F491785

General Info

Members Datasets Scaffolds Average Seq Length
1215 843 637 365

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10229856|Ga0207674_102298562
Length 429
Sequence MTRRPDPSASPAVRRWVRSDRRDRTGSAAPTAARSPRSVGEDHGAGGTTSDIFEKALLRRTMAHVQVTDLDAYYGSFKAVEGVSLGIEPRSVTAFIGPSGCGKSTLLAMIAGLESVTSGEIHIGNRLVNSVPPKDRDIAMVFQSYALYPTMTVRQNITFGMESRGVPKADQAEAVKHVAALLQIEALLGRKPGQLSGGQRQRVAMGRALVRDPKLFLFDEPLSNLDAKLRVDMRTEIKKLHNRVGKTTVYVTHDQVEAMTLASRIAVMHQGSVQQFDAAQMIYSRPANMFVAGFMGSPAMNFIPAELGEAAGRPCVTVRTTDGGTAALELAQPVPAGAPRNVVLGVRPEHIYRFSDDLKQRKRAIAEVKAPVELVEPTGAETLAVLRFGDLEVTGRFDPDSAPRMGETMTLGIDMARACLFDPTTRSLL

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
19 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
20 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
21 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
22 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
23 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
24 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
25 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
26 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
27 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
28 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
29 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
30 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
31 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
32 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
33 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
34 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
35 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
36 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
37 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
38 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
39 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2516143018 Ensifer sp. BR816 Isolate Nodule
44 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
45 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
46 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
47 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
48 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
49 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
50 2519899620 Rhizobium sp. Pop5 Isolate Nodule
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
56 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
57 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
58 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
59 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
60 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
61 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
62 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
63 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
64 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
71 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
72 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
73 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
74 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
75 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
76 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
77 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
78 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
79 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
80 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
81 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
82 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
83 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
84 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
85 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
86 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
87 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
88 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
89 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
90 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
91 2643221557 Ensifer sp. Root558 Isolate Unclassified
92 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
93 2643221591 Devosia sp. Root685 Isolate Unclassified
94 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
95 2643221599 Rhizobium sp. Root708 Isolate Unclassified
96 2643221607 Rhizobium sp. Root73 Isolate Unclassified
97 2643221610 Ensifer sp. Root74 Isolate Unclassified
98 2643221618 Ensifer sp. Root231 Isolate Unclassified
99 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
100 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
101 2643221626 Ensifer sp. Root31 Isolate Unclassified
102 2643221629 Devosia sp. Root105 Isolate Unclassified
103 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
104 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
105 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
106 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
107 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
108 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
109 2643221655 Ensifer sp. Root1252 Isolate Unclassified
110 2643221659 Ensifer sp. Root127 Isolate Unclassified
111 2643221662 Devosia sp. Root413D1 Isolate Unclassified
112 2643221668 Ensifer sp. Root423 Isolate Unclassified
113 2643221675 Ensifer sp. Root1298 Isolate Unclassified
114 2643221680 Ensifer sp. Root1312 Isolate Unclassified
115 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
116 2643221688 Rhizobium sp. Root482 Isolate Unclassified
117 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
118 2643221698 Ensifer sp. Root142 Isolate Unclassified
119 2643221712 Ensifer sp. Root258 Isolate Unclassified
120 2643221718 Rhizobium sp. Root268 Isolate Unclassified
121 2643221719 Rhizobium sp. Root274 Isolate Unclassified
122 2643221723 Ensifer sp. Root278 Isolate Unclassified
123 2643221726 Ensifer sp. Root954 Isolate Unclassified
124 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
125 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
126 2718217927 Rhizobium sp. N324 Isolate Nodule
127 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
128 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
129 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
130 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
131 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
132 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
133 2718218423 Rhizobium sp. N941 Isolate Nodule
134 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
135 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
136 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
137 2721755809 Rhizobium sp. N541 Isolate Nodule
138 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
139 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
140 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
141 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
142 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
143 2738541293 Rhizobium sp. GV031 Isolate Unclassified
144 2738543024 Aminobacter sp. AP02 Isolate Unclassified
145 2751185800 Brucella pituitosa AA2 Isolate Unclassified
146 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
147 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
148 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
149 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
150 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
151 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
152 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
153 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
154 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
155 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
156 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
157 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
158 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
159 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
160 2791355262 Rhizobium sp. M1 Isolate Nodule
161 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
162 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
163 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
164 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
165 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
166 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
167 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
168 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
169 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
170 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
171 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
172 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
173 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
174 2838048938 Rhizobium pisi 27/80 Isolate Nodule
175 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
176 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
177 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
178 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
179 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
180 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
181 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
182 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
183 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
184 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
185 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
186 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
187 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
188 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
189 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
190 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
191 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
192 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
193 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
194 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
195 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
196 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
197 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
198 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
199 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
200 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
201 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
202 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
203 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
204 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
205 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
206 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
207 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
208 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
209 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
210 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
211 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
212 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
213 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
214 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
215 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
216 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
217 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
218 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
219 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
220 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
221 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
222 2844163670 Ensifer sp. 1H6 Isolate Unclassified
223 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
224 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
225 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
226 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
227 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
228 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
229 2854911287 Brucella lupini LUP21 Isolate Unclassified
230 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
231 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
232 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
233 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
234 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
235 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
236 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
237 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
238 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
239 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
240 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
241 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
242 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
243 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
244 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
245 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
246 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
247 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
248 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
249 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
250 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
251 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
252 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
253 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
254 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
255 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
256 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
257 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
258 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
259 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
260 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
261 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
262 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
263 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
264 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
265 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
266 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
267 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
268 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
269 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
270 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
271 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
272 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
273 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
274 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
275 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
276 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
277 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
278 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
279 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
280 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
281 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
282 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
283 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
284 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
285 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
286 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
287 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
288 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
289 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
290 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
291 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
292 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
293 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
294 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
295 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
296 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
297 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
298 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
299 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
300 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
301 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
302 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
303 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
304 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
305 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
306 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
307 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
308 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
309 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
310 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
311 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
312 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
313 2936381700 Rhizobium chutanense C16 Isolate Unclassified
314 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
315 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
316 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
317 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
318 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
319 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
320 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
321 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
322 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
323 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
324 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
325 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
326 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
327 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
328 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
329 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
330 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
331 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
332 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
333 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
334 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
335 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
336 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
337 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
338 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
339 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
340 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
341 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
342 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
343 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
344 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
345 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
346 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
347 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
348 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
349 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
350 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
351 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
352 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
353 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
354 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
355 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
356 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
357 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
358 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
359 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
360 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
361 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
362 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
363 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
364 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
365 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
366 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
367 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
368 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
369 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
370 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
371 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
372 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
373 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
374 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
375 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
376 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
377 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
378 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
379 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
380 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
381 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
382 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
383 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
384 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
385 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
386 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
387 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
388 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
389 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
390 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
391 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
392 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
393 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
394 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
395 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
396 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
397 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
398 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
399 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
400 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
401 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
402 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
403 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
404 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
405 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
406 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
407 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
408 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
409 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
410 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
411 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
412 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
413 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
414 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
415 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
416 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
417 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
418 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
419 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
420 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
421 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
422 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
423 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
424 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
425 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
426 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
427 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
428 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
429 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
430 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
431 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
432 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
433 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
434 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
435 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
436 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
437 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
438 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
439 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
440 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
441 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
442 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
443 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
444 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
445 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
446 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
447 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
448 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
449 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
450 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
451 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
452 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
453 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
454 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
455 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
456 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
457 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
458 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
459 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
460 2996887358 Rhizobium sp. R711 Isolate Nodule
461 2996893221 Rhizobium sp. R635 Isolate Nodule
462 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
463 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
464 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
465 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
466 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
467 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
468 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
469 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
470 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
471 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
472 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
473 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
474 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
475 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
476 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
477 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
478 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
479 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
480 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
481 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
482 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
483 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
484 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
485 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
486 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
487 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
488 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
489 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
490 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
491 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
492 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
493 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
494 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
495 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
496 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
497 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
498 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
499 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
500 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
501 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
502 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
503 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
504 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
505 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
506 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
507 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
508 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
509 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
510 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
511 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
512 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
513 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
514 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
515 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
516 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
517 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
518 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
519 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
520 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
521 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
522 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
523 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
524 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
525 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
526 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
527 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
528 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
529 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
530 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
531 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
532 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
533 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
534 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
535 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
536 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
537 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
538 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
539 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
540 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
541 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
542 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
543 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
544 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
545 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
546 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
547 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
548 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
549 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
550 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
551 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
552 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
553 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
554 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
555 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
556 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
557 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
558 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
559 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
560 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
561 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
562 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
563 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
564 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
565 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
566 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
567 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
568 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
569 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
570 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
571 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
572 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
573 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
574 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
575 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
576 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
577 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
578 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
579 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
580 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
581 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
582 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
583 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
584 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
585 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
586 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
587 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
588 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
589 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
590 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
591 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
592 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
593 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
594 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
595 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
596 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
626 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
628 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
629 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
630 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
631 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
632 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
634 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
635 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
636 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
637 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
638 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
639 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
640 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
641 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
642 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
643 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
644 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
645 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
646 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
647 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
648 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
649 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
650 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
651 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
652 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
653 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
654 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
655 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
656 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
657 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
658 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
659 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
660 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
661 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
662 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
663 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
664 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
665 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
666 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
667 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
668 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
669 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
670 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
671 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
672 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
673 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
674 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
675 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
676 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
677 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
678 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
679 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
680 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
681 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
682 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
683 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
684 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
685 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
686 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
687 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
688 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
689 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
690 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
691 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
692 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
693 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
694 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
695 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
696 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
697 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
698 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
699 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
700 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
701 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
702 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
703 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
704 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
705 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
706 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
707 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
708 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
709 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
710 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
711 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
712 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
713 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
714 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
715 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
716 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
717 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
718 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
719 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
720 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
721 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
722 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
723 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
724 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
725 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
726 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
727 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
728 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
729 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
730 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
731 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
732 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
733 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
734 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
735 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
736 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
737 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
738 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
739 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
740 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
741 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
742 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
743 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
744 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
745 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
746 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
747 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
748 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
749 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
750 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
751 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
752 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
753 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
754 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
755 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
756 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
757 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
758 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
759 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
760 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
761 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
762 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
763 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
764 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
765 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
766 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
767 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
768 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
769 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
770 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
771 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
772 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
773 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
774 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
775 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
776 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
777 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
778 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
779 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
780 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
781 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
782 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
783 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
784 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
785 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
786 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
787 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
788 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
789 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
790 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
791 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
792 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
793 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
794 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
795 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
796 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
797 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
800 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
801 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
802 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
803 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
804 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
805 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
806 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
807 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
808 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
809 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
810 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
811 8005258706 Rhizobium sp. R693 Isolate Nodule
812 8005275841 Rhizobium sp. N4311 Isolate Nodule
813 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
814 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
815 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
816 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
817 8005321885 Rhizobium sp. R72 Isolate Nodule
818 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
819 8005382845 Rhizobium sp. R634 Isolate Nodule
820 8005395548 Rhizobium sp. R339 Isolate Nodule
821 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
822 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
823 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
824 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
825 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
826 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
827 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
828 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
829 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
830 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
831 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
832 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
833 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
834 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
835 8024501048 Rhizobium sp. H4 Isolate Nodule
836 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
837 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
838 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
839 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
840 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
841 8056382006 Rhizobium croatiense 13T Isolate Nodule
842 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
843 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.18
Metatranscriptomes 0.25
Isolates 47.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 35.88
Rhizoplane 3.54
Rhizosphere 30.45
Stem 0
Stem Tuber 0
Unclassified 17.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10014042 3300001989 Bacteria 2917
2 JGI25155J39150_1000017 3300002704 Bacteria 159274
3 JGI25156J39149_1000034 3300002705 Bacteria 114036
4 JGI25162J39368_1001729 3300002737 Bacteria 10530
5 JGI25154J39366_1000034 3300002738 Bacteria 176764
6 JGI25158J39367_1000032 3300002739 Bacteria 30976
7 JGI25157J39369_1000137 3300002741 Bacteria 61333
8 JGI25157J39369_1000744 3300002741 Bacteria 17229
9 JGI25152J39213_1001331 3300002773 Bacteria 10900
10 JGI25152J39213_1004173 3300002773 Bacteria 4656
11 JGI25152J39213_1004522 3300002773 Bacteria 4356
12 JGI25150J39212_1000093 3300002774 Bacteria 51048
13 JGI25150J39212_1004918 3300002774 Bacteria 2909
14 JGI25159J45721_1000017 3300002987 Bacteria 136127
15 JGI25159J45721_1000123 3300002987 Bacteria 36902
16 JGI25159J45721_1001871 3300002987 Bacteria 8415
17 JGI25151J46595_10000007 3300003187 Bacteria 411751
18 JGI25151J46595_10002246 3300003187 Bacteria 11862
19 JGI25151J46595_10004050 3300003187 Bacteria 7860
20 JGI25151J46595_10008237 3300003187 Bacteria 5029
21 JGI25151J46595_10039171 3300003187 Bacteria 1754
22 JGI25165J46597_1000821 3300003214 Bacteria 23315
23 JGI25165J46597_1001523 3300003214 Bacteria 11677
24 JGI25153J46596_10001186 3300003215 Bacteria 15742
25 JGI25153J46596_10001306 3300003215 Bacteria 14934
26 JGI25153J46596_10004193 3300003215 Bacteria 7819
27 JGI25153J46596_10005439 3300003215 Bacteria 6684
28 JGI25153J46596_10008984 3300003215 Bacteria 4706
29 JGI25153J46596_10009234 3300003215 Bacteria 4613
30 JGI25160J50197_1000006 3300003354 Bacteria 316247
31 JGI25160J50197_1000027 3300003354 Bacteria 182809
32 JGI25160J50197_1007119 3300003354 Bacteria 4413
33 JGI25160J50197_1007183 3300003354 Bacteria 4388
34 JGI25161J50226_1000004 3300003374 Bacteria 316212
35 JGI25161J50226_1000129 3300003374 Bacteria 53598
36 JGI25161J50226_1009580 3300003374 Bacteria 1367
37 Ga0006562J51391_1007525 3300003578 Bacteria 6084
38 Ga0055542_1000516 3300003762 Bacteria 34984
39 Ga0055526_1000297 3300003771 Bacteria 41523
40 Ga0055526_1005794 3300003771 Bacteria 6957
41 Ga0055526_1009740 3300003771 Bacteria 4572
42 Ga0055526_1021898 3300003771 Bacteria 2200
43 Ga0055524_1000873 3300003775 Bacteria 19631
44 Ga0055524_1016513 3300003775 Bacteria 2644
45 Ga0055536_1007476 3300003781 Bacteria 4877
46 Ga0055528_1000186 3300003790 Bacteria 52663
47 Ga0055528_1001399 3300003790 Bacteria 14796
48 Ga0055528_1014982 3300003790 Bacteria 2826
49 Ga0055540_1004099 3300003792 Bacteria 6749
50 Ga0055543_1000002 3300004625 Bacteria 390020
51 Ga0055543_1000029 3300004625 Bacteria 131452
52 Ga0055543_1000403 3300004625 Bacteria 27596
53 Ga0065165_1000122 3300005262 Bacteria 132524
54 Ga0065165_1000341 3300005262 Bacteria 76483
55 Ga0065165_1020856 3300005262 Bacteria 2292
56 Ga0065165_1047781 3300005262 Bacteria 1233
57 Ga0068869_100106214 3300005334 Bacteria 2131
58 Ga0070666_10016166 3300005335 Bacteria 4770
59 Ga0068868_100002162 3300005338 Bacteria 13565
60 Ga0070660_100005489 3300005339 Bacteria 8782
61 Ga0070660_100008737 3300005339 Bacteria 7093
62 Ga0070660_100009363 3300005339 Bacteria 6883
63 Ga0070661_100034358 3300005344 Bacteria 3677
64 Ga0070668_100011445 3300005347 Bacteria 6605
65 Ga0070671_100024553 3300005355 Bacteria 4936
66 Ga0070709_10002006 3300005434 Bacteria 11075
67 Ga0070709_10070301 3300005434 Bacteria 2256
68 Ga0070710_10004005 3300005437 Bacteria 6984
69 Ga0070711_100075003 3300005439 Bacteria 2393
70 Ga0070708_100037445 3300005445 Bacteria 4232
71 Ga0070663_100061703 3300005455 Bacteria 2700
72 Ga0070662_100031433 3300005457 Bacteria 3726
73 Ga0070685_10101656 3300005466 Bacteria 1756
74 Ga0070706_100102693 3300005467 Bacteria 2658
75 Ga0070706_100111759 3300005467 Bacteria 2543
76 Ga0070706_100363808 3300005467 Bacteria 1348
77 Ga0070707_100152678 3300005468 Bacteria 2249
78 Ga0070698_100005977 3300005471 Bacteria 13268
79 Ga0070697_100018053 3300005536 Bacteria 5558
80 Ga0068853_100010540 3300005539 Bacteria 7474
81 Ga0068853_100033270 3300005539 Bacteria 4373
82 Ga0068853_100040462 3300005539 Bacteria 3977
83 Ga0068853_100181162 3300005539 Bacteria 1911
84 Ga0068855_100026237 3300005563 Bacteria 6971
85 Ga0068855_100085523 3300005563 Bacteria 3648
86 Ga0068855_100130103 3300005563 Bacteria 2875
87 Ga0068855_100279615 3300005563 Bacteria 1854
88 Ga0068855_100435867 3300005563 Bacteria 1432
89 Ga0070664_100327360 3300005564 Bacteria 1389
90 Ga0068856_100066976 3300005614 Bacteria 3549
91 Ga0068856_100267704 3300005614 Bacteria 1724
92 Ga0070702_100031259 3300005615 Bacteria 2911
93 Ga0068852_100304547 3300005616 Bacteria 1543
94 Ga0068859_100043431 3300005617 Bacteria 4517
95 Ga0068861_100146643 3300005719 Bacteria 1932
96 Ga0068858_100021932 3300005842 Bacteria 5963
97 Ga0068862_100164631 3300005844 Bacteria 1982
98 Ga0081540_1002724 3300005983 Bacteria 14381
99 Ga0075365_10017568 3300006038 Bacteria 4379
100 Ga0070712_100008084 3300006175 Bacteria 6603
101 Ga0070712_100015177 3300006175 Bacteria 4955
102 Ga0070712_100085714 3300006175 Bacteria 2294
103 Ga0075367_10006691 3300006178 Bacteria 5846
104 Ga0075367_10020528 3300006178 Bacteria 3681
105 Ga0075369_10001249 3300006186 Bacteria 8641
106 Ga0075369_10004629 3300006186 Bacteria 5102
107 Ga0075366_10028154 3300006195 Bacteria 3297
108 Ga0075366_10034043 3300006195 Bacteria 3001
109 Ga0075370_10064590 3300006353 Bacteria 2088
110 Ga0068871_100282872 3300006358 Bacteria 1451
111 Ga0075428_100400839 3300006844 Bacteria 1470
112 Ga0075430_100016596 3300006846 Bacteria 6271
113 Ga0075430_100206456 3300006846 Bacteria 1630
114 Ga0075431_100014366 3300006847 Bacteria 8008
115 Ga0075431_100015726 3300006847 Bacteria 7672
116 Ga0075431_100361722 3300006847 Bacteria 1457
117 Ga0075431_100361723 3300006847 Bacteria 1457
118 Ga0075434_100000506 3300006871 Bacteria 29511
119 Ga0075429_100012911 3300006880 Bacteria 7247
120 Ga0075429_100267726 3300006880 Bacteria 1496
121 Ga0097620_100043430 3300006931 Bacteria 4517
122 Ga0079104_1002943 3300006946 Bacteria 8438
123 Ga0079104_1003729 3300006946 Bacteria 6891
124 Ga0105251_10001618 3300009011 Bacteria 19132
125 Ga0105244_10020973 3300009036 Bacteria 3620
126 Ga0105240_10000216 3300009093 Bacteria 115800
127 Ga0105240_10000365 3300009093 Bacteria 84843
128 Ga0105240_10002442 3300009093 Bacteria 29876
129 Ga0105240_10256218 3300009093 Bacteria 2021
130 Ga0111539_10120386 3300009094 Bacteria 3075
131 Ga0105245_10016610 3300009098 Bacteria 6424
132 Ga0105245_10194629 3300009098 Bacteria 1944
133 Ga0114129_10016902 3300009147 Bacteria 10388
134 Ga0105241_10009211 3300009174 Bacteria 7262
135 Ga0105241_10100487 3300009174 Bacteria 2299
136 Ga0105248_10072915 3300009177 Bacteria 3859
137 Ga0105237_10000536 3300009545 Bacteria 53573
138 Ga0105237_10001312 3300009545 Bacteria 33037
139 Ga0105237_10001836 3300009545 Bacteria 27312
140 Ga0105237_10048283 3300009545 Bacteria 4279
141 Ga0105237_10085855 3300009545 Bacteria 3137
142 Ga0105238_10005908 3300009551 Bacteria 12125
143 Ga0105238_10017215 3300009551 Bacteria 7342
144 Ga0105238_10053246 3300009551 Bacteria 4067
145 Ga0105238_10063681 3300009551 Bacteria 3688
146 Ga0105249_10034408 3300009553 Bacteria 4592
147 Ga0105249_10257555 3300009553 Bacteria 1732
148 Ga0123341_1000188 3300009765 Bacteria 31454
149 Ga0123342_1002765 3300009766 Bacteria 28880
150 Ga0105239_10001156 3300010375 Bacteria 36262
151 Ga0105239_10003602 3300010375 Bacteria 18922
152 Ga0105239_10048123 3300010375 Bacteria 4675
153 Ga0105239_10135236 3300010375 Bacteria 2744
154 Ga0105246_10011277 3300011119 Bacteria 5544
155 Ga0157322_1000019 3300012490 Bacteria 2783
156 Ga0157370_10000183 3300013104 Bacteria 78649
157 Ga0157370_10198145 3300013104 Bacteria 1863
158 Ga0157369_10000943 3300013105 Bacteria 36946
159 Ga0171463_1004 3300013249 Bacteria 437207
160 Ga0157374_10041999 3300013296 Bacteria 4217
161 Ga0157378_10179202 3300013297 Bacteria 1992
162 Ga0163162_10300864 3300013306 Bacteria 1736
163 Ga0157372_10028512 3300013307 Bacteria 6093
164 Ga0163163_10007069 3300014325 Bacteria 9866
165 Ga0157379_10018982 3300014968 Bacteria 6070
166 Ga0182007_10001098 3300015262 Bacteria 14707
167 Ga0182005_1004037 3300015265 Bacteria 4817
168 Ga0182005_1017068 3300015265 Bacteria 2010
169 Ga0183363_1117 3300015690 Bacteria 21180
170 Ga0214544_1000079 3300021320 Bacteria 121742
171 Ga0214542_1000064 3300021321 Bacteria 127681
172 Ga0214542_1014176 3300021321 Bacteria 9068
173 Ga0214543_1000015 3300021327 Bacteria 305679
174 Ga0214543_1000063 3300021327 Bacteria 127694
175 Ga0213872_10010481 3300021361 Bacteria 4410
176 Ga0213872_10026621 3300021361 Bacteria 2656
177 Ga0213872_10031082 3300021361 Bacteria 2447
178 Ga0213872_10046881 3300021361 Bacteria 1966
179 Ga0213876_10002106 3300021384 Bacteria 11774
180 Ga0213875_10007310 3300021388 Bacteria 5714
181 Ga0213871_10001938 3300021441 Bacteria 3661
182 Ga0228711_1000004 3300022739 Bacteria 250146
183 Ga0228710_1000002 3300022740 Bacteria 287279
184 Ga0209435_100023 3300025206 Bacteria 201972
185 Ga0209436_100026 3300025208 Bacteria 90859
186 Ga0209436_105669 3300025208 Bacteria 2831
187 Ga0209437_100023 3300025233 Bacteria 614195
188 Ga0207425_1000018 3300025245 Bacteria 411841
189 Ga0207425_1000366 3300025245 Bacteria 31282
190 Ga0207425_1001182 3300025245 Bacteria 11622
191 Ga0207425_1007116 3300025245 Bacteria 2988
192 Ga0209646_1000080 3300025246 Bacteria 201975
193 Ga0209026_1000076 3300025250 Bacteria 201975
194 Ga0209026_1000116 3300025250 Bacteria 133228
195 Ga0209677_100216 3300025253 Bacteria 42627
196 Ga0209148_1000078 3300025254 Bacteria 296101
197 Ga0209759_1000059 3300025256 Bacteria 201975
198 Ga0209759_1000153 3300025256 Bacteria 119494
199 Ga0209129_1000026 3300025258 Bacteria 411839
200 Ga0209129_1000164 3300025258 Bacteria 98984
201 Ga0209129_1000203 3300025258 Bacteria 70739
202 Ga0209129_1000507 3300025258 Bacteria 28094
203 Ga0209129_1001741 3300025258 Bacteria 11687
204 Ga0209129_1003097 3300025258 Bacteria 7482
205 Ga0209129_1005338 3300025258 Bacteria 4588
206 Ga0209129_1007119 3300025258 Bacteria 3411
207 Ga0209233_1000062 3300025261 Bacteria 399685
208 Ga0209233_1000428 3300025261 Bacteria 30724
209 Ga0209233_1000488 3300025261 Bacteria 24083
210 Ga0209673_1000037 3300025273 Bacteria 313804
211 Ga0209673_1003018 3300025273 Bacteria 10435
212 Ga0209673_1006039 3300025273 Bacteria 5952
213 Ga0209673_1008001 3300025273 Bacteria 4765
214 Ga0209673_1016820 3300025273 Bacteria 2720
215 Ga0209130_1000027 3300025284 Bacteria 327700
216 Ga0209130_1000030 3300025284 Bacteria 323323
217 Ga0209130_1000032 3300025284 Bacteria 316240
218 Ga0209130_1004603 3300025284 Bacteria 5155
219 Ga0209130_1011935 3300025284 Bacteria 2300
220 Ga0209676_1000026 3300025292 Bacteria 574599
221 Ga0209676_1003791 3300025292 Bacteria 8943
222 Ga0209676_1029819 3300025292 Bacteria 1678
223 Ga0209025_1000035 3300025294 Bacteria 411841
224 Ga0209025_1000052 3300025294 Bacteria 324648
225 Ga0209025_1000591 3300025294 Bacteria 65471
226 Ga0209025_1001447 3300025294 Bacteria 31156
227 Ga0209025_1002696 3300025294 Bacteria 18090
228 Ga0209025_1005002 3300025294 Bacteria 11075
229 Ga0209025_1012317 3300025294 Bacteria 5499
230 Ga0209025_1012720 3300025294 Bacteria 5364
231 Ga0209025_1027546 3300025294 Bacteria 2815
232 Ga0209564_1000062 3300025295 Bacteria 321275
233 Ga0209564_1000193 3300025295 Bacteria 141731
234 Ga0209564_1000207 3300025295 Bacteria 135313
235 Ga0209564_1000379 3300025295 Bacteria 81420
236 Ga0209564_1012022 3300025295 Bacteria 3815
237 Ga0209564_1034858 3300025295 Bacteria 1468
238 Ga0209758_1000040 3300025297 Bacteria 411841
239 Ga0209758_1000072 3300025297 Bacteria 277776
240 Ga0209758_1000280 3300025297 Bacteria 101103
241 Ga0209758_1000586 3300025297 Bacteria 56819
242 Ga0209758_1000906 3300025297 Bacteria 40219
243 Ga0209758_1001057 3300025297 Bacteria 35976
244 Ga0209758_1022648 3300025297 Bacteria 2870
245 Ga0209758_1035653 3300025297 Bacteria 1957
246 Ga0209050_1000772 3300025298 Bacteria 45952
247 Ga0209050_1015956 3300025298 Bacteria 3109
248 Ga0209050_1018518 3300025298 Bacteria 2701
249 Ga0209256_1000343 3300025299 Bacteria 75902
250 Ga0209256_1000893 3300025299 Bacteria 36710
251 Ga0209256_1000943 3300025299 Bacteria 35287
252 Ga0209256_1001510 3300025299 Bacteria 23567
253 Ga0209256_1001680 3300025299 Bacteria 21453
254 Ga0209256_1028022 3300025299 Bacteria 1596
255 Ga0207426_1000047 3300025302 Bacteria 417011
256 Ga0207426_1000072 3300025302 Bacteria 327700
257 Ga0207426_1000077 3300025302 Bacteria 316246
258 Ga0207426_1000094 3300025302 Bacteria 275293
259 Ga0207426_1004911 3300025302 Bacteria 6312
260 Ga0207426_1014520 3300025302 Bacteria 2883
261 Ga0209051_1005642 3300025303 Bacteria 7246
262 Ga0209051_1006175 3300025303 Bacteria 6802
263 Ga0209051_1029156 3300025303 Bacteria 2165
264 Ga0209051_1036723 3300025303 Bacteria 1806
265 Ga0209257_1004341 3300025304 Bacteria 11076
266 Ga0209257_1007258 3300025304 Bacteria 6771
267 Ga0209257_1027515 3300025304 Bacteria 1891
268 Ga0207713_1030896 3300025735 Bacteria 2378
269 Ga0207692_10003598 3300025898 Bacteria 6066
270 Ga0207692_10073388 3300025898 Bacteria 1810
271 Ga0207680_10054909 3300025903 Bacteria 2399
272 Ga0207647_10011076 3300025904 Bacteria 6338
273 Ga0207699_10006930 3300025906 Bacteria 5517
274 Ga0207705_10005139 3300025909 Bacteria 9807
275 Ga0207684_10018600 3300025910 Bacteria 5948
276 Ga0207695_10000319 3300025913 Bacteria 116116
277 Ga0207695_10000492 3300025913 Bacteria 84474
278 Ga0207695_10014292 3300025913 Bacteria 9415
279 Ga0207695_10090854 3300025913 Bacteria 3068
280 Ga0207695_10156628 3300025913 Bacteria 2212
281 Ga0207671_10000078 3300025914 Bacteria 150705
282 Ga0207671_10004703 3300025914 Bacteria 12904
283 Ga0207671_10006804 3300025914 Bacteria 10101
284 Ga0207693_10067430 3300025915 Bacteria 2802
285 Ga0207663_10020893 3300025916 Bacteria 3716
286 Ga0207663_10036590 3300025916 Bacteria 2954
287 Ga0207657_10000364 3300025919 Bacteria 47699
288 Ga0207657_10002381 3300025919 Bacteria 20347
289 Ga0207657_10007827 3300025919 Bacteria 10907
290 Ga0207657_10109199 3300025919 Bacteria 2287
291 Ga0207649_10066866 3300025920 Bacteria 2280
292 Ga0207646_10011044 3300025922 Bacteria 8769
293 Ga0207646_10131280 3300025922 Bacteria 2255
294 Ga0207694_10011973 3300025924 Bacteria 6541
295 Ga0207694_10039302 3300025924 Bacteria 3641
296 Ga0207687_10000198 3300025927 Bacteria 40595
297 Ga0207706_10047804 3300025933 Bacteria 3785
298 Ga0207706_10287017 3300025933 Bacteria 1435
299 Ga0207686_10070615 3300025934 Bacteria 2245
300 Ga0207665_10003339 3300025939 Bacteria 10757
301 Ga0207665_10078090 3300025939 Bacteria 2273
302 Ga0207711_10016459 3300025941 Bacteria 6144
303 Ga0207689_10042424 3300025942 Bacteria 3763
304 Ga0207667_10086550 3300025949 Bacteria 3243
305 Ga0207667_10134289 3300025949 Bacteria 2548
306 Ga0207651_10134720 3300025960 Bacteria 1898
307 Ga0207712_10052957 3300025961 Bacteria 2845
308 Ga0207668_10027489 3300025972 Bacteria 3705
309 Ga0207640_10260119 3300025981 Bacteria 1352
310 Ga0207658_10113575 3300025986 Bacteria 2146
311 Ga0207703_10028528 3300026035 Bacteria 4400
312 Ga0207678_10021567 3300026067 Bacteria 5649
313 Ga0207678_10082023 3300026067 Bacteria 2760
314 Ga0207702_10031816 3300026078 Bacteria 4400
315 Ga0207676_10028233 3300026095 Bacteria 4190
316 Ga0207674_10229856 3300026116 Bacteria 1802
317 Ga0207698_10360158 3300026142 Bacteria 1377
318 Ga0209281_1000030 3300027111 Bacteria 425931
319 Ga0209281_1000144 3300027111 Bacteria 172471
320 Ga0209282_1000004 3300027666 Bacteria 425931
321 Ga0209813_10003842 3300027866 Bacteria 3552
322 Ga0268266_10000606 3300028379 Bacteria 48985
323 Ga0268266_10103921 3300028379 Bacteria 2508
324 Ga0268266_10180066 3300028379 Bacteria 1924
325 Ga0307515_10000492 3300028794 Bacteria 94501
326 Ga0307515_10005063 3300028794 Bacteria 26793
327 Ga0307515_10013300 3300028794 Bacteria 15392
328 Ga0307515_10014438 3300028794 Bacteria 14642
329 Ga0307515_10033162 3300028794 Bacteria 8514
330 Ga0307515_10089826 3300028794 Bacteria 3861
331 Ga0307515_10166444 3300028794 Bacteria 2220
332 Ga0307513_10020228 3300031456 Bacteria 7896
333 Ga0307513_10037125 3300031456 Bacteria 5425
334 Ga0307513_10134374 3300031456 Bacteria 2412
335 Ga0307513_10153197 3300031456 Bacteria 2210
336 Ga0307509_10000011 3300031507 Bacteria 298257
337 Ga0307509_10001831 3300031507 Bacteria 35184
338 Ga0307509_10089607 3300031507 Bacteria 3154
339 Ga0307508_10000611 3300031616 Bacteria 42821
340 Ga0307508_10163951 3300031616 Bacteria 1826
341 Ga0307514_10052088 3300031649 Bacteria 3167
342 Ga0307516_10009603 3300031730 Bacteria 10771
343 Ga0307516_10125160 3300031730 Bacteria 2356
344 Ga0307405_10010861 3300031731 Bacteria 4743
345 Ga0307406_10011730 3300031901 Bacteria 4975
346 Ga0307406_10048916 3300031901 Bacteria 2674
347 Ga0307412_10005001 3300031911 Bacteria 7414
348 Ga0315914_1000001 3300031967 Bacteria 416633
349 Ga0307409_100154992 3300031995 Bacteria 1995
350 Ga0307414_10029891 3300032004 Bacteria 3552
351 Ga0307414_10087297 3300032004 Bacteria 2304
352 Ga0307507_10027458 3300033179 Bacteria 6101
353 Ga0307510_10014283 3300033180 Bacteria 9402
354 Ga0307510_10204709 3300033180 Bacteria 1503
355 Ga0307510_10223121 3300033180 Bacteria 1394
356 Ga0315913_1000004 3300033430 Bacteria 192741
357 Ga0315915_1000002 3300033464 Bacteria 425854
358 Ga0373949_0000171 3300035090 Bacteria 24781
359 Ga0373935_0268845 3300035692 Bacteria 1198
360 Ga0373927_0019135 3300035695 Bacteria 4490
361 Ga0373937_0065488 3300036401 Bacteria 3345
362 Ga0395899_0000595 3300037312 Bacteria 37965
363 Ga0395899_0027264 3300037312 Bacteria 4308
364 Ga0395900_0032955 3300037418 Bacteria 5331
365 Ga0395898_0091936 3300037466 Bacteria 2918
366 Ga0395905_0000328 3300037471 Bacteria 68234
367 Ga0395905_0007705 3300037471 Bacteria 10685
368 Ga0395905_0116208 3300037471 Bacteria 2514
369 Ga0395905_0116468 3300037471 Bacteria 2512
370 Ga0436364_0990550 3300037853 Bacteria 10081
371 Ga0436364_1103499 3300037853 Bacteria 2020
372 Ga0395901_0099516 3300038443 Bacteria 3049
373 Ga0395901_0146933 3300038443 Bacteria 2478
374 Ga0395901_0160315 3300038443 Bacteria 2362
375 Ga0400483_172841 3300039062 Bacteria 1244
376 Ga0400483_190117 3300039062 Bacteria 3465
377 Ga0436365_1009141 3300039437 Bacteria 1687
378 Ga0436365_1772086 3300039437 Bacteria 47437
379 Ga0436360_0402304 3300039438 Bacteria 3123
380 Ga0436360_0800328 3300039438 Bacteria 5062
381 Ga0436360_0934493 3300039438 Bacteria 5449
382 Ga0436360_1023635 3300039438 Bacteria 2732
383 Ga0436360_1270075 3300039438 Bacteria 1258
384 Ga0436360_1350032 3300039438 Bacteria 1537
385 Ga0436361_0048400 3300039447 Bacteria 6342
386 Ga0436361_0546753 3300039447 Bacteria 1760
387 Ga0436361_0626061 3300039447 Bacteria 1213
388 Ga0436361_0715372 3300039447 Bacteria 6119
389 Ga0436361_1014632 3300039447 Bacteria 1464
390 Ga0436361_1173504 3300039447 Bacteria 10656
391 Ga0436361_1195026 3300039447 Bacteria 5295
392 Ga0436363_0799550 3300039450 Bacteria 5510
393 Ga0436363_0918794 3300039450 Bacteria 3561
394 Ga0436362_0741073 3300039453 Bacteria 2345
395 Ga0436362_1126090 3300039453 Bacteria 4730
396 Ga0439436_0002384 3300041404 Bacteria 5635
397 Ga0439439_0005514 3300041406 Bacteria 2892
398 Ga0439465_0021522 3300041413 Bacteria 2022
399 Ga0451791_0837071 3300041451 Bacteria 1316
400 Ga0451847_0087747 3300041503 Bacteria 2253
401 Ga0439445_0039807 3300042004 Bacteria 1246
402 Ga0439452_025987 3300042010 Bacteria 1481
403 Ga0439435_0000837 3300042436 Bacteria 5260
404 Ga0439435_0033690 3300042436 Bacteria 1404
405 Ga0466972_0006044 3300044658 Bacteria 6084
406 Ga0466964_0002201 3300044706 Bacteria 6899
407 Ga0466960_0010694 3300044901 Bacteria 3817
408 Ga0466959_0105573 3300045049 Bacteria 2014
409 Ga0451576_0006467 3300045051 Bacteria 14358
410 Ga0466958_0057519 3300045836 Bacteria 2363
411 Ga0495592_0002447 3300046454 Bacteria 13094
412 Ga0495603_0008586 3300046455 Bacteria 6175
413 Ga0495590_0056563 3300046457 Bacteria 1371
414 Ga0495629_0132576 3300046459 Bacteria 1735
415 Ga0495638_0020323 3300046460 Bacteria 4387
416 Ga0495638_0143729 3300046460 Bacteria 1390
417 Ga0495641_0090235 3300046461 Bacteria 1369
418 Ga0495651_0010066 3300046462 Bacteria 7265
419 Ga0495653_0076344 3300046463 Bacteria 2491
420 Ga0495650_0005824 3300046471 Bacteria 7854
421 Ga0495580_0095521 3300046472 Bacteria 2067
422 Ga0495583_0014902 3300046506 Bacteria 4256
423 Ga0495583_0038412 3300046506 Bacteria 2262
424 Ga0495606_0012400 3300046507 Bacteria 6837
425 Ga0495606_0023785 3300046507 Bacteria 4430
426 Ga0495610_0025163 3300046512 Bacteria 3201
427 Ga0495610_0090074 3300046512 Bacteria 1392
428 Ga0495620_0036984 3300046515 Bacteria 2179
429 Ga0495628_0192005 3300046516 Bacteria 1542
430 Ga0495631_0041670 3300046518 Bacteria 2031
431 Ga0495632_0052400 3300046519 Bacteria 2006
432 Ga0495643_0007132 3300046522 Bacteria 7253
433 Ga0495644_0043159 3300046523 Bacteria 1697
434 Ga0495648_0047211 3300046524 Bacteria 2663
435 Ga0495586_0053676 3300046535 Bacteria 2184
436 Ga0495633_0088317 3300046558 Bacteria 1441
437 Ga0495625_0010086 3300046660 Bacteria 7851
438 Ga0495635_0027085 3300046663 Bacteria 3988
439 Ga0495599_0025465 3300046678 Bacteria 3703
440 Ga0495623_0001445 3300046679 Bacteria 16111
441 Ga0495624_0024180 3300046690 Bacteria 3999
442 Ga0495670_0031251 3300046691 Bacteria 2646
443 Ga0495649_0156001 3300046694 Bacteria 1198
444 Ga0495581_0011439 3300047315 Bacteria 5137
445 Ga0495604_0012138 3300047317 Bacteria 6851
446 Ga0495674_0004081 3300047319 Bacteria 14127
447 Ga0495674_0016631 3300047319 Bacteria 6863
448 Ga0495672_0110063 3300047320 Bacteria 1480
449 Ga0495676_0011102 3300047321 Bacteria 8138
450 Ga0495680_0012563 3300047322 Bacteria 7445
451 Ga0495683_0040527 3300047323 Bacteria 2353
452 Ga0495675_0002082 3300047444 Bacteria 11942
453 Ga0495679_002038 3300047446 Bacteria 10678
454 Ga0495686_0078144 3300047472 Bacteria 2026
455 Ga0495602_0034456 3300048088 Bacteria 4736
456 Ga0495626_0090436 3300048091 Bacteria 1346
457 Ga0496100_0030431 3300048903 Bacteria 3348
458 Ga0496100_0031823 3300048903 Bacteria 3283
459 Ga0496100_0053457 3300048903 Bacteria 2630
460 Ga0496100_0143516 3300048903 Bacteria 1695
461 Ga0496101_0017519 3300048904 Bacteria 4858
462 Ga0496101_0063227 3300048904 Bacteria 2694
463 Ga0496101_0091302 3300048904 Bacteria 2266
464 Ga0496101_0215283 3300048904 Bacteria 1489
465 Ga0496102_0006183 3300048905 Bacteria 10207
466 Ga0496103_0030754 3300048906 Bacteria 3268
467 Ga0496103_0146721 3300048906 Bacteria 1510
468 Ga0496104_0092944 3300048907 Bacteria 2884
469 Ga0496104_0106082 3300048907 Bacteria 2692
470 Ga0496104_0398004 3300048907 Bacteria 1289
471 Ga0496105_0007751 3300048908 Bacteria 8330
472 Ga0496105_0048743 3300048908 Bacteria 3496
473 Ga0496106_0001119 3300048909 Bacteria 19846
474 Ga0496106_0004024 3300048909 Bacteria 10991
475 Ga0496106_0004253 3300048909 Bacteria 10656
476 Ga0496106_0162318 3300048909 Bacteria 1768
477 Ga0496107_0087727 3300048910 Bacteria 2271
478 Ga0496108_0005196 3300048911 Bacteria 10518
479 Ga0496108_0034298 3300048911 Bacteria 4216
480 Ga0496108_0071351 3300048911 Bacteria 2930
481 Ga0496109_0017192 3300048912 Bacteria 6334
482 Ga0496110_0000410 3300048913 Bacteria 29170
483 Ga0496110_0182863 3300048913 Bacteria 1903
484 Ga0496111_0006067 3300048914 Bacteria 7808
485 Ga0496111_0099206 3300048914 Bacteria 2139
486 Ga0496111_0105720 3300048914 Bacteria 2071
487 Ga0496112_0062382 3300048915 Bacteria 3676
488 Ga0496112_0104502 3300048915 Bacteria 2802
489 Ga0496114_0011650 3300048917 Bacteria 7033
490 Ga0496114_0037876 3300048917 Bacteria 3989
491 Ga0496114_0109930 3300048917 Bacteria 2361
492 Ga0496114_0142814 3300048917 Bacteria 2074
493 Ga0496115_0014474 3300048918 Bacteria 5972
494 Ga0496115_0166898 3300048918 Bacteria 1821
495 Ga0496115_0196114 3300048918 Bacteria 1668
496 Ga0496116_0000707 3300048919 Bacteria 42893
497 Ga0496116_0003524 3300048919 Bacteria 15408
498 Ga0496116_0107170 3300048919 Bacteria 1652
499 Ga0496116_0133490 3300048919 Bacteria 1410
500 Ga0496117_0001125 3300048920 Bacteria 40300
501 Ga0496117_0002658 3300048920 Bacteria 22158
502 Ga0496117_0003841 3300048920 Bacteria 17091
503 Ga0496117_0054371 3300048920 Bacteria 2805
504 Ga0496117_0082726 3300048920 Bacteria 2101
505 Ga0496118_0000844 3300048921 Bacteria 48654
506 Ga0496118_0005841 3300048921 Bacteria 13799
507 Ga0496118_0039560 3300048921 Bacteria 3760
508 Ga0496118_0044496 3300048921 Bacteria 3476
509 Ga0496119_0005065 3300048922 Bacteria 12805
510 Ga0496119_0010985 3300048922 Bacteria 7558
511 Ga0496119_0011556 3300048922 Bacteria 7288
512 Ga0496119_0014637 3300048922 Bacteria 6114
513 Ga0496119_0156988 3300048922 Bacteria 1213
514 Ga0496120_0003021 3300048923 Bacteria 15931
515 Ga0496120_0005096 3300048923 Bacteria 10628
516 Ga0496121_0003319 3300048924 Bacteria 23101
517 Ga0496121_0006713 3300048924 Bacteria 14137
518 Ga0496121_0014935 3300048924 Bacteria 8181
519 Ga0496121_0034582 3300048924 Bacteria 4547
520 Ga0496121_0035736 3300048924 Bacteria 4445
521 Ga0496122_0000024 3300048925 Bacteria 372400
522 Ga0496122_0005156 3300048925 Bacteria 15745
523 Ga0496122_0006309 3300048925 Bacteria 13664
524 Ga0496122_0016334 3300048925 Bacteria 7033
525 Ga0496122_0020333 3300048925 Bacteria 6005
526 Ga0496122_0044170 3300048925 Bacteria 3481
527 Ga0496123_0000086 3300048926 Bacteria 183266
528 Ga0496123_0006124 3300048926 Bacteria 11794
529 Ga0496123_0012365 3300048926 Bacteria 7286
530 Ga0496123_0022089 3300048926 Bacteria 4917
531 Ga0496124_0000488 3300048927 Bacteria 67995
532 Ga0496124_0001118 3300048927 Bacteria 42215
533 Ga0496124_0011653 3300048927 Bacteria 8773
534 Ga0496124_0026404 3300048927 Bacteria 5236
535 Ga0496124_0052092 3300048927 Bacteria 3479
536 Ga0496124_0072685 3300048927 Bacteria 2847
537 Ga0496124_0141937 3300048927 Bacteria 1894
538 Ga0496124_0211508 3300048927 Bacteria 1467
539 Ga0496125_0000134 3300048928 Bacteria 161449
540 Ga0496125_0002416 3300048928 Bacteria 24308
541 Ga0496125_0003868 3300048928 Bacteria 17714
542 Ga0496125_0031557 3300048928 Bacteria 4720
543 Ga0496125_0123800 3300048928 Bacteria 1837
544 Ga0496125_0130908 3300048928 Bacteria 1766
545 Ga0496126_0000434 3300048929 Bacteria 83949
546 Ga0496126_0017103 3300048929 Bacteria 7232
547 Ga0496126_0017199 3300048929 Bacteria 7208
548 Ga0496126_0043674 3300048929 Bacteria 4132
549 Ga0496126_0141609 3300048929 Bacteria 2069
550 Ga0496126_0243967 3300048929 Bacteria 1499
551 Ga0496126_0313509 3300048929 Bacteria 1291
552 Ga0501031_0016746 3300049568 Bacteria 4762
553 Ga0501032_0000219 3300049569 Bacteria 47451
554 Ga0501032_0023515 3300049569 Bacteria 4256
555 Ga0501033_0000126 3300049570 Bacteria 74250
556 Ga0501034_0000012 3300049571 Bacteria 310504
557 Ga0501034_0001879 3300049571 Bacteria 26611
558 Ga0501034_0002949 3300049571 Bacteria 19712
559 Ga0501034_0045980 3300049571 Bacteria 4410
560 Ga0501034_0074210 3300049571 Bacteria 3410
561 Ga0501034_0143480 3300049571 Bacteria 2366
562 Ga0501034_0156211 3300049571 Bacteria 2255
563 Ga0501034_0202959 3300049571 Bacteria 1940
564 Ga0501034_0206490 3300049571 Bacteria 1920
565 Ga0501036_0000483 3300049572 Bacteria 28404
566 Ga0501036_0161458 3300049572 Bacteria 1889
567 Ga0501037_0000021 3300049573 Bacteria 150037
568 Ga0501038_0000032 3300049574 Bacteria 131432
569 Ga0501039_0000025 3300049575 Bacteria 152236
570 Ga0501039_0065397 3300049575 Bacteria 2821
571 Ga0501040_0073929 3300049576 Bacteria 2355
572 Ga0501043_0000015 3300049579 Bacteria 175932
573 Ga0501043_0009591 3300049579 Bacteria 7585
574 Ga0501043_0246376 3300049579 Bacteria 1377
575 Ga0501046_0033565 3300049580 Bacteria 4145
576 Ga0501047_0035472 3300049581 Bacteria 4819
577 Ga0501067_0000018 3300049583 Bacteria 101701
578 Ga0501068_0000782 3300049584 Bacteria 16418
579 Ga0501068_0008897 3300049584 Bacteria 5602
580 Ga0501069_0000116 3300049585 Bacteria 35726
581 Ga0501073_0086263 3300049589 Bacteria 2183
582 Ga0501074_0074913 3300049590 Bacteria 2430
583 Ga0501075_0058420 3300049591 Bacteria 2905
584 Ga0501076_0016026 3300049592 Bacteria 5673
585 Ga0501077_0008186 3300049593 Bacteria 6465
586 Ga0501079_0041947 3300049741 Bacteria 3533
587 Ga0501080_0139755 3300049742 Bacteria 2240
588 Ga0501081_0016810 3300049743 Bacteria 4837
589 Ga0501083_0124136 3300049744 Bacteria 1693
590 Ga0501280_004198 3300049776 Bacteria 2135
591 Ga0501035_0000436 3300049822 Bacteria 46832
592 Ga0501035_0097249 3300049822 Bacteria 2586
593 Ga0501044_0007432 3300049823 Bacteria 12050
594 Ga0501044_0061715 3300049823 Bacteria 3834
595 Ga0501044_0071495 3300049823 Bacteria 3528
596 Ga0501044_0151769 3300049823 Bacteria 2298
597 Ga0501044_0348212 3300049823 Bacteria 1402
598 Ga0501045_0033979 3300049824 Bacteria 3700
599 nmdc:mga03683_13296_c1 3300050489 Bacteria 3026
600 nmdc:mga0yw44_105419_c1 3300050492 Bacteria 1801
601 nmdc:mga0yw44_49921_c2 3300050492 Bacteria 1967
602 nmdc:mga0k408_3230_c1 3300050493 Bacteria 8626
603 nmdc:mga06z11_23383_c1 3300050494 Bacteria 2902
604 nmdc:mga05p37_175327_c1 3300050507 Bacteria 2612
605 nmdc:mga05p37_47923_c1 3300050507 Bacteria 5255
606 nmdc:mga09592_11254_c1 3300050508 Bacteria 7278
607 nmdc:mga09592_303666_c1 3300050508 Bacteria 1384
608 nmdc:mga0qj67_12870_c1 3300050509 Bacteria 6314
609 nmdc:mga06r32_12511_c1 3300050510 Bacteria 7658
610 nmdc:mga06r32_168612_c1 3300050510 Bacteria 2173
611 nmdc:mga06r32_4390_c1 3300050510 Bacteria 12611
612 nmdc:mga06r32_7328_c1 3300050510 Bacteria 9930
613 nmdc:mga0n895_8893_c1 3300050512 Bacteria 8748
614 Ga0495612_0001813 3300053078 Bacteria 8758
615 Ga0500610_0077617 3300053079 Bacteria 1731
616 Ga0500578_0036800 3300053086 Bacteria 3142
617 Ga0500566_0003024 3300053094 Bacteria 10055
618 Ga0500628_024616 3300053129 Bacteria 1252
619 Ga0500658_0054670 3300053134 Bacteria 1641
620 Ga0500559_0003318 3300053136 Bacteria 7981
621 Ga0500559_0037943 3300053136 Bacteria 2090
622 Ga0500568_0000219 3300053139 Bacteria 49081
623 Ga0500568_0009899 3300053139 Bacteria 4502
624 Ga0500568_0027708 3300053139 Bacteria 2367
625 Ga0500603_007969 3300053150 Bacteria 2337
626 Ga0500604_0012354 3300053151 Bacteria 2305
627 Ga0500616_0015630 3300053153 Bacteria 4334
628 Ga0500622_0002427 3300053156 Bacteria 13459
629 Ga0500622_0019077 3300053156 Bacteria 3642
630 Ga0500636_0004433 3300053177 Bacteria 7944
631 Ga0500636_0123787 3300053177 Bacteria 1448
632 Ga0501084_0084380 3300054114 Bacteria 2666
633 Ga0587077_019916 3300059493 Bacteria 1174
634 Ga0587088_005066 3300059508 Bacteria 1710
635 Ga0501082_0054899 3300060353 Bacteria 3433
636 Ga0501082_0068353 3300060353 Bacteria 3059
637 Ga0530510_0002198 3300061734 Bacteria 13380

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0132576 Ga0495629_0132576_749_1696 289
2 3300046461 Ga0495641_0090235 Ga0495641_0090235_380_1327 289
3 iso_pu_bacteria 8018163183 8018164734 297
4 iso_pu_bacteria 8018163183 8018170351 297
5 iso_pu_bacteria 2724679232 2725946125 302
6 3300049742 Ga0501080_0139755 Ga0501080_0139755_986_2038 307
7 iso_pu_bacteria 2585427526 2585528973 312
8 iso_pu_bacteria 8005376324 8005378503 314
9 iso_pu_bacteria 2842205361 2842206669 315
10 iso_pu_bacteria 2842278818 2842280126 315
11 3300039062 Ga0400483_172841 Ga0400483_172841_232_1203 318
12 iso_pu_bacteria 2513237084 2513570265 319
13 iso_pu_bacteria 2513237084 2513573758 319
14 3300048910 Ga0496107_0087727 Ga0496107_0087727_1270_2253 323
15 iso_pu_bacteria 2529292951 2530650192 324
16 3300025960 Ga0207651_10134720 Ga0207651_101347202 326
17 3300009545 Ga0105237_10085855 Ga0105237_100858552 329
18 3300026142 Ga0207698_10360158 Ga0207698_103601582 329
19 3300046516 Ga0495628_0192005 Ga0495628_0192005_358_1446 329
20 iso_pu_bacteria 8005688590 8005691518 329
21 iso_pu_bacteria 2960610863 2960613712 331
22 iso_pu_bacteria 8005460587 8005464744 331
23 iso_pu_bacteria 8005563573 8005569661 333
24 iso_pu_bacteria 2916076590 2916080022 334
25 3300005434 Ga0070709_10070301 Ga0070709_100703011 336
26 3300046455 Ga0495603_0008586 Ga0495603_0008586_3134_4222 336
27 3300046663 Ga0495635_0027085 Ga0495635_0027085_691_1779 336
28 3300046690 Ga0495624_0024180 Ga0495624_0024180_2071_3159 336
29 3300047315 Ga0495581_0011439 Ga0495581_0011439_2909_3997 336
30 3300047319 Ga0495674_0016631 Ga0495674_0016631_4711_5799 336
31 3300047321 Ga0495676_0011102 Ga0495676_0011102_1318_2406 336
32 3300053078 Ga0495612_0001813 Ga0495612_0001813_599_1687 336
33 iso_pu_bacteria 8057874678 8057880943 336
34 iso_pu_bacteria 8005695170 8005700633 337
35 iso_pu_bacteria 2838016132 2838022618 338
36 3300005334 Ga0068869_100106214 Ga0068869_1001062142 339
37 3300005338 Ga0068868_100002162 Ga0068868_1000021626 339
38 3300005339 Ga0070660_100009363 Ga0070660_1000093636 339
39 3300005539 Ga0068853_100040462 Ga0068853_1000404622 339
40 3300005615 Ga0070702_100031259 Ga0070702_1000312593 339
41 3300006358 Ga0068871_100282872 Ga0068871_1002828721 339
42 3300009098 Ga0105245_10016610 Ga0105245_100166102 339
43 3300009174 Ga0105241_10100487 Ga0105241_101004872 339
44 3300009551 Ga0105238_10063681 Ga0105238_100636812 339
45 3300011119 Ga0105246_10011277 Ga0105246_100112774 339
46 3300013307 Ga0157372_10028512 Ga0157372_100285125 339
47 3300014325 Ga0163163_10007069 Ga0163163_100070699 339
48 3300025913 Ga0207695_10090854 Ga0207695_100908542 339
49 3300025919 Ga0207657_10002381 Ga0207657_1000238117 339
50 3300025924 Ga0207694_10011973 Ga0207694_100119733 339
51 3300025927 Ga0207687_10000198 Ga0207687_1000019821 339
52 3300025933 Ga0207706_10287017 Ga0207706_102870172 339
53 3300025942 Ga0207689_10042424 Ga0207689_100424243 339
54 3300026095 Ga0207676_10028233 Ga0207676_100282332 339
55 3300048904 Ga0496101_0063227 Ga0496101_0063227_812_1900 339
56 3300048907 Ga0496104_0106082 Ga0496104_0106082_1388_2476 339
57 3300048908 Ga0496105_0007751 Ga0496105_0007751_3977_5065 339
58 3300048909 Ga0496106_0004253 Ga0496106_0004253_8483_9571 339
59 3300048911 Ga0496108_0005196 Ga0496108_0005196_8242_9330 339
60 3300048913 Ga0496110_0000410 Ga0496110_0000410_3816_4904 339
61 3300048917 Ga0496114_0037876 Ga0496114_0037876_1017_2105 339
62 3300048918 Ga0496115_0196114 Ga0496115_0196114_380_1468 339
63 iso_pu_bacteria 2894772417 2894776637 340
64 iso_pu_bacteria 2585428058 2587733421 341
65 iso_pu_bacteria 2585428062 2587754871 341
66 iso_pu_bacteria 2643221592 2643972028 341
67 iso_pu_bacteria 2643221625 2644142227 341
68 iso_pu_bacteria 2643221648 2644275921 341
69 iso_pu_bacteria 2929199973 2929202999 341
70 iso_pu_bacteria 8055909800 8055916093 341
71 3300048927 Ga0496124_0141937 Ga0496124_0141937_142_1254 342
72 iso_pu_bacteria 8023680758 8023686261 343
73 3300006846 Ga0075430_100016596 Ga0075430_1000165964 344
74 3300050509 nmdc:mga0qj67_12870_c1 nmdc:mga0qj67_12870_c1_2091_3143 344
75 3300050510 nmdc:mga06r32_12511_c1 nmdc:mga06r32_12511_c1_599_1651 344
76 3300003215 JGI25153J46596_10001186 JGI25153J46596_100011869 345
77 3300003215 JGI25153J46596_10001306 JGI25153J46596_1000130613 345
78 3300003771 Ga0055526_1005794 Ga0055526_10057943 345
79 3300005539 Ga0068853_100010540 Ga0068853_1000105405 345
80 3300005564 Ga0070664_100327360 Ga0070664_1003273602 345
81 3300005616 Ga0068852_100304547 Ga0068852_1003045472 345
82 3300006844 Ga0075428_100400839 Ga0075428_1004008391 345
83 3300006846 Ga0075430_100206456 Ga0075430_1002064562 345
84 3300006847 Ga0075431_100361722 Ga0075431_1003617221 345
85 3300006847 Ga0075431_100361723 Ga0075431_1003617231 345
86 3300006880 Ga0075429_100267726 Ga0075429_1002677262 345
87 3300009093 Ga0105240_10002442 Ga0105240_1000244210 345
88 3300009094 Ga0111539_10120386 Ga0111539_101203863 345
89 3300009545 Ga0105237_10001836 Ga0105237_1000183620 345
90 3300009551 Ga0105238_10017215 Ga0105238_100172155 345
91 3300010375 Ga0105239_10001156 Ga0105239_100011567 345
92 3300025245 Ga0207425_1000366 Ga0207425_100036613 345
93 3300025258 Ga0209129_1000164 Ga0209129_100016411 345
94 3300025273 Ga0209673_1008001 Ga0209673_10080013 345
95 3300025295 Ga0209564_1000062 Ga0209564_100006262 345
96 3300025297 Ga0209758_1000072 Ga0209758_1000072221 345
97 3300025297 Ga0209758_1000280 Ga0209758_100028059 345
98 3300025298 Ga0209050_1000772 Ga0209050_100077240 345
99 3300025302 Ga0207426_1014520 Ga0207426_10145203 345
100 3300025913 Ga0207695_10014292 Ga0207695_100142928 345
101 3300025914 Ga0207671_10006804 Ga0207671_100068044 345
102 3300028379 Ga0268266_10103921 Ga0268266_101039212 345
103 3300028794 Ga0307515_10000492 Ga0307515_100004927 345
104 3300028794 Ga0307515_10005063 Ga0307515_100050637 345
105 3300028794 Ga0307515_10014438 Ga0307515_100144389 345
106 3300031456 Ga0307513_10153197 Ga0307513_101531972 345
107 3300031507 Ga0307509_10001831 Ga0307509_100018316 345
108 3300031507 Ga0307509_10089607 Ga0307509_100896072 345
109 3300031616 Ga0307508_10000611 Ga0307508_1000061114 345
110 3300031649 Ga0307514_10052088 Ga0307514_100520882 345
111 3300031730 Ga0307516_10009603 Ga0307516_100096039 345
112 3300033179 Ga0307507_10027458 Ga0307507_100274584 345
113 3300033180 Ga0307510_10014283 Ga0307510_100142835 345
114 3300037466 Ga0395898_0091936 Ga0395898_0091936_295_1347 345
115 3300038443 Ga0395901_0160315 Ga0395901_0160315_12_1064 345
116 3300046454 Ga0495592_0002447 Ga0495592_0002447_7404_8456 345
117 3300046471 Ga0495650_0005824 Ga0495650_0005824_3764_4816 345
118 3300046512 Ga0495610_0025163 Ga0495610_0025163_618_1670 345
119 3300046660 Ga0495625_0010086 Ga0495625_0010086_4699_5751 345
120 3300049571 Ga0501034_0001879 Ga0501034_0001879_23268_24320 345
121 3300049584 Ga0501068_0008897 Ga0501068_0008897_1559_2611 345
122 3300049823 Ga0501044_0071495 Ga0501044_0071495_1574_2626 345
123 3300050489 nmdc:mga03683_13296_c1 nmdc:mga03683_13296_c1_1641_2693 345
124 3300050507 nmdc:mga05p37_175327_c1 nmdc:mga05p37_175327_c1_1496_2548 345
125 3300050508 nmdc:mga09592_303666_c1 nmdc:mga09592_303666_c1_32_1084 345
126 3300050510 nmdc:mga06r32_168612_c1 nmdc:mga06r32_168612_c1_1101_2153 345
127 iso_pu_bacteria 2513237144 2513910714 345
128 iso_pu_bacteria 2854896431 2854896864 345
129 iso_pu_bacteria 2854916844 2854920531 345
130 iso_pu_bacteria 2933016740 2933016856 345
131 iso_pu_bacteria 2519899620 2520378602 346
132 3300035090 Ga0373949_0000171 Ga0373949_0000171_18973_20034 348
133 3300038443 Ga0395901_0099516 Ga0395901_0099516_425_1540 348
134 3300039450 Ga0436363_0918794 Ga0436363_0918794_32_1084 348
135 iso_pu_bacteria 2643221591 2643966430 348
136 3300006175 Ga0070712_100008084 Ga0070712_1000080846 349
137 3300006195 Ga0075366_10034043 Ga0075366_100340432 349
138 3300006847 Ga0075431_100015726 Ga0075431_1000157262 349
139 3300006880 Ga0075429_100012911 Ga0075429_1000129116 349
140 3300009553 Ga0105249_10257555 Ga0105249_102575552 349
141 3300025915 Ga0207693_10067430 Ga0207693_100674302 349
142 3300025916 Ga0207663_10020893 Ga0207663_100208934 349
143 3300031507 Ga0307509_10000011 Ga0307509_1000001161 349
144 3300031730 Ga0307516_10125160 Ga0307516_101251602 349
145 3300036401 Ga0373937_0065488 Ga0373937_0065488_541_1605 349
146 3300048903 Ga0496100_0031823 Ga0496100_0031823_298_1368 349
147 3300048904 Ga0496101_0017519 Ga0496101_0017519_3145_4215 349
148 3300048905 Ga0496102_0006183 Ga0496102_0006183_1915_2985 349
149 3300048907 Ga0496104_0092944 Ga0496104_0092944_12_1082 349
150 3300048908 Ga0496105_0048743 Ga0496105_0048743_2102_3172 349
151 3300048909 Ga0496106_0004024 Ga0496106_0004024_7654_8724 349
152 3300048911 Ga0496108_0034298 Ga0496108_0034298_1623_2693 349
153 3300048912 Ga0496109_0017192 Ga0496109_0017192_2037_3107 349
154 3300048914 Ga0496111_0099206 Ga0496111_0099206_487_1557 349
155 3300048917 Ga0496114_0011650 Ga0496114_0011650_1198_2268 349
156 3300048918 Ga0496115_0014474 Ga0496115_0014474_2932_4002 349
157 3300050493 nmdc:mga0k408_3230_c1 nmdc:mga0k408_3230_c1_1747_2820 349
158 3300050508 nmdc:mga09592_11254_c1 nmdc:mga09592_11254_c1_580_1647 349
159 3300050510 nmdc:mga06r32_4390_c1 nmdc:mga06r32_4390_c1_9737_10804 349
160 3300053094 Ga0500566_0003024 Ga0500566_0003024_2432_3496 349
161 3300053150 Ga0500603_007969 Ga0500603_007969_503_1567 349
162 3300005467 Ga0070706_100363808 Ga0070706_1003638082 350
163 3300005563 Ga0068855_100130103 Ga0068855_1001301033 350
164 3300025922 Ga0207646_10011044 Ga0207646_100110444 350
165 3300044658 Ga0466972_0006044 Ga0466972_0006044_879_1973 350
166 iso_pu_bacteria 2878738818 2878745751 350
167 iso_pu_bacteria 2924776078 2924784149 350
168 3300005617 Ga0068859_100043431 Ga0068859_1000434312 351
169 3300005842 Ga0068858_100021932 Ga0068858_1000219324 351
170 3300006871 Ga0075434_100000506 Ga0075434_1000005065 351
171 3300006931 Ga0097620_100043430 Ga0097620_1000434302 351
172 3300014968 Ga0157379_10018982 Ga0157379_100189824 351
173 3300025934 Ga0207686_10070615 Ga0207686_100706152 351
174 3300025939 Ga0207665_10078090 Ga0207665_100780904 351
175 3300026035 Ga0207703_10028528 Ga0207703_100285284 351
176 3300048915 Ga0496112_0062382 Ga0496112_0062382_888_1970 351
177 3300049583 Ga0501067_0000018 Ga0501067_0000018_12386_13471 351
178 3300049584 Ga0501068_0000782 Ga0501068_0000782_9189_10274 351
179 3300049585 Ga0501069_0000116 Ga0501069_0000116_26194_27279 351
180 3300050512 nmdc:mga0n895_8893_c1 nmdc:mga0n895_8893_c1_2763_3851 351
181 3300061734 Ga0530510_0002198 Ga0530510_0002198_7650_8735 351
182 iso_pu_bacteria 8004395343 8004396466 351
183 3300039450 Ga0436363_0799550 Ga0436363_0799550_3650_4765 352
184 3300048903 Ga0496100_0053457 Ga0496100_0053457_715_1812 352
185 3300048904 Ga0496101_0091302 Ga0496101_0091302_688_1785 352
186 3300048911 Ga0496108_0071351 Ga0496108_0071351_427_1524 352
187 3300048914 Ga0496111_0105720 Ga0496111_0105720_491_1588 352
188 3300048915 Ga0496112_0104502 Ga0496112_0104502_708_1805 352
189 3300048917 Ga0496114_0109930 Ga0496114_0109930_718_1815 352
190 3300048918 Ga0496115_0166898 Ga0496115_0166898_43_1140 352
191 iso_pu_bacteria 2842217011 2842224343 352
192 iso_pu_bacteria 2935901341 2935908147 352
193 iso_pu_bacteria 8024479707 8024483687 352
194 3300025284 Ga0209130_1011935 Ga0209130_10119352 353
195 3300042004 Ga0439445_0039807 Ga0439445_0039807_131_1207 354
196 iso_pu_bacteria 2512875016 2512928873 354
197 iso_pu_bacteria 2876363079 2876369085 354
198 iso_pu_bacteria 2903448605 2903449061 354
199 iso_pu_bacteria 2903521522 2903526447 354
200 iso_pu_bacteria 2903528002 2903532224 354
201 iso_pu_bacteria 2963644680 2963650361 354
202 iso_pu_bacteria 2968083720 2968086120 354
203 iso_pu_bacteria 3004211236 3004215497 354
204 iso_pu_bacteria 3004218560 3004225661 354
205 iso_pu_bacteria 637000159 637078588 354
206 iso_pu_bacteria 2802429605 2805932177 356
207 iso_pu_bacteria 8005307578 8005313413 356
208 3300021388 Ga0213875_10007310 Ga0213875_100073101 357
209 3300037853 Ga0436364_0990550 Ga0436364_0990550_1006_2121 357
210 3300042436 Ga0439435_0000837 Ga0439435_0000837_194_1294 357
211 iso_pu_bacteria 8005301065 8005303840 357
212 3300013306 Ga0163162_10300864 Ga0163162_103008642 358
213 3300053079 Ga0500610_0077617 Ga0500610_0077617_401_1483 358
214 3300037312 Ga0395899_0000595 Ga0395899_0000595_12419_13531 359
215 3300037418 Ga0395900_0032955 Ga0395900_0032955_2408_3520 359
216 3300037471 Ga0395905_0007705 Ga0395905_0007705_6008_7120 359
217 iso_pu_bacteria 2885270888 2885275377 359
218 iso_pu_bacteria 8056382006 8056386800 359
219 3300003790 Ga0055528_1001399 Ga0055528_10013992 360
220 3300009765 Ga0123341_1000188 Ga0123341_100018822 360
221 iso_pu_bacteria 2509276021 2509389696 360
222 3300049571 Ga0501034_0045980 Ga0501034_0045980_1606_2712 361
223 iso_pu_bacteria 2508501127 2509141244 361
224 iso_pu_bacteria 2582581315 2585327724 361
225 iso_pu_bacteria 2582581315 2585329127 361
226 iso_pu_bacteria 2597489875 2597815451 361
227 iso_pu_bacteria 2643221653 2644299610 361
228 iso_pu_bacteria 2643221719 2644657838 361
229 iso_pu_bacteria 2841734538 2841738197 361
230 iso_pu_bacteria 2856342000 2856347566 361
231 iso_pu_bacteria 2871474448 2871480199 361
232 iso_pu_bacteria 2878788777 2878795755 361
233 iso_pu_bacteria 2888343758 2888349449 361
234 iso_pu_bacteria 2898795034 2898797459 361
235 iso_pu_bacteria 2924754689 2924758641 361
236 iso_pu_bacteria 2937836603 2937842558 361
237 iso_pu_bacteria 2958071322 2958071882 361
238 iso_pu_bacteria 2970524798 2970530978 361
239 iso_pu_bacteria 2970540015 2970546583 361
240 iso_pu_bacteria 2989776772 2989781290 361
241 iso_pu_bacteria 2995392953 2995394354 361
242 iso_pu_bacteria 8004633249 8004638565 361
243 iso_pu_bacteria 8005246636 8005247336 361
244 iso_pu_bacteria 8018150411 8018151175 361
245 iso_pu_bacteria 8055617313 8055623851 361
246 iso_pu_bacteria 2508501122 2509108897 362
247 iso_pu_bacteria 2509276019 2509378025 362
248 iso_pu_bacteria 2509276033 2509445871 362
249 iso_pu_bacteria 2510065057 2510305787 362
250 iso_pu_bacteria 2511231052 2511498551 362
251 iso_pu_bacteria 2512047086 2512534702 362
252 iso_pu_bacteria 2512875026 2512973485 362
253 iso_pu_bacteria 2513237086 2513583711 362
254 iso_pu_bacteria 2513237089 2513601998 362
255 iso_pu_bacteria 2513237091 2513615785 362
256 iso_pu_bacteria 2513237140 2513886747 362
257 iso_pu_bacteria 2513237143 2513906811 362
258 iso_pu_bacteria 2513237156 2513983451 362
259 iso_pu_bacteria 2513237159 2513997473 362
260 iso_pu_bacteria 2513237160 2514003404 362
261 iso_pu_bacteria 2515154107 2515612466 362
262 iso_pu_bacteria 2516143018 2516205657 362
263 iso_pu_bacteria 2516653046 2516894829 362
264 iso_pu_bacteria 2517487022 2517571512 362
265 iso_pu_bacteria 2524023207 2524450352 362
266 iso_pu_bacteria 2551306084 2551676683 362
267 iso_pu_bacteria 2551306084 2551680307 362
268 iso_pu_bacteria 2551306085 2551685138 362
269 iso_pu_bacteria 2551306086 2551696288 362
270 iso_pu_bacteria 2551306087 2551704486 362
271 iso_pu_bacteria 2551306089 2551711335 362
272 iso_pu_bacteria 2551306090 2551719673 362
273 iso_pu_bacteria 2551306091 2551728085 362
274 iso_pu_bacteria 2551306092 2551738515 362
275 iso_pu_bacteria 2551306093 2551742749 362
276 iso_pu_bacteria 2558860100 2558867473 362
277 iso_pu_bacteria 2582581283 2585167649 362
278 iso_pu_bacteria 2582581306 2585265903 362
279 iso_pu_bacteria 2582581865 2585390093 362
280 iso_pu_bacteria 2582581866 2585395276 362
281 iso_pu_bacteria 2599185352 2600193938 362
282 iso_pu_bacteria 2643221607 2644052146 362
283 iso_pu_bacteria 2643221634 2644195028 362
284 iso_pu_bacteria 2643221636 2644204940 362
285 iso_pu_bacteria 2643221637 2644208619 362
286 iso_pu_bacteria 2643221686 2644484889 362
287 iso_pu_bacteria 2643221688 2644494147 362
288 iso_pu_bacteria 2643221689 2644500555 362
289 iso_pu_bacteria 2643221718 2644652149 362
290 iso_pu_bacteria 2643221723 2644677011 362
291 iso_pu_bacteria 2657244999 2657682344 362
292 iso_pu_bacteria 2690316117 2692319879 362
293 iso_pu_bacteria 2751185821 2753458515 362
294 iso_pu_bacteria 2791355082 2792582306 362
295 iso_pu_bacteria 2791355091 2792621838 362
296 iso_pu_bacteria 2791355092 2792628904 362
297 iso_pu_bacteria 2791355094 2792640038 362
298 iso_pu_bacteria 2802428858 2802717122 362
299 iso_pu_bacteria 2802428859 2802724890 362
300 iso_pu_bacteria 2802428860 2802729640 362
301 iso_pu_bacteria 2802428861 2802736986 362
302 iso_pu_bacteria 2802428862 2802743391 362
303 iso_pu_bacteria 2802428863 2802749483 362
304 iso_pu_bacteria 2802429268 2804753763 362
305 iso_pu_bacteria 2838074704 2838078098 362
306 iso_pu_bacteria 2841911363 2841911805 362
307 iso_pu_bacteria 2841917233 2841917238 362
308 iso_pu_bacteria 2842521101 2842522286 362
309 iso_pu_bacteria 2847417321 2847420898 362
310 iso_pu_bacteria 2848992105 2848995731 362
311 iso_pu_bacteria 2850079185 2850082716 362
312 iso_pu_bacteria 2855825444 2855827463 362
313 iso_pu_bacteria 2855839649 2855842837 362
314 iso_pu_bacteria 2855872281 2855873595 362
315 iso_pu_bacteria 2858800743 2858802175 362
316 iso_pu_bacteria 2896384573 2896390124 362
317 iso_pu_bacteria 2913295892 2913300257 362
318 iso_pu_bacteria 2915980308 2915981748 362
319 iso_pu_bacteria 2915986958 2915993388 362
320 iso_pu_bacteria 2915993759 2915998339 362
321 iso_pu_bacteria 2916000859 2916006130 362
322 iso_pu_bacteria 2916007675 2916009065 362
323 iso_pu_bacteria 2916014648 2916019829 362
324 iso_pu_bacteria 2916021584 2916023894 362
325 iso_pu_bacteria 2916028427 2916031000 362
326 iso_pu_bacteria 2916035215 2916040460 362
327 iso_pu_bacteria 2916041962 2916043395 362
328 iso_pu_bacteria 2916048683 2916050680 362
329 iso_pu_bacteria 2916055098 2916056823 362
330 iso_pu_bacteria 2916061851 2916066519 362
331 iso_pu_bacteria 2920760137 2920760255 362
332 iso_pu_bacteria 2921201388 2921204804 362
333 iso_pu_bacteria 2921208531 2921209843 362
334 iso_pu_bacteria 2921237296 2921239746 362
335 iso_pu_bacteria 2921244191 2921245667 362
336 iso_pu_bacteria 2921250672 2921252837 362
337 iso_pu_bacteria 2921257292 2921262616 362
338 iso_pu_bacteria 2921263974 2921266276 362
339 iso_pu_bacteria 2921282425 2921288920 362
340 iso_pu_bacteria 2921289301 2921293943 362
341 iso_pu_bacteria 2921296804 2921303834 362
342 iso_pu_bacteria 2924144063 2924144772 362
343 iso_pu_bacteria 2924150972 2924157624 362
344 iso_pu_bacteria 2924158325 2924158818 362
345 iso_pu_bacteria 2924165586 2924168562 362
346 iso_pu_bacteria 2924172951 2924174270 362
347 iso_pu_bacteria 2924179722 2924185988 362
348 iso_pu_bacteria 2924186466 2924187780 362
349 iso_pu_bacteria 2924193448 2924193522 362
350 iso_pu_bacteria 2924200457 2924201410 362
351 iso_pu_bacteria 2924207177 2924207754 362
352 iso_pu_bacteria 2924214083 2924220734 362
353 iso_pu_bacteria 2924221636 2924223503 362
354 iso_pu_bacteria 2924228884 2924234072 362
355 iso_pu_bacteria 2936381700 2936388530 362
356 iso_pu_bacteria 2936996657 2936997402 362
357 iso_pu_bacteria 2937002841 2937004136 362
358 iso_pu_bacteria 2937009748 2937010326 362
359 iso_pu_bacteria 2937016420 2937017758 362
360 iso_pu_bacteria 2937023124 2937023213 362
361 iso_pu_bacteria 2937029754 2937031760 362
362 iso_pu_bacteria 2937036028 2937037827 362
363 iso_pu_bacteria 2937042894 2937044369 362
364 iso_pu_bacteria 2937049772 2937051030 362
365 iso_pu_bacteria 2937056579 2937063008 362
366 iso_pu_bacteria 2937063883 2937070437 362
367 iso_pu_bacteria 2937071275 2937075429 362
368 iso_pu_bacteria 2937078374 2937082144 362
369 iso_pu_bacteria 2937084907 2937089916 362
370 iso_pu_bacteria 2937091812 2937092468 362
371 iso_pu_bacteria 2937098957 2937103093 362
372 iso_pu_bacteria 2937106411 2937113207 362
373 iso_pu_bacteria 2937113482 2937114208 362
374 iso_pu_bacteria 2937119839 2937120206 362
375 iso_pu_bacteria 2937126314 2937128578 362
376 iso_pu_bacteria 2957375807 2957376827 362
377 iso_pu_bacteria 2957382221 2957384525 362
378 iso_pu_bacteria 2957388812 2957395232 362
379 iso_pu_bacteria 2957395598 2957398059 362
380 iso_pu_bacteria 2957402308 2957405196 362
381 iso_pu_bacteria 2957408893 2957411748 362
382 iso_pu_bacteria 2957415311 2957417505 362
383 iso_pu_bacteria 2957422303 2957422329 362
384 iso_pu_bacteria 2957430029 2957430043 362
385 iso_pu_bacteria 2957437181 2957441635 362
386 iso_pu_bacteria 2957443900 2957450368 362
387 iso_pu_bacteria 2957450854 2957455945 362
388 iso_pu_bacteria 2957457609 2957460963 362
389 iso_pu_bacteria 2957464669 2957466543 362
390 iso_pu_bacteria 2957471148 2957471375 362
391 iso_pu_bacteria 2957478035 2957479431 362
392 iso_pu_bacteria 2957484790 2957491137 362
393 iso_pu_bacteria 2957491536 2957494470 362
394 iso_pu_bacteria 2957498199 2957505208 362
395 iso_pu_bacteria 2957505466 2957512284 362
396 iso_pu_bacteria 2960584000 2960588275 362
397 iso_pu_bacteria 2960591022 2960592765 362
398 iso_pu_bacteria 2960597568 2960597934 362
399 iso_pu_bacteria 2960603979 2960606596 362
400 iso_pu_bacteria 2960617483 2960618379 362
401 iso_pu_bacteria 2960624210 2960629862 362
402 iso_pu_bacteria 2960631154 2960634162 362
403 iso_pu_bacteria 2960637947 2960643718 362
404 iso_pu_bacteria 2960645483 2960647496 362
405 iso_pu_bacteria 2960652885 2960653581 362
406 iso_pu_bacteria 2960660292 2960666906 362
407 iso_pu_bacteria 2960667422 2960673253 362
408 iso_pu_bacteria 2960674078 2960674918 362
409 iso_pu_bacteria 2960680706 2960681690 362
410 iso_pu_bacteria 2960687367 2960689370 362
411 iso_pu_bacteria 2960693952 2960699046 362
412 iso_pu_bacteria 2964607997 2964615055 362
413 iso_pu_bacteria 2964615318 2964617002 362
414 iso_pu_bacteria 2964621998 2964625867 362
415 iso_pu_bacteria 2964628898 2964629498 362
416 iso_pu_bacteria 2964636051 2964641535 362
417 iso_pu_bacteria 2964643177 2964643645 362
418 iso_pu_bacteria 2964649959 2964655248 362
419 iso_pu_bacteria 2964656573 2964663274 362
420 iso_pu_bacteria 2964663802 2964669364 362
421 iso_pu_bacteria 2964670856 2964676981 362
422 iso_pu_bacteria 2964678106 2964679184 362
423 iso_pu_bacteria 2964685014 2964687264 362
424 iso_pu_bacteria 2964691889 2964695106 362
425 iso_pu_bacteria 2964698721 2964699123 362
426 iso_pu_bacteria 2964705432 2964705989 362
427 iso_pu_bacteria 2964712639 2964712696 362
428 iso_pu_bacteria 2964719344 2964719543 362
429 iso_pu_bacteria 2967664464 2967667594 362
430 iso_pu_bacteria 2967671571 2967676334 362
431 iso_pu_bacteria 2967678726 2967681212 362
432 iso_pu_bacteria 2967686174 2967692462 362
433 iso_pu_bacteria 2967693043 2967699363 362
434 iso_pu_bacteria 2967699805 2967703181 362
435 iso_pu_bacteria 2967706974 2967713230 362
436 iso_pu_bacteria 2967714385 2967721160 362
437 iso_pu_bacteria 2967721400 2967723829 362
438 iso_pu_bacteria 2967728569 2967731797 362
439 iso_pu_bacteria 2967735183 2967738427 362
440 iso_pu_bacteria 2967742019 2967743606 362
441 iso_pu_bacteria 2967748971 2967753452 362
442 iso_pu_bacteria 2967755722 2967757502 362
443 iso_pu_bacteria 2967762386 2967765834 362
444 iso_pu_bacteria 2967769361 2967770382 362
445 iso_pu_bacteria 2967775926 2967782328 362
446 iso_pu_bacteria 2970019648 2970021952 362
447 iso_pu_bacteria 2970026789 2970028713 362
448 iso_pu_bacteria 2970033650 2970036662 362
449 iso_pu_bacteria 2970040964 2970046563 362
450 iso_pu_bacteria 2970047711 2970051121 362
451 iso_pu_bacteria 2970054988 2970058872 362
452 iso_pu_bacteria 2970061556 2970065373 362
453 iso_pu_bacteria 2970068827 2970070323 362
454 iso_pu_bacteria 2970076120 2970076755 362
455 iso_pu_bacteria 2970082768 2970084010 362
456 iso_pu_bacteria 2970088815 2970092780 362
457 iso_pu_bacteria 2970095765 2970101249 362
458 iso_pu_bacteria 2970102677 2970106953 362
459 iso_pu_bacteria 2970109326 2970111099 362
460 iso_pu_bacteria 2970116247 2970122326 362
461 iso_pu_bacteria 2970122695 2970124542 362
462 iso_pu_bacteria 2970129317 2970133558 362
463 iso_pu_bacteria 2970136068 2970142234 362
464 iso_pu_bacteria 2970143518 2970147300 362
465 iso_pu_bacteria 2970149975 2970151714 362
466 iso_pu_bacteria 2970156795 2970158696 362
467 iso_pu_bacteria 2970164137 2970170791 362
468 iso_pu_bacteria 2970170962 2970175033 362
469 iso_pu_bacteria 2970177841 2970184567 362
470 iso_pu_bacteria 2970184632 2970185529 362
471 iso_pu_bacteria 2970191845 2970197950 362
472 iso_pu_bacteria 2977516862 2977523745 362
473 iso_pu_bacteria 2977523885 2977525138 362
474 iso_pu_bacteria 2977530762 2977531165 362
475 iso_pu_bacteria 2977537788 2977544507 362
476 iso_pu_bacteria 2977544691 2977547184 362
477 iso_pu_bacteria 2977551784 2977558048 362
478 iso_pu_bacteria 2977558990 2977564760 362
479 iso_pu_bacteria 2977565890 2977571275 362
480 iso_pu_bacteria 2977572785 2977573798 362
481 iso_pu_bacteria 2977579622 2977585141 362
482 iso_pu_bacteria 643692032 643827493 362
483 iso_pu_bacteria 648276728 648737272 362
484 iso_pu_bacteria 8003992118 8003995418 362
485 iso_pu_bacteria 8003999396 8004003179 362
486 iso_pu_bacteria 8049293176 8049296363 362
487 iso_pu_bacteria 8057160832 8057162318 362
488 3300009093 Ga0105240_10000365 Ga0105240_1000036552 363
489 3300013105 Ga0157369_10000943 Ga0157369_1000094327 363
490 3300025913 Ga0207695_10000492 Ga0207695_1000049220 363
491 3300037312 Ga0395899_0027264 Ga0395899_0027264_419_1525 363
492 3300046462 Ga0495651_0010066 Ga0495651_0010066_5608_6714 363
493 3300046463 Ga0495653_0076344 Ga0495653_0076344_1082_2188 363
494 3300046472 Ga0495580_0095521 Ga0495580_0095521_885_1991 363
495 3300046524 Ga0495648_0047211 Ga0495648_0047211_986_2092 363
496 3300046535 Ga0495586_0053676 Ga0495586_0053676_1016_2125 363
497 3300046678 Ga0495599_0025465 Ga0495599_0025465_515_1621 363
498 3300046679 Ga0495623_0001445 Ga0495623_0001445_9815_10921 363
499 3300047317 Ga0495604_0012138 Ga0495604_0012138_5047_6153 363
500 3300047319 Ga0495674_0004081 Ga0495674_0004081_882_1988 363
501 3300047320 Ga0495672_0110063 Ga0495672_0110063_73_1179 363
502 3300047322 Ga0495680_0012563 Ga0495680_0012563_4382_5488 363
503 3300047444 Ga0495675_0002082 Ga0495675_0002082_6434_7540 363
504 3300047446 Ga0495679_002038 Ga0495679_002038_6676_7782 363
505 3300048088 Ga0495602_0034456 Ga0495602_0034456_257_1363 363
506 3300048917 Ga0496114_0142814 Ga0496114_0142814_638_1744 363
507 3300048927 Ga0496124_0211508 Ga0496124_0211508_282_1388 363
508 iso_pu_bacteria 2509276033 2509445868 363
509 iso_pu_bacteria 2510065019 2510132583 363
510 iso_pu_bacteria 2510065019 2510134969 363
511 iso_pu_bacteria 2510461069 2510843277 363
512 iso_pu_bacteria 2510461076 2510893935 363
513 iso_pu_bacteria 2510461076 2510896391 363
514 iso_pu_bacteria 2510461076 2510898960 363
515 iso_pu_bacteria 2510917028 2511181732 363
516 iso_pu_bacteria 2510917030 2511197312 363
517 iso_pu_bacteria 2511231027 2511392188 363
518 iso_pu_bacteria 2513237085 2513575718 363
519 iso_pu_bacteria 2513237085 2513581557 363
520 iso_pu_bacteria 2513237088 2513598611 363
521 iso_pu_bacteria 2513237093 2513631183 363
522 iso_pu_bacteria 2513237093 2513636290 363
523 iso_pu_bacteria 2513237103 2513710526 363
524 iso_pu_bacteria 2513237103 2513710920 363
525 iso_pu_bacteria 2513237138 2513866064 363
526 iso_pu_bacteria 2513237144 2513908073 363
527 iso_pu_bacteria 2513237146 2513927060 363
528 iso_pu_bacteria 2513237162 2514019637 363
529 iso_pu_bacteria 2513237162 2514024888 363
530 iso_pu_bacteria 2513237351 2514588942 363
531 iso_pu_bacteria 2515075009 2515111579 363
532 iso_pu_bacteria 2515075009 2515114056 363
533 iso_pu_bacteria 2515154113 2515637108 363
534 iso_pu_bacteria 2515154113 2515638266 363
535 iso_pu_bacteria 2515154114 2515641884 363
536 iso_pu_bacteria 2515154114 2515647126 363
537 iso_pu_bacteria 2515154116 2515656636 363
538 iso_pu_bacteria 2516653077 2517037692 363
539 iso_pu_bacteria 2516653077 2517040225 363
540 iso_pu_bacteria 2516653085 2517075774 363
541 iso_pu_bacteria 2516653085 2517077980 363
542 iso_pu_bacteria 2517093000 2517094356 363
543 iso_pu_bacteria 2517093000 2517096774 363
544 iso_pu_bacteria 2517287029 2517406153 363
545 iso_pu_bacteria 2517287029 2517410480 363
546 iso_pu_bacteria 2524023209 2524461013 363
547 iso_pu_bacteria 2534681796 2535516720 363
548 iso_pu_bacteria 2582581294 2585200372 363
549 iso_pu_bacteria 2582581298 2585224648 363
550 iso_pu_bacteria 2582581304 2585254958 363
551 iso_pu_bacteria 2582581308 2585281407 363
552 iso_pu_bacteria 2582581316 2585334432 363
553 iso_pu_bacteria 2582581867 2585404319 363
554 iso_pu_bacteria 2585427527 2585535629 363
555 iso_pu_bacteria 2585427528 2585543871 363
556 iso_pu_bacteria 2585427529 2585547204 363
557 iso_pu_bacteria 2585427530 2585556010 363
558 iso_pu_bacteria 2585427590 2585821981 363
559 iso_pu_bacteria 2585427593 2585838255 363
560 iso_pu_bacteria 2585427593 2585839649 363
561 iso_pu_bacteria 2585427594 2585842729 363
562 iso_pu_bacteria 2599185170 2599420447 363
563 iso_pu_bacteria 2615840626 2616310519 363
564 iso_pu_bacteria 2617270742 2617382227 363
565 iso_pu_bacteria 2617270742 2617384454 363
566 iso_pu_bacteria 2617270742 2617386511 363
567 iso_pu_bacteria 2643221557 2643807982 363
568 iso_pu_bacteria 2643221564 2643837668 363
569 iso_pu_bacteria 2643221599 2644002893 363
570 iso_pu_bacteria 2643221610 2644068829 363
571 iso_pu_bacteria 2643221618 2644103977 363
572 iso_pu_bacteria 2643221623 2644133289 363
573 iso_pu_bacteria 2643221626 2644150511 363
574 iso_pu_bacteria 2643221629 2644168784 363
575 iso_pu_bacteria 2643221643 2644242374 363
576 iso_pu_bacteria 2643221655 2644311167 363
577 iso_pu_bacteria 2643221659 2644335074 363
578 iso_pu_bacteria 2643221662 2644347332 363
579 iso_pu_bacteria 2643221668 2644379416 363
580 iso_pu_bacteria 2643221675 2644419900 363
581 iso_pu_bacteria 2643221680 2644453256 363
582 iso_pu_bacteria 2643221698 2644546310 363
583 iso_pu_bacteria 2643221712 2644615338 363
584 iso_pu_bacteria 2643221726 2644688716 363
585 iso_pu_bacteria 2718217927 2719385152 363
586 iso_pu_bacteria 2718217927 2719387385 363
587 iso_pu_bacteria 2718217997 2719664914 363
588 iso_pu_bacteria 2718217997 2719667044 363
589 iso_pu_bacteria 2718218199 2720491334 363
590 iso_pu_bacteria 2718218199 2720493464 363
591 iso_pu_bacteria 2718218232 2720612694 363
592 iso_pu_bacteria 2718218232 2720614921 363
593 iso_pu_bacteria 2718218233 2720619534 363
594 iso_pu_bacteria 2718218233 2720621692 363
595 iso_pu_bacteria 2718218235 2720630989 363
596 iso_pu_bacteria 2718218235 2720633020 363
597 iso_pu_bacteria 2718218269 2720774627 363
598 iso_pu_bacteria 2718218269 2720776744 363
599 iso_pu_bacteria 2718218423 2721398872 363
600 iso_pu_bacteria 2718218423 2721401020 363
601 iso_pu_bacteria 2721755556 2723026352 363
602 iso_pu_bacteria 2721755556 2723028335 363
603 iso_pu_bacteria 2721755684 2723559895 363
604 iso_pu_bacteria 2721755684 2723561962 363
605 iso_pu_bacteria 2721755685 2723566515 363
606 iso_pu_bacteria 2721755685 2723568592 363
607 iso_pu_bacteria 2721755809 2724037685 363
608 iso_pu_bacteria 2721755809 2724039833 363
609 iso_pu_bacteria 2721755819 2724089234 363
610 iso_pu_bacteria 2721755819 2724091351 363
611 iso_pu_bacteria 2721755822 2724103780 363
612 iso_pu_bacteria 2721755822 2724105857 363
613 iso_pu_bacteria 2721755823 2724109616 363
614 iso_pu_bacteria 2721755823 2724111685 363
615 iso_pu_bacteria 2728369352 2730107288 363
616 iso_pu_bacteria 2728369352 2730109271 363
617 iso_pu_bacteria 2738541293 2738799772 363
618 iso_pu_bacteria 2738543024 2739307547 363
619 iso_pu_bacteria 2751185800 2753358118 363
620 iso_pu_bacteria 2758568016 2758639104 363
621 iso_pu_bacteria 2765235802 2765465990 363
622 iso_pu_bacteria 2765235942 2766063670 363
623 iso_pu_bacteria 2765235942 2766065188 363
624 iso_pu_bacteria 2767802442 2770196626 363
625 iso_pu_bacteria 2775506902 2776269265 363
626 iso_pu_bacteria 2775506904 2776283596 363
627 iso_pu_bacteria 2775507049 2776910482 363
628 iso_pu_bacteria 2775507266 2778174945 363
629 iso_pu_bacteria 2791355253 2793281383 363
630 iso_pu_bacteria 2791355262 2793338556 363
631 iso_pu_bacteria 2818991453 2819641642 363
632 iso_pu_bacteria 2838022645 2838022853 363
633 iso_pu_bacteria 2838022645 2838024183 363
634 iso_pu_bacteria 2838035591 2838040882 363
635 iso_pu_bacteria 2838042994 2838047486 363
636 iso_pu_bacteria 2838042994 2838047795 363
637 iso_pu_bacteria 2838048938 2838051055 363
638 iso_pu_bacteria 2838048938 2838054105 363
639 iso_pu_bacteria 2838661181 2838664730 363
640 iso_pu_bacteria 2838668709 2838675287 363
641 iso_pu_bacteria 2838675328 2838679065 363
642 iso_pu_bacteria 2838701080 2838707649 363
643 iso_pu_bacteria 2838714209 2838718019 363
644 iso_pu_bacteria 2838719591 2838723364 363
645 iso_pu_bacteria 2838724970 2838728733 363
646 iso_pu_bacteria 2839993093 2839993622 363
647 iso_pu_bacteria 2840764183 2840766644 363
648 iso_pu_bacteria 2841846520 2841851459 363
649 iso_pu_bacteria 2841864319 2841865181 363
650 iso_pu_bacteria 2841864319 2841868030 363
651 iso_pu_bacteria 2842124991 2842130043 363
652 iso_pu_bacteria 2842130223 2842133784 363
653 iso_pu_bacteria 2842146304 2842152187 363
654 iso_pu_bacteria 2842152218 2842155952 363
655 iso_pu_bacteria 2842163707 2842165272 363
656 iso_pu_bacteria 2842170452 2842174264 363
657 iso_pu_bacteria 2842175837 2842179398 363
658 iso_pu_bacteria 2842187318 2842190918 363
659 iso_pu_bacteria 2842192696 2842197279 363
660 iso_pu_bacteria 2842211629 2842215233 363
661 iso_pu_bacteria 2842224351 2842228128 363
662 iso_pu_bacteria 2842250916 2842257396 363
663 iso_pu_bacteria 2842264693 2842268700 363
664 iso_pu_bacteria 2842264693 2842269947 363
665 iso_pu_bacteria 2842298080 2842298852 363
666 iso_pu_bacteria 2842304105 2842308357 363
667 iso_pu_bacteria 2842317721 2842324450 363
668 iso_pu_bacteria 2842357229 2842359280 363
669 iso_pu_bacteria 2842363717 2842367011 363
670 iso_pu_bacteria 2842428310 2842432833 363
671 iso_pu_bacteria 2842428310 2842433808 363
672 iso_pu_bacteria 2842434925 2842439138 363
673 iso_pu_bacteria 2842434925 2842440160 363
674 iso_pu_bacteria 2842441272 2842445767 363
675 iso_pu_bacteria 2842441272 2842446829 363
676 iso_pu_bacteria 2842447887 2842451383 363
677 iso_pu_bacteria 2842447887 2842453604 363
678 iso_pu_bacteria 2842462802 2842466881 363
679 iso_pu_bacteria 2842462802 2842468243 363
680 iso_pu_bacteria 2842469257 2842473752 363
681 iso_pu_bacteria 2842469257 2842474769 363
682 iso_pu_bacteria 2842482326 2842485788 363
683 iso_pu_bacteria 2842489311 2842494561 363
684 iso_pu_bacteria 2842489311 2842495579 363
685 iso_pu_bacteria 2842509118 2842510880 363
686 iso_pu_bacteria 2842871566 2842875122 363
687 iso_pu_bacteria 2844163670 2844166328 363
688 iso_pu_bacteria 2844454524 2844454824 363
689 iso_pu_bacteria 2844454524 2844457358 363
690 iso_pu_bacteria 2852387548 2852391379 363
691 iso_pu_bacteria 2854911287 2854916369 363
692 iso_pu_bacteria 2889790730 2889793173 363
693 iso_pu_bacteria 2889914905 2889917595 363
694 iso_pu_bacteria 2891373044 2891374659 363
695 iso_pu_bacteria 2894652903 2894653418 363
696 iso_pu_bacteria 2899803654 2899808365 363
697 iso_pu_bacteria 2904578770 2904579680 363
698 iso_pu_bacteria 2915650412 2915652737 363
699 iso_pu_bacteria 2919100787 2919104700 363
700 iso_pu_bacteria 2919114240 2919118256 363
701 iso_pu_bacteria 2919119836 2919120653 363
702 iso_pu_bacteria 2920822456 2920826020 363
703 iso_pu_bacteria 2923556063 2923558389 363
704 iso_pu_bacteria 2926754445 2926758020 363
705 iso_pu_bacteria 2928521798 2928522478 363
706 iso_pu_bacteria 2933006813 2933010977 363
707 iso_pu_bacteria 2933016740 2933019861 363
708 iso_pu_bacteria 2933570622 2933574806 363
709 iso_pu_bacteria 2939669807 2939673722 363
710 iso_pu_bacteria 2941499720 2941501436 363
711 iso_pu_bacteria 2989349275 2989354553 363
712 iso_pu_bacteria 2989771324 2989775162 363
713 iso_pu_bacteria 2996310559 2996311102 363
714 iso_pu_bacteria 2996336353 2996340710 363
715 iso_pu_bacteria 2996887358 2996891898 363
716 iso_pu_bacteria 2996893221 2996894613 363
717 iso_pu_bacteria 3002141150 3002142013 363
718 iso_pu_bacteria 3003930520 3003935483 363
719 iso_pu_bacteria 3005409236 3005415370 363
720 iso_pu_bacteria 3005416602 3005419181 363
721 iso_pu_bacteria 3005445848 3005449406 363
722 iso_pu_bacteria 3005452660 3005457288 363
723 iso_pu_bacteria 3005452660 3005458462 363
724 iso_pu_bacteria 639633055 639647712 363
725 iso_pu_bacteria 639633055 639650128 363
726 iso_pu_bacteria 8002285264 8002291596 363
727 iso_pu_bacteria 8005258706 8005263309 363
728 iso_pu_bacteria 8005275841 8005279924 363
729 iso_pu_bacteria 8005275841 8005282132 363
730 iso_pu_bacteria 8005289223 8005294147 363
731 iso_pu_bacteria 8005314921 8005316736 363
732 iso_pu_bacteria 8005321885 8005326425 363
733 iso_pu_bacteria 8005382845 8005383715 363
734 iso_pu_bacteria 8005382845 8005384761 363
735 iso_pu_bacteria 8005395548 8005401043 363
736 iso_pu_bacteria 8005460587 8005462227 363
737 iso_pu_bacteria 8005497431 8005501828 363
738 iso_pu_bacteria 8005542996 8005545392 363
739 iso_pu_bacteria 8005563573 8005566909 363
740 iso_pu_bacteria 8005619151 8005620823 363
741 iso_pu_bacteria 8005619151 8005623137 363
742 iso_pu_bacteria 8005626139 8005631555 363
743 iso_pu_bacteria 8005668836 8005671063 363
744 iso_pu_bacteria 8005668836 8005673206 363
745 iso_pu_bacteria 8005668836 8005673251 363
746 iso_pu_bacteria 8018127388 8018132347 363
747 iso_pu_bacteria 8024501048 8024504966 363
748 iso_pu_bacteria 8024501048 8024505821 363
749 iso_pu_bacteria 8046767195 8046769217 363
750 iso_pu_bacteria 8054558443 8054559535 363
751 3300039453 Ga0436362_1126090 Ga0436362_1126090_2653_3765 364
752 iso_pu_bacteria 2503198000 2503204066 364
753 iso_pu_bacteria 2508501123 2509118262 364
754 iso_pu_bacteria 2513237090 2513607856 364
755 iso_pu_bacteria 2924762789 2924765937 364
756 iso_pu_bacteria 2937822353 2937823384 364
757 iso_pu_bacteria 2937848649 2937850892 364
758 iso_pu_bacteria 2977922695 2977923868 364
759 iso_pu_bacteria 2977986579 2977991103 364
760 iso_pu_bacteria 2987666974 2987673263 364
761 iso_pu_bacteria 3004211236 3004213306 364
762 iso_pu_bacteria 3004218560 3004221378 364
763 3300032004 Ga0307414_10029891 Ga0307414_100298912 365
764 3300035692 Ga0373935_0268845 Ga0373935_0268845_17_1123 365
765 3300041413 Ga0439465_0021522 Ga0439465_0021522_504_1601 365
766 3300042436 Ga0439435_0033690 Ga0439435_0033690_149_1255 365
767 3300044706 Ga0466964_0002201 Ga0466964_0002201_3794_4906 365
768 3300045051 Ga0451576_0006467 Ga0451576_0006467_6376_7485 365
769 3300049776 Ga0501280_004198 Ga0501280_004198_501_1613 365
770 3300002987 JGI25159J45721_1000017 JGI25159J45721_100001714 366
771 3300003187 JGI25151J46595_10039171 JGI25151J46595_100391712 366
772 3300003354 JGI25160J50197_1000027 JGI25160J50197_1000027168 366
773 3300003374 JGI25161J50226_1009580 JGI25161J50226_10095801 366
774 3300003771 Ga0055526_1000297 Ga0055526_10002975 366
775 3300003781 Ga0055536_1007476 Ga0055536_10074762 366
776 3300004625 Ga0055543_1000403 Ga0055543_100040314 366
777 3300005262 Ga0065165_1000122 Ga0065165_100012214 366
778 3300005344 Ga0070661_100034358 Ga0070661_1000343582 366
779 3300005539 Ga0068853_100181162 Ga0068853_1001811622 366
780 3300006946 Ga0079104_1002943 Ga0079104_10029436 366
781 3300006946 Ga0079104_1003729 Ga0079104_10037292 366
782 3300009551 Ga0105238_10005908 Ga0105238_100059085 366
783 3300021320 Ga0214544_1000079 Ga0214544_100007998 366
784 3300021321 Ga0214542_1000064 Ga0214542_1000064102 366
785 3300021321 Ga0214542_1014176 Ga0214542_10141765 366
786 3300021327 Ga0214543_1000015 Ga0214543_1000015155 366
787 3300021327 Ga0214543_1000063 Ga0214543_100006310 366
788 3300022739 Ga0228711_1000004 Ga0228711_1000004198 366
789 3300022740 Ga0228710_1000002 Ga0228710_1000002146 366
790 3300025208 Ga0209436_105669 Ga0209436_1056692 366
791 3300025284 Ga0209130_1000027 Ga0209130_1000027302 366
792 3300025292 Ga0209676_1003791 Ga0209676_10037918 366
793 3300025294 Ga0209025_1000591 Ga0209025_100059115 366
794 3300025295 Ga0209564_1000193 Ga0209564_100019338 366
795 3300025297 Ga0209758_1022648 Ga0209758_10226482 366
796 3300025299 Ga0209256_1001680 Ga0209256_10016804 366
797 3300025302 Ga0207426_1000072 Ga0207426_100007214 366
798 3300025304 Ga0209257_1007258 Ga0209257_10072586 366
799 3300025920 Ga0207649_10066866 Ga0207649_100668662 366
800 3300025924 Ga0207694_10039302 Ga0207694_100393023 366
801 3300026078 Ga0207702_10031816 Ga0207702_100318163 366
802 3300027111 Ga0209281_1000030 Ga0209281_1000030113 366
803 3300027111 Ga0209281_1000144 Ga0209281_100014474 366
804 3300027666 Ga0209282_1000004 Ga0209282_1000004113 366
805 3300028794 Ga0307515_10013300 Ga0307515_1001330011 366
806 3300031967 Ga0315914_1000001 Ga0315914_1000001270 366
807 3300031995 Ga0307409_100154992 Ga0307409_1001549922 366
808 3300032004 Ga0307414_10087297 Ga0307414_100872971 366
809 3300033430 Ga0315913_1000004 Ga0315913_100000431 366
810 3300033464 Ga0315915_1000002 Ga0315915_1000002114 366
811 3300039438 Ga0436360_1023635 Ga0436360_1023635_877_1983 366
812 3300041404 Ga0439436_0002384 Ga0439436_0002384_4026_5138 366
813 3300041406 Ga0439439_0005514 Ga0439439_0005514_1760_2872 366
814 3300042010 Ga0439452_025987 Ga0439452_025987_332_1444 366
815 3300045049 Ga0466959_0105573 Ga0466959_0105573_339_1445 366
816 3300045836 Ga0466958_0057519 Ga0466958_0057519_413_1519 366
817 3300046506 Ga0495583_0014902 Ga0495583_0014902_299_1411 366
818 3300046507 Ga0495606_0012400 Ga0495606_0012400_5676_6788 366
819 3300048924 Ga0496121_0014935 Ga0496121_0014935_524_1627 366
820 3300048924 Ga0496121_0035736 Ga0496121_0035736_2697_3809 366
821 3300059493 Ga0587077_019916 Ga0587077_019916_46_1149 366
822 3300002704 JGI25155J39150_1000017 JGI25155J39150_1000017100 367
823 3300002705 JGI25156J39149_1000034 JGI25156J39149_100003411 367
824 3300002737 JGI25162J39368_1001729 JGI25162J39368_10017296 367
825 3300002738 JGI25154J39366_1000034 JGI25154J39366_100003470 367
826 3300002739 JGI25158J39367_1000032 JGI25158J39367_100003224 367
827 3300002741 JGI25157J39369_1000137 JGI25157J39369_100013736 367
828 3300002773 JGI25152J39213_1001331 JGI25152J39213_10013319 367
829 3300002773 JGI25152J39213_1004173 JGI25152J39213_10041733 367
830 3300002773 JGI25152J39213_1004522 JGI25152J39213_10045223 367
831 3300002774 JGI25150J39212_1000093 JGI25150J39212_10000936 367
832 3300002774 JGI25150J39212_1004918 JGI25150J39212_10049182 367
833 3300002987 JGI25159J45721_1000123 JGI25159J45721_100012320 367
834 3300002987 JGI25159J45721_1001871 JGI25159J45721_10018712 367
835 3300003187 JGI25151J46595_10000007 JGI25151J46595_10000007216 367
836 3300003187 JGI25151J46595_10002246 JGI25151J46595_100022468 367
837 3300003187 JGI25151J46595_10004050 JGI25151J46595_100040501 367
838 3300003187 JGI25151J46595_10008237 JGI25151J46595_100082372 367
839 3300003214 JGI25165J46597_1000821 JGI25165J46597_100082110 367
840 3300003215 JGI25153J46596_10004193 JGI25153J46596_100041936 367
841 3300003215 JGI25153J46596_10005439 JGI25153J46596_100054392 367
842 3300003215 JGI25153J46596_10008984 JGI25153J46596_100089844 367
843 3300003215 JGI25153J46596_10009234 JGI25153J46596_100092343 367
844 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006265 367
845 3300003354 JGI25160J50197_1007119 JGI25160J50197_10071194 367
846 3300003354 JGI25160J50197_1007183 JGI25160J50197_10071833 367
847 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004265 367
848 3300003374 JGI25161J50226_1000129 JGI25161J50226_100012928 367
849 3300003578 Ga0006562J51391_1007525 Ga0006562J51391_10075254 367
850 3300003771 Ga0055526_1009740 Ga0055526_10097402 367
851 3300003771 Ga0055526_1021898 Ga0055526_10218982 367
852 3300003775 Ga0055524_1000873 Ga0055524_10008736 367
853 3300003775 Ga0055524_1016513 Ga0055524_10165132 367
854 3300003790 Ga0055528_1000186 Ga0055528_100018639 367
855 3300003790 Ga0055528_1014982 Ga0055528_10149823 367
856 3300003792 Ga0055540_1004099 Ga0055540_10040992 367
857 3300004625 Ga0055543_1000002 Ga0055543_100000270 367
858 3300004625 Ga0055543_1000029 Ga0055543_100002997 367
859 3300005262 Ga0065165_1000341 Ga0065165_10003415 367
860 3300005262 Ga0065165_1020856 Ga0065165_10208561 367
861 3300005262 Ga0065165_1047781 Ga0065165_10477811 367
862 3300005335 Ga0070666_10016166 Ga0070666_100161662 367
863 3300005339 Ga0070660_100005489 Ga0070660_1000054896 367
864 3300005339 Ga0070660_100008737 Ga0070660_1000087372 367
865 3300005347 Ga0070668_100011445 Ga0070668_1000114455 367
866 3300005355 Ga0070671_100024553 Ga0070671_1000245535 367
867 3300005455 Ga0070663_100061703 Ga0070663_1000617033 367
868 3300005457 Ga0070662_100031433 Ga0070662_1000314331 367
869 3300005466 Ga0070685_10101656 Ga0070685_101016562 367
870 3300005467 Ga0070706_100102693 Ga0070706_1001026933 367
871 3300005536 Ga0070697_100018053 Ga0070697_1000180535 367
872 3300005563 Ga0068855_100026237 Ga0068855_1000262374 367
873 3300005563 Ga0068855_100085523 Ga0068855_1000855233 367
874 3300005563 Ga0068855_100279615 Ga0068855_1002796151 367
875 3300005614 Ga0068856_100267704 Ga0068856_1002677042 367
876 3300005719 Ga0068861_100146643 Ga0068861_1001466432 367
877 3300005844 Ga0068862_100164631 Ga0068862_1001646312 367
878 3300005983 Ga0081540_1002724 Ga0081540_10027243 367
879 3300006038 Ga0075365_10017568 Ga0075365_100175684 367
880 3300006175 Ga0070712_100015177 Ga0070712_1000151772 367
881 3300006178 Ga0075367_10006691 Ga0075367_100066914 367
882 3300006178 Ga0075367_10020528 Ga0075367_100205282 367
883 3300006186 Ga0075369_10001249 Ga0075369_100012492 367
884 3300006186 Ga0075369_10004629 Ga0075369_100046293 367
885 3300006195 Ga0075366_10028154 Ga0075366_100281543 367
886 3300006353 Ga0075370_10064590 Ga0075370_100645902 367
887 3300006847 Ga0075431_100014366 Ga0075431_1000143665 367
888 3300009011 Ga0105251_10001618 Ga0105251_1000161817 367
889 3300009036 Ga0105244_10020973 Ga0105244_100209732 367
890 3300009093 Ga0105240_10000216 Ga0105240_1000021613 367
891 3300009098 Ga0105245_10194629 Ga0105245_101946292 367
892 3300009147 Ga0114129_10016902 Ga0114129_100169025 367
893 3300009177 Ga0105248_10072915 Ga0105248_100729151 367
894 3300009545 Ga0105237_10000536 Ga0105237_1000053641 367
895 3300009553 Ga0105249_10034408 Ga0105249_100344081 367
896 3300009766 Ga0123342_1002765 Ga0123342_100276525 367
897 3300010375 Ga0105239_10048123 Ga0105239_100481234 367
898 3300012490 Ga0157322_1000019 Ga0157322_10000192 367
899 3300013104 Ga0157370_10000183 Ga0157370_100001837 367
900 3300013249 Ga0171463_1004 Ga0171463_1004278 367
901 3300015262 Ga0182007_10001098 Ga0182007_100010988 367
902 3300015265 Ga0182005_1004037 Ga0182005_10040372 367
903 3300015265 Ga0182005_1017068 Ga0182005_10170682 367
904 3300015690 Ga0183363_1117 Ga0183363_11176 367
905 3300021361 Ga0213872_10010481 Ga0213872_100104815 367
906 3300021361 Ga0213872_10031082 Ga0213872_100310822 367
907 3300021361 Ga0213872_10046881 Ga0213872_100468811 367
908 3300021384 Ga0213876_10002106 Ga0213876_100021065 367
909 3300021441 Ga0213871_10001938 Ga0213871_100019383 367
910 3300025206 Ga0209435_100023 Ga0209435_10002397 367
911 3300025208 Ga0209436_100026 Ga0209436_10002658 367
912 3300025233 Ga0209437_100023 Ga0209437_100023280 367
913 3300025245 Ga0207425_1000018 Ga0207425_1000018118 367
914 3300025245 Ga0207425_1001182 Ga0207425_100118211 367
915 3300025245 Ga0207425_1007116 Ga0207425_10071162 367
916 3300025246 Ga0209646_1000080 Ga0209646_100008097 367
917 3300025250 Ga0209026_1000076 Ga0209026_100007697 367
918 3300025253 Ga0209677_100216 Ga0209677_1002161 367
919 3300025256 Ga0209759_1000059 Ga0209759_100005997 367
920 3300025258 Ga0209129_1000026 Ga0209129_1000026211 367
921 3300025258 Ga0209129_1000203 Ga0209129_100020310 367
922 3300025258 Ga0209129_1000507 Ga0209129_100050714 367
923 3300025258 Ga0209129_1001741 Ga0209129_10017414 367
924 3300025258 Ga0209129_1003097 Ga0209129_10030974 367
925 3300025258 Ga0209129_1005338 Ga0209129_10053382 367
926 3300025258 Ga0209129_1007119 Ga0209129_10071193 367
927 3300025261 Ga0209233_1000062 Ga0209233_1000062195 367
928 3300025261 Ga0209233_1000428 Ga0209233_100042810 367
929 3300025273 Ga0209673_1000037 Ga0209673_100003710 367
930 3300025273 Ga0209673_1003018 Ga0209673_10030182 367
931 3300025273 Ga0209673_1006039 Ga0209673_10060392 367
932 3300025273 Ga0209673_1016820 Ga0209673_10168201 367
933 3300025284 Ga0209130_1000030 Ga0209130_100003029 367
934 3300025284 Ga0209130_1000032 Ga0209130_1000032256 367
935 3300025284 Ga0209130_1004603 Ga0209130_10046031 367
936 3300025292 Ga0209676_1000026 Ga0209676_1000026480 367
937 3300025292 Ga0209676_1029819 Ga0209676_10298192 367
938 3300025294 Ga0209025_1000035 Ga0209025_1000035211 367
939 3300025294 Ga0209025_1000052 Ga0209025_1000052254 367
940 3300025294 Ga0209025_1001447 Ga0209025_100144710 367
941 3300025294 Ga0209025_1002696 Ga0209025_100269610 367
942 3300025294 Ga0209025_1005002 Ga0209025_10050022 367
943 3300025294 Ga0209025_1012317 Ga0209025_10123174 367
944 3300025294 Ga0209025_1012720 Ga0209025_10127204 367
945 3300025294 Ga0209025_1027546 Ga0209025_10275463 367
946 3300025295 Ga0209564_1000207 Ga0209564_1000207100 367
947 3300025295 Ga0209564_1000379 Ga0209564_100037947 367
948 3300025295 Ga0209564_1012022 Ga0209564_10120222 367
949 3300025295 Ga0209564_1034858 Ga0209564_10348582 367
950 3300025297 Ga0209758_1000040 Ga0209758_1000040211 367
951 3300025297 Ga0209758_1000586 Ga0209758_100058623 367
952 3300025297 Ga0209758_1000906 Ga0209758_100090615 367
953 3300025297 Ga0209758_1001057 Ga0209758_100105715 367
954 3300025297 Ga0209758_1035653 Ga0209758_10356531 367
955 3300025298 Ga0209050_1015956 Ga0209050_10159561 367
956 3300025298 Ga0209050_1018518 Ga0209050_10185183 367
957 3300025299 Ga0209256_1000343 Ga0209256_10003432 367
958 3300025299 Ga0209256_1000893 Ga0209256_100089310 367
959 3300025299 Ga0209256_1000943 Ga0209256_100094317 367
960 3300025299 Ga0209256_1001510 Ga0209256_100151012 367
961 3300025299 Ga0209256_1028022 Ga0209256_10280221 367
962 3300025302 Ga0207426_1000047 Ga0207426_1000047371 367
963 3300025302 Ga0207426_1000077 Ga0207426_1000077256 367
964 3300025302 Ga0207426_1000094 Ga0207426_1000094264 367
965 3300025302 Ga0207426_1004911 Ga0207426_10049111 367
966 3300025303 Ga0209051_1005642 Ga0209051_10056422 367
967 3300025303 Ga0209051_1006175 Ga0209051_10061752 367
968 3300025303 Ga0209051_1029156 Ga0209051_10291562 367
969 3300025303 Ga0209051_1036723 Ga0209051_10367232 367
970 3300025304 Ga0209257_1004341 Ga0209257_10043418 367
971 3300025304 Ga0209257_1027515 Ga0209257_10275152 367
972 3300025735 Ga0207713_1030896 Ga0207713_10308961 367
973 3300025898 Ga0207692_10073388 Ga0207692_100733882 367
974 3300025903 Ga0207680_10054909 Ga0207680_100549091 367
975 3300025909 Ga0207705_10005139 Ga0207705_100051395 367
976 3300025910 Ga0207684_10018600 Ga0207684_100186001 367
977 3300025913 Ga0207695_10000319 Ga0207695_1000031990 367
978 3300025914 Ga0207671_10000078 Ga0207671_1000007890 367
979 3300025919 Ga0207657_10000364 Ga0207657_1000036447 367
980 3300025919 Ga0207657_10007827 Ga0207657_100078278 367
981 3300025922 Ga0207646_10131280 Ga0207646_101312802 367
982 3300025933 Ga0207706_10047804 Ga0207706_100478044 367
983 3300025941 Ga0207711_10016459 Ga0207711_100164596 367
984 3300025949 Ga0207667_10086550 Ga0207667_100865503 367
985 3300025949 Ga0207667_10134289 Ga0207667_101342893 367
986 3300025961 Ga0207712_10052957 Ga0207712_100529571 367
987 3300025972 Ga0207668_10027489 Ga0207668_100274893 367
988 3300025981 Ga0207640_10260119 Ga0207640_102601192 367
989 3300025986 Ga0207658_10113575 Ga0207658_101135751 367
990 3300026067 Ga0207678_10021567 Ga0207678_100215674 367
991 3300026067 Ga0207678_10082023 Ga0207678_100820232 367
992 3300027866 Ga0209813_10003842 Ga0209813_100038422 367
993 3300028379 Ga0268266_10180066 Ga0268266_101800662 367
994 3300028794 Ga0307515_10033162 Ga0307515_100331627 367
995 3300028794 Ga0307515_10089826 Ga0307515_100898262 367
996 3300028794 Ga0307515_10166444 Ga0307515_101664442 367
997 3300031456 Ga0307513_10020228 Ga0307513_100202286 367
998 3300031456 Ga0307513_10037125 Ga0307513_100371255 367
999 3300031456 Ga0307513_10134374 Ga0307513_101343742 367
1000 3300031731 Ga0307405_10010861 Ga0307405_100108613 367
1001 3300031901 Ga0307406_10011730 Ga0307406_100117303 367
1002 3300031901 Ga0307406_10048916 Ga0307406_100489162 367
1003 3300031911 Ga0307412_10005001 Ga0307412_100050016 367
1004 3300033180 Ga0307510_10223121 Ga0307510_102231211 367
1005 3300035695 Ga0373927_0019135 Ga0373927_0019135_3082_4197 367
1006 3300037471 Ga0395905_0000328 Ga0395905_0000328_3163_4278 367
1007 3300037471 Ga0395905_0116208 Ga0395905_0116208_65_1180 367
1008 3300037853 Ga0436364_1103499 Ga0436364_1103499_131_1240 367
1009 3300038443 Ga0395901_0146933 Ga0395901_0146933_845_1951 367
1010 3300039062 Ga0400483_190117 Ga0400483_190117_345_1460 367
1011 3300039437 Ga0436365_1772086 Ga0436365_1772086_29308_30417 367
1012 3300039438 Ga0436360_0402304 Ga0436360_0402304_101_1210 367
1013 3300039447 Ga0436361_0546753 Ga0436361_0546753_359_1468 367
1014 3300039447 Ga0436361_0626061 Ga0436361_0626061_79_1203 367
1015 3300039447 Ga0436361_1014632 Ga0436361_1014632_20_1129 367
1016 3300039447 Ga0436361_1173504 Ga0436361_1173504_9156_10265 367
1017 3300039453 Ga0436362_0741073 Ga0436362_0741073_833_1942 367
1018 3300041451 Ga0451791_0837071 Ga0451791_0837071_29_1144 367
1019 3300041503 Ga0451847_0087747 Ga0451847_0087747_311_1426 367
1020 3300044901 Ga0466960_0010694 Ga0466960_0010694_1726_2841 367
1021 3300046457 Ga0495590_0056563 Ga0495590_0056563_170_1285 367
1022 3300046460 Ga0495638_0020323 Ga0495638_0020323_3202_4317 367
1023 3300046506 Ga0495583_0038412 Ga0495583_0038412_264_1379 367
1024 3300046507 Ga0495606_0023785 Ga0495606_0023785_1261_2376 367
1025 3300046512 Ga0495610_0090074 Ga0495610_0090074_176_1294 367
1026 3300046515 Ga0495620_0036984 Ga0495620_0036984_148_1263 367
1027 3300046518 Ga0495631_0041670 Ga0495631_0041670_732_1847 367
1028 3300046519 Ga0495632_0052400 Ga0495632_0052400_587_1702 367
1029 3300046522 Ga0495643_0007132 Ga0495643_0007132_2570_3685 367
1030 3300046523 Ga0495644_0043159 Ga0495644_0043159_461_1576 367
1031 3300046558 Ga0495633_0088317 Ga0495633_0088317_98_1213 367
1032 3300046691 Ga0495670_0031251 Ga0495670_0031251_719_1837 367
1033 3300046694 Ga0495649_0156001 Ga0495649_0156001_41_1159 367
1034 3300047323 Ga0495683_0040527 Ga0495683_0040527_862_1977 367
1035 3300047472 Ga0495686_0078144 Ga0495686_0078144_761_1876 367
1036 3300048091 Ga0495626_0090436 Ga0495626_0090436_16_1131 367
1037 3300048903 Ga0496100_0030431 Ga0496100_0030431_2195_3310 367
1038 3300048903 Ga0496100_0143516 Ga0496100_0143516_84_1199 367
1039 3300048904 Ga0496101_0215283 Ga0496101_0215283_88_1203 367
1040 3300048906 Ga0496103_0030754 Ga0496103_0030754_791_1906 367
1041 3300048906 Ga0496103_0146721 Ga0496103_0146721_80_1195 367
1042 3300048907 Ga0496104_0398004 Ga0496104_0398004_121_1236 367
1043 3300048909 Ga0496106_0001119 Ga0496106_0001119_1277_2392 367
1044 3300048909 Ga0496106_0162318 Ga0496106_0162318_214_1329 367
1045 3300048913 Ga0496110_0182863 Ga0496110_0182863_666_1781 367
1046 3300048914 Ga0496111_0006067 Ga0496111_0006067_87_1202 367
1047 3300048919 Ga0496116_0000707 Ga0496116_0000707_41078_42193 367
1048 3300048919 Ga0496116_0003524 Ga0496116_0003524_3187_4302 367
1049 3300048919 Ga0496116_0107170 Ga0496116_0107170_432_1547 367
1050 3300048919 Ga0496116_0133490 Ga0496116_0133490_80_1195 367
1051 3300048920 Ga0496117_0001125 Ga0496117_0001125_4389_5504 367
1052 3300048920 Ga0496117_0002658 Ga0496117_0002658_19983_21098 367
1053 3300048920 Ga0496117_0003841 Ga0496117_0003841_5460_6575 367
1054 3300048920 Ga0496117_0054371 Ga0496117_0054371_1152_2267 367
1055 3300048920 Ga0496117_0082726 Ga0496117_0082726_761_1876 367
1056 3300048921 Ga0496118_0000844 Ga0496118_0000844_14367_15482 367
1057 3300048921 Ga0496118_0005841 Ga0496118_0005841_4458_5573 367
1058 3300048921 Ga0496118_0039560 Ga0496118_0039560_2065_3180 367
1059 3300048921 Ga0496118_0044496 Ga0496118_0044496_2274_3389 367
1060 3300048922 Ga0496119_0005065 Ga0496119_0005065_2490_3605 367
1061 3300048922 Ga0496119_0010985 Ga0496119_0010985_6171_7289 367
1062 3300048922 Ga0496119_0011556 Ga0496119_0011556_2382_3497 367
1063 3300048922 Ga0496119_0014637 Ga0496119_0014637_1862_2977 367
1064 3300048922 Ga0496119_0156988 Ga0496119_0156988_65_1180 367
1065 3300048923 Ga0496120_0003021 Ga0496120_0003021_3315_4430 367
1066 3300048923 Ga0496120_0005096 Ga0496120_0005096_6328_7443 367
1067 3300048924 Ga0496121_0003319 Ga0496121_0003319_4202_5320 367
1068 3300048924 Ga0496121_0006713 Ga0496121_0006713_1142_2257 367
1069 3300048924 Ga0496121_0034582 Ga0496121_0034582_1046_2161 367
1070 3300048925 Ga0496122_0000024 Ga0496122_0000024_98233_99348 367
1071 3300048925 Ga0496122_0005156 Ga0496122_0005156_13047_14162 367
1072 3300048925 Ga0496122_0006309 Ga0496122_0006309_9161_10276 367
1073 3300048925 Ga0496122_0016334 Ga0496122_0016334_2565_3680 367
1074 3300048925 Ga0496122_0020333 Ga0496122_0020333_4271_5386 367
1075 3300048925 Ga0496122_0044170 Ga0496122_0044170_2262_3377 367
1076 3300048926 Ga0496123_0000086 Ga0496123_0000086_21832_22947 367
1077 3300048926 Ga0496123_0006124 Ga0496123_0006124_10395_11510 367
1078 3300048926 Ga0496123_0012365 Ga0496123_0012365_2281_3396 367
1079 3300048926 Ga0496123_0022089 Ga0496123_0022089_3493_4608 367
1080 3300048927 Ga0496124_0000488 Ga0496124_0000488_2272_3387 367
1081 3300048927 Ga0496124_0001118 Ga0496124_0001118_20213_21328 367
1082 3300048927 Ga0496124_0011653 Ga0496124_0011653_3044_4159 367
1083 3300048927 Ga0496124_0026404 Ga0496124_0026404_3677_4792 367
1084 3300048927 Ga0496124_0052092 Ga0496124_0052092_562_1677 367
1085 3300048927 Ga0496124_0072685 Ga0496124_0072685_1584_2699 367
1086 3300048928 Ga0496125_0000134 Ga0496125_0000134_139142_140257 367
1087 3300048928 Ga0496125_0002416 Ga0496125_0002416_1871_2986 367
1088 3300048928 Ga0496125_0003868 Ga0496125_0003868_15291_16406 367
1089 3300048928 Ga0496125_0031557 Ga0496125_0031557_2667_3782 367
1090 3300048928 Ga0496125_0123800 Ga0496125_0123800_684_1799 367
1091 3300048928 Ga0496125_0130908 Ga0496125_0130908_434_1549 367
1092 3300048929 Ga0496126_0000434 Ga0496126_0000434_71629_72744 367
1093 3300048929 Ga0496126_0017199 Ga0496126_0017199_106_1221 367
1094 3300048929 Ga0496126_0043674 Ga0496126_0043674_841_1956 367
1095 3300048929 Ga0496126_0141609 Ga0496126_0141609_893_2008 367
1096 3300048929 Ga0496126_0243967 Ga0496126_0243967_159_1274 367
1097 3300049568 Ga0501031_0016746 Ga0501031_0016746_438_1556 367
1098 3300049569 Ga0501032_0000219 Ga0501032_0000219_44349_45467 367
1099 3300049569 Ga0501032_0023515 Ga0501032_0023515_1267_2382 367
1100 3300049570 Ga0501033_0000126 Ga0501033_0000126_28800_29918 367
1101 3300049571 Ga0501034_0000012 Ga0501034_0000012_249336_250451 367
1102 3300049571 Ga0501034_0002949 Ga0501034_0002949_1857_2975 367
1103 3300049571 Ga0501034_0074210 Ga0501034_0074210_1724_2839 367
1104 3300049571 Ga0501034_0143480 Ga0501034_0143480_47_1153 367
1105 3300049571 Ga0501034_0156211 Ga0501034_0156211_162_1277 367
1106 3300049571 Ga0501034_0202959 Ga0501034_0202959_323_1438 367
1107 3300049571 Ga0501034_0206490 Ga0501034_0206490_389_1504 367
1108 3300049572 Ga0501036_0000483 Ga0501036_0000483_16713_17831 367
1109 3300049572 Ga0501036_0161458 Ga0501036_0161458_367_1482 367
1110 3300049573 Ga0501037_0000021 Ga0501037_0000021_20136_21254 367
1111 3300049574 Ga0501038_0000032 Ga0501038_0000032_1857_2975 367
1112 3300049575 Ga0501039_0000025 Ga0501039_0000025_16126_17244 367
1113 3300049575 Ga0501039_0065397 Ga0501039_0065397_787_1902 367
1114 3300049576 Ga0501040_0073929 Ga0501040_0073929_413_1528 367
1115 3300049579 Ga0501043_0000015 Ga0501043_0000015_16746_17864 367
1116 3300049579 Ga0501043_0009591 Ga0501043_0009591_45_1160 367
1117 3300049579 Ga0501043_0246376 Ga0501043_0246376_217_1323 367
1118 3300049580 Ga0501046_0033565 Ga0501046_0033565_747_1862 367
1119 3300049581 Ga0501047_0035472 Ga0501047_0035472_607_1713 367
1120 3300049589 Ga0501073_0086263 Ga0501073_0086263_664_1779 367
1121 3300049590 Ga0501074_0074913 Ga0501074_0074913_421_1536 367
1122 3300049591 Ga0501075_0058420 Ga0501075_0058420_934_2049 367
1123 3300049592 Ga0501076_0016026 Ga0501076_0016026_1779_2894 367
1124 3300049593 Ga0501077_0008186 Ga0501077_0008186_866_1981 367
1125 3300049741 Ga0501079_0041947 Ga0501079_0041947_744_1859 367
1126 3300049743 Ga0501081_0016810 Ga0501081_0016810_2888_4003 367
1127 3300049744 Ga0501083_0124136 Ga0501083_0124136_317_1432 367
1128 3300049822 Ga0501035_0000436 Ga0501035_0000436_28992_30110 367
1129 3300049822 Ga0501035_0097249 Ga0501035_0097249_1191_2306 367
1130 3300049823 Ga0501044_0007432 Ga0501044_0007432_1194_2300 367
1131 3300049823 Ga0501044_0061715 Ga0501044_0061715_2638_3753 367
1132 3300049823 Ga0501044_0151769 Ga0501044_0151769_517_1632 367
1133 3300049823 Ga0501044_0348212 Ga0501044_0348212_229_1344 367
1134 3300049824 Ga0501045_0033979 Ga0501045_0033979_1851_2966 367
1135 3300050492 nmdc:mga0yw44_105419_c1 nmdc:mga0yw44_105419_c1_220_1335 367
1136 3300050507 nmdc:mga05p37_47923_c1 nmdc:mga05p37_47923_c1_1651_2766 367
1137 3300050510 nmdc:mga06r32_7328_c1 nmdc:mga06r32_7328_c1_2244_3359 367
1138 3300053086 Ga0500578_0036800 Ga0500578_0036800_1044_2159 367
1139 3300053129 Ga0500628_024616 Ga0500628_024616_82_1197 367
1140 3300053134 Ga0500658_0054670 Ga0500658_0054670_325_1440 367
1141 3300053136 Ga0500559_0003318 Ga0500559_0003318_4809_5924 367
1142 3300053136 Ga0500559_0037943 Ga0500559_0037943_226_1341 367
1143 3300053139 Ga0500568_0000219 Ga0500568_0000219_33800_34906 367
1144 3300053139 Ga0500568_0009899 Ga0500568_0009899_1172_2287 367
1145 3300053139 Ga0500568_0027708 Ga0500568_0027708_1162_2277 367
1146 3300053151 Ga0500604_0012354 Ga0500604_0012354_1044_2159 367
1147 3300053153 Ga0500616_0015630 Ga0500616_0015630_998_2104 367
1148 3300053156 Ga0500622_0002427 Ga0500622_0002427_7071_8186 367
1149 3300053156 Ga0500622_0019077 Ga0500622_0019077_180_1295 367
1150 3300053177 Ga0500636_0123787 Ga0500636_0123787_54_1169 367
1151 3300054114 Ga0501084_0084380 Ga0501084_0084380_654_1769 367
1152 3300060353 Ga0501082_0054899 Ga0501082_0054899_828_1943 367
1153 3300060353 Ga0501082_0068353 Ga0501082_0068353_769_1884 367
1154 3300002741 JGI25157J39369_1000744 JGI25157J39369_100074419 368
1155 3300003214 JGI25165J46597_1001523 JGI25165J46597_10015234 368
1156 3300003762 Ga0055542_1000516 Ga0055542_100051623 368
1157 3300005434 Ga0070709_10002006 Ga0070709_100020065 368
1158 3300005437 Ga0070710_10004005 Ga0070710_100040054 368
1159 3300005439 Ga0070711_100075003 Ga0070711_1000750032 368
1160 3300005445 Ga0070708_100037445 Ga0070708_1000374454 368
1161 3300005467 Ga0070706_100111759 Ga0070706_1001117592 368
1162 3300005468 Ga0070707_100152678 Ga0070707_1001526783 368
1163 3300005471 Ga0070698_100005977 Ga0070698_1000059776 368
1164 3300006175 Ga0070712_100085714 Ga0070712_1000857142 368
1165 3300009093 Ga0105240_10256218 Ga0105240_102562182 368
1166 3300009174 Ga0105241_10009211 Ga0105241_100092116 368
1167 3300009545 Ga0105237_10001312 Ga0105237_100013126 368
1168 3300009551 Ga0105238_10053246 Ga0105238_100532462 368
1169 3300010375 Ga0105239_10003602 Ga0105239_100036026 368
1170 3300010375 Ga0105239_10135236 Ga0105239_101352363 368
1171 3300013104 Ga0157370_10198145 Ga0157370_101981452 368
1172 3300013296 Ga0157374_10041999 Ga0157374_100419992 368
1173 3300013297 Ga0157378_10179202 Ga0157378_101792022 368
1174 3300021361 Ga0213872_10026621 Ga0213872_100266212 368
1175 3300025250 Ga0209026_1000116 Ga0209026_100011644 368
1176 3300025254 Ga0209148_1000078 Ga0209148_1000078182 368
1177 3300025256 Ga0209759_1000153 Ga0209759_100015379 368
1178 3300025261 Ga0209233_1000488 Ga0209233_100048810 368
1179 3300025898 Ga0207692_10003598 Ga0207692_100035983 368
1180 3300025906 Ga0207699_10006930 Ga0207699_100069302 368
1181 3300025913 Ga0207695_10156628 Ga0207695_101566282 368
1182 3300025914 Ga0207671_10004703 Ga0207671_100047034 368
1183 3300025916 Ga0207663_10036590 Ga0207663_100365902 368
1184 3300025919 Ga0207657_10109199 Ga0207657_101091992 368
1185 3300025939 Ga0207665_10003339 Ga0207665_100033394 368
1186 3300028379 Ga0268266_10000606 Ga0268266_1000060638 368
1187 3300031616 Ga0307508_10163951 Ga0307508_101639512 368
1188 3300033180 Ga0307510_10204709 Ga0307510_102047092 368
1189 3300037471 Ga0395905_0116468 Ga0395905_0116468_592_1701 368
1190 3300039437 Ga0436365_1009141 Ga0436365_1009141_255_1379 368
1191 3300039438 Ga0436360_0800328 Ga0436360_0800328_2283_3407 368
1192 3300039438 Ga0436360_0934493 Ga0436360_0934493_4240_5364 368
1193 3300039438 Ga0436360_1270075 Ga0436360_1270075_69_1193 368
1194 3300039438 Ga0436360_1350032 Ga0436360_1350032_332_1456 368
1195 3300039447 Ga0436361_0048400 Ga0436361_0048400_3264_4376 368
1196 3300039447 Ga0436361_0715372 Ga0436361_0715372_3533_4648 368
1197 3300039447 Ga0436361_1195026 Ga0436361_1195026_1241_2365 368
1198 3300046460 Ga0495638_0143729 Ga0495638_0143729_40_1146 368
1199 3300048929 Ga0496126_0313509 Ga0496126_0313509_94_1218 368
1200 3300050492 nmdc:mga0yw44_49921_c2 nmdc:mga0yw44_49921_c2_496_1602 368
1201 3300053177 Ga0500636_0004433 Ga0500636_0004433_1585_2694 368
1202 3300059508 Ga0587088_005066 Ga0587088_005066_182_1288 368
1203 3300048929 Ga0496126_0017103 Ga0496126_0017103_1712_2842 369
1204 iso_pu_bacteria 2876369609 2876371648 369
1205 iso_pu_bacteria 2881147464 2881149339 369
1206 iso_pu_bacteria 2885305155 2885307656 369
1207 iso_pu_bacteria 2885326080 2885333086 369
1208 3300001989 JGI24739J22299_10014042 JGI24739J22299_100140423 373
1209 3300005539 Ga0068853_100033270 Ga0068853_1000332704 373
1210 3300005563 Ga0068855_100435867 Ga0068855_1004358672 373
1211 3300005614 Ga0068856_100066976 Ga0068856_1000669762 373
1212 3300009545 Ga0105237_10048283 Ga0105237_100482831 373
1213 3300025904 Ga0207647_10011076 Ga0207647_100110762 373
1214 3300026116 Ga0207674_10229856 Ga0207674_102298562 373
1215 3300050494 nmdc:mga06z11_23383_c1 nmdc:mga06z11_23383_c1_1445_2566 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

80

223

0.88

PF08402

TOBE_2

TOBE domain

344

421

0.85

PF17912

OB_MalK

MalK OB fold domain

296

351

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9551 9 238
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9527 9 373
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.945 9 373
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9418 7 222
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9391 9 238
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9842 9 222 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9766 8 220 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9684 9 240 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9683 9 242 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9647 9 239 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9934 7 226 GO:0005524
GO:0016887
GO:0055052
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9845 9 191 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9797 7 230 GO:0005524
GO:0016887
AF-A0A1V4RJG8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9747 7 152 GO:0005524
GO:0016887
GO:0055052
AF-A6DHY6-F1-model_v4 Putative multiple sugar transport protein 0.9718 9 217 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.85 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map