Bacteria | 2361 |
| 492 | Ga0496114_0142814 | 3300048917 | Bacteria | 2074 |
| 493 | Ga0496115_0014474 | 3300048918 | Bacteria | 5972 |
| 494 | Ga0496115_0166898 | 3300048918 | Bacteria | 1821 |
| 495 | Ga0496115_0196114 | 3300048918 | Bacteria | 1668 |
| 496 | Ga0496116_0000707 | 3300048919 | Bacteria | 42893 |
| 497 | Ga0496116_0003524 | 3300048919 | Bacteria | 15408 |
| 498 | Ga0496116_0107170 | 3300048919 | Bacteria | 1652 |
| 499 | Ga0496116_0133490 | 3300048919 | Bacteria | 1410 |
| 500 | Ga0496117_0001125 | 3300048920 | Bacteria | 40300 |
| 501 | Ga0496117_0002658 | 3300048920 | Bacteria | 22158 |
| 502 | Ga0496117_0003841 | 3300048920 | Bacteria | 17091 |
| 503 | Ga0496117_0054371 | 3300048920 | Bacteria | 2805 |
| 504 | Ga0496117_0082726 | 3300048920 | Bacteria | 2101 |
| 505 | Ga0496118_0000844 | 3300048921 | Bacteria | 48654 |
| 506 | Ga0496118_0005841 | 3300048921 | Bacteria | 13799 |
| 507 | Ga0496118_0039560 | 3300048921 | Bacteria | 3760 |
| 508 | Ga0496118_0044496 | 3300048921 | Bacteria | 3476 |
| 509 | Ga0496119_0005065 | 3300048922 | Bacteria | 12805 |
| 510 | Ga0496119_0010985 | 3300048922 | Bacteria | 7558 |
| 511 | Ga0496119_0011556 | 3300048922 | Bacteria | 7288 |
| 512 | Ga0496119_0014637 | 3300048922 | Bacteria | 6114 |
| 513 | Ga0496119_0156988 | 3300048922 | Bacteria | 1213 |
| 514 | Ga0496120_0003021 | 3300048923 | Bacteria | 15931 |
| 515 | Ga0496120_0005096 | 3300048923 | Bacteria | 10628 |
| 516 | Ga0496121_0003319 | 3300048924 | Bacteria | 23101 |
| 517 | Ga0496121_0006713 | 3300048924 | Bacteria | 14137 |
| 518 | Ga0496121_0014935 | 3300048924 | Bacteria | 8181 |
| 519 | Ga0496121_0034582 | 3300048924 | Bacteria | 4547 |
| 520 | Ga0496121_0035736 | 3300048924 | Bacteria | 4445 |
| 521 | Ga0496122_0000024 | 3300048925 | Bacteria | 372400 |
| 522 | Ga0496122_0005156 | 3300048925 | Bacteria | 15745 |
| 523 | Ga0496122_0006309 | 3300048925 | Bacteria | 13664 |
| 524 | Ga0496122_0016334 | 3300048925 | Bacteria | 7033 |
| 525 | Ga0496122_0020333 | 3300048925 | Bacteria | 6005 |
| 526 | Ga0496122_0044170 | 3300048925 | Bacteria | 3481 |
| 527 | Ga0496123_0000086 | 3300048926 | Bacteria | 183266 |
| 528 | Ga0496123_0006124 | 3300048926 | Bacteria | 11794 |
| 529 | Ga0496123_0012365 | 3300048926 | Bacteria | 7286 |
| 530 | Ga0496123_0022089 | 3300048926 | Bacteria | 4917 |
| 531 | Ga0496124_0000488 | 3300048927 | Bacteria | 67995 |
| 532 | Ga0496124_0001118 | 3300048927 | Bacteria | 42215 |
| 533 | Ga0496124_0011653 | 3300048927 | Bacteria | 8773 |
| 534 | Ga0496124_0026404 | 3300048927 | Bacteria | 5236 |
| 535 | Ga0496124_0052092 | 3300048927 | Bacteria | 3479 |
| 536 | Ga0496124_0072685 | 3300048927 | Bacteria | 2847 |
| 537 | Ga0496124_0141937 | 3300048927 | Bacteria | 1894 |
| 538 | Ga0496124_0211508 | 3300048927 | Bacteria | 1467 |
| 539 | Ga0496125_0000134 | 3300048928 | Bacteria | 161449 |
| 540 | Ga0496125_0002416 | 3300048928 | Bacteria | 24308 |
| 541 | Ga0496125_0003868 | 3300048928 | Bacteria | 17714 |
| 542 | Ga0496125_0031557 | 3300048928 | Bacteria | 4720 |
| 543 | Ga0496125_0123800 | 3300048928 | Bacteria | 1837 |
| 544 | Ga0496125_0130908 | 3300048928 | Bacteria | 1766 |
| 545 | Ga0496126_0000434 | 3300048929 | Bacteria | 83949 |
| 546 | Ga0496126_0017103 | 3300048929 | Bacteria | 7232 |
| 547 | Ga0496126_0017199 | 3300048929 | Bacteria | 7208 |
| 548 | Ga0496126_0043674 | 3300048929 | Bacteria | 4132 |
| 549 | Ga0496126_0141609 | 3300048929 | Bacteria | 2069 |
| 550 | Ga0496126_0243967 | 3300048929 | Bacteria | 1499 |
| 551 | Ga0496126_0313509 | 3300048929 | Bacteria | 1291 |
| 552 | Ga0501031_0016746 | 3300049568 | Bacteria | 4762 |
| 553 | Ga0501032_0000219 | 3300049569 | Bacteria | 47451 |
| 554 | Ga0501032_0023515 | 3300049569 | Bacteria | 4256 |
| 555 | Ga0501033_0000126 | 3300049570 | Bacteria | 74250 |
| 556 | Ga0501034_0000012 | 3300049571 | Bacteria | 310504 |
| 557 | Ga0501034_0001879 | 3300049571 | Bacteria | 26611 |
| 558 | Ga0501034_0002949 | 3300049571 | Bacteria | 19712 |
| 559 | Ga0501034_0045980 | 3300049571 | Bacteria | 4410 |
| 560 | Ga0501034_0074210 | 3300049571 | Bacteria | 3410 |
| 561 | Ga0501034_0143480 | 3300049571 | Bacteria | 2366 |
| 562 | Ga0501034_0156211 | 3300049571 | Bacteria | 2255 |
| 563 | Ga0501034_0202959 | 3300049571 | Bacteria | 1940 |
| 564 | Ga0501034_0206490 | 3300049571 | Bacteria | 1920 |
| 565 | Ga0501036_0000483 | 3300049572 | Bacteria | 28404 |
| 566 | Ga0501036_0161458 | 3300049572 | Bacteria | 1889 |
| 567 | Ga0501037_0000021 | 3300049573 | Bacteria | 150037 |
| 568 | Ga0501038_0000032 | 3300049574 | Bacteria | 131432 |
| 569 | Ga0501039_0000025 | 3300049575 | Bacteria | 152236 |
| 570 | Ga0501039_0065397 | 3300049575 | Bacteria | 2821 |
| 571 | Ga0501040_0073929 | 3300049576 | Bacteria | 2355 |
| 572 | Ga0501043_0000015 | 3300049579 | Bacteria | 175932 |
| 573 | Ga0501043_0009591 | 3300049579 | Bacteria | 7585 |
| 574 | Ga0501043_0246376 | 3300049579 | Bacteria | 1377 |
| 575 | Ga0501046_0033565 | 3300049580 | Bacteria | 4145 |
| 576 | Ga0501047_0035472 | 3300049581 | Bacteria | 4819 |
| 577 | Ga0501067_0000018 | 3300049583 | Bacteria | 101701 |
| 578 | Ga0501068_0000782 | 3300049584 | Bacteria | 16418 |
| 579 | Ga0501068_0008897 | 3300049584 | Bacteria | 5602 |
| 580 | Ga0501069_0000116 | 3300049585 | Bacteria | 35726 |
| 581 | Ga0501073_0086263 | 3300049589 | Bacteria | 2183 |
| 582 | Ga0501074_0074913 | 3300049590 | Bacteria | 2430 |
| 583 | Ga0501075_0058420 | 3300049591 | Bacteria | 2905 |
| 584 | Ga0501076_0016026 | 3300049592 | Bacteria | 5673 |
| 585 | Ga0501077_0008186 | 3300049593 | Bacteria | 6465 |
| 586 | Ga0501079_0041947 | 3300049741 | Bacteria | 3533 |
| 587 | Ga0501080_0139755 | 3300049742 | Bacteria | 2240 |
| 588 | Ga0501081_0016810 | 3300049743 | Bacteria | 4837 |
| 589 | Ga0501083_0124136 | 3300049744 | Bacteria | 1693 |
| 590 | Ga0501280_004198 | 3300049776 | Bacteria | 2135 |
| 591 | Ga0501035_0000436 | 3300049822 | Bacteria | 46832 |
| 592 | Ga0501035_0097249 | 3300049822 | Bacteria | 2586 |
| 593 | Ga0501044_0007432 | 3300049823 | Bacteria | 12050 |
| 594 | Ga0501044_0061715 | 3300049823 | Bacteria | 3834 |
| 595 | Ga0501044_0071495 | 3300049823 | Bacteria | 3528 |
| 596 | Ga0501044_0151769 | 3300049823 | Bacteria | 2298 |
| 597 | Ga0501044_0348212 | 3300049823 | Bacteria | 1402 |
| 598 | Ga0501045_0033979 | 3300049824 | Bacteria | 3700 |
| 599 | nmdc:mga03683_13296_c1 | 3300050489 | Bacteria | 3026 |
| 600 | nmdc:mga0yw44_105419_c1 | 3300050492 | Bacteria | 1801 |
| 601 | nmdc:mga0yw44_49921_c2 | 3300050492 | Bacteria | 1967 |
| 602 | nmdc:mga0k408_3230_c1 | 3300050493 | Bacteria | 8626 |
| 603 | nmdc:mga06z11_23383_c1 | 3300050494 | Bacteria | 2902 |
| 604 | nmdc:mga05p37_175327_c1 | 3300050507 | Bacteria | 2612 |
| 605 | nmdc:mga05p37_47923_c1 | 3300050507 | Bacteria | 5255 |
| 606 | nmdc:mga09592_11254_c1 | 3300050508 | Bacteria | 7278 |
| 607 | nmdc:mga09592_303666_c1 | 3300050508 | Bacteria | 1384 |
| 608 | nmdc:mga0qj67_12870_c1 | 3300050509 | Bacteria | 6314 |
| 609 | nmdc:mga06r32_12511_c1 | 3300050510 | Bacteria | 7658 |
| 610 | nmdc:mga06r32_168612_c1 | 3300050510 | Bacteria | 2173 |
| 611 | nmdc:mga06r32_4390_c1 | 3300050510 | Bacteria | 12611 |
| 612 | nmdc:mga06r32_7328_c1 | 3300050510 | Bacteria | 9930 |
| 613 | nmdc:mga0n895_8893_c1 | 3300050512 | Bacteria | 8748 |
| 614 | Ga0495612_0001813 | 3300053078 | Bacteria | 8758 |
| 615 | Ga0500610_0077617 | 3300053079 | Bacteria | 1731 |
| 616 | Ga0500578_0036800 | 3300053086 | Bacteria | 3142 |
| 617 | Ga0500566_0003024 | 3300053094 | Bacteria | 10055 |
| 618 | Ga0500628_024616 | 3300053129 | Bacteria | 1252 |
| 619 | Ga0500658_0054670 | 3300053134 | Bacteria | 1641 |
| 620 | Ga0500559_0003318 | 3300053136 | Bacteria | 7981 |
| 621 | Ga0500559_0037943 | 3300053136 | Bacteria | 2090 |
| 622 | Ga0500568_0000219 | 3300053139 | Bacteria | 49081 |
| 623 | Ga0500568_0009899 | 3300053139 | Bacteria | 4502 |
| 624 | Ga0500568_0027708 | 3300053139 | Bacteria | 2367 |
| 625 | Ga0500603_007969 | 3300053150 | Bacteria | 2337 |
| 626 | Ga0500604_0012354 | 3300053151 | Bacteria | 2305 |
| 627 | Ga0500616_0015630 | 3300053153 | Bacteria | 4334 |
| 628 | Ga0500622_0002427 | 3300053156 | Bacteria | 13459 |
| 629 | Ga0500622_0019077 | 3300053156 | Bacteria | 3642 |
| 630 | Ga0500636_0004433 | 3300053177 | Bacteria | 7944 |
| 631 | Ga0500636_0123787 | 3300053177 | Bacteria | 1448 |
| 632 | Ga0501084_0084380 | 3300054114 | Bacteria | 2666 |
| 633 | Ga0587077_019916 | 3300059493 | Bacteria | 1174 |
| 634 | Ga0587088_005066 | 3300059508 | Bacteria | 1710 |
| 635 | Ga0501082_0054899 | 3300060353 | Bacteria | 3433 |
| 636 | Ga0501082_0068353 | 3300060353 | Bacteria | 3059 |
| 637 | Ga0530510_0002198 | 3300061734 | Bacteria | 13380 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0132576 | Ga0495629_0132576_749_1696 | 289 |
| 2 | 3300046461 | Ga0495641_0090235 | Ga0495641_0090235_380_1327 | 289 |
| 3 | iso_pu_bacteria | 8018163183 | 8018164734 | 297 |
| 4 | iso_pu_bacteria | 8018163183 | 8018170351 | 297 |
| 5 | iso_pu_bacteria | 2724679232 | 2725946125 | 302 |
| 6 | 3300049742 | Ga0501080_0139755 | Ga0501080_0139755_986_2038 | 307 |
| 7 | iso_pu_bacteria | 2585427526 | 2585528973 | 312 |
| 8 | iso_pu_bacteria | 8005376324 | 8005378503 | 314 |
| 9 | iso_pu_bacteria | 2842205361 | 2842206669 | 315 |
| 10 | iso_pu_bacteria | 2842278818 | 2842280126 | 315 |
| 11 | 3300039062 | Ga0400483_172841 | Ga0400483_172841_232_1203 | 318 |
| 12 | iso_pu_bacteria | 2513237084 | 2513570265 | 319 |
| 13 | iso_pu_bacteria | 2513237084 | 2513573758 | 319 |
| 14 | 3300048910 | Ga0496107_0087727 | Ga0496107_0087727_1270_2253 | 323 |
| 15 | iso_pu_bacteria | 2529292951 | 2530650192 | 324 |
| 16 | 3300025960 | Ga0207651_10134720 | Ga0207651_101347202 | 326 |
| 17 | 3300009545 | Ga0105237_10085855 | Ga0105237_100858552 | 329 |
| 18 | 3300026142 | Ga0207698_10360158 | Ga0207698_103601582 | 329 |
| 19 | 3300046516 | Ga0495628_0192005 | Ga0495628_0192005_358_1446 | 329 |
| 20 | iso_pu_bacteria | 8005688590 | 8005691518 | 329 |
| 21 | iso_pu_bacteria | 2960610863 | 2960613712 | 331 |
| 22 | iso_pu_bacteria | 8005460587 | 8005464744 | 331 |
| 23 | iso_pu_bacteria | 8005563573 | 8005569661 | 333 |
| 24 | iso_pu_bacteria | 2916076590 | 2916080022 | 334 |
| 25 | 3300005434 | Ga0070709_10070301 | Ga0070709_100703011 | 336 |
| 26 | 3300046455 | Ga0495603_0008586 | Ga0495603_0008586_3134_4222 | 336 |
| 27 | 3300046663 | Ga0495635_0027085 | Ga0495635_0027085_691_1779 | 336 |
| 28 | 3300046690 | Ga0495624_0024180 | Ga0495624_0024180_2071_3159 | 336 |
| 29 | 3300047315 | Ga0495581_0011439 | Ga0495581_0011439_2909_3997 | 336 |
| 30 | 3300047319 | Ga0495674_0016631 | Ga0495674_0016631_4711_5799 | 336 |
| 31 | 3300047321 | Ga0495676_0011102 | Ga0495676_0011102_1318_2406 | 336 |
| 32 | 3300053078 | Ga0495612_0001813 | Ga0495612_0001813_599_1687 | 336 |
| 33 | iso_pu_bacteria | 8057874678 | 8057880943 | 336 |
| 34 | iso_pu_bacteria | 8005695170 | 8005700633 | 337 |
| 35 | iso_pu_bacteria | 2838016132 | 2838022618 | 338 |
| 36 | 3300005334 | Ga0068869_100106214 | Ga0068869_1001062142 | 339 |
| 37 | 3300005338 | Ga0068868_100002162 | Ga0068868_1000021626 | 339 |
| 38 | 3300005339 | Ga0070660_100009363 | Ga0070660_1000093636 | 339 |
| 39 | 3300005539 | Ga0068853_100040462 | Ga0068853_1000404622 | 339 |
| 40 | 3300005615 | Ga0070702_100031259 | Ga0070702_1000312593 | 339 |
| 41 | 3300006358 | Ga0068871_100282872 | Ga0068871_1002828721 | 339 |
| 42 | 3300009098 | Ga0105245_10016610 | Ga0105245_100166102 | 339 |
| 43 | 3300009174 | Ga0105241_10100487 | Ga0105241_101004872 | 339 |
| 44 | 3300009551 | Ga0105238_10063681 | Ga0105238_100636812 | 339 |
| 45 | 3300011119 | Ga0105246_10011277 | Ga0105246_100112774 | 339 |
| 46 | 3300013307 | Ga0157372_10028512 | Ga0157372_100285125 | 339 |
| 47 | 3300014325 | Ga0163163_10007069 | Ga0163163_100070699 | 339 |
| 48 | 3300025913 | Ga0207695_10090854 | Ga0207695_100908542 | 339 |
| 49 | 3300025919 | Ga0207657_10002381 | Ga0207657_1000238117 | 339 |
| 50 | 3300025924 | Ga0207694_10011973 | Ga0207694_100119733 | 339 |
| 51 | 3300025927 | Ga0207687_10000198 | Ga0207687_1000019821 | 339 |
| 52 | 3300025933 | Ga0207706_10287017 | Ga0207706_102870172 | 339 |
| 53 | 3300025942 | Ga0207689_10042424 | Ga0207689_100424243 | 339 |
| 54 | 3300026095 | Ga0207676_10028233 | Ga0207676_100282332 | 339 |
| 55 | 3300048904 | Ga0496101_0063227 | Ga0496101_0063227_812_1900 | 339 |
| 56 | 3300048907 | Ga0496104_0106082 | Ga0496104_0106082_1388_2476 | 339 |
| 57 | 3300048908 | Ga0496105_0007751 | Ga0496105_0007751_3977_5065 | 339 |
| 58 | 3300048909 | Ga0496106_0004253 | Ga0496106_0004253_8483_9571 | 339 |
| 59 | 3300048911 | Ga0496108_0005196 | Ga0496108_0005196_8242_9330 | 339 |
| 60 | 3300048913 | Ga0496110_0000410 | Ga0496110_0000410_3816_4904 | 339 |
| 61 | 3300048917 | Ga0496114_0037876 | Ga0496114_0037876_1017_2105 | 339 |
| 62 | 3300048918 | Ga0496115_0196114 | Ga0496115_0196114_380_1468 | 339 |
| 63 | iso_pu_bacteria | 2894772417 | 2894776637 | 340 |
| 64 | iso_pu_bacteria | 2585428058 | 2587733421 | 341 |
| 65 | iso_pu_bacteria | 2585428062 | 2587754871 | 341 |
| 66 | iso_pu_bacteria | 2643221592 | 2643972028 | 341 |
| 67 | iso_pu_bacteria | 2643221625 | 2644142227 | 341 |
| 68 | iso_pu_bacteria | 2643221648 | 2644275921 | 341 |
| 69 | iso_pu_bacteria | 2929199973 | 2929202999 | 341 |
| 70 | iso_pu_bacteria | 8055909800 | 8055916093 | 341 |
| 71 | 3300048927 | Ga0496124_0141937 | Ga0496124_0141937_142_1254 | 342 |
| 72 | iso_pu_bacteria | 8023680758 | 8023686261 | 343 |
| 73 | 3300006846 | Ga0075430_100016596 | Ga0075430_1000165964 | 344 |
| 74 | 3300050509 | nmdc:mga0qj67_12870_c1 | nmdc:mga0qj67_12870_c1_2091_3143 | 344 |
| 75 | 3300050510 | nmdc:mga06r32_12511_c1 | nmdc:mga06r32_12511_c1_599_1651 | 344 |
| 76 | 3300003215 | JGI25153J46596_10001186 | JGI25153J46596_100011869 | 345 |
| 77 | 3300003215 | JGI25153J46596_10001306 | JGI25153J46596_1000130613 | 345 |
| 78 | 3300003771 | Ga0055526_1005794 | Ga0055526_10057943 | 345 |
| 79 | 3300005539 | Ga0068853_100010540 | Ga0068853_1000105405 | 345 |
| 80 | 3300005564 | Ga0070664_100327360 | Ga0070664_1003273602 | 345 |
| 81 | 3300005616 | Ga0068852_100304547 | Ga0068852_1003045472 | 345 |
| 82 | 3300006844 | Ga0075428_100400839 | Ga0075428_1004008391 | 345 |
| 83 | 3300006846 | Ga0075430_100206456 | Ga0075430_1002064562 | 345 |
| 84 | 3300006847 | Ga0075431_100361722 | Ga0075431_1003617221 | 345 |
| 85 | 3300006847 | Ga0075431_100361723 | Ga0075431_1003617231 | 345 |
| 86 | 3300006880 | Ga0075429_100267726 | Ga0075429_1002677262 | 345 |
| 87 | 3300009093 | Ga0105240_10002442 | Ga0105240_1000244210 | 345 |
| 88 | 3300009094 | Ga0111539_10120386 | Ga0111539_101203863 | 345 |
| 89 | 3300009545 | Ga0105237_10001836 | Ga0105237_1000183620 | 345 |
| 90 | 3300009551 | Ga0105238_10017215 | Ga0105238_100172155 | 345 |
| 91 | 3300010375 | Ga0105239_10001156 | Ga0105239_100011567 | 345 |
| 92 | 3300025245 | Ga0207425_1000366 | Ga0207425_100036613 | 345 |
| 93 | 3300025258 | Ga0209129_1000164 | Ga0209129_100016411 | 345 |
| 94 | 3300025273 | Ga0209673_1008001 | Ga0209673_10080013 | 345 |
| 95 | 3300025295 | Ga0209564_1000062 | Ga0209564_100006262 | 345 |
| 96 | 3300025297 | Ga0209758_1000072 | Ga0209758_1000072221 | 345 |
| 97 | 3300025297 | Ga0209758_1000280 | Ga0209758_100028059 | 345 |
| 98 | 3300025298 | Ga0209050_1000772 | Ga0209050_100077240 | 345 |
| 99 | 3300025302 | Ga0207426_1014520 | Ga0207426_10145203 | 345 |
| 100 | 3300025913 | Ga0207695_10014292 | Ga0207695_100142928 | 345 |
| 101 | 3300025914 | Ga0207671_10006804 | Ga0207671_100068044 | 345 |
| 102 | 3300028379 | Ga0268266_10103921 | Ga0268266_101039212 | 345 |
| 103 | 3300028794 | Ga0307515_10000492 | Ga0307515_100004927 | 345 |
| 104 | 3300028794 | Ga0307515_10005063 | Ga0307515_100050637 | 345 |
| 105 | 3300028794 | Ga0307515_10014438 | Ga0307515_100144389 | 345 |
| 106 | 3300031456 | Ga0307513_10153197 | Ga0307513_101531972 | 345 |
| 107 | 3300031507 | Ga0307509_10001831 | Ga0307509_100018316 | 345 |
| 108 | 3300031507 | Ga0307509_10089607 | Ga0307509_100896072 | 345 |
| 109 | 3300031616 | Ga0307508_10000611 | Ga0307508_1000061114 | 345 |
| 110 | 3300031649 | Ga0307514_10052088 | Ga0307514_100520882 | 345 |
| 111 | 3300031730 | Ga0307516_10009603 | Ga0307516_100096039 | 345 |
| 112 | 3300033179 | Ga0307507_10027458 | Ga0307507_100274584 | 345 |
| 113 | 3300033180 | Ga0307510_10014283 | Ga0307510_100142835 | 345 |
| 114 | 3300037466 | Ga0395898_0091936 | Ga0395898_0091936_295_1347 | 345 |
| 115 | 3300038443 | Ga0395901_0160315 | Ga0395901_0160315_12_1064 | 345 |
| 116 | 3300046454 | Ga0495592_0002447 | Ga0495592_0002447_7404_8456 | 345 |
| 117 | 3300046471 | Ga0495650_0005824 | Ga0495650_0005824_3764_4816 | 345 |
| 118 | 3300046512 | Ga0495610_0025163 | Ga0495610_0025163_618_1670 | 345 |
| 119 | 3300046660 | Ga0495625_0010086 | Ga0495625_0010086_4699_5751 | 345 |
| 120 | 3300049571 | Ga0501034_0001879 | Ga0501034_0001879_23268_24320 | 345 |
| 121 | 3300049584 | Ga0501068_0008897 | Ga0501068_0008897_1559_2611 | 345 |
| 122 | 3300049823 | Ga0501044_0071495 | Ga0501044_0071495_1574_2626 | 345 |
| 123 | 3300050489 | nmdc:mga03683_13296_c1 | nmdc:mga03683_13296_c1_1641_2693 | 345 |
| 124 | 3300050507 | nmdc:mga05p37_175327_c1 | nmdc:mga05p37_175327_c1_1496_2548 | 345 |
| 125 | 3300050508 | nmdc:mga09592_303666_c1 | nmdc:mga09592_303666_c1_32_1084 | 345 |
| 126 | 3300050510 | nmdc:mga06r32_168612_c1 | nmdc:mga06r32_168612_c1_1101_2153 | 345 |
| 127 | iso_pu_bacteria | 2513237144 | 2513910714 | 345 |
| 128 | iso_pu_bacteria | 2854896431 | 2854896864 | 345 |
| 129 | iso_pu_bacteria | 2854916844 | 2854920531 | 345 |
| 130 | iso_pu_bacteria | 2933016740 | 2933016856 | 345 |
| 131 | iso_pu_bacteria | 2519899620 | 2520378602 | 346 |
| 132 | 3300035090 | Ga0373949_0000171 | Ga0373949_0000171_18973_20034 | 348 |
| 133 | 3300038443 | Ga0395901_0099516 | Ga0395901_0099516_425_1540 | 348 |
| 134 | 3300039450 | Ga0436363_0918794 | Ga0436363_0918794_32_1084 | 348 |
| 135 | iso_pu_bacteria | 2643221591 | 2643966430 | 348 |
| 136 | 3300006175 | Ga0070712_100008084 | Ga0070712_1000080846 | 349 |
| 137 | 3300006195 | Ga0075366_10034043 | Ga0075366_100340432 | 349 |
| 138 | 3300006847 | Ga0075431_100015726 | Ga0075431_1000157262 | 349 |
| 139 | 3300006880 | Ga0075429_100012911 | Ga0075429_1000129116 | 349 |
| 140 | 3300009553 | Ga0105249_10257555 | Ga0105249_102575552 | 349 |
| 141 | 3300025915 | Ga0207693_10067430 | Ga0207693_100674302 | 349 |
| 142 | 3300025916 | Ga0207663_10020893 | Ga0207663_100208934 | 349 |
| 143 | 3300031507 | Ga0307509_10000011 | Ga0307509_1000001161 | 349 |
| 144 | 3300031730 | Ga0307516_10125160 | Ga0307516_101251602 | 349 |
| 145 | 3300036401 | Ga0373937_0065488 | Ga0373937_0065488_541_1605 | 349 |
| 146 | 3300048903 | Ga0496100_0031823 | Ga0496100_0031823_298_1368 | 349 |
| 147 | 3300048904 | Ga0496101_0017519 | Ga0496101_0017519_3145_4215 | 349 |
| 148 | 3300048905 | Ga0496102_0006183 | Ga0496102_0006183_1915_2985 | 349 |
| 149 | 3300048907 | Ga0496104_0092944 | Ga0496104_0092944_12_1082 | 349 |
| 150 | 3300048908 | Ga0496105_0048743 | Ga0496105_0048743_2102_3172 | 349 |
| 151 | 3300048909 | Ga0496106_0004024 | Ga0496106_0004024_7654_8724 | 349 |
| 152 | 3300048911 | Ga0496108_0034298 | Ga0496108_0034298_1623_2693 | 349 |
| 153 | 3300048912 | Ga0496109_0017192 | Ga0496109_0017192_2037_3107 | 349 |
| 154 | 3300048914 | Ga0496111_0099206 | Ga0496111_0099206_487_1557 | 349 |
| 155 | 3300048917 | Ga0496114_0011650 | Ga0496114_0011650_1198_2268 | 349 |
| 156 | 3300048918 | Ga0496115_0014474 | Ga0496115_0014474_2932_4002 | 349 |
| 157 | 3300050493 | nmdc:mga0k408_3230_c1 | nmdc:mga0k408_3230_c1_1747_2820 | 349 |
| 158 | 3300050508 | nmdc:mga09592_11254_c1 | nmdc:mga09592_11254_c1_580_1647 | 349 |
| 159 | 3300050510 | nmdc:mga06r32_4390_c1 | nmdc:mga06r32_4390_c1_9737_10804 | 349 |
| 160 | 3300053094 | Ga0500566_0003024 | Ga0500566_0003024_2432_3496 | 349 |
| 161 | 3300053150 | Ga0500603_007969 | Ga0500603_007969_503_1567 | 349 |
| 162 | 3300005467 | Ga0070706_100363808 | Ga0070706_1003638082 | 350 |
| 163 | 3300005563 | Ga0068855_100130103 | Ga0068855_1001301033 | 350 |
| 164 | 3300025922 | Ga0207646_10011044 | Ga0207646_100110444 | 350 |
| 165 | 3300044658 | Ga0466972_0006044 | Ga0466972_0006044_879_1973 | 350 |
| 166 | iso_pu_bacteria | 2878738818 | 2878745751 | 350 |
| 167 | iso_pu_bacteria | 2924776078 | 2924784149 | 350 |
| 168 | 3300005617 | Ga0068859_100043431 | Ga0068859_1000434312 | 351 |
| 169 | 3300005842 | Ga0068858_100021932 | Ga0068858_1000219324 | 351 |
| 170 | 3300006871 | Ga0075434_100000506 | Ga0075434_1000005065 | 351 |
| 171 | 3300006931 | Ga0097620_100043430 | Ga0097620_1000434302 | 351 |
| 172 | 3300014968 | Ga0157379_10018982 | Ga0157379_100189824 | 351 |
| 173 | 3300025934 | Ga0207686_10070615 | Ga0207686_100706152 | 351 |
| 174 | 3300025939 | Ga0207665_10078090 | Ga0207665_100780904 | 351 |
| 175 | 3300026035 | Ga0207703_10028528 | Ga0207703_100285284 | 351 |
| 176 | 3300048915 | Ga0496112_0062382 | Ga0496112_0062382_888_1970 | 351 |
| 177 | 3300049583 | Ga0501067_0000018 | Ga0501067_0000018_12386_13471 | 351 |
| 178 | 3300049584 | Ga0501068_0000782 | Ga0501068_0000782_9189_10274 | 351 |
| 179 | 3300049585 | Ga0501069_0000116 | Ga0501069_0000116_26194_27279 | 351 |
| 180 | 3300050512 | nmdc:mga0n895_8893_c1 | nmdc:mga0n895_8893_c1_2763_3851 | 351 |
| 181 | 3300061734 | Ga0530510_0002198 | Ga0530510_0002198_7650_8735 | 351 |
| 182 | iso_pu_bacteria | 8004395343 | 8004396466 | 351 |
| 183 | 3300039450 | Ga0436363_0799550 | Ga0436363_0799550_3650_4765 | 352 |
| 184 | 3300048903 | Ga0496100_0053457 | Ga0496100_0053457_715_1812 | 352 |
| 185 | 3300048904 | Ga0496101_0091302 | Ga0496101_0091302_688_1785 | 352 |
| 186 | 3300048911 | Ga0496108_0071351 | Ga0496108_0071351_427_1524 | 352 |
| 187 | 3300048914 | Ga0496111_0105720 | Ga0496111_0105720_491_1588 | 352 |
| 188 | 3300048915 | Ga0496112_0104502 | Ga0496112_0104502_708_1805 | 352 |
| 189 | 3300048917 | Ga0496114_0109930 | Ga0496114_0109930_718_1815 | 352 |
| 190 | 3300048918 | Ga0496115_0166898 | Ga0496115_0166898_43_1140 | 352 |
| 191 | iso_pu_bacteria | 2842217011 | 2842224343 | 352 |
| 192 | iso_pu_bacteria | 2935901341 | 2935908147 | 352 |
| 193 | iso_pu_bacteria | 8024479707 | 8024483687 | 352 |
| 194 | 3300025284 | Ga0209130_1011935 | Ga0209130_10119352 | 353 |
| 195 | 3300042004 | Ga0439445_0039807 | Ga0439445_0039807_131_1207 | 354 |
| 196 | iso_pu_bacteria | 2512875016 | 2512928873 | 354 |
| 197 | iso_pu_bacteria | 2876363079 | 2876369085 | 354 |
| 198 | iso_pu_bacteria | 2903448605 | 2903449061 | 354 |
| 199 | iso_pu_bacteria | 2903521522 | 2903526447 | 354 |
| 200 | iso_pu_bacteria | 2903528002 | 2903532224 | 354 |
| 201 | iso_pu_bacteria | 2963644680 | 2963650361 | 354 |
| 202 | iso_pu_bacteria | 2968083720 | 2968086120 | 354 |
| 203 | iso_pu_bacteria | 3004211236 | 3004215497 | 354 |
| 204 | iso_pu_bacteria | 3004218560 | 3004225661 | 354 |
| 205 | iso_pu_bacteria | 637000159 | 637078588 | 354 |
| 206 | iso_pu_bacteria | 2802429605 | 2805932177 | 356 |
| 207 | iso_pu_bacteria | 8005307578 | 8005313413 | 356 |
| 208 | 3300021388 | Ga0213875_10007310 | Ga0213875_100073101 | 357 |
| 209 | 3300037853 | Ga0436364_0990550 | Ga0436364_0990550_1006_2121 | 357 |
| 210 | 3300042436 | Ga0439435_0000837 | Ga0439435_0000837_194_1294 | 357 |
| 211 | iso_pu_bacteria | 8005301065 | 8005303840 | 357 |
| 212 | 3300013306 | Ga0163162_10300864 | Ga0163162_103008642 | 358 |
| 213 | 3300053079 | Ga0500610_0077617 | Ga0500610_0077617_401_1483 | 358 |
| 214 | 3300037312 | Ga0395899_0000595 | Ga0395899_0000595_12419_13531 | 359 |
| 215 | 3300037418 | Ga0395900_0032955 | Ga0395900_0032955_2408_3520 | 359 |
| 216 | 3300037471 | Ga0395905_0007705 | Ga0395905_0007705_6008_7120 | 359 |
| 217 | iso_pu_bacteria | 2885270888 | 2885275377 | 359 |
| 218 | iso_pu_bacteria | 8056382006 | 8056386800 | 359 |
| 219 | 3300003790 | Ga0055528_1001399 | Ga0055528_10013992 | 360 |
| 220 | 3300009765 | Ga0123341_1000188 | Ga0123341_100018822 | 360 |
| 221 | iso_pu_bacteria | 2509276021 | 2509389696 | 360 |
| 222 | 3300049571 | Ga0501034_0045980 | Ga0501034_0045980_1606_2712 | 361 |
| 223 | iso_pu_bacteria | 2508501127 | 2509141244 | 361 |
| 224 | iso_pu_bacteria | 2582581315 | 2585327724 | 361 |
| 225 | iso_pu_bacteria | 2582581315 | 2585329127 | 361 |
| 226 | iso_pu_bacteria | 2597489875 | 2597815451 | 361 |
| 227 | iso_pu_bacteria | 2643221653 | 2644299610 | 361 |
| 228 | iso_pu_bacteria | 2643221719 | 2644657838 | 361 |
| 229 | iso_pu_bacteria | 2841734538 | 2841738197 | 361 |
| 230 | iso_pu_bacteria | 2856342000 | 2856347566 | 361 |
| 231 | iso_pu_bacteria | 2871474448 | 2871480199 | 361 |
| 232 | iso_pu_bacteria | 2878788777 | 2878795755 | 361 |
| 233 | iso_pu_bacteria | 2888343758 | 2888349449 | 361 |
| 234 | iso_pu_bacteria | 2898795034 | 2898797459 | 361 |
| 235 | iso_pu_bacteria | 2924754689 | 2924758641 | 361 |
| 236 | iso_pu_bacteria | 2937836603 | 2937842558 | 361 |
| 237 | iso_pu_bacteria | 2958071322 | 2958071882 | 361 |
| 238 | iso_pu_bacteria | 2970524798 | 2970530978 | 361 |
| 239 | iso_pu_bacteria | 2970540015 | 2970546583 | 361 |
| 240 | iso_pu_bacteria | 2989776772 | 2989781290 | 361 |
| 241 | iso_pu_bacteria | 2995392953 | 2995394354 | 361 |
| 242 | iso_pu_bacteria | 8004633249 | 8004638565 | 361 |
| 243 | iso_pu_bacteria | 8005246636 | 8005247336 | 361 |
| 244 | iso_pu_bacteria | 8018150411 | 8018151175 | 361 |
| 245 | iso_pu_bacteria | 8055617313 | 8055623851 | 361 |
| 246 | iso_pu_bacteria | 2508501122 | 2509108897 | 362 |
| 247 | iso_pu_bacteria | 2509276019 | 2509378025 | 362 |
| 248 | iso_pu_bacteria | 2509276033 | 2509445871 | 362 |
| 249 | iso_pu_bacteria | 2510065057 | 2510305787 | 362 |
| 250 | iso_pu_bacteria | 2511231052 | 2511498551 | 362 |
| 251 | iso_pu_bacteria | 2512047086 | 2512534702 | 362 |
| 252 | iso_pu_bacteria | 2512875026 | 2512973485 | 362 |
| 253 | iso_pu_bacteria | 2513237086 | 2513583711 | 362 |
| 254 | iso_pu_bacteria | 2513237089 | 2513601998 | 362 |
| 255 | iso_pu_bacteria | 2513237091 | 2513615785 | 362 |
| 256 | iso_pu_bacteria | 2513237140 | 2513886747 | 362 |
| 257 | iso_pu_bacteria | 2513237143 | 2513906811 | 362 |
| 258 | iso_pu_bacteria | 2513237156 | 2513983451 | 362 |
| 259 | iso_pu_bacteria | 2513237159 | 2513997473 | 362 |
| 260 | iso_pu_bacteria | 2513237160 | 2514003404 | 362 |
| 261 | iso_pu_bacteria | 2515154107 | 2515612466 | 362 |
| 262 | iso_pu_bacteria | 2516143018 | 2516205657 | 362 |
| 263 | iso_pu_bacteria | 2516653046 | 2516894829 | 362 |
| 264 | iso_pu_bacteria | 2517487022 | 2517571512 | 362 |
| 265 | iso_pu_bacteria | 2524023207 | 2524450352 | 362 |
| 266 | iso_pu_bacteria | 2551306084 | 2551676683 | 362 |
| 267 | iso_pu_bacteria | 2551306084 | 2551680307 | 362 |
| 268 | iso_pu_bacteria | 2551306085 | 2551685138 | 362 |
| 269 | iso_pu_bacteria | 2551306086 | 2551696288 | 362 |
| 270 | iso_pu_bacteria | 2551306087 | 2551704486 | 362 |
| 271 | iso_pu_bacteria | 2551306089 | 2551711335 | 362 |
| 272 | iso_pu_bacteria | 2551306090 | 2551719673 | 362 |
| 273 | iso_pu_bacteria | 2551306091 | 2551728085 | 362 |
| 274 | iso_pu_bacteria | 2551306092 | 2551738515 | 362 |
| 275 | iso_pu_bacteria | 2551306093 | 2551742749 | 362 |
| 276 | iso_pu_bacteria | 2558860100 | 2558867473 | 362 |
| 277 | iso_pu_bacteria | 2582581283 | 2585167649 | 362 |
| 278 | iso_pu_bacteria | 2582581306 | 2585265903 | 362 |
| 279 | iso_pu_bacteria | 2582581865 | 2585390093 | 362 |
| 280 | iso_pu_bacteria | 2582581866 | 2585395276 | 362 |
| 281 | iso_pu_bacteria | 2599185352 | 2600193938 | 362 |
| 282 | iso_pu_bacteria | 2643221607 | 2644052146 | 362 |
| 283 | iso_pu_bacteria | 2643221634 | 2644195028 | 362 |
| 284 | iso_pu_bacteria | 2643221636 | 2644204940 | 362 |
| 285 | iso_pu_bacteria | 2643221637 | 2644208619 | 362 |
| 286 | iso_pu_bacteria | 2643221686 | 2644484889 | 362 |
| 287 | iso_pu_bacteria | 2643221688 | 2644494147 | 362 |
| 288 | iso_pu_bacteria | 2643221689 | 2644500555 | 362 |
| 289 | iso_pu_bacteria | 2643221718 | 2644652149 | 362 |
| 290 | iso_pu_bacteria | 2643221723 | 2644677011 | 362 |
| 291 | iso_pu_bacteria | 2657244999 | 2657682344 | 362 |
| 292 | iso_pu_bacteria | 2690316117 | 2692319879 | 362 |
| 293 | iso_pu_bacteria | 2751185821 | 2753458515 | 362 |
| 294 | iso_pu_bacteria | 2791355082 | 2792582306 | 362 |
| 295 | iso_pu_bacteria | 2791355091 | 2792621838 | 362 |
| 296 | iso_pu_bacteria | 2791355092 | 2792628904 | 362 |
| 297 | iso_pu_bacteria | 2791355094 | 2792640038 | 362 |
| 298 | iso_pu_bacteria | 2802428858 | 2802717122 | 362 |
| 299 | iso_pu_bacteria | 2802428859 | 2802724890 | 362 |
| 300 | iso_pu_bacteria | 2802428860 | 2802729640 | 362 |
| 301 | iso_pu_bacteria | 2802428861 | 2802736986 | 362 |
| 302 | iso_pu_bacteria | 2802428862 | 2802743391 | 362 |
| 303 | iso_pu_bacteria | 2802428863 | 2802749483 | 362 |
| 304 | iso_pu_bacteria | 2802429268 | 2804753763 | 362 |
| 305 | iso_pu_bacteria | 2838074704 | 2838078098 | 362 |
| 306 | iso_pu_bacteria | 2841911363 | 2841911805 | 362 |
| 307 | iso_pu_bacteria | 2841917233 | 2841917238 | 362 |
| 308 | iso_pu_bacteria | 2842521101 | 2842522286 | 362 |
| 309 | iso_pu_bacteria | 2847417321 | 2847420898 | 362 |
| 310 | iso_pu_bacteria | 2848992105 | 2848995731 | 362 |
| 311 | iso_pu_bacteria | 2850079185 | 2850082716 | 362 |
| 312 | iso_pu_bacteria | 2855825444 | 2855827463 | 362 |
| 313 | iso_pu_bacteria | 2855839649 | 2855842837 | 362 |
| 314 | iso_pu_bacteria | 2855872281 | 2855873595 | 362 |
| 315 | iso_pu_bacteria | 2858800743 | 2858802175 | 362 |
| 316 | iso_pu_bacteria | 2896384573 | 2896390124 | 362 |
| 317 | iso_pu_bacteria | 2913295892 | 2913300257 | 362 |
| 318 | iso_pu_bacteria | 2915980308 | 2915981748 | 362 |
| 319 | iso_pu_bacteria | 2915986958 | 2915993388 | 362 |
| 320 | iso_pu_bacteria | 2915993759 | 2915998339 | 362 |
| 321 | iso_pu_bacteria | 2916000859 | 2916006130 | 362 |
| 322 | iso_pu_bacteria | 2916007675 | 2916009065 | 362 |
| 323 | iso_pu_bacteria | 2916014648 | 2916019829 | 362 |
| 324 | iso_pu_bacteria | 2916021584 | 2916023894 | 362 |
| 325 | iso_pu_bacteria | 2916028427 | 2916031000 | 362 |
| 326 | iso_pu_bacteria | 2916035215 | 2916040460 | 362 |
| 327 | iso_pu_bacteria | 2916041962 | 2916043395 | 362 |
| 328 | iso_pu_bacteria | 2916048683 | 2916050680 | 362 |
| 329 | iso_pu_bacteria | 2916055098 | 2916056823 | 362 |
| 330 | iso_pu_bacteria | 2916061851 | 2916066519 | 362 |
| 331 | iso_pu_bacteria | 2920760137 | 2920760255 | 362 |
| 332 | iso_pu_bacteria | 2921201388 | 2921204804 | 362 |
| 333 | iso_pu_bacteria | 2921208531 | 2921209843 | 362 |
| 334 | iso_pu_bacteria | 2921237296 | 2921239746 | 362 |
| 335 | iso_pu_bacteria | 2921244191 | 2921245667 | 362 |
| 336 | iso_pu_bacteria | 2921250672 | 2921252837 | 362 |
| 337 | iso_pu_bacteria | 2921257292 | 2921262616 | 362 |
| 338 | iso_pu_bacteria | 2921263974 | 2921266276 | 362 |
| 339 | iso_pu_bacteria | 2921282425 | 2921288920 | 362 |
| 340 | iso_pu_bacteria | 2921289301 | 2921293943 | 362 |
| 341 | iso_pu_bacteria | 2921296804 | 2921303834 | 362 |
| 342 | iso_pu_bacteria | 2924144063 | 2924144772 | 362 |
| 343 | iso_pu_bacteria | 2924150972 | 2924157624 | 362 |
| 344 | iso_pu_bacteria | 2924158325 | 2924158818 | 362 |
| 345 | iso_pu_bacteria | 2924165586 | 2924168562 | 362 |
| 346 | iso_pu_bacteria | 2924172951 | 2924174270 | 362 |
| 347 | iso_pu_bacteria | 2924179722 | 2924185988 | 362 |
| 348 | iso_pu_bacteria | 2924186466 | 2924187780 | 362 |
| 349 | iso_pu_bacteria | 2924193448 | 2924193522 | 362 |
| 350 | iso_pu_bacteria | 2924200457 | 2924201410 | 362 |
| 351 | iso_pu_bacteria | 2924207177 | 2924207754 | 362 |
| 352 | iso_pu_bacteria | 2924214083 | 2924220734 | 362 |
| 353 | iso_pu_bacteria | 2924221636 | 2924223503 | 362 |
| 354 | iso_pu_bacteria | 2924228884 | 2924234072 | 362 |
| 355 | iso_pu_bacteria | 2936381700 | 2936388530 | 362 |
| 356 | iso_pu_bacteria | 2936996657 | 2936997402 | 362 |
| 357 | iso_pu_bacteria | 2937002841 | 2937004136 | 362 |
| 358 | iso_pu_bacteria | 2937009748 | 2937010326 | 362 |
| 359 | iso_pu_bacteria | 2937016420 | 2937017758 | 362 |
| 360 | iso_pu_bacteria | 2937023124 | 2937023213 | 362 |
| 361 | iso_pu_bacteria | 2937029754 | 2937031760 | 362 |
| 362 | iso_pu_bacteria | 2937036028 | 2937037827 | 362 |
| 363 | iso_pu_bacteria | 2937042894 | 2937044369 | 362 |
| 364 | iso_pu_bacteria | 2937049772 | 2937051030 | 362 |
| 365 | iso_pu_bacteria | 2937056579 | 2937063008 | 362 |
| 366 | iso_pu_bacteria | 2937063883 | 2937070437 | 362 |
| 367 | iso_pu_bacteria | 2937071275 | 2937075429 | 362 |
| 368 | iso_pu_bacteria | 2937078374 | 2937082144 | 362 |
| 369 | iso_pu_bacteria | 2937084907 | 2937089916 | 362 |
| 370 | iso_pu_bacteria | 2937091812 | 2937092468 | 362 |
| 371 | iso_pu_bacteria | 2937098957 | 2937103093 | 362 |
| 372 | iso_pu_bacteria | 2937106411 | 2937113207 | 362 |
| 373 | iso_pu_bacteria | 2937113482 | 2937114208 | 362 |
| 374 | iso_pu_bacteria | 2937119839 | 2937120206 | 362 |
| 375 | iso_pu_bacteria | 2937126314 | 2937128578 | 362 |
| 376 | iso_pu_bacteria | 2957375807 | 2957376827 | 362 |
| 377 | iso_pu_bacteria | 2957382221 | 2957384525 | 362 |
| 378 | iso_pu_bacteria | 2957388812 | 2957395232 | 362 |
| 379 | iso_pu_bacteria | 2957395598 | 2957398059 | 362 |
| 380 | iso_pu_bacteria | 2957402308 | 2957405196 | 362 |
| 381 | iso_pu_bacteria | 2957408893 | 2957411748 | 362 |
| 382 | iso_pu_bacteria | 2957415311 | 2957417505 | 362 |
| 383 | iso_pu_bacteria | 2957422303 | 2957422329 | 362 |
| 384 | iso_pu_bacteria | 2957430029 | 2957430043 | 362 |
| 385 | iso_pu_bacteria | 2957437181 | 2957441635 | 362 |
| 386 | iso_pu_bacteria | 2957443900 | 2957450368 | 362 |
| 387 | iso_pu_bacteria | 2957450854 | 2957455945 | 362 |
| 388 | iso_pu_bacteria | 2957457609 | 2957460963 | 362 |
| 389 | iso_pu_bacteria | 2957464669 | 2957466543 | 362 |
| 390 | iso_pu_bacteria | 2957471148 | 2957471375 | 362 |
| 391 | iso_pu_bacteria | 2957478035 | 2957479431 | 362 |
| 392 | iso_pu_bacteria | 2957484790 | 2957491137 | 362 |
| 393 | iso_pu_bacteria | 2957491536 | 2957494470 | 362 |
| 394 | iso_pu_bacteria | 2957498199 | 2957505208 | 362 |
| 395 | iso_pu_bacteria | 2957505466 | 2957512284 | 362 |
| 396 | iso_pu_bacteria | 2960584000 | 2960588275 | 362 |
| 397 | iso_pu_bacteria | 2960591022 | 2960592765 | 362 |
| 398 | iso_pu_bacteria | 2960597568 | 2960597934 | 362 |
| 399 | iso_pu_bacteria | 2960603979 | 2960606596 | 362 |
| 400 | iso_pu_bacteria | 2960617483 | 2960618379 | 362 |
| 401 | iso_pu_bacteria | 2960624210 | 2960629862 | 362 |
| 402 | iso_pu_bacteria | 2960631154 | 2960634162 | 362 |
| 403 | iso_pu_bacteria | 2960637947 | 2960643718 | 362 |
| 404 | iso_pu_bacteria | 2960645483 | 2960647496 | 362 |
| 405 | iso_pu_bacteria | 2960652885 | 2960653581 | 362 |
| 406 | iso_pu_bacteria | 2960660292 | 2960666906 | 362 |
| 407 | iso_pu_bacteria | 2960667422 | 2960673253 | 362 |
| 408 | iso_pu_bacteria | 2960674078 | 2960674918 | 362 |
| 409 | iso_pu_bacteria | 2960680706 | 2960681690 | 362 |
| 410 | iso_pu_bacteria | 2960687367 | 2960689370 | 362 |
| 411 | iso_pu_bacteria | 2960693952 | 2960699046 | 362 |
| 412 | iso_pu_bacteria | 2964607997 | 2964615055 | 362 |
| 413 | iso_pu_bacteria | 2964615318 | 2964617002 | 362 |
| 414 | iso_pu_bacteria | 2964621998 | 2964625867 | 362 |
| 415 | iso_pu_bacteria | 2964628898 | 2964629498 | 362 |
| 416 | iso_pu_bacteria | 2964636051 | 2964641535 | 362 |
| 417 | iso_pu_bacteria | 2964643177 | 2964643645 | 362 |
| 418 | iso_pu_bacteria | 2964649959 | 2964655248 | 362 |
| 419 | iso_pu_bacteria | 2964656573 | 2964663274 | 362 |
| 420 | iso_pu_bacteria | 2964663802 | 2964669364 | 362 |
| 421 | iso_pu_bacteria | 2964670856 | 2964676981 | 362 |
| 422 | iso_pu_bacteria | 2964678106 | 2964679184 | 362 |
| 423 | iso_pu_bacteria | 2964685014 | 2964687264 | 362 |
| 424 | iso_pu_bacteria | 2964691889 | 2964695106 | 362 |
| 425 | iso_pu_bacteria | 2964698721 | 2964699123 | 362 |
| 426 | iso_pu_bacteria | 2964705432 | 2964705989 | 362 |
| 427 | iso_pu_bacteria | 2964712639 | 2964712696 | 362 |
| 428 | iso_pu_bacteria | 2964719344 | 2964719543 | 362 |
| 429 | iso_pu_bacteria | 2967664464 | 2967667594 | 362 |
| 430 | iso_pu_bacteria | 2967671571 | 2967676334 | 362 |
| 431 | iso_pu_bacteria | 2967678726 | 2967681212 | 362 |
| 432 | iso_pu_bacteria | 2967686174 | 2967692462 | 362 |
| 433 | iso_pu_bacteria | 2967693043 | 2967699363 | 362 |
| 434 | iso_pu_bacteria | 2967699805 | 2967703181 | 362 |
| 435 | iso_pu_bacteria | 2967706974 | 2967713230 | 362 |
| 436 | iso_pu_bacteria | 2967714385 | 2967721160 | 362 |
| 437 | iso_pu_bacteria | 2967721400 | 2967723829 | 362 |
| 438 | iso_pu_bacteria | 2967728569 | 2967731797 | 362 |
| 439 | iso_pu_bacteria | 2967735183 | 2967738427 | 362 |
| 440 | iso_pu_bacteria | 2967742019 | 2967743606 | 362 |
| 441 | iso_pu_bacteria | 2967748971 | 2967753452 | 362 |
| 442 | iso_pu_bacteria | 2967755722 | 2967757502 | 362 |
| 443 | iso_pu_bacteria | 2967762386 | 2967765834 | 362 |
| 444 | iso_pu_bacteria | 2967769361 | 2967770382 | 362 |
| 445 | iso_pu_bacteria | 2967775926 | 2967782328 | 362 |
| 446 | iso_pu_bacteria | 2970019648 | 2970021952 | 362 |
| 447 | iso_pu_bacteria | 2970026789 | 2970028713 | 362 |
| 448 | iso_pu_bacteria | 2970033650 | 2970036662 | 362 |
| 449 | iso_pu_bacteria | 2970040964 | 2970046563 | 362 |
| 450 | iso_pu_bacteria | 2970047711 | 2970051121 | 362 |
| 451 | iso_pu_bacteria | 2970054988 | 2970058872 | 362 |
| 452 | iso_pu_bacteria | 2970061556 | 2970065373 | 362 |
| 453 | iso_pu_bacteria | 2970068827 | 2970070323 | 362 |
| 454 | iso_pu_bacteria | 2970076120 | 2970076755 | 362 |
| 455 | iso_pu_bacteria | 2970082768 | 2970084010 | 362 |
| 456 | iso_pu_bacteria | 2970088815 | 2970092780 | 362 |
| 457 | iso_pu_bacteria | 2970095765 | 2970101249 | 362 |
| 458 | iso_pu_bacteria | 2970102677 | 2970106953 | 362 |
| 459 | iso_pu_bacteria | 2970109326 | 2970111099 | 362 |
| 460 | iso_pu_bacteria | 2970116247 | 2970122326 | 362 |
| 461 | iso_pu_bacteria | 2970122695 | 2970124542 | 362 |
| 462 | iso_pu_bacteria | 2970129317 | 2970133558 | 362 |
| 463 | iso_pu_bacteria | 2970136068 | 2970142234 | 362 |
| 464 | iso_pu_bacteria | 2970143518 | 2970147300 | 362 |
| 465 | iso_pu_bacteria | 2970149975 | 2970151714 | 362 |
| 466 | iso_pu_bacteria | 2970156795 | 2970158696 | 362 |
| 467 | iso_pu_bacteria | 2970164137 | 2970170791 | 362 |
| 468 | iso_pu_bacteria | 2970170962 | 2970175033 | 362 |
| 469 | iso_pu_bacteria | 2970177841 | 2970184567 | 362 |
| 470 | iso_pu_bacteria | 2970184632 | 2970185529 | 362 |
| 471 | iso_pu_bacteria | 2970191845 | 2970197950 | 362 |
| 472 | iso_pu_bacteria | 2977516862 | 2977523745 | 362 |
| 473 | iso_pu_bacteria | 2977523885 | 2977525138 | 362 |
| 474 | iso_pu_bacteria | 2977530762 | 2977531165 | 362 |
| 475 | iso_pu_bacteria | 2977537788 | 2977544507 | 362 |
| 476 | iso_pu_bacteria | 2977544691 | 2977547184 | 362 |
| 477 | iso_pu_bacteria | 2977551784 | 2977558048 | 362 |
| 478 | iso_pu_bacteria | 2977558990 | 2977564760 | 362 |
| 479 | iso_pu_bacteria | 2977565890 | 2977571275 | 362 |
| 480 | iso_pu_bacteria | 2977572785 | 2977573798 | 362 |
| 481 | iso_pu_bacteria | 2977579622 | 2977585141 | 362 |
| 482 | iso_pu_bacteria | 643692032 | 643827493 | 362 |
| 483 | iso_pu_bacteria | 648276728 | 648737272 | 362 |
| 484 | iso_pu_bacteria | 8003992118 | 8003995418 | 362 |
| 485 | iso_pu_bacteria | 8003999396 | 8004003179 | 362 |
| 486 | iso_pu_bacteria | 8049293176 | 8049296363 | 362 |
| 487 | iso_pu_bacteria | 8057160832 | 8057162318 | 362 |
| 488 | 3300009093 | Ga0105240_10000365 | Ga0105240_1000036552 | 363 |
| 489 | 3300013105 | Ga0157369_10000943 | Ga0157369_1000094327 | 363 |
| 490 | 3300025913 | Ga0207695_10000492 | Ga0207695_1000049220 | 363 |
| 491 | 3300037312 | Ga0395899_0027264 | Ga0395899_0027264_419_1525 | 363 |
| 492 | 3300046462 | Ga0495651_0010066 | Ga0495651_0010066_5608_6714 | 363 |
| 493 | 3300046463 | Ga0495653_0076344 | Ga0495653_0076344_1082_2188 | 363 |
| 494 | 3300046472 | Ga0495580_0095521 | Ga0495580_0095521_885_1991 | 363 |
| 495 | 3300046524 | Ga0495648_0047211 | Ga0495648_0047211_986_2092 | 363 |
| 496 | 3300046535 | Ga0495586_0053676 | Ga0495586_0053676_1016_2125 | 363 |
| 497 | 3300046678 | Ga0495599_0025465 | Ga0495599_0025465_515_1621 | 363 |
| 498 | 3300046679 | Ga0495623_0001445 | Ga0495623_0001445_9815_10921 | 363 |
| 499 | 3300047317 | Ga0495604_0012138 | Ga0495604_0012138_5047_6153 | 363 |
| 500 | 3300047319 | Ga0495674_0004081 | Ga0495674_0004081_882_1988 | 363 |
| 501 | 3300047320 | Ga0495672_0110063 | Ga0495672_0110063_73_1179 | 363 |
| 502 | 3300047322 | Ga0495680_0012563 | Ga0495680_0012563_4382_5488 | 363 |
| 503 | 3300047444 | Ga0495675_0002082 | Ga0495675_0002082_6434_7540 | 363 |
| 504 | 3300047446 | Ga0495679_002038 | Ga0495679_002038_6676_7782 | 363 |
| 505 | 3300048088 | Ga0495602_0034456 | Ga0495602_0034456_257_1363 | 363 |
| 506 | 3300048917 | Ga0496114_0142814 | Ga0496114_0142814_638_1744 | 363 |
| 507 | 3300048927 | Ga0496124_0211508 | Ga0496124_0211508_282_1388 | 363 |
| 508 | iso_pu_bacteria | 2509276033 | 2509445868 | 363 |
| 509 | iso_pu_bacteria | 2510065019 | 2510132583 | 363 |
| 510 | iso_pu_bacteria | 2510065019 | 2510134969 | 363 |
| 511 | iso_pu_bacteria | 2510461069 | 2510843277 | 363 |
| 512 | iso_pu_bacteria | 2510461076 | 2510893935 | 363 |
| 513 | iso_pu_bacteria | 2510461076 | 2510896391 | 363 |
| 514 | iso_pu_bacteria | 2510461076 | 2510898960 | 363 |
| 515 | iso_pu_bacteria | 2510917028 | 2511181732 | 363 |
| 516 | iso_pu_bacteria | 2510917030 | 2511197312 | 363 |
| 517 | iso_pu_bacteria | 2511231027 | 2511392188 | 363 |
| 518 | iso_pu_bacteria | 2513237085 | 2513575718 | 363 |
| 519 | iso_pu_bacteria | 2513237085 | 2513581557 | 363 |
| 520 | iso_pu_bacteria | 2513237088 | 2513598611 | 363 |
| 521 | iso_pu_bacteria | 2513237093 | 2513631183 | 363 |
| 522 | iso_pu_bacteria | 2513237093 | 2513636290 | 363 |
| 523 | iso_pu_bacteria | 2513237103 | 2513710526 | 363 |
| 524 | iso_pu_bacteria | 2513237103 | 2513710920 | 363 |
| 525 | iso_pu_bacteria | 2513237138 | 2513866064 | 363 |
| 526 | iso_pu_bacteria | 2513237144 | 2513908073 | 363 |
| 527 | iso_pu_bacteria | 2513237146 | 2513927060 | 363 |
| 528 | iso_pu_bacteria | 2513237162 | 2514019637 | 363 |
| 529 | iso_pu_bacteria | 2513237162 | 2514024888 | 363 |
| 530 | iso_pu_bacteria | 2513237351 | 2514588942 | 363 |
| 531 | iso_pu_bacteria | 2515075009 | 2515111579 | 363 |
| 532 | iso_pu_bacteria | 2515075009 | 2515114056 | 363 |
| 533 | iso_pu_bacteria | 2515154113 | 2515637108 | 363 |
| 534 | iso_pu_bacteria | 2515154113 | 2515638266 | 363 |
| 535 | iso_pu_bacteria | 2515154114 | 2515641884 | 363 |
| 536 | iso_pu_bacteria | 2515154114 | 2515647126 | 363 |
| 537 | iso_pu_bacteria | 2515154116 | 2515656636 | 363 |
| 538 | iso_pu_bacteria | 2516653077 | 2517037692 | 363 |
| 539 | iso_pu_bacteria | 2516653077 | 2517040225 | 363 |
| 540 | iso_pu_bacteria | 2516653085 | 2517075774 | 363 |
| 541 | iso_pu_bacteria | 2516653085 | 2517077980 | 363 |
| 542 | iso_pu_bacteria | 2517093000 | 2517094356 | 363 |
| 543 | iso_pu_bacteria | 2517093000 | 2517096774 | 363 |
| 544 | iso_pu_bacteria | 2517287029 | 2517406153 | 363 |
| 545 | iso_pu_bacteria | 2517287029 | 2517410480 | 363 |
| 546 | iso_pu_bacteria | 2524023209 | 2524461013 | 363 |
| 547 | iso_pu_bacteria | 2534681796 | 2535516720 | 363 |
| 548 | iso_pu_bacteria | 2582581294 | 2585200372 | 363 |
| 549 | iso_pu_bacteria | 2582581298 | 2585224648 | 363 |
| 550 | iso_pu_bacteria | 2582581304 | 2585254958 | 363 |
| 551 | iso_pu_bacteria | 2582581308 | 2585281407 | 363 |
| 552 | iso_pu_bacteria | 2582581316 | 2585334432 | 363 |
| 553 | iso_pu_bacteria | 2582581867 | 2585404319 | 363 |
| 554 | iso_pu_bacteria | 2585427527 | 2585535629 | 363 |
| 555 | iso_pu_bacteria | 2585427528 | 2585543871 | 363 |
| 556 | iso_pu_bacteria | 2585427529 | 2585547204 | 363 |
| 557 | iso_pu_bacteria | 2585427530 | 2585556010 | 363 |
| 558 | iso_pu_bacteria | 2585427590 | 2585821981 | 363 |
| 559 | iso_pu_bacteria | 2585427593 | 2585838255 | 363 |
| 560 | iso_pu_bacteria | 2585427593 | 2585839649 | 363 |
| 561 | iso_pu_bacteria | 2585427594 | 2585842729 | 363 |
| 562 | iso_pu_bacteria | 2599185170 | 2599420447 | 363 |
| 563 | iso_pu_bacteria | 2615840626 | 2616310519 | 363 |
| 564 | iso_pu_bacteria | 2617270742 | 2617382227 | 363 |
| 565 | iso_pu_bacteria | 2617270742 | 2617384454 | 363 |
| 566 | iso_pu_bacteria | 2617270742 | 2617386511 | 363 |
| 567 | iso_pu_bacteria | 2643221557 | 2643807982 | 363 |
| 568 | iso_pu_bacteria | 2643221564 | 2643837668 | 363 |
| 569 | iso_pu_bacteria | 2643221599 | 2644002893 | 363 |
| 570 | iso_pu_bacteria | 2643221610 | 2644068829 | 363 |
| 571 | iso_pu_bacteria | 2643221618 | 2644103977 | 363 |
| 572 | iso_pu_bacteria | 2643221623 | 2644133289 | 363 |
| 573 | iso_pu_bacteria | 2643221626 | 2644150511 | 363 |
| 574 | iso_pu_bacteria | 2643221629 | 2644168784 | 363 |
| 575 | iso_pu_bacteria | 2643221643 | 2644242374 | 363 |
| 576 | iso_pu_bacteria | 2643221655 | 2644311167 | 363 |
| 577 | iso_pu_bacteria | 2643221659 | 2644335074 | 363 |
| 578 | iso_pu_bacteria | 2643221662 | 2644347332 | 363 |
| 579 | iso_pu_bacteria | 2643221668 | 2644379416 | 363 |
| 580 | iso_pu_bacteria | 2643221675 | 2644419900 | 363 |
| 581 | iso_pu_bacteria | 2643221680 | 2644453256 | 363 |
| 582 | iso_pu_bacteria | 2643221698 | 2644546310 | 363 |
| 583 | iso_pu_bacteria | 2643221712 | 2644615338 | 363 |
| 584 | iso_pu_bacteria | 2643221726 | 2644688716 | 363 |
| 585 | iso_pu_bacteria | 2718217927 | 2719385152 | 363 |
| 586 | iso_pu_bacteria | 2718217927 | 2719387385 | 363 |
| 587 | iso_pu_bacteria | 2718217997 | 2719664914 | 363 |
| 588 | iso_pu_bacteria | 2718217997 | 2719667044 | 363 |
| 589 | iso_pu_bacteria | 2718218199 | 2720491334 | 363 |
| 590 | iso_pu_bacteria | 2718218199 | 2720493464 | 363 |
| 591 | iso_pu_bacteria | 2718218232 | 2720612694 | 363 |
| 592 | iso_pu_bacteria | 2718218232 | 2720614921 | 363 |
| 593 | iso_pu_bacteria | 2718218233 | 2720619534 | 363 |
| 594 | iso_pu_bacteria | 2718218233 | 2720621692 | 363 |
| 595 | iso_pu_bacteria | 2718218235 | 2720630989 | 363 |
| 596 | iso_pu_bacteria | 2718218235 | 2720633020 | 363 |
| 597 | iso_pu_bacteria | 2718218269 | 2720774627 | 363 |
| 598 | iso_pu_bacteria | 2718218269 | 2720776744 | 363 |
| 599 | iso_pu_bacteria | 2718218423 | 2721398872 | 363 |
| 600 | iso_pu_bacteria | 2718218423 | 2721401020 | 363 |
| 601 | iso_pu_bacteria | 2721755556 | 2723026352 | 363 |
| 602 | iso_pu_bacteria | 2721755556 | 2723028335 | 363 |
| 603 | iso_pu_bacteria | 2721755684 | 2723559895 | 363 |
| 604 | iso_pu_bacteria | 2721755684 | 2723561962 | 363 |
| 605 | iso_pu_bacteria | 2721755685 | 2723566515 | 363 |
| 606 | iso_pu_bacteria | 2721755685 | 2723568592 | 363 |
| 607 | iso_pu_bacteria | 2721755809 | 2724037685 | 363 |
| 608 | iso_pu_bacteria | 2721755809 | 2724039833 | 363 |
| 609 | iso_pu_bacteria | 2721755819 | 2724089234 | 363 |
| 610 | iso_pu_bacteria | 2721755819 | 2724091351 | 363 |
| 611 | iso_pu_bacteria | 2721755822 | 2724103780 | 363 |
| 612 | iso_pu_bacteria | 2721755822 | 2724105857 | 363 |
| 613 | iso_pu_bacteria | 2721755823 | 2724109616 | 363 |
| 614 | iso_pu_bacteria | 2721755823 | 2724111685 | 363 |
| 615 | iso_pu_bacteria | 2728369352 | 2730107288 | 363 |
| 616 | iso_pu_bacteria | 2728369352 | 2730109271 | 363 |
| 617 | iso_pu_bacteria | 2738541293 | 2738799772 | 363 |
| 618 | iso_pu_bacteria | 2738543024 | 2739307547 | 363 |
| 619 | iso_pu_bacteria | 2751185800 | 2753358118 | 363 |
| 620 | iso_pu_bacteria | 2758568016 | 2758639104 | 363 |
| 621 | iso_pu_bacteria | 2765235802 | 2765465990 | 363 |
| 622 | iso_pu_bacteria | 2765235942 | 2766063670 | 363 |
| 623 | iso_pu_bacteria | 2765235942 | 2766065188 | 363 |
| 624 | iso_pu_bacteria | 2767802442 | 2770196626 | 363 |
| 625 | iso_pu_bacteria | 2775506902 | 2776269265 | 363 |
| 626 | iso_pu_bacteria | 2775506904 | 2776283596 | 363 |
| 627 | iso_pu_bacteria | 2775507049 | 2776910482 | 363 |
| 628 | iso_pu_bacteria | 2775507266 | 2778174945 | 363 |
| 629 | iso_pu_bacteria | 2791355253 | 2793281383 | 363 |
| 630 | iso_pu_bacteria | 2791355262 | 2793338556 | 363 |
| 631 | iso_pu_bacteria | 2818991453 | 2819641642 | 363 |
| 632 | iso_pu_bacteria | 2838022645 | 2838022853 | 363 |
| 633 | iso_pu_bacteria | 2838022645 | 2838024183 | 363 |
| 634 | iso_pu_bacteria | 2838035591 | 2838040882 | 363 |
| 635 | iso_pu_bacteria | 2838042994 | 2838047486 | 363 |
| 636 | iso_pu_bacteria | 2838042994 | 2838047795 | 363 |
| 637 | iso_pu_bacteria | 2838048938 | 2838051055 | 363 |
| 638 | iso_pu_bacteria | 2838048938 | 2838054105 | 363 |
| 639 | iso_pu_bacteria | 2838661181 | 2838664730 | 363 |
| 640 | iso_pu_bacteria | 2838668709 | 2838675287 | 363 |
| 641 | iso_pu_bacteria | 2838675328 | 2838679065 | 363 |
| 642 | iso_pu_bacteria | 2838701080 | 2838707649 | 363 |
| 643 | iso_pu_bacteria | 2838714209 | 2838718019 | 363 |
| 644 | iso_pu_bacteria | 2838719591 | 2838723364 | 363 |
| 645 | iso_pu_bacteria | 2838724970 | 2838728733 | 363 |
| 646 | iso_pu_bacteria | 2839993093 | 2839993622 | 363 |
| 647 | iso_pu_bacteria | 2840764183 | 2840766644 | 363 |
| 648 | iso_pu_bacteria | 2841846520 | 2841851459 | 363 |
| 649 | iso_pu_bacteria | 2841864319 | 2841865181 | 363 |
| 650 | iso_pu_bacteria | 2841864319 | 2841868030 | 363 |
| 651 | iso_pu_bacteria | 2842124991 | 2842130043 | 363 |
| 652 | iso_pu_bacteria | 2842130223 | 2842133784 | 363 |
| 653 | iso_pu_bacteria | 2842146304 | 2842152187 | 363 |
| 654 | iso_pu_bacteria | 2842152218 | 2842155952 | 363 |
| 655 | iso_pu_bacteria | 2842163707 | 2842165272 | 363 |
| 656 | iso_pu_bacteria | 2842170452 | 2842174264 | 363 |
| 657 | iso_pu_bacteria | 2842175837 | 2842179398 | 363 |
| 658 | iso_pu_bacteria | 2842187318 | 2842190918 | 363 |
| 659 | iso_pu_bacteria | 2842192696 | 2842197279 | 363 |
| 660 | iso_pu_bacteria | 2842211629 | 2842215233 | 363 |
| 661 | iso_pu_bacteria | 2842224351 | 2842228128 | 363 |
| 662 | iso_pu_bacteria | 2842250916 | 2842257396 | 363 |
| 663 | iso_pu_bacteria | 2842264693 | 2842268700 | 363 |
| 664 | iso_pu_bacteria | 2842264693 | 2842269947 | 363 |
| 665 | iso_pu_bacteria | 2842298080 | 2842298852 | 363 |
| 666 | iso_pu_bacteria | 2842304105 | 2842308357 | 363 |
| 667 | iso_pu_bacteria | 2842317721 | 2842324450 | 363 |
| 668 | iso_pu_bacteria | 2842357229 | 2842359280 | 363 |
| 669 | iso_pu_bacteria | 2842363717 | 2842367011 | 363 |
| 670 | iso_pu_bacteria | 2842428310 | 2842432833 | 363 |
| 671 | iso_pu_bacteria | 2842428310 | 2842433808 | 363 |
| 672 | iso_pu_bacteria | 2842434925 | 2842439138 | 363 |
| 673 | iso_pu_bacteria | 2842434925 | 2842440160 | 363 |
| 674 | iso_pu_bacteria | 2842441272 | 2842445767 | 363 |
| 675 | iso_pu_bacteria | 2842441272 | 2842446829 | 363 |
| 676 | iso_pu_bacteria | 2842447887 | 2842451383 | 363 |
| 677 | iso_pu_bacteria | 2842447887 | 2842453604 | 363 |
| 678 | iso_pu_bacteria | 2842462802 | 2842466881 | 363 |
| 679 | iso_pu_bacteria | 2842462802 | 2842468243 | 363 |
| 680 | iso_pu_bacteria | 2842469257 | 2842473752 | 363 |
| 681 | iso_pu_bacteria | 2842469257 | 2842474769 | 363 |
| 682 | iso_pu_bacteria | 2842482326 | 2842485788 | 363 |
| 683 | iso_pu_bacteria | 2842489311 | 2842494561 | 363 |
| 684 | iso_pu_bacteria | 2842489311 | 2842495579 | 363 |
| 685 | iso_pu_bacteria | 2842509118 | 2842510880 | 363 |
| 686 | iso_pu_bacteria | 2842871566 | 2842875122 | 363 |
| 687 | iso_pu_bacteria | 2844163670 | 2844166328 | 363 |
| 688 | iso_pu_bacteria | 2844454524 | 2844454824 | 363 |
| 689 | iso_pu_bacteria | 2844454524 | 2844457358 | 363 |
| 690 | iso_pu_bacteria | 2852387548 | 2852391379 | 363 |
| 691 | iso_pu_bacteria | 2854911287 | 2854916369 | 363 |
| 692 | iso_pu_bacteria | 2889790730 | 2889793173 | 363 |
| 693 | iso_pu_bacteria | 2889914905 | 2889917595 | 363 |
| 694 | iso_pu_bacteria | 2891373044 | 2891374659 | 363 |
| 695 | iso_pu_bacteria | 2894652903 | 2894653418 | 363 |
| 696 | iso_pu_bacteria | 2899803654 | 2899808365 | 363 |
| 697 | iso_pu_bacteria | 2904578770 | 2904579680 | 363 |
| 698 | iso_pu_bacteria | 2915650412 | 2915652737 | 363 |
| 699 | iso_pu_bacteria | 2919100787 | 2919104700 | 363 |
| 700 | iso_pu_bacteria | 2919114240 | 2919118256 | 363 |
| 701 | iso_pu_bacteria | 2919119836 | 2919120653 | 363 |
| 702 | iso_pu_bacteria | 2920822456 | 2920826020 | 363 |
| 703 | iso_pu_bacteria | 2923556063 | 2923558389 | 363 |
| 704 | iso_pu_bacteria | 2926754445 | 2926758020 | 363 |
| 705 | iso_pu_bacteria | 2928521798 | 2928522478 | 363 |
| 706 | iso_pu_bacteria | 2933006813 | 2933010977 | 363 |
| 707 | iso_pu_bacteria | 2933016740 | 2933019861 | 363 |
| 708 | iso_pu_bacteria | 2933570622 | 2933574806 | 363 |
| 709 | iso_pu_bacteria | 2939669807 | 2939673722 | 363 |
| 710 | iso_pu_bacteria | 2941499720 | 2941501436 | 363 |
| 711 | iso_pu_bacteria | 2989349275 | 2989354553 | 363 |
| 712 | iso_pu_bacteria | 2989771324 | 2989775162 | 363 |
| 713 | iso_pu_bacteria | 2996310559 | 2996311102 | 363 |
| 714 | iso_pu_bacteria | 2996336353 | 2996340710 | 363 |
| 715 | iso_pu_bacteria | 2996887358 | 2996891898 | 363 |
| 716 | iso_pu_bacteria | 2996893221 | 2996894613 | 363 |
| 717 | iso_pu_bacteria | 3002141150 | 3002142013 | 363 |
| 718 | iso_pu_bacteria | 3003930520 | 3003935483 | 363 |
| 719 | iso_pu_bacteria | 3005409236 | 3005415370 | 363 |
| 720 | iso_pu_bacteria | 3005416602 | 3005419181 | 363 |
| 721 | iso_pu_bacteria | 3005445848 | 3005449406 | 363 |
| 722 | iso_pu_bacteria | 3005452660 | 3005457288 | 363 |
| 723 | iso_pu_bacteria | 3005452660 | 3005458462 | 363 |
| 724 | iso_pu_bacteria | 639633055 | 639647712 | 363 |
| 725 | iso_pu_bacteria | 639633055 | 639650128 | 363 |
| 726 | iso_pu_bacteria | 8002285264 | 8002291596 | 363 |
| 727 | iso_pu_bacteria | 8005258706 | 8005263309 | 363 |
| 728 | iso_pu_bacteria | 8005275841 | 8005279924 | 363 |
| 729 | iso_pu_bacteria | 8005275841 | 8005282132 | 363 |
| 730 | iso_pu_bacteria | 8005289223 | 8005294147 | 363 |
| 731 | iso_pu_bacteria | 8005314921 | 8005316736 | 363 |
| 732 | iso_pu_bacteria | 8005321885 | 8005326425 | 363 |
| 733 | iso_pu_bacteria | 8005382845 | 8005383715 | 363 |
| 734 | iso_pu_bacteria | 8005382845 | 8005384761 | 363 |
| 735 | iso_pu_bacteria | 8005395548 | 8005401043 | 363 |
| 736 | iso_pu_bacteria | 8005460587 | 8005462227 | 363 |
| 737 | iso_pu_bacteria | 8005497431 | 8005501828 | 363 |
| 738 | iso_pu_bacteria | 8005542996 | 8005545392 | 363 |
| 739 | iso_pu_bacteria | 8005563573 | 8005566909 | 363 |
| 740 | iso_pu_bacteria | 8005619151 | 8005620823 | 363 |
| 741 | iso_pu_bacteria | 8005619151 | 8005623137 | 363 |
| 742 | iso_pu_bacteria | 8005626139 | 8005631555 | 363 |
| 743 | iso_pu_bacteria | 8005668836 | 8005671063 | 363 |
| 744 | iso_pu_bacteria | 8005668836 | 8005673206 | 363 |
| 745 | iso_pu_bacteria | 8005668836 | 8005673251 | 363 |
| 746 | iso_pu_bacteria | 8018127388 | 8018132347 | 363 |
| 747 | iso_pu_bacteria | 8024501048 | 8024504966 | 363 |
| 748 | iso_pu_bacteria | 8024501048 | 8024505821 | 363 |
| 749 | iso_pu_bacteria | 8046767195 | 8046769217 | 363 |
| 750 | iso_pu_bacteria | 8054558443 | 8054559535 | 363 |
| 751 | 3300039453 | Ga0436362_1126090 | Ga0436362_1126090_2653_3765 | 364 |
| 752 | iso_pu_bacteria | 2503198000 | 2503204066 | 364 |
| 753 | iso_pu_bacteria | 2508501123 | 2509118262 | 364 |
| 754 | iso_pu_bacteria | 2513237090 | 2513607856 | 364 |
| 755 | iso_pu_bacteria | 2924762789 | 2924765937 | 364 |
| 756 | iso_pu_bacteria | 2937822353 | 2937823384 | 364 |
| 757 | iso_pu_bacteria | 2937848649 | 2937850892 | 364 |
| 758 | iso_pu_bacteria | 2977922695 | 2977923868 | 364 |
| 759 | iso_pu_bacteria | 2977986579 | 2977991103 | 364 |
| 760 | iso_pu_bacteria | 2987666974 | 2987673263 | 364 |
| 761 | iso_pu_bacteria | 3004211236 | 3004213306 | 364 |
| 762 | iso_pu_bacteria | 3004218560 | 3004221378 | 364 |
| 763 | 3300032004 | Ga0307414_10029891 | Ga0307414_100298912 | 365 |
| 764 | 3300035692 | Ga0373935_0268845 | Ga0373935_0268845_17_1123 | 365 |
| 765 | 3300041413 | Ga0439465_0021522 | Ga0439465_0021522_504_1601 | 365 |
| 766 | 3300042436 | Ga0439435_0033690 | Ga0439435_0033690_149_1255 | 365 |
| 767 | 3300044706 | Ga0466964_0002201 | Ga0466964_0002201_3794_4906 | 365 |
| 768 | 3300045051 | Ga0451576_0006467 | Ga0451576_0006467_6376_7485 | 365 |
| 769 | 3300049776 | Ga0501280_004198 | Ga0501280_004198_501_1613 | 365 |
| 770 | 3300002987 | JGI25159J45721_1000017 | JGI25159J45721_100001714 | 366 |
| 771 | 3300003187 | JGI25151J46595_10039171 | JGI25151J46595_100391712 | 366 |
| 772 | 3300003354 | JGI25160J50197_1000027 | JGI25160J50197_1000027168 | 366 |
| 773 | 3300003374 | JGI25161J50226_1009580 | JGI25161J50226_10095801 | 366 |
| 774 | 3300003771 | Ga0055526_1000297 | Ga0055526_10002975 | 366 |
| 775 | 3300003781 | Ga0055536_1007476 | Ga0055536_10074762 | 366 |
| 776 | 3300004625 | Ga0055543_1000403 | Ga0055543_100040314 | 366 |
| 777 | 3300005262 | Ga0065165_1000122 | Ga0065165_100012214 | 366 |
| 778 | 3300005344 | Ga0070661_100034358 | Ga0070661_1000343582 | 366 |
| 779 | 3300005539 | Ga0068853_100181162 | Ga0068853_1001811622 | 366 |
| 780 | 3300006946 | Ga0079104_1002943 | Ga0079104_10029436 | 366 |
| 781 | 3300006946 | Ga0079104_1003729 | Ga0079104_10037292 | 366 |
| 782 | 3300009551 | Ga0105238_10005908 | Ga0105238_100059085 | 366 |
| 783 | 3300021320 | Ga0214544_1000079 | Ga0214544_100007998 | 366 |
| 784 | 3300021321 | Ga0214542_1000064 | Ga0214542_1000064102 | 366 |
| 785 | 3300021321 | Ga0214542_1014176 | Ga0214542_10141765 | 366 |
| 786 | 3300021327 | Ga0214543_1000015 | Ga0214543_1000015155 | 366 |
| 787 | 3300021327 | Ga0214543_1000063 | Ga0214543_100006310 | 366 |
| 788 | 3300022739 | Ga0228711_1000004 | Ga0228711_1000004198 | 366 |
| 789 | 3300022740 | Ga0228710_1000002 | Ga0228710_1000002146 | 366 |
| 790 | 3300025208 | Ga0209436_105669 | Ga0209436_1056692 | 366 |
| 791 | 3300025284 | Ga0209130_1000027 | Ga0209130_1000027302 | 366 |
| 792 | 3300025292 | Ga0209676_1003791 | Ga0209676_10037918 | 366 |
| 793 | 3300025294 | Ga0209025_1000591 | Ga0209025_100059115 | 366 |
| 794 | 3300025295 | Ga0209564_1000193 | Ga0209564_100019338 | 366 |
| 795 | 3300025297 | Ga0209758_1022648 | Ga0209758_10226482 | 366 |
| 796 | 3300025299 | Ga0209256_1001680 | Ga0209256_10016804 | 366 |
| 797 | 3300025302 | Ga0207426_1000072 | Ga0207426_100007214 | 366 |
| 798 | 3300025304 | Ga0209257_1007258 | Ga0209257_10072586 | 366 |
| 799 | 3300025920 | Ga0207649_10066866 | Ga0207649_100668662 | 366 |
| 800 | 3300025924 | Ga0207694_10039302 | Ga0207694_100393023 | 366 |
| 801 | 3300026078 | Ga0207702_10031816 | Ga0207702_100318163 | 366 |
| 802 | 3300027111 | Ga0209281_1000030 | Ga0209281_1000030113 | 366 |
| 803 | 3300027111 | Ga0209281_1000144 | Ga0209281_100014474 | 366 |
| 804 | 3300027666 | Ga0209282_1000004 | Ga0209282_1000004113 | 366 |
| 805 | 3300028794 | Ga0307515_10013300 | Ga0307515_1001330011 | 366 |
| 806 | 3300031967 | Ga0315914_1000001 | Ga0315914_1000001270 | 366 |
| 807 | 3300031995 | Ga0307409_100154992 | Ga0307409_1001549922 | 366 |
| 808 | 3300032004 | Ga0307414_10087297 | Ga0307414_100872971 | 366 |
| 809 | 3300033430 | Ga0315913_1000004 | Ga0315913_100000431 | 366 |
| 810 | 3300033464 | Ga0315915_1000002 | Ga0315915_1000002114 | 366 |
| 811 | 3300039438 | Ga0436360_1023635 | Ga0436360_1023635_877_1983 | 366 |
| 812 | 3300041404 | Ga0439436_0002384 | Ga0439436_0002384_4026_5138 | 366 |
| 813 | 3300041406 | Ga0439439_0005514 | Ga0439439_0005514_1760_2872 | 366 |
| 814 | 3300042010 | Ga0439452_025987 | Ga0439452_025987_332_1444 | 366 |
| 815 | 3300045049 | Ga0466959_0105573 | Ga0466959_0105573_339_1445 | 366 |
| 816 | 3300045836 | Ga0466958_0057519 | Ga0466958_0057519_413_1519 | 366 |
| 817 | 3300046506 | Ga0495583_0014902 | Ga0495583_0014902_299_1411 | 366 |
| 818 | 3300046507 | Ga0495606_0012400 | Ga0495606_0012400_5676_6788 | 366 |
| 819 | 3300048924 | Ga0496121_0014935 | Ga0496121_0014935_524_1627 | 366 |
| 820 | 3300048924 | Ga0496121_0035736 | Ga0496121_0035736_2697_3809 | 366 |
| 821 | 3300059493 | Ga0587077_019916 | Ga0587077_019916_46_1149 | 366 |
| 822 | 3300002704 | JGI25155J39150_1000017 | JGI25155J39150_1000017100 | 367 |
| 823 | 3300002705 | JGI25156J39149_1000034 | JGI25156J39149_100003411 | 367 |
| 824 | 3300002737 | JGI25162J39368_1001729 | JGI25162J39368_10017296 | 367 |
| 825 | 3300002738 | JGI25154J39366_1000034 | JGI25154J39366_100003470 | 367 |
| 826 | 3300002739 | JGI25158J39367_1000032 | JGI25158J39367_100003224 | 367 |
| 827 | 3300002741 | JGI25157J39369_1000137 | JGI25157J39369_100013736 | 367 |
| 828 | 3300002773 | JGI25152J39213_1001331 | JGI25152J39213_10013319 | 367 |
| 829 | 3300002773 | JGI25152J39213_1004173 | JGI25152J39213_10041733 | 367 |
| 830 | 3300002773 | JGI25152J39213_1004522 | JGI25152J39213_10045223 | 367 |
| 831 | 3300002774 | JGI25150J39212_1000093 | JGI25150J39212_10000936 | 367 |
| 832 | 3300002774 | JGI25150J39212_1004918 | JGI25150J39212_10049182 | 367 |
| 833 | 3300002987 | JGI25159J45721_1000123 | JGI25159J45721_100012320 | 367 |
| 834 | 3300002987 | JGI25159J45721_1001871 | JGI25159J45721_10018712 | 367 |
| 835 | 3300003187 | JGI25151J46595_10000007 | JGI25151J46595_10000007216 | 367 |
| 836 | 3300003187 | JGI25151J46595_10002246 | JGI25151J46595_100022468 | 367 |
| 837 | 3300003187 | JGI25151J46595_10004050 | JGI25151J46595_100040501 | 367 |
| 838 | 3300003187 | JGI25151J46595_10008237 | JGI25151J46595_100082372 | 367 |
| 839 | 3300003214 | JGI25165J46597_1000821 | JGI25165J46597_100082110 | 367 |
| 840 | 3300003215 | JGI25153J46596_10004193 | JGI25153J46596_100041936 | 367 |
| 841 | 3300003215 | JGI25153J46596_10005439 | JGI25153J46596_100054392 | 367 |
| 842 | 3300003215 | JGI25153J46596_10008984 | JGI25153J46596_100089844 | 367 |
| 843 | 3300003215 | JGI25153J46596_10009234 | JGI25153J46596_100092343 | 367 |
| 844 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_1000006265 | 367 |
| 845 | 3300003354 | JGI25160J50197_1007119 | JGI25160J50197_10071194 | 367 |
| 846 | 3300003354 | JGI25160J50197_1007183 | JGI25160J50197_10071833 | 367 |
| 847 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_1000004265 | 367 |
| 848 | 3300003374 | JGI25161J50226_1000129 | JGI25161J50226_100012928 | 367 |
| 849 | 3300003578 | Ga0006562J51391_1007525 | Ga0006562J51391_10075254 | 367 |
| 850 | 3300003771 | Ga0055526_1009740 | Ga0055526_10097402 | 367 |
| 851 | 3300003771 | Ga0055526_1021898 | Ga0055526_10218982 | 367 |
| 852 | 3300003775 | Ga0055524_1000873 | Ga0055524_10008736 | 367 |
| 853 | 3300003775 | Ga0055524_1016513 | Ga0055524_10165132 | 367 |
| 854 | 3300003790 | Ga0055528_1000186 | Ga0055528_100018639 | 367 |
| 855 | 3300003790 | Ga0055528_1014982 | Ga0055528_10149823 | 367 |
| 856 | 3300003792 | Ga0055540_1004099 | Ga0055540_10040992 | 367 |
| 857 | 3300004625 | Ga0055543_1000002 | Ga0055543_100000270 | 367 |
| 858 | 3300004625 | Ga0055543_1000029 | Ga0055543_100002997 | 367 |
| 859 | 3300005262 | Ga0065165_1000341 | Ga0065165_10003415 | 367 |
| 860 | 3300005262 | Ga0065165_1020856 | Ga0065165_10208561 | 367 |
| 861 | 3300005262 | Ga0065165_1047781 | Ga0065165_10477811 | 367 |
| 862 | 3300005335 | Ga0070666_10016166 | Ga0070666_100161662 | 367 |
| 863 | 3300005339 | Ga0070660_100005489 | Ga0070660_1000054896 | 367 |
| 864 | 3300005339 | Ga0070660_100008737 | Ga0070660_1000087372 | 367 |
| 865 | 3300005347 | Ga0070668_100011445 | Ga0070668_1000114455 | 367 |
| 866 | 3300005355 | Ga0070671_100024553 | Ga0070671_1000245535 | 367 |
| 867 | 3300005455 | Ga0070663_100061703 | Ga0070663_1000617033 | 367 |
| 868 | 3300005457 | Ga0070662_100031433 | Ga0070662_1000314331 | 367 |
| 869 | 3300005466 | Ga0070685_10101656 | Ga0070685_101016562 | 367 |
| 870 | 3300005467 | Ga0070706_100102693 | Ga0070706_1001026933 | 367 |
| 871 | 3300005536 | Ga0070697_100018053 | Ga0070697_1000180535 | 367 |
| 872 | 3300005563 | Ga0068855_100026237 | Ga0068855_1000262374 | 367 |
| 873 | 3300005563 | Ga0068855_100085523 | Ga0068855_1000855233 | 367 |
| 874 | 3300005563 | Ga0068855_100279615 | Ga0068855_1002796151 | 367 |
| 875 | 3300005614 | Ga0068856_100267704 | Ga0068856_1002677042 | 367 |
| 876 | 3300005719 | Ga0068861_100146643 | Ga0068861_1001466432 | 367 |
| 877 | 3300005844 | Ga0068862_100164631 | Ga0068862_1001646312 | 367 |
| 878 | 3300005983 | Ga0081540_1002724 | Ga0081540_10027243 | 367 |
| 879 | 3300006038 | Ga0075365_10017568 | Ga0075365_100175684 | 367 |
| 880 | 3300006175 | Ga0070712_100015177 | Ga0070712_1000151772 | 367 |
| 881 | 3300006178 | Ga0075367_10006691 | Ga0075367_100066914 | 367 |
| 882 | 3300006178 | Ga0075367_10020528 | Ga0075367_100205282 | 367 |
| 883 | 3300006186 | Ga0075369_10001249 | Ga0075369_100012492 | 367 |
| 884 | 3300006186 | Ga0075369_10004629 | Ga0075369_100046293 | 367 |
| 885 | 3300006195 | Ga0075366_10028154 | Ga0075366_100281543 | 367 |
| 886 | 3300006353 | Ga0075370_10064590 | Ga0075370_100645902 | 367 |
| 887 | 3300006847 | Ga0075431_100014366 | Ga0075431_1000143665 | 367 |
| 888 | 3300009011 | Ga0105251_10001618 | Ga0105251_1000161817 | 367 |
| 889 | 3300009036 | Ga0105244_10020973 | Ga0105244_100209732 | 367 |
| 890 | 3300009093 | Ga0105240_10000216 | Ga0105240_1000021613 | 367 |
| 891 | 3300009098 | Ga0105245_10194629 | Ga0105245_101946292 | 367 |
| 892 | 3300009147 | Ga0114129_10016902 | Ga0114129_100169025 | 367 |
| 893 | 3300009177 | Ga0105248_10072915 | Ga0105248_100729151 | 367 |
| 894 | 3300009545 | Ga0105237_10000536 | Ga0105237_1000053641 | 367 |
| 895 | 3300009553 | Ga0105249_10034408 | Ga0105249_100344081 | 367 |
| 896 | 3300009766 | Ga0123342_1002765 | Ga0123342_100276525 | 367 |
| 897 | 3300010375 | Ga0105239_10048123 | Ga0105239_100481234 | 367 |
| 898 | 3300012490 | Ga0157322_1000019 | Ga0157322_10000192 | 367 |
| 899 | 3300013104 | Ga0157370_10000183 | Ga0157370_100001837 | 367 |
| 900 | 3300013249 | Ga0171463_1004 | Ga0171463_1004278 | 367 |
| 901 | 3300015262 | Ga0182007_10001098 | Ga0182007_100010988 | 367 |
| 902 | 3300015265 | Ga0182005_1004037 | Ga0182005_10040372 | 367 |
| 903 | 3300015265 | Ga0182005_1017068 | Ga0182005_10170682 | 367 |
| 904 | 3300015690 | Ga0183363_1117 | Ga0183363_11176 | 367 |
| 905 | 3300021361 | Ga0213872_10010481 | Ga0213872_100104815 | 367 |
| 906 | 3300021361 | Ga0213872_10031082 | Ga0213872_100310822 | 367 |
| 907 | 3300021361 | Ga0213872_10046881 | Ga0213872_100468811 | 367 |
| 908 | 3300021384 | Ga0213876_10002106 | Ga0213876_100021065 | 367 |
| 909 | 3300021441 | Ga0213871_10001938 | Ga0213871_100019383 | 367 |
| 910 | 3300025206 | Ga0209435_100023 | Ga0209435_10002397 | 367 |
| 911 | 3300025208 | Ga0209436_100026 | Ga0209436_10002658 | 367 |
| 912 | 3300025233 | Ga0209437_100023 | Ga0209437_100023280 | 367 |
| 913 | 3300025245 | Ga0207425_1000018 | Ga0207425_1000018118 | 367 |
| 914 | 3300025245 | Ga0207425_1001182 | Ga0207425_100118211 | 367 |
| 915 | 3300025245 | Ga0207425_1007116 | Ga0207425_10071162 | 367 |
| 916 | 3300025246 | Ga0209646_1000080 | Ga0209646_100008097 | 367 |
| 917 | 3300025250 | Ga0209026_1000076 | Ga0209026_100007697 | 367 |
| 918 | 3300025253 | Ga0209677_100216 | Ga0209677_1002161 | 367 |
| 919 | 3300025256 | Ga0209759_1000059 | Ga0209759_100005997 | 367 |
| 920 | 3300025258 | Ga0209129_1000026 | Ga0209129_1000026211 | 367 |
| 921 | 3300025258 | Ga0209129_1000203 | Ga0209129_100020310 | 367 |
| 922 | 3300025258 | Ga0209129_1000507 | Ga0209129_100050714 | 367 |
| 923 | 3300025258 | Ga0209129_1001741 | Ga0209129_10017414 | 367 |
| 924 | 3300025258 | Ga0209129_1003097 | Ga0209129_10030974 | 367 |
| 925 | 3300025258 | Ga0209129_1005338 | Ga0209129_10053382 | 367 |
| 926 | 3300025258 | Ga0209129_1007119 | Ga0209129_10071193 | 367 |
| 927 | 3300025261 | Ga0209233_1000062 | Ga0209233_1000062195 | 367 |
| 928 | 3300025261 | Ga0209233_1000428 | Ga0209233_100042810 | 367 |
| 929 | 3300025273 | Ga0209673_1000037 | Ga0209673_100003710 | 367 |
| 930 | 3300025273 | Ga0209673_1003018 | Ga0209673_10030182 | 367 |
| 931 | 3300025273 | Ga0209673_1006039 | Ga0209673_10060392 | 367 |
| 932 | 3300025273 | Ga0209673_1016820 | Ga0209673_10168201 | 367 |
| 933 | 3300025284 | Ga0209130_1000030 | Ga0209130_100003029 | 367 |
| 934 | 3300025284 | Ga0209130_1000032 | Ga0209130_1000032256 | 367 |
| 935 | 3300025284 | Ga0209130_1004603 | Ga0209130_10046031 | 367 |
| 936 | 3300025292 | Ga0209676_1000026 | Ga0209676_1000026480 | 367 |
| 937 | 3300025292 | Ga0209676_1029819 | Ga0209676_10298192 | 367 |
| 938 | 3300025294 | Ga0209025_1000035 | Ga0209025_1000035211 | 367 |
| 939 | 3300025294 | Ga0209025_1000052 | Ga0209025_1000052254 | 367 |
| 940 | 3300025294 | Ga0209025_1001447 | Ga0209025_100144710 | 367 |
| 941 | 3300025294 | Ga0209025_1002696 | Ga0209025_100269610 | 367 |
| 942 | 3300025294 | Ga0209025_1005002 | Ga0209025_10050022 | 367 |
| 943 | 3300025294 | Ga0209025_1012317 | Ga0209025_10123174 | 367 |
| 944 | 3300025294 | Ga0209025_1012720 | Ga0209025_10127204 | 367 |
| 945 | 3300025294 | Ga0209025_1027546 | Ga0209025_10275463 | 367 |
| 946 | 3300025295 | Ga0209564_1000207 | Ga0209564_1000207100 | 367 |
| 947 | 3300025295 | Ga0209564_1000379 | Ga0209564_100037947 | 367 |
| 948 | 3300025295 | Ga0209564_1012022 | Ga0209564_10120222 | 367 |
| 949 | 3300025295 | Ga0209564_1034858 | Ga0209564_10348582 | 367 |
| 950 | 3300025297 | Ga0209758_1000040 | Ga0209758_1000040211 | 367 |
| 951 | 3300025297 | Ga0209758_1000586 | Ga0209758_100058623 | 367 |
| 952 | 3300025297 | Ga0209758_1000906 | Ga0209758_100090615 | 367 |
| 953 | 3300025297 | Ga0209758_1001057 | Ga0209758_100105715 | 367 |
| 954 | 3300025297 | Ga0209758_1035653 | Ga0209758_10356531 | 367 |
| 955 | 3300025298 | Ga0209050_1015956 | Ga0209050_10159561 | 367 |
| 956 | 3300025298 | Ga0209050_1018518 | Ga0209050_10185183 | 367 |
| 957 | 3300025299 | Ga0209256_1000343 | Ga0209256_10003432 | 367 |
| 958 | 3300025299 | Ga0209256_1000893 | Ga0209256_100089310 | 367 |
| 959 | 3300025299 | Ga0209256_1000943 | Ga0209256_100094317 | 367 |
| 960 | 3300025299 | Ga0209256_1001510 | Ga0209256_100151012 | 367 |
| 961 | 3300025299 | Ga0209256_1028022 | Ga0209256_10280221 | 367 |
| 962 | 3300025302 | Ga0207426_1000047 | Ga0207426_1000047371 | 367 |
| 963 | 3300025302 | Ga0207426_1000077 | Ga0207426_1000077256 | 367 |
| 964 | 3300025302 | Ga0207426_1000094 | Ga0207426_1000094264 | 367 |
| 965 | 3300025302 | Ga0207426_1004911 | Ga0207426_10049111 | 367 |
| 966 | 3300025303 | Ga0209051_1005642 | Ga0209051_10056422 | 367 |
| 967 | 3300025303 | Ga0209051_1006175 | Ga0209051_10061752 | 367 |
| 968 | 3300025303 | Ga0209051_1029156 | Ga0209051_10291562 | 367 |
| 969 | 3300025303 | Ga0209051_1036723 | Ga0209051_10367232 | 367 |
| 970 | 3300025304 | Ga0209257_1004341 | Ga0209257_10043418 | 367 |
| 971 | 3300025304 | Ga0209257_1027515 | Ga0209257_10275152 | 367 |
| 972 | 3300025735 | Ga0207713_1030896 | Ga0207713_10308961 | 367 |
| 973 | 3300025898 | Ga0207692_10073388 | Ga0207692_100733882 | 367 |
| 974 | 3300025903 | Ga0207680_10054909 | Ga0207680_100549091 | 367 |
| 975 | 3300025909 | Ga0207705_10005139 | Ga0207705_100051395 | 367 |
| 976 | 3300025910 | Ga0207684_10018600 | Ga0207684_100186001 | 367 |
| 977 | 3300025913 | Ga0207695_10000319 | Ga0207695_1000031990 | 367 |
| 978 | 3300025914 | Ga0207671_10000078 | Ga0207671_1000007890 | 367 |
| 979 | 3300025919 | Ga0207657_10000364 | Ga0207657_1000036447 | 367 |
| 980 | 3300025919 | Ga0207657_10007827 | Ga0207657_100078278 | 367 |
| 981 | 3300025922 | Ga0207646_10131280 | Ga0207646_101312802 | 367 |
| 982 | 3300025933 | Ga0207706_10047804 | Ga0207706_100478044 | 367 |
| 983 | 3300025941 | Ga0207711_10016459 | Ga0207711_100164596 | 367 |
| 984 | 3300025949 | Ga0207667_10086550 | Ga0207667_100865503 | 367 |
| 985 | 3300025949 | Ga0207667_10134289 | Ga0207667_101342893 | 367 |
| 986 | 3300025961 | Ga0207712_10052957 | Ga0207712_100529571 | 367 |
| 987 | 3300025972 | Ga0207668_10027489 | Ga0207668_100274893 | 367 |
| 988 | 3300025981 | Ga0207640_10260119 | Ga0207640_102601192 | 367 |
| 989 | 3300025986 | Ga0207658_10113575 | Ga0207658_101135751 | 367 |
| 990 | 3300026067 | Ga0207678_10021567 | Ga0207678_100215674 | 367 |
| 991 | 3300026067 | Ga0207678_10082023 | Ga0207678_100820232 | 367 |
| 992 | 3300027866 | Ga0209813_10003842 | Ga0209813_100038422 | 367 |
| 993 | 3300028379 | Ga0268266_10180066 | Ga0268266_101800662 | 367 |
| 994 | 3300028794 | Ga0307515_10033162 | Ga0307515_100331627 | 367 |
| 995 | 3300028794 | Ga0307515_10089826 | Ga0307515_100898262 | 367 |
| 996 | 3300028794 | Ga0307515_10166444 | Ga0307515_101664442 | 367 |
| 997 | 3300031456 | Ga0307513_10020228 | Ga0307513_100202286 | 367 |
| 998 | 3300031456 | Ga0307513_10037125 | Ga0307513_100371255 | 367 |
| 999 | 3300031456 | Ga0307513_10134374 | Ga0307513_101343742 | 367 |
| 1000 | 3300031731 | Ga0307405_10010861 | Ga0307405_100108613 | 367 |
| 1001 | 3300031901 | Ga0307406_10011730 | Ga0307406_100117303 | 367 |
| 1002 | 3300031901 | Ga0307406_10048916 | Ga0307406_100489162 | 367 |
| 1003 | 3300031911 | Ga0307412_10005001 | Ga0307412_100050016 | 367 |
| 1004 | 3300033180 | Ga0307510_10223121 | Ga0307510_102231211 | 367 |
| 1005 | 3300035695 | Ga0373927_0019135 | Ga0373927_0019135_3082_4197 | 367 |
| 1006 | 3300037471 | Ga0395905_0000328 | Ga0395905_0000328_3163_4278 | 367 |
| 1007 | 3300037471 | Ga0395905_0116208 | Ga0395905_0116208_65_1180 | 367 |
| 1008 | 3300037853 | Ga0436364_1103499 | Ga0436364_1103499_131_1240 | 367 |
| 1009 | 3300038443 | Ga0395901_0146933 | Ga0395901_0146933_845_1951 | 367 |
| 1010 | 3300039062 | Ga0400483_190117 | Ga0400483_190117_345_1460 | 367 |
| 1011 | 3300039437 | Ga0436365_1772086 | Ga0436365_1772086_29308_30417 | 367 |
| 1012 | 3300039438 | Ga0436360_0402304 | Ga0436360_0402304_101_1210 | 367 |
| 1013 | 3300039447 | Ga0436361_0546753 | Ga0436361_0546753_359_1468 | 367 |
| 1014 | 3300039447 | Ga0436361_0626061 | Ga0436361_0626061_79_1203 | 367 |
| 1015 | 3300039447 | Ga0436361_1014632 | Ga0436361_1014632_20_1129 | 367 |
| 1016 | 3300039447 | Ga0436361_1173504 | Ga0436361_1173504_9156_10265 | 367 |
| 1017 | 3300039453 | Ga0436362_0741073 | Ga0436362_0741073_833_1942 | 367 |
| 1018 | 3300041451 | Ga0451791_0837071 | Ga0451791_0837071_29_1144 | 367 |
| 1019 | 3300041503 | Ga0451847_0087747 | Ga0451847_0087747_311_1426 | 367 |
| 1020 | 3300044901 | Ga0466960_0010694 | Ga0466960_0010694_1726_2841 | 367 |
| 1021 | 3300046457 | Ga0495590_0056563 | Ga0495590_0056563_170_1285 | 367 |
| 1022 | 3300046460 | Ga0495638_0020323 | Ga0495638_0020323_3202_4317 | 367 |
| 1023 | 3300046506 | Ga0495583_0038412 | Ga0495583_0038412_264_1379 | 367 |
| 1024 | 3300046507 | Ga0495606_0023785 | Ga0495606_0023785_1261_2376 | 367 |
| 1025 | 3300046512 | Ga0495610_0090074 | Ga0495610_0090074_176_1294 | 367 |
| 1026 | 3300046515 | Ga0495620_0036984 | Ga0495620_0036984_148_1263 | 367 |
| 1027 | 3300046518 | Ga0495631_0041670 | Ga0495631_0041670_732_1847 | 367 |
| 1028 | 3300046519 | Ga0495632_0052400 | Ga0495632_0052400_587_1702 | 367 |
| 1029 | 3300046522 | Ga0495643_0007132 | Ga0495643_0007132_2570_3685 | 367 |
| 1030 | 3300046523 | Ga0495644_0043159 | Ga0495644_0043159_461_1576 | 367 |
| 1031 | 3300046558 | Ga0495633_0088317 | Ga0495633_0088317_98_1213 | 367 |
| 1032 | 3300046691 | Ga0495670_0031251 | Ga0495670_0031251_719_1837 | 367 |
| 1033 | 3300046694 | Ga0495649_0156001 | Ga0495649_0156001_41_1159 | 367 |
| 1034 | 3300047323 | Ga0495683_0040527 | Ga0495683_0040527_862_1977 | 367 |
| 1035 | 3300047472 | Ga0495686_0078144 | Ga0495686_0078144_761_1876 | 367 |
| 1036 | 3300048091 | Ga0495626_0090436 | Ga0495626_0090436_16_1131 | 367 |
| 1037 | 3300048903 | Ga0496100_0030431 | Ga0496100_0030431_2195_3310 | 367 |
| 1038 | 3300048903 | Ga0496100_0143516 | Ga0496100_0143516_84_1199 | 367 |
| 1039 | 3300048904 | Ga0496101_0215283 | Ga0496101_0215283_88_1203 | 367 |
| 1040 | 3300048906 | Ga0496103_0030754 | Ga0496103_0030754_791_1906 | 367 |
| 1041 | 3300048906 | Ga0496103_0146721 | Ga0496103_0146721_80_1195 | 367 |
| 1042 | 3300048907 | Ga0496104_0398004 | Ga0496104_0398004_121_1236 | 367 |
| 1043 | 3300048909 | Ga0496106_0001119 | Ga0496106_0001119_1277_2392 | 367 |
| 1044 | 3300048909 | Ga0496106_0162318 | Ga0496106_0162318_214_1329 | 367 |
| 1045 | 3300048913 | Ga0496110_0182863 | Ga0496110_0182863_666_1781 | 367 |
| 1046 | 3300048914 | Ga0496111_0006067 | Ga0496111_0006067_87_1202 | 367 |
| 1047 | 3300048919 | Ga0496116_0000707 | Ga0496116_0000707_41078_42193 | 367 |
| 1048 | 3300048919 | Ga0496116_0003524 | Ga0496116_0003524_3187_4302 | 367 |
| 1049 | 3300048919 | Ga0496116_0107170 | Ga0496116_0107170_432_1547 | 367 |
| 1050 | 3300048919 | Ga0496116_0133490 | Ga0496116_0133490_80_1195 | 367 |
| 1051 | 3300048920 | Ga0496117_0001125 | Ga0496117_0001125_4389_5504 | 367 |
| 1052 | 3300048920 | Ga0496117_0002658 | Ga0496117_0002658_19983_21098 | 367 |
| 1053 | 3300048920 | Ga0496117_0003841 | Ga0496117_0003841_5460_6575 | 367 |
| 1054 | 3300048920 | Ga0496117_0054371 | Ga0496117_0054371_1152_2267 | 367 |
| 1055 | 3300048920 | Ga0496117_0082726 | Ga0496117_0082726_761_1876 | 367 |
| 1056 | 3300048921 | Ga0496118_0000844 | Ga0496118_0000844_14367_15482 | 367 |
| 1057 | 3300048921 | Ga0496118_0005841 | Ga0496118_0005841_4458_5573 | 367 |
| 1058 | 3300048921 | Ga0496118_0039560 | Ga0496118_0039560_2065_3180 | 367 |
| 1059 | 3300048921 | Ga0496118_0044496 | Ga0496118_0044496_2274_3389 | 367 |
| 1060 | 3300048922 | Ga0496119_0005065 | Ga0496119_0005065_2490_3605 | 367 |
| 1061 | 3300048922 | Ga0496119_0010985 | Ga0496119_0010985_6171_7289 | 367 |
| 1062 | 3300048922 | Ga0496119_0011556 | Ga0496119_0011556_2382_3497 | 367 |
| 1063 | 3300048922 | Ga0496119_0014637 | Ga0496119_0014637_1862_2977 | 367 |
| 1064 | 3300048922 | Ga0496119_0156988 | Ga0496119_0156988_65_1180 | 367 |
| 1065 | 3300048923 | Ga0496120_0003021 | Ga0496120_0003021_3315_4430 | 367 |
| 1066 | 3300048923 | Ga0496120_0005096 | Ga0496120_0005096_6328_7443 | 367 |
| 1067 | 3300048924 | Ga0496121_0003319 | Ga0496121_0003319_4202_5320 | 367 |
| 1068 | 3300048924 | Ga0496121_0006713 | Ga0496121_0006713_1142_2257 | 367 |
| 1069 | 3300048924 | Ga0496121_0034582 | Ga0496121_0034582_1046_2161 | 367 |
| 1070 | 3300048925 | Ga0496122_0000024 | Ga0496122_0000024_98233_99348 | 367 |
| 1071 | 3300048925 | Ga0496122_0005156 | Ga0496122_0005156_13047_14162 | 367 |
| 1072 | 3300048925 | Ga0496122_0006309 | Ga0496122_0006309_9161_10276 | 367 |
| 1073 | 3300048925 | Ga0496122_0016334 | Ga0496122_0016334_2565_3680 | 367 |
| 1074 | 3300048925 | Ga0496122_0020333 | Ga0496122_0020333_4271_5386 | 367 |
| 1075 | 3300048925 | Ga0496122_0044170 | Ga0496122_0044170_2262_3377 | 367 |
| 1076 | 3300048926 | Ga0496123_0000086 | Ga0496123_0000086_21832_22947 | 367 |
| 1077 | 3300048926 | Ga0496123_0006124 | Ga0496123_0006124_10395_11510 | 367 |
| 1078 | 3300048926 | Ga0496123_0012365 | Ga0496123_0012365_2281_3396 | 367 |
| 1079 | 3300048926 | Ga0496123_0022089 | Ga0496123_0022089_3493_4608 | 367 |
| 1080 | 3300048927 | Ga0496124_0000488 | Ga0496124_0000488_2272_3387 | 367 |
| 1081 | 3300048927 | Ga0496124_0001118 | Ga0496124_0001118_20213_21328 | 367 |
| 1082 | 3300048927 | Ga0496124_0011653 | Ga0496124_0011653_3044_4159 | 367 |
| 1083 | 3300048927 | Ga0496124_0026404 | Ga0496124_0026404_3677_4792 | 367 |
| 1084 | 3300048927 | Ga0496124_0052092 | Ga0496124_0052092_562_1677 | 367 |
| 1085 | 3300048927 | Ga0496124_0072685 | Ga0496124_0072685_1584_2699 | 367 |
| 1086 | 3300048928 | Ga0496125_0000134 | Ga0496125_0000134_139142_140257 | 367 |
| 1087 | 3300048928 | Ga0496125_0002416 | Ga0496125_0002416_1871_2986 | 367 |
| 1088 | 3300048928 | Ga0496125_0003868 | Ga0496125_0003868_15291_16406 | 367 |
| 1089 | 3300048928 | Ga0496125_0031557 | Ga0496125_0031557_2667_3782 | 367 |
| 1090 | 3300048928 | Ga0496125_0123800 | Ga0496125_0123800_684_1799 | 367 |
| 1091 | 3300048928 | Ga0496125_0130908 | Ga0496125_0130908_434_1549 | 367 |
| 1092 | 3300048929 | Ga0496126_0000434 | Ga0496126_0000434_71629_72744 | 367 |
| 1093 | 3300048929 | Ga0496126_0017199 | Ga0496126_0017199_106_1221 | 367 |
| 1094 | 3300048929 | Ga0496126_0043674 | Ga0496126_0043674_841_1956 | 367 |
| 1095 | 3300048929 | Ga0496126_0141609 | Ga0496126_0141609_893_2008 | 367 |
| 1096 | 3300048929 | Ga0496126_0243967 | Ga0496126_0243967_159_1274 | 367 |
| 1097 | 3300049568 | Ga0501031_0016746 | Ga0501031_0016746_438_1556 | 367 |
| 1098 | 3300049569 | Ga0501032_0000219 | Ga0501032_0000219_44349_45467 | 367 |
| 1099 | 3300049569 | Ga0501032_0023515 | Ga0501032_0023515_1267_2382 | 367 |
| 1100 | 3300049570 | Ga0501033_0000126 | Ga0501033_0000126_28800_29918 | 367 |
| 1101 | 3300049571 | Ga0501034_0000012 | Ga0501034_0000012_249336_250451 | 367 |
| 1102 | 3300049571 | Ga0501034_0002949 | Ga0501034_0002949_1857_2975 | 367 |
| 1103 | 3300049571 | Ga0501034_0074210 | Ga0501034_0074210_1724_2839 | 367 |
| 1104 | 3300049571 | Ga0501034_0143480 | Ga0501034_0143480_47_1153 | 367 |
| 1105 | 3300049571 | Ga0501034_0156211 | Ga0501034_0156211_162_1277 | 367 |
| 1106 | 3300049571 | Ga0501034_0202959 | Ga0501034_0202959_323_1438 | 367 |
| 1107 | 3300049571 | Ga0501034_0206490 | Ga0501034_0206490_389_1504 | 367 |
| 1108 | 3300049572 | Ga0501036_0000483 | Ga0501036_0000483_16713_17831 | 367 |
| 1109 | 3300049572 | Ga0501036_0161458 | Ga0501036_0161458_367_1482 | 367 |
| 1110 | 3300049573 | Ga0501037_0000021 | Ga0501037_0000021_20136_21254 | 367 |
| 1111 | 3300049574 | Ga0501038_0000032 | Ga0501038_0000032_1857_2975 | 367 |
| 1112 | 3300049575 | Ga0501039_0000025 | Ga0501039_0000025_16126_17244 | 367 |
| 1113 | 3300049575 | Ga0501039_0065397 | Ga0501039_0065397_787_1902 | 367 |
| 1114 | 3300049576 | Ga0501040_0073929 | Ga0501040_0073929_413_1528 | 367 |
| 1115 | 3300049579 | Ga0501043_0000015 | Ga0501043_0000015_16746_17864 | 367 |
| 1116 | 3300049579 | Ga0501043_0009591 | Ga0501043_0009591_45_1160 | 367 |
| 1117 | 3300049579 | Ga0501043_0246376 | Ga0501043_0246376_217_1323 | 367 |
| 1118 | 3300049580 | Ga0501046_0033565 | Ga0501046_0033565_747_1862 | 367 |
| 1119 | 3300049581 | Ga0501047_0035472 | Ga0501047_0035472_607_1713 | 367 |
| 1120 | 3300049589 | Ga0501073_0086263 | Ga0501073_0086263_664_1779 | 367 |
| 1121 | 3300049590 | Ga0501074_0074913 | Ga0501074_0074913_421_1536 | 367 |
| 1122 | 3300049591 | Ga0501075_0058420 | Ga0501075_0058420_934_2049 | 367 |
| 1123 | 3300049592 | Ga0501076_0016026 | Ga0501076_0016026_1779_2894 | 367 |
| 1124 | 3300049593 | Ga0501077_0008186 | Ga0501077_0008186_866_1981 | 367 |
| 1125 | 3300049741 | Ga0501079_0041947 | Ga0501079_0041947_744_1859 | 367 |
| 1126 | 3300049743 | Ga0501081_0016810 | Ga0501081_0016810_2888_4003 | 367 |
| 1127 | 3300049744 | Ga0501083_0124136 | Ga0501083_0124136_317_1432 | 367 |
| 1128 | 3300049822 | Ga0501035_0000436 | Ga0501035_0000436_28992_30110 | 367 |
| 1129 | 3300049822 | Ga0501035_0097249 | Ga0501035_0097249_1191_2306 | 367 |
| 1130 | 3300049823 | Ga0501044_0007432 | Ga0501044_0007432_1194_2300 | 367 |
| 1131 | 3300049823 | Ga0501044_0061715 | Ga0501044_0061715_2638_3753 | 367 |
| 1132 | 3300049823 | Ga0501044_0151769 | Ga0501044_0151769_517_1632 | 367 |
| 1133 | 3300049823 | Ga0501044_0348212 | Ga0501044_0348212_229_1344 | 367 |
| 1134 | 3300049824 | Ga0501045_0033979 | Ga0501045_0033979_1851_2966 | 367 |
| 1135 | 3300050492 | nmdc:mga0yw44_105419_c1 | nmdc:mga0yw44_105419_c1_220_1335 | 367 |
| 1136 | 3300050507 | nmdc:mga05p37_47923_c1 | nmdc:mga05p37_47923_c1_1651_2766 | 367 |
| 1137 | 3300050510 | nmdc:mga06r32_7328_c1 | nmdc:mga06r32_7328_c1_2244_3359 | 367 |
| 1138 | 3300053086 | Ga0500578_0036800 | Ga0500578_0036800_1044_2159 | 367 |
| 1139 | 3300053129 | Ga0500628_024616 | Ga0500628_024616_82_1197 | 367 |
| 1140 | 3300053134 | Ga0500658_0054670 | Ga0500658_0054670_325_1440 | 367 |
| 1141 | 3300053136 | Ga0500559_0003318 | Ga0500559_0003318_4809_5924 | 367 |
| 1142 | 3300053136 | Ga0500559_0037943 | Ga0500559_0037943_226_1341 | 367 |
| 1143 | 3300053139 | Ga0500568_0000219 | Ga0500568_0000219_33800_34906 | 367 |
| 1144 | 3300053139 | Ga0500568_0009899 | Ga0500568_0009899_1172_2287 | 367 |
| 1145 | 3300053139 | Ga0500568_0027708 | Ga0500568_0027708_1162_2277 | 367 |
| 1146 | 3300053151 | Ga0500604_0012354 | Ga0500604_0012354_1044_2159 | 367 |
| 1147 | 3300053153 | Ga0500616_0015630 | Ga0500616_0015630_998_2104 | 367 |
| 1148 | 3300053156 | Ga0500622_0002427 | Ga0500622_0002427_7071_8186 | 367 |
| 1149 | 3300053156 | Ga0500622_0019077 | Ga0500622_0019077_180_1295 | 367 |
| 1150 | 3300053177 | Ga0500636_0123787 | Ga0500636_0123787_54_1169 | 367 |
| 1151 | 3300054114 | Ga0501084_0084380 | Ga0501084_0084380_654_1769 | 367 |
| 1152 | 3300060353 | Ga0501082_0054899 | Ga0501082_0054899_828_1943 | 367 |
| 1153 | 3300060353 | Ga0501082_0068353 | Ga0501082_0068353_769_1884 | 367 |
| 1154 | 3300002741 | JGI25157J39369_1000744 | JGI25157J39369_100074419 | 368 |
| 1155 | 3300003214 | JGI25165J46597_1001523 | JGI25165J46597_10015234 | 368 |
| 1156 | 3300003762 | Ga0055542_1000516 | Ga0055542_100051623 | 368 |
| 1157 | 3300005434 | Ga0070709_10002006 | Ga0070709_100020065 | 368 |
| 1158 | 3300005437 | Ga0070710_10004005 | Ga0070710_100040054 | 368 |
| 1159 | 3300005439 | Ga0070711_100075003 | Ga0070711_1000750032 | 368 |
| 1160 | 3300005445 | Ga0070708_100037445 | Ga0070708_1000374454 | 368 |
| 1161 | 3300005467 | Ga0070706_100111759 | Ga0070706_1001117592 | 368 |
| 1162 | 3300005468 | Ga0070707_100152678 | Ga0070707_1001526783 | 368 |
| 1163 | 3300005471 | Ga0070698_100005977 | Ga0070698_1000059776 | 368 |
| 1164 | 3300006175 | Ga0070712_100085714 | Ga0070712_1000857142 | 368 |
| 1165 | 3300009093 | Ga0105240_10256218 | Ga0105240_102562182 | 368 |
| 1166 | 3300009174 | Ga0105241_10009211 | Ga0105241_100092116 | 368 |
| 1167 | 3300009545 | Ga0105237_10001312 | Ga0105237_100013126 | 368 |
| 1168 | 3300009551 | Ga0105238_10053246 | Ga0105238_100532462 | 368 |
| 1169 | 3300010375 | Ga0105239_10003602 | Ga0105239_100036026 | 368 |
| 1170 | 3300010375 | Ga0105239_10135236 | Ga0105239_101352363 | 368 |
| 1171 | 3300013104 | Ga0157370_10198145 | Ga0157370_101981452 | 368 |
| 1172 | 3300013296 | Ga0157374_10041999 | Ga0157374_100419992 | 368 |
| 1173 | 3300013297 | Ga0157378_10179202 | Ga0157378_101792022 | 368 |
| 1174 | 3300021361 | Ga0213872_10026621 | Ga0213872_100266212 | 368 |
| 1175 | 3300025250 | Ga0209026_1000116 | Ga0209026_100011644 | 368 |
| 1176 | 3300025254 | Ga0209148_1000078 | Ga0209148_1000078182 | 368 |
| 1177 | 3300025256 | Ga0209759_1000153 | Ga0209759_100015379 | 368 |
| 1178 | 3300025261 | Ga0209233_1000488 | Ga0209233_100048810 | 368 |
| 1179 | 3300025898 | Ga0207692_10003598 | Ga0207692_100035983 | 368 |
| 1180 | 3300025906 | Ga0207699_10006930 | Ga0207699_100069302 | 368 |
| 1181 | 3300025913 | Ga0207695_10156628 | Ga0207695_101566282 | 368 |
| 1182 | 3300025914 | Ga0207671_10004703 | Ga0207671_100047034 | 368 |
| 1183 | 3300025916 | Ga0207663_10036590 | Ga0207663_100365902 | 368 |
| 1184 | 3300025919 | Ga0207657_10109199 | Ga0207657_101091992 | 368 |
| 1185 | 3300025939 | Ga0207665_10003339 | Ga0207665_100033394 | 368 |
| 1186 | 3300028379 | Ga0268266_10000606 | Ga0268266_1000060638 | 368 |
| 1187 | 3300031616 | Ga0307508_10163951 | Ga0307508_101639512 | 368 |
| 1188 | 3300033180 | Ga0307510_10204709 | Ga0307510_102047092 | 368 |
| 1189 | 3300037471 | Ga0395905_0116468 | Ga0395905_0116468_592_1701 | 368 |
| 1190 | 3300039437 | Ga0436365_1009141 | Ga0436365_1009141_255_1379 | 368 |
| 1191 | 3300039438 | Ga0436360_0800328 | Ga0436360_0800328_2283_3407 | 368 |
| 1192 | 3300039438 | Ga0436360_0934493 | Ga0436360_0934493_4240_5364 | 368 |
| 1193 | 3300039438 | Ga0436360_1270075 | Ga0436360_1270075_69_1193 | 368 |
| 1194 | 3300039438 | Ga0436360_1350032 | Ga0436360_1350032_332_1456 | 368 |
| 1195 | 3300039447 | Ga0436361_0048400 | Ga0436361_0048400_3264_4376 | 368 |
| 1196 | 3300039447 | Ga0436361_0715372 | Ga0436361_0715372_3533_4648 | 368 |
| 1197 | 3300039447 | Ga0436361_1195026 | Ga0436361_1195026_1241_2365 | 368 |
| 1198 | 3300046460 | Ga0495638_0143729 | Ga0495638_0143729_40_1146 | 368 |
| 1199 | 3300048929 | Ga0496126_0313509 | Ga0496126_0313509_94_1218 | 368 |
| 1200 | 3300050492 | nmdc:mga0yw44_49921_c2 | nmdc:mga0yw44_49921_c2_496_1602 | 368 |
| 1201 | 3300053177 | Ga0500636_0004433 | Ga0500636_0004433_1585_2694 | 368 |
| 1202 | 3300059508 | Ga0587088_005066 | Ga0587088_005066_182_1288 | 368 |
| 1203 | 3300048929 | Ga0496126_0017103 | Ga0496126_0017103_1712_2842 | 369 |
| 1204 | iso_pu_bacteria | 2876369609 | 2876371648 | 369 |
| 1205 | iso_pu_bacteria | 2881147464 | 2881149339 | 369 |
| 1206 | iso_pu_bacteria | 2885305155 | 2885307656 | 369 |
| 1207 | iso_pu_bacteria | 2885326080 | 2885333086 | 369 |
| 1208 | 3300001989 | JGI24739J22299_10014042 | JGI24739J22299_100140423 | 373 |
| 1209 | 3300005539 | Ga0068853_100033270 | Ga0068853_1000332704 | 373 |
| 1210 | 3300005563 | Ga0068855_100435867 | Ga0068855_1004358672 | 373 |
| 1211 | 3300005614 | Ga0068856_100066976 | Ga0068856_1000669762 | 373 |
| 1212 | 3300009545 | Ga0105237_10048283 | Ga0105237_100482831 | 373 |
| 1213 | 3300025904 | Ga0207647_10011076 | Ga0207647_100110762 | 373 |
| 1214 | 3300026116 | Ga0207674_10229856 | Ga0207674_102298562 | 373 |
| 1215 | 3300050494 | nmdc:mga06z11_23383_c1 | nmdc:mga06z11_23383_c1_1445_2566 | 373 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9551 | 9 | 238 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9527 | 9 | 373 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.945 | 9 | 373 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9418 | 7 | 222 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9391 | 9 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9842 | 9 | 222 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9766 | 8 | 220 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9684 | 9 | 240 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9683 | 9 | 242 | 3.40.50.300 |
| af_Q2G089_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9647 | 9 | 239 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9934 | 7 | 226 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A7X9BG07-F1-model_v4 | ABC transporter ATP-binding protein | 0.9845 | 9 | 191 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A7J3BDG1-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9797 | 7 | 230 |
GO:0005524
GO:0016887 |
| AF-A0A1V4RJG8-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9747 | 7 | 152 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A6DHY6-F1-model_v4 | Putative multiple sugar transport protein | 0.9718 | 9 | 217 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar