F491733

General Info

Members Datasets Scaffolds Average Seq Length
1211 686 958 429

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0923208|Ga0436364_0923208_124_1545
Length 473
Sequence LEAKRQRPSPAARLKRRNERKGLTRPWHLWQKGRRPTNAEFDMPAPQPPGFETLSLHAGQHPDPVTGARAVPIYQTTSYVFQDADHAAALFNLERAGHIYTRISNPTIAVLEERLAALEDGVGAICTASGMAAMHLAIATLLNAGDHIVASASLYGGTINLLAHTLPRFGITTTFVKPRDLDAFRAAIKPNTRLVIGETIGNPGLEVLDIPKVAEIAHAAKIPLLIDNTFATPYLSKPIELGADIVMHSATKWIGGHGIAIGGAIVDGGRFDWRASGKFGVLTEPYGGYHGIVFDEQFGTAAFIMRARTEGLRDFGACLSPTNAFQLLQGVETLGVRMDRHMQNTQLVLEALKSNKAVDWVLHPSLEDHSDYQLAKTLLPRGAGSIVSFGIKGGRPAGRKFIESLRMISHLANVGDAKTLVIHPASTTHQQMDAEQLKAAGIGEELVRLSVGIEAVADITDDLGSALRVSQRV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
23 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
24 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
25 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
26 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
27 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
28 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
29 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
30 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
31 2643221651 Afipia sp. Root123D2 Isolate Unclassified
32 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
33 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
34 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
35 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
36 2738541295 Bacillus sp. OK085 Isolate Unclassified
37 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
38 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
39 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
40 2791355199
41 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
42 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
43 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
44 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
45 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
46 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
47 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
48 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
49 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
50 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
51 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
52 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
53 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
54 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
55 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
56 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
57 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
58 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
59 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
60 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
61 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
62 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
63 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
64 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
65 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
66 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
67 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
68 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
69 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
70 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
71 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
72 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
73 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
74 2842682962 Bacillus sp. R-72492 Isolate Unclassified
75 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
76 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
77 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
78 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
79 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
80 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
81 2849139964 Bacillus sp. R-71875 Isolate Unclassified
82 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
83 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
84 2857581216 Bacillus sp. R-71922 Isolate Unclassified
85 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
86 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
87 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
88 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
89 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
90 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
91 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
92 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
93 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
94 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
95 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
96 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
97 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
98 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
99 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
100 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
101 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
102 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
103 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
104 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
105 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
106 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
107 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
108 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
109 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
110 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
111 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
112 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
113 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
114 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
115 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
116 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
117 2904699407
118 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
119 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
120 2906610324
121 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
122 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
123 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
124 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
125 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
126 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
127 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
128 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
129 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
130 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
131 2922368715
132 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
133 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
134 2922425934
135 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
136 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
137 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
138 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
139 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
140 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
141 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
142 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
143 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
144 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
145 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
146 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
147 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
148 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
149 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
150 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
151 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
152 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
153 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
154 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
155 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
156 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
157 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
158 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
159 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
160 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
161 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
162 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
163 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
164 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
165 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
166 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
167 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
168 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
169 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
170 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
171 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
172 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
173 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
174 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
175 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
176 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
177 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
178 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
179 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
180 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
181 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
182 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
183 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
184 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
185 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
186 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
187 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
188 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
189 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
190 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
191 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
192 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
193 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
194 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
195 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
196 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
197 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
198 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
199 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
200 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
201 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
202 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
203 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
204 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
205 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
206 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
207 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
208 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
209 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
210 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
211 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
212 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
213 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
214 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
215 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
217 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
218 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
219 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
220 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
221 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
222 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
223 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
224 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
225 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
226 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
227 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
228 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
229 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
230 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
231 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
232 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
233 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
234 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
235 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
236 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
237 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
238 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
239 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
240 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
241 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
242 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
243 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
244 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
245 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
246 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
247 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
248 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
249 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
250 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
251 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
252 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
253 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
254 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
255 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
256 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
257 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
258 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
259 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
260 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
261 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
262 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
263 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
264 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
265 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
266 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
267 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
268 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
269 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
270 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
271 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
272 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
273 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
274 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
275 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
276 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
277 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
278 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
279 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
280 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
281 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
282 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
283 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
284 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
285 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
286 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
289 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
290 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
291 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
292 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
293 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
294 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
295 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
296 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
297 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
298 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
299 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
300 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
301 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
302 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
303 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
304 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
305 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
306 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
307 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
308 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
309 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
310 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
311 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
312 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
313 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
314 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
315 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
316 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
317 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
318 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
319 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
320 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
321 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
322 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
323 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
324 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
326 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
330 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
331 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
332 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
333 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
377 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
378 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
379 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
380 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
381 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
385 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
386 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
387 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
388 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
389 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
390 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
391 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
392 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
393 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
394 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
395 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
396 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
397 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
398 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
399 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
400 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
401 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
402 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
403 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
404 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
405 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
406 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
407 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
408 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
409 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
410 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
411 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
412 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
413 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
414 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
415 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
416 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
417 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
418 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
419 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
420 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
421 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
422 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
423 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
424 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
425 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
426 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
427 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
428 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
429 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
430 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
431 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
432 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
433 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
434 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
435 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
436 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
437 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
438 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
439 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
440 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
441 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
442 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
443 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
444 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
445 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
446 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
447 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
448 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
449 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
450 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
451 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
452 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
453 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
454 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
455 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
456 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
457 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
458 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
459 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
460 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
461 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
462 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
463 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
464 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
465 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
466 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
467 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
468 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
469 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
470 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
471 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
472 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
473 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
474 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
475 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
476 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
477 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
478 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
479 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
480 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
481 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
482 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
483 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
484 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
485 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
486 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
487 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
488 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
489 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
490 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
491 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
492 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
493 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
494 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
495 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
496 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
497 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
498 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
499 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
500 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
501 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
502 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
503 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
504 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
505 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
506 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
507 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
508 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
509 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
510 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
511 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
512 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
513 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
514 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
515 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
516 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
517 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
518 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
519 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
520 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
521 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
522 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
523 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
524 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
525 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
526 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
527 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
528 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
529 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
530 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
531 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
532 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
533 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
534 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
535 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
536 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
537 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
538 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
539 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
540 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
541 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
542 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
543 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
544 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
545 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
546 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
547 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
548 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
549 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
550 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
551 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
552 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
553 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
555 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
559 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
560 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
563 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
573 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
574 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
575 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
576 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
577 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
578 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
579 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
580 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
581 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
582 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
583 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
584 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
585 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
586 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
587 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
589 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
590 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
591 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
592 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
593 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
594 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
595 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
596 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
597 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
598 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
599 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
600 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
601 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
602 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
603 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
604 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
605 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
606 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
607 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
608 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
609 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
610 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
611 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
612 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
613 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
614 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
615 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
616 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
617 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
618 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
619 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
620 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
621 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
622 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
623 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
624 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
625 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
626 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
627 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
628 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
629 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
630 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
631 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
632 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
633 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
634 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
635 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
636 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
637 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
638 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
639 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
640 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
641 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
642 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
643 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
644 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
645 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
646 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
647 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
648 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
649 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
650 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
651 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
652 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
653 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
654 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
655 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
656 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
657 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
658 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
659 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
660 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
661 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
662 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
663 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
664 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
665 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
666 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
667 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
668 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
669 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
670 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
671 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
672 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
673 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
674 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
675 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
676 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
677 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
678 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
679 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
680 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
681 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
682 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
683 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
684 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
685 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
686 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.02
Metatranscriptomes 0.41
Isolates 20.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.4
Nodule 15.19
Rhizoplane 5.37
Rhizosphere 57.06
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000038 3300003203 Bacteria 59759
2 JGI25406J46586_10001332 3300003203 Bacteria 11620
3 JGI25153J46596_10001090 3300003215 Bacteria 16506
4 JGI25153J46596_10001143 3300003215 Bacteria 16067
5 JGI25153J46596_10013136 3300003215 Bacteria 3520
6 JGI25160J50197_1009430 3300003354 Bacteria 3620
7 JGI25404J52841_10001402 3300003659 Bacteria 4228
8 JGI25404J52841_10005555 3300003659 Bacteria 2605
9 Ga0055543_1003719 3300004625 Bacteria 4368
10 Ga0065165_1000721 3300005262 Bacteria 46476
11 Ga0065165_1002559 3300005262 Bacteria 15029
12 Ga0065165_1017679 3300005262 Bacteria 2615
13 Ga0065165_1019229 3300005262 Bacteria 2446
14 Ga0070658_10031329 3300005327 Bacteria 4270
15 Ga0070683_100004866 3300005329 Bacteria 11124
16 Ga0070670_100013506 3300005331 Bacteria 6996
17 Ga0068869_100037881 3300005334 Bacteria 3431
18 Ga0068869_100072454 3300005334 Bacteria 2552
19 Ga0070680_100084672 3300005336 Bacteria 2619
20 Ga0070682_100012739 3300005337 Bacteria 4826
21 Ga0068868_100026969 3300005338 Bacteria 4381
22 Ga0068868_100041790 3300005338 Bacteria 3573
23 Ga0068868_100061439 3300005338 Bacteria 2976
24 Ga0070660_100010412 3300005339 Bacteria 6572
25 Ga0070689_100007055 3300005340 Bacteria 7819
26 Ga0070691_10001706 3300005341 Bacteria 9524
27 Ga0070691_10026246 3300005341 Bacteria 2715
28 Ga0070661_100053990 3300005344 Bacteria 2943
29 Ga0070671_100000170 3300005355 Bacteria 42992
30 Ga0070673_100004457 3300005364 Bacteria 8852
31 Ga0070688_100188897 3300005365 Bacteria 1434
32 Ga0070659_100032467 3300005366 Bacteria 4050
33 Ga0070659_100048523 3300005366 Bacteria 3336
34 Ga0070667_100034398 3300005367 Bacteria 4239
35 Ga0070703_10011629 3300005406 Bacteria 2489
36 Ga0070709_10000734 3300005434 Bacteria 18520
37 Ga0070709_10021201 3300005434 Bacteria 3782
38 Ga0070709_10121040 3300005434 Bacteria 1774
39 Ga0070714_100000556 3300005435 Bacteria 26845
40 Ga0070714_100017873 3300005435 Bacteria 5750
41 Ga0070713_100062633 3300005436 Bacteria 3116
42 Ga0070713_100135585 3300005436 Bacteria 2175
43 Ga0070713_100319758 3300005436 Bacteria 1433
44 Ga0070710_10001203 3300005437 Bacteria 12244
45 Ga0070710_10139683 3300005437 Bacteria 1484
46 Ga0070711_100000989 3300005439 Bacteria 15060
47 Ga0070711_100003099 3300005439 Bacteria 9616
48 Ga0070711_100073841 3300005439 Bacteria 2411
49 Ga0070694_100000604 3300005444 Bacteria 19763
50 Ga0070694_100048368 3300005444 Bacteria 2861
51 Ga0070708_100012245 3300005445 Bacteria 6994
52 Ga0070708_100127008 3300005445 Bacteria 2358
53 Ga0070678_100134219 3300005456 Bacteria 1971
54 Ga0070681_10035275 3300005458 Bacteria 5025
55 Ga0070681_10064136 3300005458 Bacteria 3645
56 Ga0070681_10073291 3300005458 Bacteria 3386
57 Ga0070681_10109546 3300005458 Bacteria 2701
58 Ga0068867_100133690 3300005459 Bacteria 1931
59 Ga0070698_100104941 3300005471 Bacteria 2796
60 Ga0070699_100001264 3300005518 Bacteria 23301
61 Ga0070679_100017666 3300005530 Bacteria 6905
62 Ga0070679_100125200 3300005530 Bacteria 2552
63 Ga0070684_100002394 3300005535 Bacteria 13823
64 Ga0070684_100010958 3300005535 Bacteria 7208
65 Ga0070684_100039358 3300005535 Bacteria 4066
66 Ga0070684_100058840 3300005535 Bacteria 3359
67 Ga0070697_100012239 3300005536 Bacteria 6719
68 Ga0068853_100015741 3300005539 Bacteria 6212
69 Ga0070695_100024951 3300005545 Bacteria 3687
70 Ga0070696_100005035 3300005546 Bacteria 8829
71 Ga0070665_100013287 3300005548 Bacteria 8290
72 Ga0070665_100013848 3300005548 Bacteria 8112
73 Ga0070665_100069949 3300005548 Bacteria 3517
74 Ga0070704_100001210 3300005549 Bacteria 13549
75 Ga0070704_100174236 3300005549 Bacteria 1714
76 Ga0068855_100008028 3300005563 Bacteria 12750
77 Ga0068855_100066927 3300005563 Bacteria 4187
78 Ga0068855_100197158 3300005563 Bacteria 2268
79 Ga0068857_100038607 3300005577 Bacteria 4229
80 Ga0068857_100038848 3300005577 Bacteria 4215
81 Ga0068856_100003313 3300005614 Bacteria 16364
82 Ga0068856_100013310 3300005614 Bacteria 7967
83 Ga0068852_100001667 3300005616 Bacteria 15132
84 Ga0068852_100066401 3300005616 Bacteria 3150
85 Ga0068859_100004768 3300005617 Bacteria 13789
86 Ga0068861_100031380 3300005719 Bacteria 3903
87 Ga0068861_100076931 3300005719 Bacteria 2602
88 Ga0068851_10015821 3300005834 Bacteria 3600
89 Ga0068858_100186390 3300005842 Bacteria 1960
90 Ga0068860_100000711 3300005843 Bacteria 38159
91 Ga0068860_100114271 3300005843 Bacteria 2581
92 Ga0068862_100002512 3300005844 Bacteria 16242
93 Ga0068862_100022673 3300005844 Bacteria 5253
94 Ga0068862_100115227 3300005844 Bacteria 2363
95 Ga0081455_10000017 3300005937 Bacteria 174550
96 Ga0081455_10002635 3300005937 Bacteria 21263
97 Ga0081455_10017707 3300005937 Bacteria 6817
98 Ga0081455_10087778 3300005937 Bacteria 2530
99 Ga0081538_10004632 3300005981 Bacteria 12624
100 Ga0081538_10017999 3300005981 Bacteria 5332
101 Ga0081538_10057238 3300005981 Bacteria 2274
102 Ga0081540_1000059 3300005983 Bacteria 120226
103 Ga0081540_1004330 3300005983 Bacteria 10872
104 Ga0081540_1005964 3300005983 Bacteria 8977
105 Ga0081540_1006212 3300005983 Bacteria 8759
106 Ga0081540_1009418 3300005983 Bacteria 6729
107 Ga0081540_1013117 3300005983 Bacteria 5411
108 Ga0081540_1013193 3300005983 Bacteria 5389
109 Ga0081540_1021925 3300005983 Bacteria 3785
110 Ga0081540_1022189 3300005983 Bacteria 3752
111 Ga0081540_1026518 3300005983 Bacteria 3306
112 Ga0081540_1045581 3300005983 Bacteria 2225
113 Ga0081540_1047465 3300005983 Bacteria 2159
114 Ga0081539_10000080 3300005985 Bacteria 222745
115 Ga0081539_10000220 3300005985 Bacteria 133834
116 Ga0081539_10027918 3300005985 Bacteria 3562
117 Ga0070717_10000884 3300006028 Bacteria 19823
118 Ga0070717_10007593 3300006028 Bacteria 8058
119 Ga0070717_10028344 3300006028 Bacteria 4482
120 Ga0075365_10000311 3300006038 Bacteria 17078
121 Ga0075365_10055836 3300006038 Bacteria 2623
122 Ga0075365_10109419 3300006038 Bacteria 1898
123 Ga0075365_10111954 3300006038 Bacteria 1876
124 Ga0075368_10003624 3300006042 Bacteria 5174
125 Ga0075368_10004781 3300006042 Bacteria 4612
126 Ga0075363_100001272 3300006048 Bacteria 9377
127 Ga0075363_100043534 3300006048 Bacteria 2375
128 Ga0075364_10001505 3300006051 Bacteria 12686
129 Ga0075364_10050231 3300006051 Bacteria 2722
130 Ga0075364_10135304 3300006051 Bacteria 1655
131 Ga0070715_10001487 3300006163 Bacteria 6828
132 Ga0070716_100005650 3300006173 Bacteria 6073
133 Ga0070712_100024322 3300006175 Bacteria 4012
134 Ga0075362_10001659 3300006177 Bacteria 7214
135 Ga0075362_10010512 3300006177 Bacteria 3616
136 Ga0075367_10001516 3300006178 Bacteria 10041
137 Ga0075367_10017979 3300006178 Bacteria 3892
138 Ga0075367_10028820 3300006178 Bacteria 3170
139 Ga0075367_10040558 3300006178 Bacteria 2719
140 Ga0075367_10133111 3300006178 Bacteria 1538
141 Ga0075369_10030898 3300006186 Bacteria 2257
142 Ga0075369_10035959 3300006186 Bacteria 2106
143 Ga0075370_10021919 3300006353 Bacteria 3503
144 Ga0075370_10053904 3300006353 Bacteria 2282
145 Ga0068871_100098349 3300006358 Bacteria 2448
146 Ga0075428_100201205 3300006844 Bacteria 2153
147 Ga0075430_100125794 3300006846 Bacteria 2136
148 Ga0075431_100002016 3300006847 Bacteria 19387
149 Ga0075434_100011193 3300006871 Bacteria 8443
150 Ga0075434_100024076 3300006871 Bacteria 5947
151 Ga0075429_100012416 3300006880 Bacteria 7391
152 Ga0097620_100004768 3300006931 Bacteria 13789
153 Ga0099825_1020047 3300006941 Bacteria 4845
154 Ga0099824_1012895 3300006942 Bacteria 8903
155 Ga0099822_1003531 3300006943 Bacteria 20044
156 Ga0099823_1007767 3300006944 Bacteria 10911
157 Ga0075435_100053000 3300007076 Bacteria 3270
158 Ga0105240_10005052 3300009093 Bacteria 19785
159 Ga0105240_10302018 3300009093 Bacteria 1831
160 Ga0105240_10402852 3300009093 Bacteria 1540
161 Ga0111539_10317521 3300009094 Bacteria 1813
162 Ga0105245_10001527 3300009098 Bacteria 20967
163 Ga0105245_10008614 3300009098 Bacteria 8897
164 Ga0105247_10016349 3300009101 Bacteria 4445
165 Ga0105247_10068972 3300009101 Bacteria 2205
166 Ga0114129_10068570 3300009147 Bacteria 4945
167 Ga0114129_10086246 3300009147 Bacteria 4354
168 Ga0114129_10196571 3300009147 Bacteria 2734
169 Ga0105241_10009951 3300009174 Bacteria 6984
170 Ga0105248_10049003 3300009177 Bacteria 4738
171 Ga0105237_10001825 3300009545 Bacteria 27462
172 Ga0105237_10073492 3300009545 Bacteria 3411
173 Ga0105237_10092269 3300009545 Bacteria 3018
174 Ga0105237_10179331 3300009545 Bacteria 2119
175 Ga0105238_10047043 3300009551 Bacteria 4351
176 Ga0105238_10099556 3300009551 Bacteria 2890
177 Ga0105028_101203 3300009993 Bacteria 2732
178 Ga0099796_10038186 3300010159 Bacteria 1610
179 Ga0105239_10058217 3300010375 Bacteria 4240
180 Ga0105239_10090880 3300010375 Bacteria 3368
181 Ga0105246_10144712 3300011119 Bacteria 1792
182 Ga0157373_10051862 3300013100 Bacteria 2920
183 Ga0157371_10009033 3300013102 Bacteria 7880
184 Ga0157370_10114337 3300013104 Bacteria 2521
185 Ga0157370_10119024 3300013104 Bacteria 2466
186 Ga0157369_10004066 3300013105 Bacteria 17322
187 Ga0157369_10014664 3300013105 Bacteria 8843
188 Ga0157369_10021176 3300013105 Bacteria 7269
189 Ga0157369_10037827 3300013105 Bacteria 5281
190 Ga0157369_10293897 3300013105 Bacteria 1691
191 Ga0157374_10012732 3300013296 Bacteria 7328
192 Ga0163162_10040120 3300013306 Bacteria 4680
193 Ga0157372_10025437 3300013307 Bacteria 6436
194 Ga0157375_10017268 3300013308 Bacteria 6508
195 Ga0157375_10239327 3300013308 Bacteria 1975
196 Ga0157375_10439566 3300013308 Bacteria 1470
197 Ga0163163_10031880 3300014325 Bacteria 5090
198 Ga0163163_10038268 3300014325 Bacteria 4674
199 Ga0163163_10056783 3300014325 Bacteria 3869
200 Ga0163163_10127689 3300014325 Bacteria 2581
201 Ga0157379_10098154 3300014968 Bacteria 2630
202 Ga0157376_10005380 3300014969 Bacteria 8949
203 Ga0214544_1000007 3300021320 Bacteria 379989
204 Ga0214542_1000007 3300021321 Bacteria 291816
205 Ga0214545_1000006 3300021324 Bacteria 291693
206 Ga0214545_1025698 3300021324 Bacteria 3350
207 Ga0214543_1000009 3300021327 Bacteria 384302
208 Ga0213872_10018555 3300021361 Bacteria 3208
209 Ga0213876_10010761 3300021384 Bacteria 4902
210 Ga0209677_101607 3300025253 Bacteria 9538
211 Ga0209148_1000216 3300025254 Bacteria 98209
212 Ga0209233_1004139 3300025261 Bacteria 4992
213 Ga0209455_1001447 3300025272 Bacteria 10717
214 Ga0209673_1030417 3300025273 Bacteria 1701
215 Ga0209675_1007363 3300025291 Bacteria 4232
216 Ga0209564_1001014 3300025295 Bacteria 34834
217 Ga0209564_1004938 3300025295 Bacteria 7883
218 Ga0209564_1010262 3300025295 Bacteria 4339
219 Ga0209758_1000015 3300025297 Bacteria 851943
220 Ga0209758_1000161 3300025297 Bacteria 154278
221 Ga0209758_1001304 3300025297 Bacteria 30476
222 Ga0209758_1007191 3300025297 Bacteria 7672
223 Ga0209758_1009851 3300025297 Bacteria 5839
224 Ga0209758_1015686 3300025297 Bacteria 3905
225 Ga0209758_1035145 3300025297 Bacteria 1980
226 Ga0209256_1007571 3300025299 Bacteria 5304
227 Ga0209256_1013156 3300025299 Bacteria 3093
228 Ga0207426_1000186 3300025302 Bacteria 154130
229 Ga0207426_1001742 3300025302 Bacteria 16568
230 Ga0207426_1012233 3300025302 Bacteria 3232
231 Ga0209257_1000368 3300025304 Bacteria 91038
232 Ga0207653_10002688 3300025885 Bacteria 5649
233 Ga0207692_10002111 3300025898 Bacteria 7583
234 Ga0207692_10024479 3300025898 Bacteria 2807
235 Ga0207710_10020548 3300025900 Bacteria 2823
236 Ga0207710_10042202 3300025900 Bacteria 2025
237 Ga0207688_10042576 3300025901 Bacteria 2528
238 Ga0207647_10036925 3300025904 Bacteria 3101
239 Ga0207699_10002096 3300025906 Bacteria 9428
240 Ga0207699_10014465 3300025906 Bacteria 4069
241 Ga0207705_10135086 3300025909 Bacteria 1838
242 Ga0207684_10064450 3300025910 Bacteria 3111
243 Ga0207684_10097208 3300025910 Bacteria 2514
244 Ga0207654_10029722 3300025911 Bacteria 2995
245 Ga0207707_10002566 3300025912 Bacteria 16278
246 Ga0207707_10004618 3300025912 Bacteria 12098
247 Ga0207707_10012807 3300025912 Bacteria 7295
248 Ga0207707_10016469 3300025912 Bacteria 6446
249 Ga0207707_10095500 3300025912 Bacteria 2598
250 Ga0207695_10000006 3300025913 Bacteria 1135309
251 Ga0207695_10029203 3300025913 Bacteria 6099
252 Ga0207695_10135448 3300025913 Bacteria 2416
253 Ga0207695_10208308 3300025913 Bacteria 1867
254 Ga0207671_10005136 3300025914 Bacteria 12194
255 Ga0207671_10079706 3300025914 Bacteria 2454
256 Ga0207693_10001388 3300025915 Bacteria 21472
257 Ga0207693_10018758 3300025915 Bacteria 5505
258 Ga0207693_10033960 3300025915 Bacteria 4025
259 Ga0207663_10010667 3300025916 Bacteria 4900
260 Ga0207663_10012993 3300025916 Bacteria 4515
261 Ga0207663_10016593 3300025916 Bacteria 4087
262 Ga0207660_10001934 3300025917 Bacteria 13823
263 Ga0207660_10022103 3300025917 Bacteria 4283
264 Ga0207660_10081312 3300025917 Bacteria 2381
265 Ga0207657_10001315 3300025919 Bacteria 26383
266 Ga0207657_10012952 3300025919 Bacteria 8199
267 Ga0207652_10014815 3300025921 Bacteria 6321
268 Ga0207652_10016463 3300025921 Bacteria 6038
269 Ga0207694_10063186 3300025924 Bacteria 2884
270 Ga0207650_10009533 3300025925 Bacteria 6635
271 Ga0207700_10001452 3300025928 Bacteria 13448
272 Ga0207700_10004770 3300025928 Bacteria 8042
273 Ga0207700_10034329 3300025928 Bacteria 3641
274 Ga0207700_10043367 3300025928 Bacteria 3303
275 Ga0207700_10043639 3300025928 Bacteria 3295
276 Ga0207700_10126505 3300025928 Bacteria 2080
277 Ga0207700_10251466 3300025928 Bacteria 1510
278 Ga0207644_10001194 3300025931 Bacteria 16721
279 Ga0207690_10050422 3300025932 Bacteria 2779
280 Ga0207706_10039347 3300025933 Bacteria 4192
281 Ga0207706_10059280 3300025933 Bacteria 3371
282 Ga0207709_10048312 3300025935 Bacteria 2592
283 Ga0207670_10007348 3300025936 Bacteria 6142
284 Ga0207669_10002669 3300025937 Bacteria 7634
285 Ga0207665_10000874 3300025939 Bacteria 20343
286 Ga0207665_10005463 3300025939 Bacteria 8482
287 Ga0207665_10019486 3300025939 Bacteria 4460
288 Ga0207665_10047796 3300025939 Bacteria 2870
289 Ga0207711_10061786 3300025941 Bacteria 3230
290 Ga0207661_10001422 3300025944 Bacteria 16129
291 Ga0207661_10021344 3300025944 Bacteria 4850
292 Ga0207661_10117171 3300025944 Bacteria 2262
293 Ga0207679_10127642 3300025945 Bacteria 2035
294 Ga0207667_10012575 3300025949 Bacteria 9738
295 Ga0207667_10248073 3300025949 Bacteria 1821
296 Ga0207651_10064458 3300025960 Bacteria 2565
297 Ga0207712_10092064 3300025961 Bacteria 2234
298 Ga0207668_10069457 3300025972 Bacteria 2508
299 Ga0207668_10237981 3300025972 Bacteria 1471
300 Ga0207677_10005921 3300026023 Bacteria 6654
301 Ga0207677_10104908 3300026023 Bacteria 2090
302 Ga0207639_10014696 3300026041 Bacteria 5512
303 Ga0207678_10010380 3300026067 Bacteria 8177
304 Ga0207678_10032772 3300026067 Bacteria 4528
305 Ga0207678_10048937 3300026067 Bacteria 3653
306 Ga0207678_10050044 3300026067 Bacteria 3610
307 Ga0207678_10105136 3300026067 Bacteria 2409
308 Ga0207708_10003078 3300026075 Bacteria 12277
309 Ga0207708_10119042 3300026075 Bacteria 2057
310 Ga0207702_10000325 3300026078 Bacteria 54690
311 Ga0207674_10037716 3300026116 Bacteria 5023
312 Ga0207674_10090075 3300026116 Bacteria 3059
313 Ga0207674_10121292 3300026116 Bacteria 2582
314 Ga0207675_100080248 3300026118 Bacteria 3059
315 Ga0207675_100128525 3300026118 Bacteria 2402
316 Ga0207683_10021712 3300026121 Bacteria 5502
317 Ga0207683_10214283 3300026121 Bacteria 1753
318 Ga0209389_1000062 3300027296 Bacteria 102842
319 Ga0209389_1000072 3300027296 Bacteria 96795
320 Ga0209589_1000011 3300027357 Bacteria 236981
321 Ga0209589_1000270 3300027357 Bacteria 65577
322 Ga0209489_100012 3300027361 Bacteria 236981
323 Ga0209489_100160 3300027361 Bacteria 102842
324 Ga0209489_100206 3300027361 Bacteria 96866
325 Ga0209700_100019 3300027363 Bacteria 236981
326 Ga0209700_101128 3300027363 Bacteria 54168
327 Ga0209813_10000705 3300027866 Bacteria 7645
328 Ga0268266_10002101 3300028379 Bacteria 21999
329 Ga0268266_10025141 3300028379 Bacteria 5068
330 Ga0268266_10062907 3300028379 Bacteria 3203
331 Ga0268265_10015487 3300028380 Bacteria 5219
332 Ga0268265_10058818 3300028380 Bacteria 2937
333 Ga0268264_10000065 3300028381 Bacteria 298403
334 Ga0268264_10007132 3300028381 Bacteria 9365
335 Ga0265337_1022685 3300028556 Bacteria 1940
336 Ga0265326_10025223 3300028558 Bacteria 1695
337 Ga0265319_1029202 3300028563 Bacteria 1937
338 Ga0265334_10045023 3300028573 Bacteria 1710
339 Ga0265318_10044010 3300028577 Bacteria 1690
340 Ga0265323_10031892 3300028653 Bacteria 1956
341 Ga0265336_10000481 3300028666 Bacteria 23616
342 Ga0307517_10000279 3300028786 Bacteria 88025
343 Ga0307515_10012109 3300028794 Bacteria 16266
344 Ga0265338_10000317 3300028800 Bacteria 87318
345 Ga0265324_10007835 3300029957 Bacteria 4291
346 Ga0265324_10009946 3300029957 Bacteria 3694
347 Ga0265324_10015575 3300029957 Bacteria 2793
348 Ga0265328_10000750 3300031239 Bacteria 15050
349 Ga0265328_10011927 3300031239 Bacteria 3465
350 Ga0265328_10042051 3300031239 Bacteria 1682
351 Ga0265340_10006005 3300031247 Bacteria 6709
352 Ga0265331_10000497 3300031250 Bacteria 37153
353 Ga0265331_10032599 3300031250 Bacteria 2581
354 Ga0265327_10000810 3300031251 Bacteria 47518
355 Ga0265327_10005760 3300031251 Bacteria 10204
356 Ga0265316_10025488 3300031344 Bacteria 4933
357 Ga0265316_10039472 3300031344 Bacteria 3791
358 Ga0307509_10024299 3300031507 Bacteria 6787
359 Ga0307408_100154312 3300031548 Bacteria 1816
360 Ga0265313_10001452 3300031595 Bacteria 22114
361 Ga0307508_10000514 3300031616 Bacteria 46387
362 Ga0265314_10021427 3300031711 Bacteria 4969
363 Ga0265314_10036474 3300031711 Bacteria 3573
364 Ga0265314_10065731 3300031711 Bacteria 2448
365 Ga0265314_10100505 3300031711 Bacteria 1860
366 Ga0265342_10012872 3300031712 Bacteria 5645
367 Ga0316576_10013900 3300031727 Bacteria 5366
368 Ga0307516_10001288 3300031730 Bacteria 34892
369 Ga0307516_10010587 3300031730 Bacteria 10122
370 Ga0307516_10212641 3300031730 Bacteria 1647
371 Ga0307413_10037981 3300031824 Bacteria 2787
372 Ga0307416_100257244 3300032002 Bacteria 1704
373 Ga0307510_10035023 3300033180 Bacteria 5612
374 Ga0307510_10042213 3300033180 Bacteria 4973
375 Ga0307510_10115841 3300033180 Bacteria 2403
376 Ga0307510_10117603 3300033180 Bacteria 2375
377 Ga0315911_1000003 3300033442 Bacteria 502217
378 Ga0373926_0013951 3300035083 Bacteria 2729
379 Ga0373934_0018837 3300035086 Bacteria 2644
380 Ga0373923_0028209 3300035111 Bacteria 2244
381 Ga0373936_0047639 3300035113 Bacteria 1729
382 Ga0373936_0051498 3300035113 Bacteria 1666
383 Ga0373945_0044837 3300035116 Bacteria 1609
384 Ga0373953_0004607 3300035117 Bacteria 4404
385 Ga0373953_0017845 3300035117 Bacteria 2616
386 Ga0373953_0020181 3300035117 Bacteria 2488
387 Ga0373954_0005482 3300035118 Bacteria 5488
388 Ga0373954_0025608 3300035118 Bacteria 2698
389 Ga0373956_0011396 3300035119 Bacteria 3662
390 Ga0373956_0015134 3300035119 Bacteria 3227
391 Ga0373957_0006039 3300035120 Bacteria 3794
392 Ga0373957_0008872 3300035120 Bacteria 3274
393 Ga0373960_0005258 3300035121 Bacteria 2991
394 Ga0373943_0011057 3300035170 Bacteria 4054
395 Ga0373943_0014684 3300035170 Bacteria 3551
396 Ga0373946_0064896 3300035171 Bacteria 1562
397 Ga0373955_0039968 3300035172 Bacteria 2506
398 Ga0373961_0003418 3300035241 Bacteria 3934
399 Ga0316574_0077273 3300035398 Bacteria 2110
400 Ga0373924_0009804 3300035410 Bacteria 3519
401 Ga0373924_0013743 3300035410 Bacteria 3046
402 Ga0373924_0016970 3300035410 Bacteria 2786
403 Ga0373924_0023653 3300035410 Bacteria 2413
404 Ga0373924_0025392 3300035410 Bacteria 2343
405 Ga0373931_0024832 3300035691 Bacteria 3040
406 Ga0373935_0075116 3300035692 Bacteria 2186
407 Ga0373927_0007448 3300035695 Bacteria 7404
408 Ga0373927_0021594 3300035695 Bacteria 4219
409 Ga0373927_0029712 3300035695 Bacteria 3564
410 Ga0373927_0065400 3300035695 Bacteria 2352
411 Ga0373927_0089216 3300035695 Bacteria 2002
412 Ga0373927_0197595 3300035695 Bacteria 1320
413 Ga0373933_0001552 3300035724 Bacteria 13451
414 Ga0373933_0056454 3300035724 Bacteria 2357
415 Ga0373947_0017234 3300035725 Bacteria 4154
416 Ga0373947_0042387 3300035725 Bacteria 2716
417 Ga0373947_0086393 3300035725 Bacteria 1950
418 Ga0373937_0000352 3300036401 Bacteria 42756
419 Ga0373937_0070802 3300036401 Bacteria 3216
420 Ga0316582_0042720 3300036647 Bacteria 2841
421 Ga0373925_0014183 3300037068 Bacteria 5766
422 Ga0373925_0034822 3300037068 Bacteria 3713
423 Ga0373925_0072684 3300037068 Bacteria 2602
424 Ga0395899_0053228 3300037312 Bacteria 2998
425 Ga0395899_0171799 3300037312 Bacteria 1526
426 Ga0395900_0000982 3300037418 Bacteria 37090
427 Ga0395900_0010894 3300037418 Bacteria 9298
428 Ga0395900_0034116 3300037418 Bacteria 5239
429 Ga0395900_0041755 3300037418 Bacteria 4727
430 Ga0395900_0069121 3300037418 Bacteria 3630
431 Ga0395900_0179921 3300037418 Bacteria 2149
432 Ga0395900_0192842 3300037418 Bacteria 2066
433 Ga0395898_0002224 3300037466 Bacteria 23633
434 Ga0395898_0005680 3300037466 Bacteria 13446
435 Ga0395898_0089280 3300037466 Bacteria 2966
436 Ga0395898_0139419 3300037466 Bacteria 2321
437 Ga0395905_0000710 3300037471 Bacteria 44148
438 Ga0395905_0048406 3300037471 Bacteria 3984
439 Ga0436364_0084731 3300037853 Bacteria 2720
440 Ga0436364_0923208 3300037853 Bacteria 1667
441 Ga0395901_0023426 3300038443 Bacteria 6330
442 Ga0395901_0139718 3300038443 Bacteria 2546
443 Ga0400484_04880 3300038725 Bacteria 7299
444 Ga0400485_06767 3300038735 Bacteria 9144
445 Ga0400483_015990 3300039062 Bacteria 6361
446 Ga0400483_179422 3300039062 Bacteria 17867
447 Ga0400483_238094 3300039062 Bacteria 6286
448 Ga0400487_10787 3300039110 Bacteria 4508
449 Ga0436365_0129589 3300039437 Bacteria 3077
450 Ga0436365_0771783 3300039437 Bacteria 36298
451 Ga0436365_1747149 3300039437 Bacteria 3995
452 Ga0436365_1805073 3300039437 Bacteria 2228
453 Ga0436360_0339475 3300039438 Bacteria 2399
454 Ga0436361_0731125 3300039447 Bacteria 9316
455 Ga0436361_0799126 3300039447 Bacteria 2049
456 Ga0436361_0852708 3300039447 Bacteria 3227
457 Ga0436363_1518892 3300039450 Bacteria 4640
458 Ga0436362_0347390 3300039453 Bacteria 3858
459 Ga0439438_010411 3300041405 Bacteria 2941
460 Ga0439465_0013506 3300041413 Bacteria 2545
461 Ga0439435_0029075 3300042436 Bacteria 1490
462 Ga0451577_0313931 3300042876 Bacteria 1421
463 Ga0466972_0000136 3300044658 Bacteria 60410
464 Ga0453683_0095084 3300044673 Bacteria 1870
465 Ga0466965_0045560 3300044683 Bacteria 2170
466 Ga0466966_0002418 3300044684 Bacteria 12199
467 Ga0466961_0000324 3300044693 Bacteria 31518
468 Ga0453684_0000006 3300044712 Bacteria 1364191
469 Ga0453684_0000031 3300044712 Bacteria 752632
470 Ga0453684_0011035 3300044712 Bacteria 15264
471 Ga0466957_0135722 3300044842 Bacteria 1581
472 Ga0466959_0047380 3300045049 Bacteria 3161
473 Ga0466967_0019583 3300045976 Bacteria 5446
474 Ga0466967_0098327 3300045976 Bacteria 2672
475 Ga0466967_0115264 3300045976 Bacteria 2474
476 Ga0466967_0145779 3300045976 Bacteria 2209
477 Ga0495617_017014 3300046452 Bacteria 2457
478 Ga0495592_0018882 3300046454 Bacteria 5249
479 Ga0495592_0051566 3300046454 Bacteria 3056
480 Ga0495592_0054426 3300046454 Bacteria 2965
481 Ga0495592_0107296 3300046454 Bacteria 1981
482 Ga0495592_0126889 3300046454 Bacteria 1789
483 Ga0495603_0000330 3300046455 Bacteria 25593
484 Ga0495603_0002054 3300046455 Bacteria 11838
485 Ga0495603_0040931 3300046455 Bacteria 2772
486 Ga0495603_0094746 3300046455 Bacteria 1744
487 Ga0495629_0000360 3300046459 Bacteria 38561
488 Ga0495629_0024403 3300046459 Bacteria 4306
489 Ga0495629_0037632 3300046459 Bacteria 3410
490 Ga0495638_0006922 3300046460 Bacteria 8180
491 Ga0495641_0005597 3300046461 Bacteria 8413
492 Ga0495651_0021480 3300046462 Bacteria 5017
493 Ga0495651_0024011 3300046462 Bacteria 4743
494 Ga0495651_0026750 3300046462 Bacteria 4492
495 Ga0495651_0030511 3300046462 Bacteria 4204
496 Ga0495651_0088807 3300046462 Bacteria 2322
497 Ga0495653_0003278 3300046463 Bacteria 12988
498 Ga0495653_0011730 3300046463 Bacteria 7155
499 Ga0495653_0051629 3300046463 Bacteria 3156
500 Ga0495580_0001688 3300046472 Bacteria 19386
501 Ga0495582_0000214 3300046473 Bacteria 32147
502 Ga0495639_0000015 3300046475 Bacteria 80742
503 Ga0495639_0030698 3300046475 Bacteria 2389
504 Ga0495639_0033968 3300046475 Bacteria 2280
505 Ga0495662_0004450 3300046476 Bacteria 7039
506 Ga0495664_0001728 3300046477 Bacteria 11612
507 Ga0495664_0016059 3300046477 Bacteria 4264
508 Ga0495664_0024564 3300046477 Bacteria 3504
509 Ga0495664_0061683 3300046477 Bacteria 2232
510 Ga0495585_0105842 3300046492 Bacteria 1500
511 Ga0495594_0001132 3300046499 Bacteria 13911
512 Ga0495594_0093074 3300046499 Bacteria 1690
513 Ga0495606_0003820 3300046507 Bacteria 15624
514 Ga0495606_0082434 3300046507 Bacteria 1996
515 Ga0495608_0002823 3300046511 Bacteria 12462
516 Ga0495608_0009353 3300046511 Bacteria 6851
517 Ga0495608_0021135 3300046511 Bacteria 4469
518 Ga0495618_0002341 3300046514 Bacteria 12222
519 Ga0495618_0032473 3300046514 Bacteria 3269
520 Ga0495628_0001092 3300046516 Bacteria 24748
521 Ga0495628_0044514 3300046516 Bacteria 3530
522 Ga0495628_0071776 3300046516 Bacteria 2698
523 Ga0495630_0011905 3300046517 Bacteria 6307
524 Ga0495630_0080137 3300046517 Bacteria 2463
525 Ga0495648_0027979 3300046524 Bacteria 3764
526 Ga0495648_0075710 3300046524 Bacteria 1935
527 Ga0495666_0056663 3300046526 Bacteria 1877
528 Ga0495652_0002591 3300046529 Bacteria 18487
529 Ga0495652_0007194 3300046529 Bacteria 10274
530 Ga0495652_0009095 3300046529 Bacteria 9040
531 Ga0495652_0010234 3300046529 Bacteria 8503
532 Ga0495652_0024384 3300046529 Bacteria 5355
533 Ga0495652_0053753 3300046529 Bacteria 3432
534 Ga0495665_0033315 3300046531 Bacteria 2755
535 Ga0495640_0002801 3300046533 Bacteria 14017
536 Ga0495640_0003290 3300046533 Bacteria 12999
537 Ga0495640_0006186 3300046533 Bacteria 9485
538 Ga0495640_0013426 3300046533 Bacteria 6223
539 Ga0495640_0076213 3300046533 Bacteria 2238
540 Ga0495586_0038272 3300046535 Bacteria 2575
541 Ga0495587_0000506 3300046536 Bacteria 27235
542 Ga0495587_0020512 3300046536 Bacteria 4079
543 Ga0495645_0018023 3300046543 Bacteria 5065
544 Ga0495645_0029296 3300046543 Bacteria 4003
545 Ga0495645_0053248 3300046543 Bacteria 2942
546 Ga0495622_0002296 3300046557 Bacteria 9301
547 Ga0495622_0008179 3300046557 Bacteria 4845
548 Ga0495667_0001667 3300046559 Bacteria 14728
549 Ga0495667_0021284 3300046559 Bacteria 4376
550 Ga0495667_0026223 3300046559 Bacteria 3926
551 Ga0495667_0026794 3300046559 Bacteria 3883
552 Ga0495667_0034204 3300046559 Bacteria 3398
553 Ga0495667_0078620 3300046559 Bacteria 2145
554 Ga0495656_0005052 3300046615 Bacteria 4545
555 Ga0495656_0006995 3300046615 Bacteria 3972
556 Ga0495668_0095589 3300046616 Bacteria 1626
557 Ga0495634_0000395 3300046642 Bacteria 42803
558 Ga0495634_0018348 3300046642 Bacteria 4982
559 Ga0495634_0030311 3300046642 Bacteria 3737
560 Ga0495634_0045845 3300046642 Bacteria 2953
561 Ga0495634_0086782 3300046642 Bacteria 2037
562 Ga0495635_0000358 3300046663 Bacteria 29005
563 Ga0495635_0001697 3300046663 Bacteria 14829
564 Ga0495635_0004397 3300046663 Bacteria 9763
565 Ga0495635_0035275 3300046663 Bacteria 3468
566 Ga0495659_0060432 3300046664 Bacteria 1398
567 Ga0495661_0006955 3300046665 Bacteria 7907
568 Ga0495588_0015433 3300046674 Bacteria 3676
569 Ga0495588_0090246 3300046674 Bacteria 1605
570 Ga0495657_0005774 3300046675 Bacteria 9748
571 Ga0495599_0020937 3300046678 Bacteria 4076
572 Ga0495599_0026732 3300046678 Bacteria 3617
573 Ga0495599_0096971 3300046678 Bacteria 1838
574 Ga0495623_0004938 3300046679 Bacteria 8745
575 Ga0495623_0010819 3300046679 Bacteria 5906
576 Ga0495623_0013744 3300046679 Bacteria 5248
577 Ga0495623_0025207 3300046679 Bacteria 3830
578 Ga0495646_0022504 3300046680 Bacteria 3975
579 Ga0495646_0024852 3300046680 Bacteria 3770
580 Ga0495646_0027000 3300046680 Bacteria 3604
581 Ga0495646_0029540 3300046680 Bacteria 3426
582 Ga0495646_0056869 3300046680 Bacteria 2344
583 Ga0495647_0004081 3300046681 Bacteria 4719
584 Ga0495647_0019929 3300046681 Bacteria 2403
585 Ga0495658_0000342 3300046683 Bacteria 26121
586 Ga0495658_0003508 3300046683 Bacteria 7760
587 Ga0495669_0024978 3300046684 Bacteria 2604
588 Ga0495613_0023281 3300046689 Bacteria 4614
589 Ga0495613_0029997 3300046689 Bacteria 4040
590 Ga0495624_0021313 3300046690 Bacteria 4299
591 Ga0495624_0052761 3300046690 Bacteria 2568
592 Ga0495670_0063032 3300046691 Bacteria 1866
593 Ga0495671_0015491 3300046692 Bacteria 4083
594 Ga0495649_0006829 3300046694 Bacteria 7066
595 Ga0495649_0088203 3300046694 Bacteria 1655
596 Ga0495600_0007532 3300046809 Bacteria 6665
597 Ga0495600_0008402 3300046809 Bacteria 6338
598 Ga0495600_0061182 3300046809 Bacteria 2459
599 Ga0495581_0000341 3300047315 Bacteria 23276
600 Ga0495581_0020661 3300047315 Bacteria 3819
601 Ga0495581_0088213 3300047315 Bacteria 1799
602 Ga0495604_0000765 3300047317 Bacteria 27080
603 Ga0495604_0008805 3300047317 Bacteria 7976
604 Ga0495604_0030226 3300047317 Bacteria 4304
605 Ga0495674_0000557 3300047319 Bacteria 34594
606 Ga0495674_0003736 3300047319 Bacteria 14799
607 Ga0495674_0038445 3300047319 Bacteria 4295
608 Ga0495674_0043202 3300047319 Bacteria 4013
609 Ga0495674_0057285 3300047319 Bacteria 3410
610 Ga0495674_0057739 3300047319 Bacteria 3396
611 Ga0495672_0106235 3300047320 Bacteria 1514
612 Ga0495676_0083714 3300047321 Bacteria 2410
613 Ga0495680_0001188 3300047322 Bacteria 28564
614 Ga0495680_0004754 3300047322 Bacteria 12899
615 Ga0495680_0026674 3300047322 Bacteria 4758
616 Ga0495680_0102516 3300047322 Bacteria 2130
617 Ga0495675_0002133 3300047444 Bacteria 11788
618 Ga0495675_0011233 3300047444 Bacteria 5618
619 Ga0495675_0020004 3300047444 Bacteria 4254
620 Ga0495675_0031462 3300047444 Bacteria 3387
621 Ga0495684_0000897 3300047471 Bacteria 24092
622 Ga0495684_0001995 3300047471 Bacteria 16409
623 Ga0495684_0033209 3300047471 Bacteria 3960
624 Ga0495684_0047857 3300047471 Bacteria 3269
625 Ga0495684_0052028 3300047471 Bacteria 3125
626 Ga0495686_0124457 3300047472 Bacteria 1534
627 Ga0495593_0000506 3300047673 Bacteria 22030
628 Ga0495593_0031066 3300047673 Bacteria 2920
629 Ga0495602_0002695 3300048088 Bacteria 18143
630 Ga0495602_0026279 3300048088 Bacteria 5617
631 Ga0495602_0116189 3300048088 Bacteria 2162
632 Ga0495614_0084920 3300048089 Bacteria 1374
633 Ga0496100_0020491 3300048903 Bacteria 3965
634 Ga0496100_0080534 3300048903 Bacteria 2198
635 Ga0496100_0147768 3300048903 Bacteria 1673
636 Ga0496101_0000648 3300048904 Bacteria 20964
637 Ga0496101_0041620 3300048904 Bacteria 3277
638 Ga0496102_0003521 3300048905 Bacteria 13269
639 Ga0496102_0067115 3300048905 Bacteria 3289
640 Ga0496103_0058435 3300048906 Bacteria 2396
641 Ga0496104_0013552 3300048907 Bacteria 7347
642 Ga0496104_0018065 3300048907 Bacteria 6430
643 Ga0496104_0037271 3300048907 Bacteria 4548
644 Ga0496104_0049276 3300048907 Bacteria 3972
645 Ga0496104_0085080 3300048907 Bacteria 3018
646 Ga0496104_0086957 3300048907 Bacteria 2985
647 Ga0496104_0181384 3300048907 Bacteria 2016
648 Ga0496105_0027418 3300048908 Bacteria 4653
649 Ga0496105_0052854 3300048908 Bacteria 3355
650 Ga0496105_0092141 3300048908 Bacteria 2502
651 Ga0496106_0001529 3300048909 Bacteria 17390
652 Ga0496106_0007572 3300048909 Bacteria 8031
653 Ga0496106_0011062 3300048909 Bacteria 6670
654 Ga0496106_0038241 3300048909 Bacteria 3590
655 Ga0496106_0162265 3300048909 Bacteria 1768
656 Ga0496106_0202157 3300048909 Bacteria 1581
657 Ga0496107_0004714 3300048910 Bacteria 9266
658 Ga0496107_0045648 3300048910 Bacteria 3152
659 Ga0496107_0067639 3300048910 Bacteria 2592
660 Ga0496108_0000764 3300048911 Bacteria 25051
661 Ga0496108_0033486 3300048911 Bacteria 4269
662 Ga0496108_0067856 3300048911 Bacteria 3008
663 Ga0496108_0200627 3300048911 Bacteria 1731
664 Ga0496109_0002732 3300048912 Bacteria 14794
665 Ga0496109_0004357 3300048912 Bacteria 11828
666 Ga0496109_0206856 3300048912 Bacteria 1845
667 Ga0496110_0002562 3300048913 Bacteria 13666
668 Ga0496110_0003472 3300048913 Bacteria 12087
669 Ga0496110_0026093 3300048913 Bacteria 4996
670 Ga0496110_0096309 3300048913 Bacteria 2652
671 Ga0496110_0112586 3300048913 Bacteria 2447
672 Ga0496110_0266767 3300048913 Bacteria 1559
673 Ga0496110_0327938 3300048913 Bacteria 1394
674 Ga0496111_0001360 3300048914 Bacteria 13842
675 Ga0496111_0003253 3300048914 Bacteria 10031
676 Ga0496112_0000031 3300048915 Bacteria 120022
677 Ga0496112_0004915 3300048915 Bacteria 11438
678 Ga0496112_0004941 3300048915 Bacteria 11417
679 Ga0496112_0008448 3300048915 Bacteria 9225
680 Ga0496112_0041116 3300048915 Bacteria 4522
681 Ga0496112_0069229 3300048915 Bacteria 3486
682 Ga0496112_0075336 3300048915 Bacteria 3337
683 Ga0496112_0179492 3300048915 Bacteria 2081
684 Ga0496113_0001977 3300048916 Bacteria 11748
685 Ga0496113_0047075 3300048916 Bacteria 3204
686 Ga0496113_0050949 3300048916 Bacteria 3088
687 Ga0496114_0009865 3300048917 Bacteria 7589
688 Ga0496114_0151894 3300048917 Bacteria 2009
689 Ga0496114_0230589 3300048917 Bacteria 1627
690 Ga0496115_0009797 3300048918 Bacteria 7135
691 Ga0496115_0073197 3300048918 Bacteria 2781
692 Ga0496115_0083531 3300048918 Bacteria 2603
693 Ga0496115_0094179 3300048918 Bacteria 2450
694 Ga0496115_0116827 3300048918 Bacteria 2194
695 Ga0496115_0118715 3300048918 Bacteria 2175
696 Ga0496116_0014153 3300048919 Bacteria 6385
697 Ga0496117_0000060 3300048920 Bacteria 258500
698 Ga0496117_0009844 3300048920 Bacteria 8805
699 Ga0496117_0034745 3300048920 Bacteria 3794
700 Ga0496117_0071857 3300048920 Bacteria 2316
701 Ga0496117_0159220 3300048920 Bacteria 1325
702 Ga0496118_0005918 3300048921 Bacteria 13679
703 Ga0496118_0013173 3300048921 Bacteria 7845
704 Ga0496118_0040100 3300048921 Bacteria 3727
705 Ga0496118_0058734 3300048921 Bacteria 2871
706 Ga0496118_0121500 3300048921 Bacteria 1701
707 Ga0496118_0146433 3300048921 Bacteria 1486
708 Ga0496119_0028655 3300048922 Bacteria 3794
709 Ga0496120_0014815 3300048923 Bacteria 5173
710 Ga0496121_0000406 3300048924 Bacteria 85761
711 Ga0496121_0000769 3300048924 Bacteria 58817
712 Ga0496121_0002143 3300048924 Bacteria 30998
713 Ga0496121_0012483 3300048924 Bacteria 9252
714 Ga0496121_0027061 3300048924 Bacteria 5377
715 Ga0496121_0068500 3300048924 Bacteria 2870
716 Ga0496121_0077208 3300048924 Bacteria 2653
717 Ga0496121_0110766 3300048924 Bacteria 2094
718 Ga0496122_0040920 3300048925 Bacteria 3674
719 Ga0496122_0042875 3300048925 Bacteria 3553
720 Ga0496123_0066540 3300048926 Bacteria 2282
721 Ga0496124_0002534 3300048927 Bacteria 23718
722 Ga0496124_0044466 3300048927 Bacteria 3810
723 Ga0496124_0221418 3300048927 Bacteria 1423
724 Ga0496125_0003938 3300048928 Bacteria 17519
725 Ga0496125_0003990 3300048928 Bacteria 17353
726 Ga0496125_0028546 3300048928 Bacteria 5036
727 Ga0496125_0064486 3300048928 Bacteria 2910
728 Ga0496126_0010317 3300048929 Bacteria 9806
729 Ga0496126_0034185 3300048929 Bacteria 4776
730 Ga0496126_0051661 3300048929 Bacteria 3740
731 Ga0496126_0095509 3300048929 Bacteria 2607
732 Ga0496126_0161425 3300048929 Bacteria 1915
733 Ga0496126_0172382 3300048929 Bacteria 1842
734 Ga0496126_0234903 3300048929 Bacteria 1534
735 Ga0496126_0242983 3300048929 Bacteria 1503
736 Ga0496126_0268889 3300048929 Bacteria 1415
737 Ga0501305_001889 3300049161 Bacteria 2155
738 Ga0501305_003735 3300049161 Bacteria 1745
739 Ga0495682_0013780 3300049460 Bacteria 3073
740 Ga0501312_000418 3300049528 Bacteria 3357
741 Ga0501312_002551 3300049528 Bacteria 1975
742 Ga0501317_001504 3300049533 Bacteria 2020
743 Ga0501031_0000207 3300049568 Bacteria 33573
744 Ga0501031_0115929 3300049568 Bacteria 1750
745 Ga0501032_0000189 3300049569 Bacteria 50924
746 Ga0501032_0000252 3300049569 Bacteria 44619
747 Ga0501032_0002406 3300049569 Bacteria 14591
748 Ga0501032_0055999 3300049569 Bacteria 2652
749 Ga0501033_0000082 3300049570 Bacteria 89837
750 Ga0501033_0000493 3300049570 Bacteria 37227
751 Ga0501033_0038099 3300049570 Bacteria 3597
752 Ga0501033_0211862 3300049570 Bacteria 1381
753 Ga0501034_0018545 3300049571 Bacteria 7132
754 Ga0501034_0022592 3300049571 Bacteria 6409
755 Ga0501034_0047258 3300049571 Bacteria 4347
756 Ga0501036_0000134 3300049572 Bacteria 47683
757 Ga0501036_0016378 3300049572 Bacteria 6192
758 Ga0501036_0254508 3300049572 Bacteria 1471
759 Ga0501037_0000050 3300049573 Bacteria 112824
760 Ga0501037_0002190 3300049573 Bacteria 14128
761 Ga0501037_0002324 3300049573 Bacteria 13742
762 Ga0501037_0005438 3300049573 Bacteria 9278
763 Ga0501038_0002725 3300049574 Bacteria 16472
764 Ga0501038_0010145 3300049574 Bacteria 8622
765 Ga0501038_0010211 3300049574 Bacteria 8593
766 Ga0501038_0110841 3300049574 Bacteria 2274
767 Ga0501038_0136765 3300049574 Bacteria 2007
768 Ga0501039_0000064 3300049575 Bacteria 83415
769 Ga0501039_0000123 3300049575 Bacteria 53579
770 Ga0501039_0004985 3300049575 Bacteria 10074
771 Ga0501039_0041161 3300049575 Bacteria 3568
772 Ga0501039_0061672 3300049575 Bacteria 2904
773 Ga0501039_0142212 3300049575 Bacteria 1885
774 Ga0501040_0010754 3300049576 Bacteria 5984
775 Ga0501041_0006153 3300049577 Bacteria 7013
776 Ga0501041_0109994 3300049577 Bacteria 1709
777 Ga0501042_0007944 3300049578 Bacteria 6979
778 Ga0501042_0010034 3300049578 Bacteria 6332
779 Ga0501042_0016034 3300049578 Bacteria 5140
780 Ga0501042_0028604 3300049578 Bacteria 3929
781 Ga0501042_0032220 3300049578 Bacteria 3711
782 Ga0501043_0000999 3300049579 Bacteria 24883
783 Ga0501043_0007904 3300049579 Bacteria 8406
784 Ga0501043_0010418 3300049579 Bacteria 7283
785 Ga0501043_0108403 3300049579 Bacteria 2181
786 Ga0501046_0000434 3300049580 Bacteria 41950
787 Ga0501046_0012628 3300049580 Bacteria 7181
788 Ga0501047_0000131 3300049581 Bacteria 91079
789 Ga0501047_0000866 3300049581 Bacteria 30920
790 Ga0501048_0002325 3300049582 Bacteria 14503
791 Ga0501048_0010161 3300049582 Bacteria 7041
792 Ga0501048_0012442 3300049582 Bacteria 6330
793 Ga0501067_0000628 3300049583 Bacteria 18974
794 Ga0501067_0007650 3300049583 Bacteria 6007
795 Ga0501068_0000080 3300049584 Bacteria 39376
796 Ga0501068_0008999 3300049584 Bacteria 5572
797 Ga0501068_0057044 3300049584 Bacteria 2367
798 Ga0501069_0002904 3300049585 Bacteria 8802
799 Ga0501069_0029899 3300049585 Bacteria 2990
800 Ga0501069_0054403 3300049585 Bacteria 2229
801 Ga0501070_0000209 3300049586 Bacteria 55271
802 Ga0501070_0004437 3300049586 Bacteria 12052
803 Ga0501070_0025205 3300049586 Bacteria 4987
804 Ga0501070_0027934 3300049586 Bacteria 4733
805 Ga0501070_0143436 3300049586 Bacteria 1972
806 Ga0501071_0008177 3300049587 Bacteria 6902
807 Ga0501071_0008392 3300049587 Bacteria 6826
808 Ga0501071_0033785 3300049587 Bacteria 3635
809 Ga0501071_0120488 3300049587 Bacteria 1944
810 Ga0501071_0172348 3300049587 Bacteria 1620
811 Ga0501072_0000378 3300049588 Bacteria 31856
812 Ga0501072_0001448 3300049588 Bacteria 17791
813 Ga0501072_0015136 3300049588 Bacteria 5915
814 Ga0501073_0000062 3300049589 Bacteria 66884
815 Ga0501073_0014131 3300049589 Bacteria 5798
816 Ga0501073_0051826 3300049589 Bacteria 2874
817 Ga0501074_0000642 3300049590 Bacteria 21686
818 Ga0501074_0002216 3300049590 Bacteria 13485
819 Ga0501075_0005258 3300049591 Bacteria 8849
820 Ga0501075_0076901 3300049591 Bacteria 2525
821 Ga0501075_0122453 3300049591 Bacteria 1980
822 Ga0501076_0017280 3300049592 Bacteria 5480
823 Ga0501076_0024246 3300049592 Bacteria 4687
824 Ga0501076_0183263 3300049592 Bacteria 1707
825 Ga0501076_0228976 3300049592 Bacteria 1519
826 Ga0501077_0004743 3300049593 Bacteria 8266
827 Ga0501077_0040966 3300049593 Bacteria 2949
828 Ga0501077_0075708 3300049593 Bacteria 2131
829 Ga0501079_0006018 3300049741 Bacteria 9088
830 Ga0501079_0016419 3300049741 Bacteria 5653
831 Ga0501079_0031135 3300049741 Bacteria 4100
832 Ga0501079_0131467 3300049741 Bacteria 1948
833 Ga0501079_0177568 3300049741 Bacteria 1661
834 Ga0501080_0000200 3300049742 Bacteria 44051
835 Ga0501080_0012893 3300049742 Bacteria 7671
836 Ga0501080_0037072 3300049742 Bacteria 4552
837 Ga0501080_0043316 3300049742 Bacteria 4192
838 Ga0501080_0048542 3300049742 Bacteria 3951
839 Ga0501080_0185967 3300049742 Bacteria 1910
840 Ga0501081_0003080 3300049743 Bacteria 10587
841 Ga0501081_0100683 3300049743 Bacteria 2042
842 Ga0501083_0000199 3300049744 Bacteria 38479
843 Ga0501083_0000628 3300049744 Bacteria 22814
844 Ga0501083_0007134 3300049744 Bacteria 7935
845 Ga0501035_0000123 3300049822 Bacteria 93734
846 Ga0501035_0000598 3300049822 Bacteria 39723
847 Ga0501035_0039684 3300049822 Bacteria 4259
848 Ga0501044_0000100 3300049823 Bacteria 106729
849 Ga0501044_0000887 3300049823 Bacteria 36069
850 Ga0501044_0009069 3300049823 Bacteria 10872
851 Ga0501044_0021553 3300049823 Bacteria 6871
852 Ga0501044_0042937 3300049823 Bacteria 4699
853 Ga0501045_0001526 3300049824 Bacteria 15418
854 Ga0501045_0009596 3300049824 Bacteria 6774
855 Ga0501045_0036173 3300049824 Bacteria 3585
856 nmdc:mga03683_25957_c2 3300050489 Bacteria 1924
857 nmdc:mga03n38_54330_c1 3300050490 Bacteria 1800
858 nmdc:mga03n38_748_c1 3300050490 Bacteria 8589
859 nmdc:mga00v17_3459_c1 3300050491 Bacteria 8171
860 nmdc:mga0yw44_17358_c1 3300050492 Bacteria 3915
861 nmdc:mga0yw44_4498_c1 3300050492 Bacteria 6406
862 nmdc:mga0yw44_49835_c1 3300050492 Bacteria 2529
863 nmdc:mga0yw44_89146_c1 3300050492 Bacteria 1946
864 nmdc:mga06z11_205_c1 3300050494 Bacteria 23665
865 nmdc:mga06z11_27492_c1 3300050494 Bacteria 2719
866 nmdc:mga06z11_53356_c1 3300050494 Bacteria 2079
867 nmdc:mga06z11_6231_c1 3300050494 Bacteria 4834
868 nmdc:mga06z11_62408_c1 3300050494 Bacteria 1947
869 nmdc:mga06z11_80691_c1 3300050494 Bacteria 1745
870 nmdc:mga04h51_644_c1 3300050495 Bacteria 8168
871 nmdc:mga07m45_25150_c2 3300050496 Bacteria 2481
872 nmdc:mga07m45_2788_c1 3300050496 Bacteria 8259
873 nmdc:mga05p37_120614_c1 3300050507 Bacteria 3221
874 nmdc:mga05p37_165152_c1 3300050507 Bacteria 2702
875 nmdc:mga06r32_4688_c1 3300050510 Bacteria 12278
876 nmdc:mga08y16_371938_c1 3300050511 Bacteria 1466
877 nmdc:mga08y16_53082_c1 3300050511 Bacteria 4240
878 nmdc:mga0n895_11688_c1 3300050512 Bacteria 7845
879 nmdc:mga0n895_33987_c1 3300050512 Bacteria 4904
880 nmdc:mga0rr50_32064_c1 3300050513 Bacteria 3739
881 nmdc:mga0rr50_85747_c1 3300050513 Bacteria 2441
882 nmdc:mga0a205_3751_c1 3300050515 Bacteria 13606
883 nmdc:mga0sz30_13068_c1 3300050516 Bacteria 3244
884 Ga0495601_0000848 3300053077 Bacteria 16636
885 Ga0495601_0069785 3300053077 Bacteria 2241
886 Ga0495612_0014423 3300053078 Bacteria 3178
887 Ga0495612_0015990 3300053078 Bacteria 3007
888 Ga0495595_0002544 3300053084 Bacteria 7157
889 Ga0495595_0005739 3300053084 Bacteria 5027
890 Ga0495595_0013241 3300053084 Bacteria 3482
891 Ga0495619_0000858 3300053085 Bacteria 19930
892 Ga0495619_0006701 3300053085 Bacteria 7286
893 Ga0500578_0043292 3300053086 Bacteria 2890
894 Ga0500578_0045031 3300053086 Bacteria 2832
895 Ga0500643_000111 3300053087 Bacteria 85038
896 Ga0500651_0005693 3300053093 Bacteria 7135
897 Ga0500651_0030707 3300053093 Bacteria 3382
898 Ga0500566_0010251 3300053094 Bacteria 5525
899 Ga0500566_0019553 3300053094 Bacteria 3976
900 Ga0500566_0040898 3300053094 Bacteria 2679
901 Ga0500641_0027912 3300053096 Bacteria 2200
902 Ga0500650_0000250 3300053098 Bacteria 13119
903 Ga0500556_0000003 3300053104 Bacteria 679379
904 Ga0500557_000034 3300053105 Bacteria 71225
905 Ga0500569_012555 3300053109 Bacteria 2052
906 Ga0500572_000023 3300053111 Bacteria 47431
907 Ga0500594_0018699 3300053118 Bacteria 1710
908 Ga0500595_011567 3300053119 Bacteria 3446
909 Ga0500595_014895 3300053119 Bacteria 2937
910 Ga0500595_031747 3300053119 Bacteria 1769
911 Ga0500607_039743 3300053121 Bacteria 2552
912 Ga0500608_006686 3300053122 Bacteria 4716
913 Ga0500618_010201 3300053125 Bacteria 2527
914 Ga0500642_0000053 3300053130 Bacteria 71632
915 Ga0500642_0000175 3300053130 Bacteria 26632
916 Ga0500642_0016179 3300053130 Bacteria 2826
917 Ga0500642_0025114 3300053130 Bacteria 2417
918 Ga0500652_000441 3300053131 Bacteria 14718
919 Ga0500658_0065659 3300053134 Bacteria 1520
920 Ga0500559_0000146 3300053136 Bacteria 55375
921 Ga0500559_0001416 3300053136 Bacteria 13619
922 Ga0500559_0024210 3300053136 Bacteria 2581
923 Ga0500568_0000733 3300053139 Bacteria 23549
924 Ga0500568_0005060 3300053139 Bacteria 6905
925 Ga0500568_0015018 3300053139 Bacteria 3475
926 Ga0500590_022753 3300053148 Bacteria 3256
927 Ga0500603_006653 3300053150 Bacteria 2517
928 Ga0500604_0002553 3300053151 Bacteria 4966
929 Ga0500616_0000034 3300053153 Bacteria 396651
930 Ga0500616_0000041 3300053153 Bacteria 359328
931 Ga0500622_0001837 3300053156 Bacteria 16081
932 Ga0500622_0028058 3300053156 Bacteria 2964
933 Ga0500622_0051363 3300053156 Bacteria 2122
934 Ga0500634_0054221 3300053161 Bacteria 2149
935 Ga0500638_002809 3300053162 Bacteria 6234
936 Ga0500638_091226 3300053162 Bacteria 1434
937 Ga0500636_0000033 3300053177 Bacteria 72990
938 Ga0500636_0002841 3300053177 Bacteria 9666
939 Ga0500636_0045999 3300053177 Bacteria 2573
940 Ga0500637_0000026 3300053178 Bacteria 59050
941 Ga0500637_0001578 3300053178 Bacteria 9754
942 Ga0500625_001985 3300053729 Bacteria 7415
943 Ga0500645_017807 3300053730 Bacteria 2223
944 Ga0500596_001715 3300053735 Bacteria 4441
945 Ga0500599_001352 3300053736 Bacteria 2801
946 Ga0500601_000010 3300053737 Bacteria 45442
947 Ga0501084_0004920 3300054114 Bacteria 10915
948 Ga0501084_0026729 3300054114 Bacteria 4819
949 Ga0501084_0043563 3300054114 Bacteria 3754
950 Ga0501084_0073591 3300054114 Bacteria 2861
951 Ga0501084_0193228 3300054114 Bacteria 1717
952 Ga0501082_0011691 3300060353 Bacteria 7547
953 Ga0501082_0011762 3300060353 Bacteria 7522
954 Ga0501082_0020282 3300060353 Bacteria 5730
955 Ga0501082_0028999 3300060353 Bacteria 4767
956 Ga0501082_0037072 3300060353 Bacteria 4201
957 Ga0530510_0009156 3300061734 Bacteria 6938
958 Ga0530510_0120930 3300061734 Bacteria 1922

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10035959 Ga0075369_100359592 368
2 3300005563 Ga0068855_100008028 Ga0068855_1000080286 380
3 3300049575 Ga0501039_0041161 Ga0501039_0041161_362_1591 387
4 3300049578 Ga0501042_0032220 Ga0501042_0032220_1755_2984 387
5 3300049592 Ga0501076_0228976 Ga0501076_0228976_214_1443 387
6 3300061734 Ga0530510_0009156 Ga0530510_0009156_4730_5959 387
7 3300021384 Ga0213876_10010761 Ga0213876_100107611 393
8 3300039437 Ga0436365_0129589 Ga0436365_0129589_1464_2714 393
9 3300035695 Ga0373927_0197595 Ga0373927_0197595_117_1301 394
10 3300035725 Ga0373947_0042387 Ga0373947_0042387_37_1221 394
11 3300048920 Ga0496117_0159220 Ga0496117_0159220_112_1296 394
12 3300048921 Ga0496118_0121500 Ga0496118_0121500_18_1202 394
13 3300048929 Ga0496126_0242983 Ga0496126_0242983_309_1493 394
14 3300050490 nmdc:mga03n38_748_c1 nmdc:mga03n38_748_c1_7353_8537 394
15 3300050507 nmdc:mga05p37_165152_c1 nmdc:mga05p37_165152_c1_15_1199 394
16 3300005471 Ga0070698_100104941 Ga0070698_1001049413 401
17 3300049570 Ga0501033_0038099 Ga0501033_0038099_1313_2521 402
18 3300049572 Ga0501036_0016378 Ga0501036_0016378_2998_4206 402
19 3300049573 Ga0501037_0005438 Ga0501037_0005438_294_1502 402
20 3300049577 Ga0501041_0006153 Ga0501041_0006153_1309_2517 402
21 3300049580 Ga0501046_0012628 Ga0501046_0012628_3045_4253 402
22 3300049582 Ga0501048_0012442 Ga0501048_0012442_1741_2949 402
23 3300049588 Ga0501072_0001448 Ga0501072_0001448_1087_2295 402
24 3300049743 Ga0501081_0100683 Ga0501081_0100683_395_1603 402
25 3300054114 Ga0501084_0004920 Ga0501084_0004920_8100_9308 402
26 3300031595 Ga0265313_10001452 Ga0265313_100014528 405
27 3300044673 Ga0453683_0095084 Ga0453683_0095084_360_1640 406
28 3300044712 Ga0453684_0011035 Ga0453684_0011035_3935_5227 406
29 3300046477 Ga0495664_0001728 Ga0495664_0001728_8031_9251 406
30 3300006028 Ga0070717_10028344 Ga0070717_100283441 408
31 3300005434 Ga0070709_10021201 Ga0070709_100212011 409
32 3300026116 Ga0207674_10121292 Ga0207674_101212922 409
33 3300035116 Ga0373945_0044837 Ga0373945_0044837_366_1595 409
34 3300048929 Ga0496126_0172382 Ga0496126_0172382_220_1515 411
35 3300005434 Ga0070709_10000734 Ga0070709_100007347 412
36 3300005435 Ga0070714_100000556 Ga0070714_10000055621 412
37 3300005437 Ga0070710_10001203 Ga0070710_100012036 412
38 3300005439 Ga0070711_100000989 Ga0070711_1000009896 412
39 3300006173 Ga0070716_100005650 Ga0070716_1000056506 412
40 3300006175 Ga0070712_100024322 Ga0070712_1000243223 412
41 3300025898 Ga0207692_10002111 Ga0207692_100021116 412
42 3300025906 Ga0207699_10014465 Ga0207699_100144653 412
43 3300025915 Ga0207693_10033960 Ga0207693_100339604 412
44 3300025916 Ga0207663_10010667 Ga0207663_100106675 412
45 3300025928 Ga0207700_10004770 Ga0207700_100047701 412
46 3300025939 Ga0207665_10005463 Ga0207665_100054633 412
47 3300048929 Ga0496126_0234903 Ga0496126_0234903_95_1390 412
48 3300032002 Ga0307416_100257244 Ga0307416_1002572442 413
49 3300037418 Ga0395900_0041755 Ga0395900_0041755_1899_3194 413
50 3300037466 Ga0395898_0139419 Ga0395898_0139419_981_2276 413
51 iso_pu_bacteria 8019608314 8019612890 413
52 3300009093 Ga0105240_10402852 Ga0105240_104028522 415
53 3300013104 Ga0157370_10119024 Ga0157370_101190242 415
54 3300013105 Ga0157369_10021176 Ga0157369_100211763 415
55 3300025904 Ga0207647_10036925 Ga0207647_100369253 415
56 3300025913 Ga0207695_10135448 Ga0207695_101354482 415
57 3300026116 Ga0207674_10090075 Ga0207674_100900752 415
58 3300031711 Ga0265314_10021427 Ga0265314_100214273 415
59 3300031712 Ga0265342_10012872 Ga0265342_100128721 415
60 3300036647 Ga0316582_0042720 Ga0316582_0042720_133_1425 415
61 3300053139 Ga0500568_0005060 Ga0500568_0005060_2800_4092 415
62 3300031727 Ga0316576_10013900 Ga0316576_100139004 417
63 3300035398 Ga0316574_0077273 Ga0316574_0077273_779_2074 417
64 3300047471 Ga0495684_0047857 Ga0495684_0047857_1452_2705 417
65 3300049577 Ga0501041_0109994 Ga0501041_0109994_26_1393 419
66 3300049578 Ga0501042_0016034 Ga0501042_0016034_1832_3199 419
67 3300049593 Ga0501077_0040966 Ga0501077_0040966_707_2074 419
68 3300049824 Ga0501045_0036173 Ga0501045_0036173_1495_2862 419
69 3300060353 Ga0501082_0037072 Ga0501082_0037072_1871_3238 419
70 3300025912 Ga0207707_10095500 Ga0207707_100955002 420
71 3300025921 Ga0207652_10014815 Ga0207652_100148153 420
72 3300005535 Ga0070684_100002394 Ga0070684_1000023943 421
73 3300025944 Ga0207661_10001422 Ga0207661_1000142212 421
74 3300049161 Ga0501305_003735 Ga0501305_003735_47_1363 421
75 3300049533 Ga0501317_001504 Ga0501317_001504_220_1536 421
76 iso_pu_bacteria 2939615513 2939616628 421
77 3300006846 Ga0075430_100125794 Ga0075430_1001257942 423
78 3300031824 Ga0307413_10037981 Ga0307413_100379812 423
79 3300049586 Ga0501070_0027934 Ga0501070_0027934_2222_3517 423
80 3300049586 Ga0501070_0143436 Ga0501070_0143436_393_1667 423
81 3300014325 Ga0163163_10127689 Ga0163163_101276893 424
82 3300039447 Ga0436361_0731125 Ga0436361_0731125_7868_9181 424
83 iso_pu_bacteria 2671180330 2672338434 424
84 iso_pu_bacteria 2816332186 2816865638 424
85 iso_pu_bacteria 2842682962 2842686398 424
86 iso_pu_bacteria 2849139964 2849143271 424
87 iso_pu_bacteria 2857581216 2857583437 424
88 3300048920 Ga0496117_0000060 Ga0496117_0000060_197901_199181 425
89 iso_pu_bacteria 8054280661 8054282554 425
90 3300038725 Ga0400484_04880 Ga0400484_04880_2824_4122 427
91 iso_pu_bacteria 2507262055 2507504589 427
92 iso_pu_bacteria 2508501009 2508546017 427
93 iso_pu_bacteria 2508501042 2508694864 427
94 iso_pu_bacteria 2508501128 2509149855 427
95 iso_pu_bacteria 2511231028 2511393401 427
96 iso_pu_bacteria 2513237092 2513626546 427
97 iso_pu_bacteria 2513237094 2513638457 427
98 iso_pu_bacteria 2513237095 2513649369 427
99 iso_pu_bacteria 2513237096 2513657160 427
100 iso_pu_bacteria 2513237098 2513674050 427
101 iso_pu_bacteria 2513237101 2513693746 427
102 iso_pu_bacteria 2513237102 2513699385 427
103 iso_pu_bacteria 2513237104 2513714758 427
104 iso_pu_bacteria 2513237137 2513863154 427
105 iso_pu_bacteria 2513237139 2513875566 427
106 iso_pu_bacteria 2513237141 2513889846 427
107 iso_pu_bacteria 2513237145 2513919168 427
108 iso_pu_bacteria 2513237161 2514011043 427
109 iso_pu_bacteria 2515154112 2515624203 427
110 iso_pu_bacteria 2517093001 2517102908 427
111 iso_pu_bacteria 2517572143 2517891139 427
112 iso_pu_bacteria 2522572158 2523104914 427
113 iso_pu_bacteria 2524023205 2524438723 427
114 iso_pu_bacteria 2524023210 2524465590 427
115 iso_pu_bacteria 2524023228 2524533677 427
116 iso_pu_bacteria 2528768022 2528854441 427
117 iso_pu_bacteria 2597490356 2599105633 427
118 iso_pu_bacteria 2602042107 2603857185 427
119 iso_pu_bacteria 2617270735 2617347587 427
120 iso_pu_bacteria 2617270741 2617377001 427
121 iso_pu_bacteria 2643221651 2644291159 427
122 iso_pu_bacteria 2667528175 2671123259 427
123 iso_pu_bacteria 2721755755 2723843475 427
124 iso_pu_bacteria 2728368998 2728755505 427
125 iso_pu_bacteria 2738541295 2738815298 427
126 iso_pu_bacteria 2744054633 2745080489 427
127 iso_pu_bacteria 2791355196 2793063565 427
128 iso_pu_bacteria 2791355197 2793066482 427
129 iso_pu_bacteria 2791355199 2793084000 427
130 iso_pu_bacteria 2802429603 2805921079 427
131 iso_pu_bacteria 2816332527 2818237049 427
132 iso_pu_bacteria 2824600985 2824606341 427
133 iso_pu_bacteria 2824609381 2824612078 427
134 iso_pu_bacteria 2824617872 2824619223 427
135 iso_pu_bacteria 2824626560 2824628128 427
136 iso_pu_bacteria 2824635225 2824636910 427
137 iso_pu_bacteria 2824644064 2824645706 427
138 iso_pu_bacteria 2824653114 2824658465 427
139 iso_pu_bacteria 2824661429 2824668031 427
140 iso_pu_bacteria 2824671348 2824676767 427
141 iso_pu_bacteria 2824679649 2824683238 427
142 iso_pu_bacteria 2824687955 2824694047 427
143 iso_pu_bacteria 2824696289 2824701594 427
144 iso_pu_bacteria 2824704595 2824710290 427
145 iso_pu_bacteria 2824714736 2824715885 427
146 iso_pu_bacteria 2824723954 2824725373 427
147 iso_pu_bacteria 2824732956 2824736863 427
148 iso_pu_bacteria 2824746037 2824747590 427
149 iso_pu_bacteria 2824753945 2824760916 427
150 iso_pu_bacteria 2824763712 2824767681 427
151 iso_pu_bacteria 2824773399 2824777072 427
152 iso_pu_bacteria 2838122688 2838129179 427
153 iso_pu_bacteria 2841941048 2841944193 427
154 iso_pu_bacteria 2841949485 2841954632 427
155 iso_pu_bacteria 2841957949 2841963065 427
156 iso_pu_bacteria 2841966195 2841968975 427
157 iso_pu_bacteria 2841974524 2841979749 427
158 iso_pu_bacteria 2841983080 2841989655 427
159 iso_pu_bacteria 2842038055 2842044172 427
160 iso_pu_bacteria 2842045827 2842051839 427
161 iso_pu_bacteria 2842333319 2842336467 427
162 iso_pu_bacteria 2844315083 2844316126 427
163 iso_pu_bacteria 2846952575 2846954681 427
164 iso_pu_bacteria 2847930680 2847931824 427
165 iso_pu_bacteria 2847939898 2847941491 427
166 iso_pu_bacteria 2848858292 2848859052 427
167 iso_pu_bacteria 2849076700 2849082402 427
168 iso_pu_bacteria 2857509624 2857516536 427
169 iso_pu_bacteria 2857524615 2857524845 427
170 iso_pu_bacteria 2874590934 2874595511 427
171 iso_pu_bacteria 2874604998 2874611610 427
172 iso_pu_bacteria 2874612657 2874615905 427
173 iso_pu_bacteria 2874620515 2874621514 427
174 iso_pu_bacteria 2874628541 2874629450 427
175 iso_pu_bacteria 2874645413 2874647056 427
176 iso_pu_bacteria 2876761206 2876765884 427
177 iso_pu_bacteria 2876771140 2876775705 427
178 iso_pu_bacteria 2876818435 2876823697 427
179 iso_pu_bacteria 2879074833 2879079796 427
180 iso_pu_bacteria 2879083081 2879091266 427
181 iso_pu_bacteria 2879099564 2879103068 427
182 iso_pu_bacteria 2879110137 2879117474 427
183 iso_pu_bacteria 2879127579 2879131125 427
184 iso_pu_bacteria 2879142872 2879150331 427
185 iso_pu_bacteria 2881364244 2881369808 427
186 iso_pu_bacteria 2881665667 2881668643 427
187 iso_pu_bacteria 2885366525 2885368262 427
188 iso_pu_bacteria 2885374607 2885378231 427
189 iso_pu_bacteria 2885383462 2885388939 427
190 iso_pu_bacteria 2885409591 2885413154 427
191 iso_pu_bacteria 2888378607 2888380243 427
192 iso_pu_bacteria 2888388044 2888391274 427
193 iso_pu_bacteria 2888419890 2888427162 427
194 iso_pu_bacteria 2889033259 2889037788 427
195 iso_pu_bacteria 2893066018 2893069359 427
196 iso_pu_bacteria 2897803580 2897804159 427
197 iso_pu_bacteria 2903727486 2903729472 427
198 iso_pu_bacteria 2903748898 2903752240 427
199 iso_pu_bacteria 2903768456 2903775910 427
200 iso_pu_bacteria 2904666416 2904668183 427
201 iso_pu_bacteria 2904690495 2904698961 427
202 iso_pu_bacteria 2904699407 2904701018 427
203 iso_pu_bacteria 2904711408 2904719968 427
204 iso_pu_bacteria 2906602504 2906606682 427
205 iso_pu_bacteria 2906610324 2906616319 427
206 iso_pu_bacteria 2906626472 2906634551 427
207 iso_pu_bacteria 2906635258 2906641524 427
208 iso_pu_bacteria 2906643746 2906652350 427
209 iso_pu_bacteria 2906660503 2906662898 427
210 iso_pu_bacteria 2908739725 2908741459 427
211 iso_pu_bacteria 2908756301 2908758758 427
212 iso_pu_bacteria 2908775508 2908782907 427
213 iso_pu_bacteria 2919073203 2919078732 427
214 iso_pu_bacteria 2919414237 2919416266 427
215 iso_pu_bacteria 2922361189 2922361731 427
216 iso_pu_bacteria 2922368715 2922369810 427
217 iso_pu_bacteria 2922386360 2922387019 427
218 iso_pu_bacteria 2922393267 2922398767 427
219 iso_pu_bacteria 2922425934 2922431683 427
220 iso_pu_bacteria 2929615660 2929622831 427
221 iso_pu_bacteria 2929624759 2929632065 427
222 iso_pu_bacteria 2932784394 2932789848 427
223 iso_pu_bacteria 2932794094 2932796195 427
224 iso_pu_bacteria 2932801729 2932807769 427
225 iso_pu_bacteria 2932809354 2932815405 427
226 iso_pu_bacteria 2932818245 2932825156 427
227 iso_pu_bacteria 2932828146 2932829324 427
228 iso_pu_bacteria 2933577622 2933584537 427
229 iso_pu_bacteria 2935608549 2935614212 427
230 iso_pu_bacteria 2935616580 2935617757 427
231 iso_pu_bacteria 2935630451 2935635769 427
232 iso_pu_bacteria 2935638405 2935643802 427
233 iso_pu_bacteria 2935648319 2935651419 427
234 iso_pu_bacteria 2935656913 2935659813 427
235 iso_pu_bacteria 2935665750 2935670888 427
236 iso_pu_bacteria 2935675223 2935678221 427
237 iso_pu_bacteria 2935684952 2935692509 427
238 iso_pu_bacteria 2935694250 2935699277 427
239 iso_pu_bacteria 2935703347 2935710084 427
240 iso_pu_bacteria 2935713505 2935721127 427
241 iso_pu_bacteria 2935722832 2935730880 427
242 iso_pu_bacteria 2935732158 2935739816 427
243 iso_pu_bacteria 2935741537 2935748854 427
244 iso_pu_bacteria 2935750917 2935758724 427
245 iso_pu_bacteria 2935760218 2935767786 427
246 iso_pu_bacteria 2935769743 2935775581 427
247 iso_pu_bacteria 2935777560 2935779838 427
248 iso_pu_bacteria 2935785616 2935790109 427
249 iso_pu_bacteria 2935793552 2935798544 427
250 iso_pu_bacteria 2935801545 2935806752 427
251 iso_pu_bacteria 2935810662 2935817915 427
252 iso_pu_bacteria 2935819856 2935826463 427
253 iso_pu_bacteria 2935827899 2935834487 427
254 iso_pu_bacteria 2935837841 2935843788 427
255 iso_pu_bacteria 2935847175 2935851342 427
256 iso_pu_bacteria 2935855204 2935856744 427
257 iso_pu_bacteria 2935864058 2935868223 427
258 iso_pu_bacteria 2935873716 2935879581 427
259 iso_pu_bacteria 2935883170 2935887477 427
260 iso_pu_bacteria 2935908558 2935913306 427
261 iso_pu_bacteria 2935916978 2935922710 427
262 iso_pu_bacteria 2935926038 2935930769 427
263 iso_pu_bacteria 2935934488 2935939897 427
264 iso_pu_bacteria 2935942939 2935946846 427
265 iso_pu_bacteria 2935951376 2935955953 427
266 iso_pu_bacteria 2935959822 2935966250 427
267 iso_pu_bacteria 2935967501 2935972746 427
268 iso_pu_bacteria 2935975950 2935982537 427
269 iso_pu_bacteria 2935984226 2935984521 427
270 iso_pu_bacteria 2935992306 2935997087 427
271 iso_pu_bacteria 2936002035 2936009801 427
272 iso_pu_bacteria 2936011229 2936014229 427
273 iso_pu_bacteria 2936019824 2936022862 427
274 iso_pu_bacteria 2936028420 2936030999 427
275 iso_pu_bacteria 2936037263 2936044687 427
276 iso_pu_bacteria 2936046547 2936049120 427
277 iso_pu_bacteria 2936055302 2936055565 427
278 iso_pu_bacteria 2936361878 2936362461 427
279 iso_pu_bacteria 2940556831 2940564686 427
280 iso_pu_bacteria 2941507105 2941512394 427
281 iso_pu_bacteria 2941515067 2941520101 427
282 iso_pu_bacteria 2941523033 2941528250 427
283 iso_pu_bacteria 2941531003 2941534855 427
284 iso_pu_bacteria 2941538514 2941545036 427
285 iso_pu_bacteria 2977254563 2977255994 427
286 iso_pu_bacteria 2990275345 2990276840 427
287 iso_pu_bacteria 3001892409 3001895281 427
288 iso_pu_bacteria 3005474847 3005481482 427
289 iso_pu_bacteria 3005483717 3005490392 427
290 iso_pu_bacteria 3005506211 3005509802 427
291 iso_pu_bacteria 3005587118 3005591094 427
292 iso_pu_bacteria 3005594810 3005595715 427
293 iso_pu_bacteria 3005710791 3005711692 427
294 iso_pu_bacteria 3005718088 3005718955 427
295 iso_pu_bacteria 3006978542 3006981143 427
296 iso_pu_bacteria 8006926726 8006930568 427
297 iso_pu_bacteria 8006933436 8006939235 427
298 iso_pu_bacteria 8006964411 8006966846 427
299 iso_pu_bacteria 8006973647 8006978893 427
300 iso_pu_bacteria 8006984368 8006984647 427
301 iso_pu_bacteria 8006994254 8006994642 427
302 iso_pu_bacteria 8016511872 8016518923 427
303 iso_pu_bacteria 8016522445 8016525542 427
304 iso_pu_bacteria 8016539877 8016543422 427
305 iso_pu_bacteria 8016557553 8016558286 427
306 iso_pu_bacteria 8016566248 8016568825 427
307 iso_pu_bacteria 8016575299 8016581470 427
308 iso_pu_bacteria 8016583857 8016587192 427
309 iso_pu_bacteria 8016595262 8016596283 427
310 iso_pu_bacteria 8016603502 8016607193 427
311 iso_pu_bacteria 8016613128 8016619091 427
312 iso_pu_bacteria 8016622563 8016630492 427
313 iso_pu_bacteria 8016630954 8016636591 427
314 iso_pu_bacteria 8017057580 8017057766 427
315 iso_pu_bacteria 8019530166 8019538804 427
316 iso_pu_bacteria 8019538911 8019541178 427
317 iso_pu_bacteria 8019547302 8019549438 427
318 iso_pu_bacteria 8019555841 8019565093 427
319 iso_pu_bacteria 8019565922 8019575197 427
320 iso_pu_bacteria 8019576017 8019578014 427
321 iso_pu_bacteria 8019597564 8019605644 427
322 iso_pu_bacteria 8019619141 8019623574 427
323 iso_pu_bacteria 8019629233 8019638577 427
324 iso_pu_bacteria 8019638758 8019641167 427
325 iso_pu_bacteria 8019659431 8019666378 427
326 iso_pu_bacteria 8019668869 8019676040 427
327 iso_pu_bacteria 8019678201 8019680105 427
328 iso_pu_bacteria 8019687851 8019693418 427
329 iso_pu_bacteria 8054002106 8054005951 427
330 iso_pu_bacteria 8055742211 8055750734 427
331 iso_pu_bacteria 8056673599 8056680890 427
332 iso_pu_bacteria 8056681323 8056684257 427
333 iso_pu_bacteria 8056689827 8056690599 427
334 iso_pu_bacteria 8056967851 8056970564 427
335 iso_pu_bacteria 8057632132 8057636137 427
336 3300048911 Ga0496108_0200627 Ga0496108_0200627_25_1335 428
337 3300048913 Ga0496110_0002562 Ga0496110_0002562_5408_6718 428
338 3300048914 Ga0496111_0001360 Ga0496111_0001360_1311_2621 428
339 3300005444 Ga0070694_100048368 Ga0070694_1000483683 429
340 3300005545 Ga0070695_100024951 Ga0070695_1000249513 429
341 3300005549 Ga0070704_100174236 Ga0070704_1001742362 429
342 3300005434 Ga0070709_10121040 Ga0070709_101210401 430
343 3300005435 Ga0070714_100017873 Ga0070714_1000178734 430
344 3300005436 Ga0070713_100135585 Ga0070713_1001355852 430
345 3300005981 Ga0081538_10057238 Ga0081538_100572382 430
346 3300006847 Ga0075431_100002016 Ga0075431_1000020166 430
347 3300006880 Ga0075429_100012416 Ga0075429_1000124166 430
348 3300009094 Ga0111539_10317521 Ga0111539_103175211 430
349 3300009147 Ga0114129_10068570 Ga0114129_100685706 430
350 3300009551 Ga0105238_10047043 Ga0105238_100470433 430
351 3300009993 Ga0105028_101203 Ga0105028_1012032 430
352 3300025291 Ga0209675_1007363 Ga0209675_10073635 430
353 3300025304 Ga0209257_1000368 Ga0209257_100036820 430
354 3300025928 Ga0207700_10043639 Ga0207700_100436393 430
355 3300031344 Ga0265316_10025488 Ga0265316_100254883 430
356 3300035725 Ga0373947_0086393 Ga0373947_0086393_263_1555 430
357 3300038735 Ga0400485_06767 Ga0400485_06767_4854_6146 430
358 3300039062 Ga0400483_015990 Ga0400483_015990_4060_5352 430
359 3300039437 Ga0436365_1747149 Ga0436365_1747149_2534_3826 430
360 3300042436 Ga0439435_0029075 Ga0439435_0029075_130_1422 430
361 3300048926 Ga0496123_0066540 Ga0496123_0066540_53_1345 430
362 3300049161 Ga0501305_001889 Ga0501305_001889_457_1773 430
363 3300049528 Ga0501312_000418 Ga0501312_000418_645_1961 430
364 3300049528 Ga0501312_002551 Ga0501312_002551_323_1639 430
365 3300049568 Ga0501031_0115929 Ga0501031_0115929_211_1503 430
366 3300049572 Ga0501036_0254508 Ga0501036_0254508_16_1308 430
367 3300049574 Ga0501038_0010211 Ga0501038_0010211_7182_8474 430
368 3300049576 Ga0501040_0010754 Ga0501040_0010754_2697_3989 430
369 3300049578 Ga0501042_0010034 Ga0501042_0010034_887_2179 430
370 3300049579 Ga0501043_0108403 Ga0501043_0108403_717_2009 430
371 3300049584 Ga0501068_0008999 Ga0501068_0008999_3314_4606 430
372 3300049585 Ga0501069_0054403 Ga0501069_0054403_618_1910 430
373 3300049587 Ga0501071_0008392 Ga0501071_0008392_2020_3312 430
374 3300049591 Ga0501075_0005258 Ga0501075_0005258_5241_6533 430
375 3300049742 Ga0501080_0012893 Ga0501080_0012893_1611_2903 430
376 3300049742 Ga0501080_0043316 Ga0501080_0043316_877_2169 430
377 3300049823 Ga0501044_0009069 Ga0501044_0009069_2933_4225 430
378 3300049824 Ga0501045_0009596 Ga0501045_0009596_5258_6550 430
379 3300050507 nmdc:mga05p37_120614_c1 nmdc:mga05p37_120614_c1_1478_2770 430
380 3300050510 nmdc:mga06r32_4688_c1 nmdc:mga06r32_4688_c1_3361_4653 430
381 3300053151 Ga0500604_0002553 Ga0500604_0002553_734_2026 430
382 3300054114 Ga0501084_0026729 Ga0501084_0026729_418_1710 430
383 3300054114 Ga0501084_0193228 Ga0501084_0193228_115_1407 430
384 3300060353 Ga0501082_0020282 Ga0501082_0020282_521_1813 430
385 3300003203 JGI25406J46586_10000038 JGI25406J46586_1000003825 431
386 3300003203 JGI25406J46586_10001332 JGI25406J46586_1000133211 431
387 3300003215 JGI25153J46596_10001090 JGI25153J46596_100010904 431
388 3300003215 JGI25153J46596_10001143 JGI25153J46596_1000114317 431
389 3300003215 JGI25153J46596_10013136 JGI25153J46596_100131361 431
390 3300003354 JGI25160J50197_1009430 JGI25160J50197_10094303 431
391 3300003659 JGI25404J52841_10001402 JGI25404J52841_100014021 431
392 3300003659 JGI25404J52841_10005555 JGI25404J52841_100055551 431
393 3300004625 Ga0055543_1003719 Ga0055543_10037194 431
394 3300005262 Ga0065165_1000721 Ga0065165_100072122 431
395 3300005262 Ga0065165_1002559 Ga0065165_100255911 431
396 3300005262 Ga0065165_1017679 Ga0065165_10176792 431
397 3300005262 Ga0065165_1019229 Ga0065165_10192293 431
398 3300005327 Ga0070658_10031329 Ga0070658_100313293 431
399 3300005329 Ga0070683_100004866 Ga0070683_10000486613 431
400 3300005331 Ga0070670_100013506 Ga0070670_1000135061 431
401 3300005334 Ga0068869_100037881 Ga0068869_1000378812 431
402 3300005334 Ga0068869_100072454 Ga0068869_1000724542 431
403 3300005336 Ga0070680_100084672 Ga0070680_1000846724 431
404 3300005337 Ga0070682_100012739 Ga0070682_1000127392 431
405 3300005338 Ga0068868_100026969 Ga0068868_1000269692 431
406 3300005338 Ga0068868_100041790 Ga0068868_1000417903 431
407 3300005338 Ga0068868_100061439 Ga0068868_1000614392 431
408 3300005339 Ga0070660_100010412 Ga0070660_1000104123 431
409 3300005340 Ga0070689_100007055 Ga0070689_1000070552 431
410 3300005341 Ga0070691_10001706 Ga0070691_100017066 431
411 3300005341 Ga0070691_10026246 Ga0070691_100262461 431
412 3300005344 Ga0070661_100053990 Ga0070661_1000539903 431
413 3300005355 Ga0070671_100000170 Ga0070671_10000017018 431
414 3300005364 Ga0070673_100004457 Ga0070673_1000044574 431
415 3300005365 Ga0070688_100188897 Ga0070688_1001888971 431
416 3300005366 Ga0070659_100032467 Ga0070659_1000324673 431
417 3300005366 Ga0070659_100048523 Ga0070659_1000485233 431
418 3300005367 Ga0070667_100034398 Ga0070667_1000343984 431
419 3300005406 Ga0070703_10011629 Ga0070703_100116291 431
420 3300005436 Ga0070713_100062633 Ga0070713_1000626332 431
421 3300005436 Ga0070713_100319758 Ga0070713_1003197581 431
422 3300005437 Ga0070710_10139683 Ga0070710_101396831 431
423 3300005439 Ga0070711_100003099 Ga0070711_1000030991 431
424 3300005439 Ga0070711_100073841 Ga0070711_1000738412 431
425 3300005444 Ga0070694_100000604 Ga0070694_10000060410 431
426 3300005445 Ga0070708_100012245 Ga0070708_1000122455 431
427 3300005445 Ga0070708_100127008 Ga0070708_1001270082 431
428 3300005456 Ga0070678_100134219 Ga0070678_1001342191 431
429 3300005458 Ga0070681_10035275 Ga0070681_100352752 431
430 3300005458 Ga0070681_10064136 Ga0070681_100641361 431
431 3300005458 Ga0070681_10073291 Ga0070681_100732914 431
432 3300005458 Ga0070681_10109546 Ga0070681_101095464 431
433 3300005459 Ga0068867_100133690 Ga0068867_1001336902 431
434 3300005518 Ga0070699_100001264 Ga0070699_10000126411 431
435 3300005530 Ga0070679_100017666 Ga0070679_1000176663 431
436 3300005530 Ga0070679_100125200 Ga0070679_1001252004 431
437 3300005535 Ga0070684_100010958 Ga0070684_1000109588 431
438 3300005535 Ga0070684_100039358 Ga0070684_1000393582 431
439 3300005535 Ga0070684_100058840 Ga0070684_1000588404 431
440 3300005536 Ga0070697_100012239 Ga0070697_1000122394 431
441 3300005539 Ga0068853_100015741 Ga0068853_1000157414 431
442 3300005546 Ga0070696_100005035 Ga0070696_1000050353 431
443 3300005548 Ga0070665_100013287 Ga0070665_1000132875 431
444 3300005548 Ga0070665_100013848 Ga0070665_1000138483 431
445 3300005548 Ga0070665_100069949 Ga0070665_1000699492 431
446 3300005549 Ga0070704_100001210 Ga0070704_10000121015 431
447 3300005563 Ga0068855_100066927 Ga0068855_1000669272 431
448 3300005563 Ga0068855_100197158 Ga0068855_1001971582 431
449 3300005577 Ga0068857_100038607 Ga0068857_1000386073 431
450 3300005577 Ga0068857_100038848 Ga0068857_1000388485 431
451 3300005614 Ga0068856_100003313 Ga0068856_10000331316 431
452 3300005614 Ga0068856_100013310 Ga0068856_1000133103 431
453 3300005616 Ga0068852_100001667 Ga0068852_1000016673 431
454 3300005616 Ga0068852_100066401 Ga0068852_1000664013 431
455 3300005617 Ga0068859_100004768 Ga0068859_1000047685 431
456 3300005719 Ga0068861_100031380 Ga0068861_1000313803 431
457 3300005719 Ga0068861_100076931 Ga0068861_1000769312 431
458 3300005834 Ga0068851_10015821 Ga0068851_100158212 431
459 3300005842 Ga0068858_100186390 Ga0068858_1001863901 431
460 3300005843 Ga0068860_100000711 Ga0068860_10000071127 431
461 3300005843 Ga0068860_100114271 Ga0068860_1001142714 431
462 3300005844 Ga0068862_100002512 Ga0068862_10000251210 431
463 3300005844 Ga0068862_100022673 Ga0068862_1000226735 431
464 3300005844 Ga0068862_100115227 Ga0068862_1001152272 431
465 3300005937 Ga0081455_10000017 Ga0081455_1000001760 431
466 3300005937 Ga0081455_10002635 Ga0081455_1000263510 431
467 3300005937 Ga0081455_10017707 Ga0081455_100177073 431
468 3300005937 Ga0081455_10087778 Ga0081455_100877782 431
469 3300005981 Ga0081538_10004632 Ga0081538_1000463211 431
470 3300005981 Ga0081538_10017999 Ga0081538_100179995 431
471 3300005983 Ga0081540_1000059 Ga0081540_10000597 431
472 3300005983 Ga0081540_1004330 Ga0081540_10043302 431
473 3300005983 Ga0081540_1005964 Ga0081540_10059643 431
474 3300005983 Ga0081540_1006212 Ga0081540_10062126 431
475 3300005983 Ga0081540_1009418 Ga0081540_10094182 431
476 3300005983 Ga0081540_1013117 Ga0081540_10131172 431
477 3300005983 Ga0081540_1013193 Ga0081540_10131935 431
478 3300005983 Ga0081540_1021925 Ga0081540_10219253 431
479 3300005983 Ga0081540_1022189 Ga0081540_10221894 431
480 3300005983 Ga0081540_1026518 Ga0081540_10265182 431
481 3300005983 Ga0081540_1045581 Ga0081540_10455812 431
482 3300005983 Ga0081540_1047465 Ga0081540_10474652 431
483 3300005985 Ga0081539_10000080 Ga0081539_10000080185 431
484 3300005985 Ga0081539_10000220 Ga0081539_1000022025 431
485 3300005985 Ga0081539_10027918 Ga0081539_100279182 431
486 3300006028 Ga0070717_10000884 Ga0070717_1000088415 431
487 3300006028 Ga0070717_10007593 Ga0070717_100075935 431
488 3300006038 Ga0075365_10000311 Ga0075365_1000031110 431
489 3300006038 Ga0075365_10055836 Ga0075365_100558362 431
490 3300006038 Ga0075365_10109419 Ga0075365_101094191 431
491 3300006038 Ga0075365_10111954 Ga0075365_101119542 431
492 3300006042 Ga0075368_10003624 Ga0075368_100036243 431
493 3300006042 Ga0075368_10004781 Ga0075368_100047813 431
494 3300006048 Ga0075363_100001272 Ga0075363_1000012728 431
495 3300006048 Ga0075363_100043534 Ga0075363_1000435342 431
496 3300006051 Ga0075364_10001505 Ga0075364_100015057 431
497 3300006051 Ga0075364_10050231 Ga0075364_100502311 431
498 3300006051 Ga0075364_10135304 Ga0075364_101353041 431
499 3300006163 Ga0070715_10001487 Ga0070715_100014873 431
500 3300006177 Ga0075362_10001659 Ga0075362_100016592 431
501 3300006177 Ga0075362_10010512 Ga0075362_100105122 431
502 3300006178 Ga0075367_10001516 Ga0075367_100015164 431
503 3300006178 Ga0075367_10017979 Ga0075367_100179792 431
504 3300006178 Ga0075367_10028820 Ga0075367_100288203 431
505 3300006178 Ga0075367_10040558 Ga0075367_100405583 431
506 3300006178 Ga0075367_10133111 Ga0075367_101331112 431
507 3300006186 Ga0075369_10030898 Ga0075369_100308982 431
508 3300006353 Ga0075370_10021919 Ga0075370_100219192 431
509 3300006353 Ga0075370_10053904 Ga0075370_100539042 431
510 3300006358 Ga0068871_100098349 Ga0068871_1000983492 431
511 3300006844 Ga0075428_100201205 Ga0075428_1002012052 431
512 3300006871 Ga0075434_100011193 Ga0075434_1000111933 431
513 3300006871 Ga0075434_100024076 Ga0075434_1000240765 431
514 3300006931 Ga0097620_100004768 Ga0097620_1000047685 431
515 3300006941 Ga0099825_1020047 Ga0099825_10200473 431
516 3300006942 Ga0099824_1012895 Ga0099824_10128955 431
517 3300006943 Ga0099822_1003531 Ga0099822_100353114 431
518 3300006944 Ga0099823_1007767 Ga0099823_10077673 431
519 3300007076 Ga0075435_100053000 Ga0075435_1000530002 431
520 3300009093 Ga0105240_10005052 Ga0105240_1000505213 431
521 3300009093 Ga0105240_10302018 Ga0105240_103020182 431
522 3300009098 Ga0105245_10001527 Ga0105245_100015274 431
523 3300009098 Ga0105245_10008614 Ga0105245_100086145 431
524 3300009101 Ga0105247_10016349 Ga0105247_100163493 431
525 3300009101 Ga0105247_10068972 Ga0105247_100689722 431
526 3300009147 Ga0114129_10086246 Ga0114129_100862462 431
527 3300009147 Ga0114129_10196571 Ga0114129_101965712 431
528 3300009174 Ga0105241_10009951 Ga0105241_100099519 431
529 3300009177 Ga0105248_10049003 Ga0105248_100490035 431
530 3300009545 Ga0105237_10001825 Ga0105237_1000182521 431
531 3300009545 Ga0105237_10073492 Ga0105237_100734922 431
532 3300009545 Ga0105237_10092269 Ga0105237_100922692 431
533 3300009545 Ga0105237_10179331 Ga0105237_101793312 431
534 3300009551 Ga0105238_10099556 Ga0105238_100995563 431
535 3300010159 Ga0099796_10038186 Ga0099796_100381861 431
536 3300010375 Ga0105239_10058217 Ga0105239_100582172 431
537 3300010375 Ga0105239_10090880 Ga0105239_100908803 431
538 3300011119 Ga0105246_10144712 Ga0105246_101447122 431
539 3300013100 Ga0157373_10051862 Ga0157373_100518621 431
540 3300013102 Ga0157371_10009033 Ga0157371_100090334 431
541 3300013104 Ga0157370_10114337 Ga0157370_101143372 431
542 3300013105 Ga0157369_10004066 Ga0157369_1000406610 431
543 3300013105 Ga0157369_10014664 Ga0157369_100146646 431
544 3300013105 Ga0157369_10037827 Ga0157369_100378275 431
545 3300013105 Ga0157369_10293897 Ga0157369_102938972 431
546 3300013296 Ga0157374_10012732 Ga0157374_100127324 431
547 3300013306 Ga0163162_10040120 Ga0163162_100401206 431
548 3300013307 Ga0157372_10025437 Ga0157372_100254376 431
549 3300013308 Ga0157375_10017268 Ga0157375_100172684 431
550 3300013308 Ga0157375_10239327 Ga0157375_102393272 431
551 3300013308 Ga0157375_10439566 Ga0157375_104395662 431
552 3300014325 Ga0163163_10031880 Ga0163163_100318801 431
553 3300014325 Ga0163163_10038268 Ga0163163_100382685 431
554 3300014325 Ga0163163_10056783 Ga0163163_100567832 431
555 3300014968 Ga0157379_10098154 Ga0157379_100981543 431
556 3300014969 Ga0157376_10005380 Ga0157376_100053804 431
557 3300021320 Ga0214544_1000007 Ga0214544_1000007235 431
558 3300021321 Ga0214542_1000007 Ga0214542_1000007147 431
559 3300021324 Ga0214545_1000006 Ga0214545_1000006146 431
560 3300021324 Ga0214545_1025698 Ga0214545_10256982 431
561 3300021327 Ga0214543_1000009 Ga0214543_1000009235 431
562 3300021361 Ga0213872_10018555 Ga0213872_100185554 431
563 3300025253 Ga0209677_101607 Ga0209677_1016077 431
564 3300025254 Ga0209148_1000216 Ga0209148_100021654 431
565 3300025261 Ga0209233_1004139 Ga0209233_10041393 431
566 3300025272 Ga0209455_1001447 Ga0209455_100144710 431
567 3300025273 Ga0209673_1030417 Ga0209673_10304171 431
568 3300025295 Ga0209564_1001014 Ga0209564_100101411 431
569 3300025295 Ga0209564_1004938 Ga0209564_10049387 431
570 3300025295 Ga0209564_1010262 Ga0209564_10102623 431
571 3300025297 Ga0209758_1000015 Ga0209758_1000015598 431
572 3300025297 Ga0209758_1000161 Ga0209758_100016169 431
573 3300025297 Ga0209758_1001304 Ga0209758_100130422 431
574 3300025297 Ga0209758_1007191 Ga0209758_10071915 431
575 3300025297 Ga0209758_1009851 Ga0209758_10098513 431
576 3300025297 Ga0209758_1015686 Ga0209758_10156865 431
577 3300025297 Ga0209758_1035145 Ga0209758_10351451 431
578 3300025299 Ga0209256_1007571 Ga0209256_10075712 431
579 3300025299 Ga0209256_1013156 Ga0209256_10131562 431
580 3300025302 Ga0207426_1000186 Ga0207426_1000186121 431
581 3300025302 Ga0207426_1001742 Ga0207426_10017426 431
582 3300025302 Ga0207426_1012233 Ga0207426_10122332 431
583 3300025885 Ga0207653_10002688 Ga0207653_100026884 431
584 3300025898 Ga0207692_10024479 Ga0207692_100244792 431
585 3300025900 Ga0207710_10020548 Ga0207710_100205482 431
586 3300025900 Ga0207710_10042202 Ga0207710_100422022 431
587 3300025901 Ga0207688_10042576 Ga0207688_100425762 431
588 3300025906 Ga0207699_10002096 Ga0207699_100020966 431
589 3300025909 Ga0207705_10135086 Ga0207705_101350861 431
590 3300025910 Ga0207684_10064450 Ga0207684_100644502 431
591 3300025910 Ga0207684_10097208 Ga0207684_100972082 431
592 3300025911 Ga0207654_10029722 Ga0207654_100297222 431
593 3300025912 Ga0207707_10002566 Ga0207707_1000256613 431
594 3300025912 Ga0207707_10004618 Ga0207707_100046186 431
595 3300025912 Ga0207707_10012807 Ga0207707_100128074 431
596 3300025912 Ga0207707_10016469 Ga0207707_100164696 431
597 3300025913 Ga0207695_10000006 Ga0207695_10000006224 431
598 3300025913 Ga0207695_10029203 Ga0207695_100292033 431
599 3300025913 Ga0207695_10208308 Ga0207695_102083082 431
600 3300025914 Ga0207671_10005136 Ga0207671_100051364 431
601 3300025914 Ga0207671_10079706 Ga0207671_100797062 431
602 3300025915 Ga0207693_10001388 Ga0207693_1000138817 431
603 3300025915 Ga0207693_10018758 Ga0207693_100187583 431
604 3300025916 Ga0207663_10012993 Ga0207663_100129932 431
605 3300025916 Ga0207663_10016593 Ga0207663_100165931 431
606 3300025917 Ga0207660_10001934 Ga0207660_1000193416 431
607 3300025917 Ga0207660_10022103 Ga0207660_100221032 431
608 3300025917 Ga0207660_10081312 Ga0207660_100813122 431
609 3300025919 Ga0207657_10001315 Ga0207657_1000131520 431
610 3300025919 Ga0207657_10012952 Ga0207657_100129526 431
611 3300025921 Ga0207652_10016463 Ga0207652_100164632 431
612 3300025924 Ga0207694_10063186 Ga0207694_100631861 431
613 3300025925 Ga0207650_10009533 Ga0207650_100095334 431
614 3300025928 Ga0207700_10001452 Ga0207700_1000145215 431
615 3300025928 Ga0207700_10034329 Ga0207700_100343292 431
616 3300025928 Ga0207700_10043367 Ga0207700_100433674 431
617 3300025928 Ga0207700_10126505 Ga0207700_101265053 431
618 3300025928 Ga0207700_10251466 Ga0207700_102514661 431
619 3300025931 Ga0207644_10001194 Ga0207644_100011943 431
620 3300025932 Ga0207690_10050422 Ga0207690_100504223 431
621 3300025933 Ga0207706_10039347 Ga0207706_100393473 431
622 3300025933 Ga0207706_10059280 Ga0207706_100592802 431
623 3300025935 Ga0207709_10048312 Ga0207709_100483122 431
624 3300025936 Ga0207670_10007348 Ga0207670_100073483 431
625 3300025937 Ga0207669_10002669 Ga0207669_100026694 431
626 3300025939 Ga0207665_10000874 Ga0207665_1000087416 431
627 3300025939 Ga0207665_10019486 Ga0207665_100194863 431
628 3300025939 Ga0207665_10047796 Ga0207665_100477962 431
629 3300025941 Ga0207711_10061786 Ga0207711_100617863 431
630 3300025944 Ga0207661_10021344 Ga0207661_100213444 431
631 3300025944 Ga0207661_10117171 Ga0207661_101171712 431
632 3300025945 Ga0207679_10127642 Ga0207679_101276422 431
633 3300025949 Ga0207667_10012575 Ga0207667_100125754 431
634 3300025949 Ga0207667_10248073 Ga0207667_102480732 431
635 3300025960 Ga0207651_10064458 Ga0207651_100644583 431
636 3300025961 Ga0207712_10092064 Ga0207712_100920642 431
637 3300025972 Ga0207668_10069457 Ga0207668_100694572 431
638 3300025972 Ga0207668_10237981 Ga0207668_102379811 431
639 3300026023 Ga0207677_10005921 Ga0207677_100059215 431
640 3300026023 Ga0207677_10104908 Ga0207677_101049081 431
641 3300026041 Ga0207639_10014696 Ga0207639_100146963 431
642 3300026067 Ga0207678_10010380 Ga0207678_100103804 431
643 3300026067 Ga0207678_10032772 Ga0207678_100327722 431
644 3300026067 Ga0207678_10048937 Ga0207678_100489371 431
645 3300026067 Ga0207678_10050044 Ga0207678_100500443 431
646 3300026067 Ga0207678_10105136 Ga0207678_101051362 431
647 3300026075 Ga0207708_10003078 Ga0207708_1000307810 431
648 3300026075 Ga0207708_10119042 Ga0207708_101190422 431
649 3300026078 Ga0207702_10000325 Ga0207702_1000032531 431
650 3300026116 Ga0207674_10037716 Ga0207674_100377164 431
651 3300026118 Ga0207675_100080248 Ga0207675_1000802482 431
652 3300026118 Ga0207675_100128525 Ga0207675_1001285252 431
653 3300026121 Ga0207683_10021712 Ga0207683_100217125 431
654 3300026121 Ga0207683_10214283 Ga0207683_102142832 431
655 3300027296 Ga0209389_1000062 Ga0209389_100006266 431
656 3300027296 Ga0209389_1000072 Ga0209389_100007212 431
657 3300027357 Ga0209589_1000011 Ga0209589_100001121 431
658 3300027357 Ga0209589_1000270 Ga0209589_100027056 431
659 3300027361 Ga0209489_100012 Ga0209489_10001221 431
660 3300027361 Ga0209489_100160 Ga0209489_10016066 431
661 3300027361 Ga0209489_100206 Ga0209489_10020612 431
662 3300027363 Ga0209700_100019 Ga0209700_10001921 431
663 3300027363 Ga0209700_101128 Ga0209700_10112845 431
664 3300027866 Ga0209813_10000705 Ga0209813_100007054 431
665 3300028379 Ga0268266_10002101 Ga0268266_1000210116 431
666 3300028379 Ga0268266_10025141 Ga0268266_100251413 431
667 3300028379 Ga0268266_10062907 Ga0268266_100629072 431
668 3300028380 Ga0268265_10015487 Ga0268265_100154873 431
669 3300028380 Ga0268265_10058818 Ga0268265_100588182 431
670 3300028381 Ga0268264_10000065 Ga0268264_1000006531 431
671 3300028381 Ga0268264_10007132 Ga0268264_100071326 431
672 3300028556 Ga0265337_1022685 Ga0265337_10226851 431
673 3300028558 Ga0265326_10025223 Ga0265326_100252231 431
674 3300028563 Ga0265319_1029202 Ga0265319_10292022 431
675 3300028573 Ga0265334_10045023 Ga0265334_100450232 431
676 3300028577 Ga0265318_10044010 Ga0265318_100440101 431
677 3300028653 Ga0265323_10031892 Ga0265323_100318922 431
678 3300028666 Ga0265336_10000481 Ga0265336_100004814 431
679 3300028786 Ga0307517_10000279 Ga0307517_1000027943 431
680 3300028794 Ga0307515_10012109 Ga0307515_100121099 431
681 3300028800 Ga0265338_10000317 Ga0265338_1000031753 431
682 3300029957 Ga0265324_10007835 Ga0265324_100078355 431
683 3300029957 Ga0265324_10009946 Ga0265324_100099464 431
684 3300029957 Ga0265324_10015575 Ga0265324_100155751 431
685 3300031239 Ga0265328_10000750 Ga0265328_1000075012 431
686 3300031239 Ga0265328_10011927 Ga0265328_100119273 431
687 3300031239 Ga0265328_10042051 Ga0265328_100420512 431
688 3300031247 Ga0265340_10006005 Ga0265340_100060058 431
689 3300031250 Ga0265331_10000497 Ga0265331_100004977 431
690 3300031250 Ga0265331_10032599 Ga0265331_100325992 431
691 3300031251 Ga0265327_10000810 Ga0265327_1000081032 431
692 3300031251 Ga0265327_10005760 Ga0265327_100057609 431
693 3300031344 Ga0265316_10039472 Ga0265316_100394723 431
694 3300031507 Ga0307509_10024299 Ga0307509_100242992 431
695 3300031548 Ga0307408_100154312 Ga0307408_1001543122 431
696 3300031616 Ga0307508_10000514 Ga0307508_1000051430 431
697 3300031711 Ga0265314_10036474 Ga0265314_100364742 431
698 3300031711 Ga0265314_10065731 Ga0265314_100657312 431
699 3300031711 Ga0265314_10100505 Ga0265314_101005051 431
700 3300031730 Ga0307516_10001288 Ga0307516_1000128819 431
701 3300031730 Ga0307516_10010587 Ga0307516_100105874 431
702 3300031730 Ga0307516_10212641 Ga0307516_102126412 431
703 3300033180 Ga0307510_10035023 Ga0307510_100350238 431
704 3300033180 Ga0307510_10042213 Ga0307510_100422133 431
705 3300033180 Ga0307510_10115841 Ga0307510_101158413 431
706 3300033180 Ga0307510_10117603 Ga0307510_101176032 431
707 3300033442 Ga0315911_1000003 Ga0315911_1000003427 431
708 3300035083 Ga0373926_0013951 Ga0373926_0013951_986_2281 431
709 3300035086 Ga0373934_0018837 Ga0373934_0018837_1190_2485 431
710 3300035111 Ga0373923_0028209 Ga0373923_0028209_523_1818 431
711 3300035113 Ga0373936_0047639 Ga0373936_0047639_172_1467 431
712 3300035113 Ga0373936_0051498 Ga0373936_0051498_52_1347 431
713 3300035117 Ga0373953_0004607 Ga0373953_0004607_2962_4257 431
714 3300035117 Ga0373953_0017845 Ga0373953_0017845_189_1484 431
715 3300035117 Ga0373953_0020181 Ga0373953_0020181_472_1767 431
716 3300035118 Ga0373954_0005482 Ga0373954_0005482_2060_3355 431
717 3300035118 Ga0373954_0025608 Ga0373954_0025608_865_2160 431
718 3300035119 Ga0373956_0011396 Ga0373956_0011396_994_2289 431
719 3300035119 Ga0373956_0015134 Ga0373956_0015134_940_2235 431
720 3300035120 Ga0373957_0006039 Ga0373957_0006039_1508_2803 431
721 3300035120 Ga0373957_0008872 Ga0373957_0008872_879_2174 431
722 3300035121 Ga0373960_0005258 Ga0373960_0005258_1487_2782 431
723 3300035170 Ga0373943_0011057 Ga0373943_0011057_2531_3826 431
724 3300035170 Ga0373943_0014684 Ga0373943_0014684_1829_3124 431
725 3300035171 Ga0373946_0064896 Ga0373946_0064896_67_1362 431
726 3300035172 Ga0373955_0039968 Ga0373955_0039968_551_1846 431
727 3300035241 Ga0373961_0003418 Ga0373961_0003418_1351_2646 431
728 3300035410 Ga0373924_0009804 Ga0373924_0009804_29_1324 431
729 3300035410 Ga0373924_0013743 Ga0373924_0013743_455_1750 431
730 3300035410 Ga0373924_0016970 Ga0373924_0016970_1029_2324 431
731 3300035410 Ga0373924_0023653 Ga0373924_0023653_385_1680 431
732 3300035410 Ga0373924_0025392 Ga0373924_0025392_180_1475 431
733 3300035691 Ga0373931_0024832 Ga0373931_0024832_229_1524 431
734 3300035692 Ga0373935_0075116 Ga0373935_0075116_43_1338 431
735 3300035695 Ga0373927_0007448 Ga0373927_0007448_2546_3841 431
736 3300035695 Ga0373927_0021594 Ga0373927_0021594_2745_4040 431
737 3300035695 Ga0373927_0029712 Ga0373927_0029712_1564_2859 431
738 3300035695 Ga0373927_0065400 Ga0373927_0065400_751_2046 431
739 3300035695 Ga0373927_0089216 Ga0373927_0089216_653_1948 431
740 3300035724 Ga0373933_0001552 Ga0373933_0001552_9313_10608 431
741 3300035724 Ga0373933_0056454 Ga0373933_0056454_607_1902 431
742 3300035725 Ga0373947_0017234 Ga0373947_0017234_2460_3755 431
743 3300036401 Ga0373937_0000352 Ga0373937_0000352_34209_35504 431
744 3300036401 Ga0373937_0070802 Ga0373937_0070802_464_1759 431
745 3300037068 Ga0373925_0014183 Ga0373925_0014183_451_1746 431
746 3300037068 Ga0373925_0034822 Ga0373925_0034822_1949_3244 431
747 3300037068 Ga0373925_0072684 Ga0373925_0072684_632_1927 431
748 3300037312 Ga0395899_0053228 Ga0395899_0053228_410_1705 431
749 3300037312 Ga0395899_0171799 Ga0395899_0171799_11_1306 431
750 3300037418 Ga0395900_0000982 Ga0395900_0000982_7145_8440 431
751 3300037418 Ga0395900_0010894 Ga0395900_0010894_1500_2795 431
752 3300037418 Ga0395900_0034116 Ga0395900_0034116_998_2293 431
753 3300037418 Ga0395900_0069121 Ga0395900_0069121_1210_2505 431
754 3300037418 Ga0395900_0179921 Ga0395900_0179921_445_1740 431
755 3300037418 Ga0395900_0192842 Ga0395900_0192842_327_1622 431
756 3300037466 Ga0395898_0002224 Ga0395898_0002224_15760_17055 431
757 3300037466 Ga0395898_0005680 Ga0395898_0005680_8033_9328 431
758 3300037466 Ga0395898_0089280 Ga0395898_0089280_568_1863 431
759 3300037471 Ga0395905_0000710 Ga0395905_0000710_35324_36619 431
760 3300037471 Ga0395905_0048406 Ga0395905_0048406_2506_3801 431
761 3300037853 Ga0436364_0084731 Ga0436364_0084731_1144_2439 431
762 3300037853 Ga0436364_0923208 Ga0436364_0923208_124_1545 431
763 3300038443 Ga0395901_0023426 Ga0395901_0023426_142_1437 431
764 3300038443 Ga0395901_0139718 Ga0395901_0139718_543_1838 431
765 3300039062 Ga0400483_179422 Ga0400483_179422_5230_6525 431
766 3300039062 Ga0400483_238094 Ga0400483_238094_4184_5479 431
767 3300039110 Ga0400487_10787 Ga0400487_10787_1893_3203 431
768 3300039437 Ga0436365_0771783 Ga0436365_0771783_20479_21774 431
769 3300039437 Ga0436365_1805073 Ga0436365_1805073_480_1808 431
770 3300039438 Ga0436360_0339475 Ga0436360_0339475_340_1635 431
771 3300039447 Ga0436361_0799126 Ga0436361_0799126_128_1423 431
772 3300039447 Ga0436361_0852708 Ga0436361_0852708_280_1593 431
773 3300039450 Ga0436363_1518892 Ga0436363_1518892_435_1730 431
774 3300039453 Ga0436362_0347390 Ga0436362_0347390_1898_3193 431
775 3300041405 Ga0439438_010411 Ga0439438_010411_1246_2541 431
776 3300041413 Ga0439465_0013506 Ga0439465_0013506_709_2004 431
777 3300042876 Ga0451577_0313931 Ga0451577_0313931_103_1404 431
778 3300044658 Ga0466972_0000136 Ga0466972_0000136_55020_56315 431
779 3300044683 Ga0466965_0045560 Ga0466965_0045560_604_1899 431
780 3300044684 Ga0466966_0002418 Ga0466966_0002418_3368_4663 431
781 3300044693 Ga0466961_0000324 Ga0466961_0000324_10232_11527 431
782 3300044712 Ga0453684_0000006 Ga0453684_0000006_753410_754717 431
783 3300044712 Ga0453684_0000031 Ga0453684_0000031_524282_525583 431
784 3300044842 Ga0466957_0135722 Ga0466957_0135722_221_1516 431
785 3300045049 Ga0466959_0047380 Ga0466959_0047380_1533_2828 431
786 3300045976 Ga0466967_0019583 Ga0466967_0019583_1400_2695 431
787 3300045976 Ga0466967_0098327 Ga0466967_0098327_1151_2488 431
788 3300045976 Ga0466967_0115264 Ga0466967_0115264_362_1657 431
789 3300045976 Ga0466967_0145779 Ga0466967_0145779_62_1381 431
790 3300046452 Ga0495617_017014 Ga0495617_017014_224_1519 431
791 3300046454 Ga0495592_0018882 Ga0495592_0018882_2044_3372 431
792 3300046454 Ga0495592_0051566 Ga0495592_0051566_1199_2494 431
793 3300046454 Ga0495592_0054426 Ga0495592_0054426_354_1649 431
794 3300046454 Ga0495592_0107296 Ga0495592_0107296_335_1630 431
795 3300046454 Ga0495592_0126889 Ga0495592_0126889_313_1608 431
796 3300046455 Ga0495603_0000330 Ga0495603_0000330_22922_24217 431
797 3300046455 Ga0495603_0002054 Ga0495603_0002054_9485_10780 431
798 3300046455 Ga0495603_0040931 Ga0495603_0040931_1115_2410 431
799 3300046455 Ga0495603_0094746 Ga0495603_0094746_129_1424 431
800 3300046459 Ga0495629_0000360 Ga0495629_0000360_22643_23938 431
801 3300046459 Ga0495629_0024403 Ga0495629_0024403_1865_3160 431
802 3300046459 Ga0495629_0037632 Ga0495629_0037632_144_1439 431
803 3300046460 Ga0495638_0006922 Ga0495638_0006922_1836_3131 431
804 3300046461 Ga0495641_0005597 Ga0495641_0005597_5755_7050 431
805 3300046462 Ga0495651_0021480 Ga0495651_0021480_2234_3529 431
806 3300046462 Ga0495651_0024011 Ga0495651_0024011_3435_4730 431
807 3300046462 Ga0495651_0026750 Ga0495651_0026750_915_2210 431
808 3300046462 Ga0495651_0030511 Ga0495651_0030511_866_2161 431
809 3300046462 Ga0495651_0088807 Ga0495651_0088807_627_1922 431
810 3300046463 Ga0495653_0003278 Ga0495653_0003278_6363_7658 431
811 3300046463 Ga0495653_0011730 Ga0495653_0011730_944_2239 431
812 3300046463 Ga0495653_0051629 Ga0495653_0051629_1685_2980 431
813 3300046472 Ga0495580_0001688 Ga0495580_0001688_10050_11345 431
814 3300046473 Ga0495582_0000214 Ga0495582_0000214_19567_20862 431
815 3300046475 Ga0495639_0000015 Ga0495639_0000015_72454_73749 431
816 3300046475 Ga0495639_0030698 Ga0495639_0030698_759_2102 431
817 3300046475 Ga0495639_0033968 Ga0495639_0033968_561_1856 431
818 3300046476 Ga0495662_0004450 Ga0495662_0004450_1380_2675 431
819 3300046477 Ga0495664_0016059 Ga0495664_0016059_581_1876 431
820 3300046477 Ga0495664_0024564 Ga0495664_0024564_2184_3479 431
821 3300046477 Ga0495664_0061683 Ga0495664_0061683_17_1312 431
822 3300046492 Ga0495585_0105842 Ga0495585_0105842_154_1449 431
823 3300046499 Ga0495594_0001132 Ga0495594_0001132_5956_7251 431
824 3300046499 Ga0495594_0093074 Ga0495594_0093074_87_1382 431
825 3300046507 Ga0495606_0003820 Ga0495606_0003820_10319_11614 431
826 3300046507 Ga0495606_0082434 Ga0495606_0082434_515_1810 431
827 3300046511 Ga0495608_0002823 Ga0495608_0002823_6954_8249 431
828 3300046511 Ga0495608_0009353 Ga0495608_0009353_4117_5412 431
829 3300046511 Ga0495608_0021135 Ga0495608_0021135_489_1784 431
830 3300046514 Ga0495618_0002341 Ga0495618_0002341_4384_5679 431
831 3300046514 Ga0495618_0032473 Ga0495618_0032473_1460_2755 431
832 3300046516 Ga0495628_0001092 Ga0495628_0001092_14099_15394 431
833 3300046516 Ga0495628_0044514 Ga0495628_0044514_1673_2968 431
834 3300046516 Ga0495628_0071776 Ga0495628_0071776_353_1648 431
835 3300046517 Ga0495630_0011905 Ga0495630_0011905_1126_2421 431
836 3300046517 Ga0495630_0080137 Ga0495630_0080137_358_1653 431
837 3300046524 Ga0495648_0027979 Ga0495648_0027979_2326_3621 431
838 3300046524 Ga0495648_0075710 Ga0495648_0075710_33_1328 431
839 3300046526 Ga0495666_0056663 Ga0495666_0056663_530_1825 431
840 3300046529 Ga0495652_0002591 Ga0495652_0002591_1238_2533 431
841 3300046529 Ga0495652_0007194 Ga0495652_0007194_8294_9589 431
842 3300046529 Ga0495652_0009095 Ga0495652_0009095_4690_5985 431
843 3300046529 Ga0495652_0010234 Ga0495652_0010234_5628_6923 431
844 3300046529 Ga0495652_0024384 Ga0495652_0024384_1004_2299 431
845 3300046529 Ga0495652_0053753 Ga0495652_0053753_1071_2366 431
846 3300046531 Ga0495665_0033315 Ga0495665_0033315_881_2176 431
847 3300046533 Ga0495640_0002801 Ga0495640_0002801_11295_12590 431
848 3300046533 Ga0495640_0003290 Ga0495640_0003290_1842_3137 431
849 3300046533 Ga0495640_0006186 Ga0495640_0006186_1069_2364 431
850 3300046533 Ga0495640_0013426 Ga0495640_0013426_3751_5046 431
851 3300046533 Ga0495640_0076213 Ga0495640_0076213_609_1904 431
852 3300046535 Ga0495586_0038272 Ga0495586_0038272_929_2224 431
853 3300046536 Ga0495587_0000506 Ga0495587_0000506_14246_15541 431
854 3300046536 Ga0495587_0020512 Ga0495587_0020512_2283_3578 431
855 3300046543 Ga0495645_0018023 Ga0495645_0018023_917_2212 431
856 3300046543 Ga0495645_0029296 Ga0495645_0029296_38_1333 431
857 3300046543 Ga0495645_0053248 Ga0495645_0053248_491_1786 431
858 3300046557 Ga0495622_0002296 Ga0495622_0002296_1021_2316 431
859 3300046557 Ga0495622_0008179 Ga0495622_0008179_493_1788 431
860 3300046559 Ga0495667_0001667 Ga0495667_0001667_4853_6148 431
861 3300046559 Ga0495667_0021284 Ga0495667_0021284_235_1563 431
862 3300046559 Ga0495667_0026223 Ga0495667_0026223_2095_3390 431
863 3300046559 Ga0495667_0026794 Ga0495667_0026794_2004_3299 431
864 3300046559 Ga0495667_0034204 Ga0495667_0034204_864_2159 431
865 3300046559 Ga0495667_0078620 Ga0495667_0078620_354_1649 431
866 3300046615 Ga0495656_0005052 Ga0495656_0005052_1574_2869 431
867 3300046615 Ga0495656_0006995 Ga0495656_0006995_2256_3551 431
868 3300046616 Ga0495668_0095589 Ga0495668_0095589_321_1616 431
869 3300046642 Ga0495634_0000395 Ga0495634_0000395_23130_24425 431
870 3300046642 Ga0495634_0018348 Ga0495634_0018348_2745_4040 431
871 3300046642 Ga0495634_0030311 Ga0495634_0030311_1196_2491 431
872 3300046642 Ga0495634_0045845 Ga0495634_0045845_1293_2588 431
873 3300046642 Ga0495634_0086782 Ga0495634_0086782_505_1800 431
874 3300046663 Ga0495635_0000358 Ga0495635_0000358_188_1483 431
875 3300046663 Ga0495635_0001697 Ga0495635_0001697_991_2286 431
876 3300046663 Ga0495635_0004397 Ga0495635_0004397_4691_5986 431
877 3300046663 Ga0495635_0035275 Ga0495635_0035275_889_2184 431
878 3300046664 Ga0495659_0060432 Ga0495659_0060432_37_1332 431
879 3300046665 Ga0495661_0006955 Ga0495661_0006955_6551_7879 431
880 3300046674 Ga0495588_0015433 Ga0495588_0015433_460_1755 431
881 3300046674 Ga0495588_0090246 Ga0495588_0090246_141_1436 431
882 3300046675 Ga0495657_0005774 Ga0495657_0005774_1556_2851 431
883 3300046678 Ga0495599_0020937 Ga0495599_0020937_1495_2790 431
884 3300046678 Ga0495599_0026732 Ga0495599_0026732_2126_3421 431
885 3300046678 Ga0495599_0096971 Ga0495599_0096971_336_1631 431
886 3300046679 Ga0495623_0004938 Ga0495623_0004938_3190_4485 431
887 3300046679 Ga0495623_0010819 Ga0495623_0010819_326_1621 431
888 3300046679 Ga0495623_0013744 Ga0495623_0013744_1362_2657 431
889 3300046679 Ga0495623_0025207 Ga0495623_0025207_1971_3266 431
890 3300046680 Ga0495646_0022504 Ga0495646_0022504_1169_2464 431
891 3300046680 Ga0495646_0024852 Ga0495646_0024852_434_1729 431
892 3300046680 Ga0495646_0027000 Ga0495646_0027000_1370_2665 431
893 3300046680 Ga0495646_0029540 Ga0495646_0029540_1011_2306 431
894 3300046680 Ga0495646_0056869 Ga0495646_0056869_971_2266 431
895 3300046681 Ga0495647_0004081 Ga0495647_0004081_1148_2443 431
896 3300046681 Ga0495647_0019929 Ga0495647_0019929_954_2249 431
897 3300046683 Ga0495658_0000342 Ga0495658_0000342_19681_20976 431
898 3300046683 Ga0495658_0003508 Ga0495658_0003508_5913_7208 431
899 3300046684 Ga0495669_0024978 Ga0495669_0024978_856_2151 431
900 3300046689 Ga0495613_0023281 Ga0495613_0023281_1514_2809 431
901 3300046689 Ga0495613_0029997 Ga0495613_0029997_1575_2870 431
902 3300046690 Ga0495624_0021313 Ga0495624_0021313_339_1634 431
903 3300046690 Ga0495624_0052761 Ga0495624_0052761_1000_2295 431
904 3300046691 Ga0495670_0063032 Ga0495670_0063032_289_1584 431
905 3300046692 Ga0495671_0015491 Ga0495671_0015491_2157_3452 431
906 3300046694 Ga0495649_0006829 Ga0495649_0006829_4546_5841 431
907 3300046694 Ga0495649_0088203 Ga0495649_0088203_160_1455 431
908 3300046809 Ga0495600_0007532 Ga0495600_0007532_326_1621 431
909 3300046809 Ga0495600_0008402 Ga0495600_0008402_3650_4945 431
910 3300046809 Ga0495600_0061182 Ga0495600_0061182_623_1918 431
911 3300047315 Ga0495581_0000341 Ga0495581_0000341_12727_14022 431
912 3300047315 Ga0495581_0020661 Ga0495581_0020661_758_2053 431
913 3300047315 Ga0495581_0088213 Ga0495581_0088213_110_1453 431
914 3300047317 Ga0495604_0000765 Ga0495604_0000765_10841_12136 431
915 3300047317 Ga0495604_0008805 Ga0495604_0008805_4976_6271 431
916 3300047317 Ga0495604_0030226 Ga0495604_0030226_2005_3300 431
917 3300047319 Ga0495674_0000557 Ga0495674_0000557_15756_17051 431
918 3300047319 Ga0495674_0003736 Ga0495674_0003736_8053_9348 431
919 3300047319 Ga0495674_0038445 Ga0495674_0038445_176_1471 431
920 3300047319 Ga0495674_0043202 Ga0495674_0043202_2422_3717 431
921 3300047319 Ga0495674_0057285 Ga0495674_0057285_1644_2939 431
922 3300047319 Ga0495674_0057739 Ga0495674_0057739_1379_2674 431
923 3300047320 Ga0495672_0106235 Ga0495672_0106235_37_1332 431
924 3300047321 Ga0495676_0083714 Ga0495676_0083714_915_2210 431
925 3300047322 Ga0495680_0001188 Ga0495680_0001188_15442_16737 431
926 3300047322 Ga0495680_0004754 Ga0495680_0004754_6961_8256 431
927 3300047322 Ga0495680_0026674 Ga0495680_0026674_1883_3178 431
928 3300047322 Ga0495680_0102516 Ga0495680_0102516_482_1777 431
929 3300047444 Ga0495675_0002133 Ga0495675_0002133_5062_6357 431
930 3300047444 Ga0495675_0011233 Ga0495675_0011233_1788_3083 431
931 3300047444 Ga0495675_0020004 Ga0495675_0020004_1189_2484 431
932 3300047444 Ga0495675_0031462 Ga0495675_0031462_1580_2875 431
933 3300047471 Ga0495684_0000897 Ga0495684_0000897_11779_13074 431
934 3300047471 Ga0495684_0001995 Ga0495684_0001995_9787_11082 431
935 3300047471 Ga0495684_0033209 Ga0495684_0033209_926_2221 431
936 3300047471 Ga0495684_0052028 Ga0495684_0052028_162_1457 431
937 3300047472 Ga0495686_0124457 Ga0495686_0124457_107_1402 431
938 3300047673 Ga0495593_0000506 Ga0495593_0000506_3327_4622 431
939 3300047673 Ga0495593_0031066 Ga0495593_0031066_1556_2851 431
940 3300048088 Ga0495602_0002695 Ga0495602_0002695_13048_14343 431
941 3300048088 Ga0495602_0026279 Ga0495602_0026279_1078_2373 431
942 3300048088 Ga0495602_0116189 Ga0495602_0116189_287_1582 431
943 3300048089 Ga0495614_0084920 Ga0495614_0084920_64_1359 431
944 3300048903 Ga0496100_0020491 Ga0496100_0020491_684_1979 431
945 3300048903 Ga0496100_0080534 Ga0496100_0080534_325_1620 431
946 3300048903 Ga0496100_0147768 Ga0496100_0147768_263_1558 431
947 3300048904 Ga0496101_0000648 Ga0496101_0000648_13908_15203 431
948 3300048904 Ga0496101_0041620 Ga0496101_0041620_738_2033 431
949 3300048905 Ga0496102_0003521 Ga0496102_0003521_808_2103 431
950 3300048905 Ga0496102_0067115 Ga0496102_0067115_1921_3216 431
951 3300048906 Ga0496103_0058435 Ga0496103_0058435_314_1609 431
952 3300048907 Ga0496104_0013552 Ga0496104_0013552_2044_3339 431
953 3300048907 Ga0496104_0018065 Ga0496104_0018065_2730_4025 431
954 3300048907 Ga0496104_0037271 Ga0496104_0037271_73_1392 431
955 3300048907 Ga0496104_0049276 Ga0496104_0049276_2153_3448 431
956 3300048907 Ga0496104_0085080 Ga0496104_0085080_1135_2430 431
957 3300048907 Ga0496104_0086957 Ga0496104_0086957_1413_2708 431
958 3300048907 Ga0496104_0181384 Ga0496104_0181384_418_1713 431
959 3300048908 Ga0496105_0027418 Ga0496105_0027418_2957_4252 431
960 3300048908 Ga0496105_0052854 Ga0496105_0052854_156_1451 431
961 3300048908 Ga0496105_0092141 Ga0496105_0092141_560_1855 431
962 3300048909 Ga0496106_0001529 Ga0496106_0001529_5348_6643 431
963 3300048909 Ga0496106_0007572 Ga0496106_0007572_6709_8004 431
964 3300048909 Ga0496106_0011062 Ga0496106_0011062_2929_4224 431
965 3300048909 Ga0496106_0038241 Ga0496106_0038241_692_1987 431
966 3300048909 Ga0496106_0162265 Ga0496106_0162265_393_1688 431
967 3300048909 Ga0496106_0202157 Ga0496106_0202157_255_1550 431
968 3300048910 Ga0496107_0004714 Ga0496107_0004714_6679_7974 431
969 3300048910 Ga0496107_0045648 Ga0496107_0045648_1338_2633 431
970 3300048910 Ga0496107_0067639 Ga0496107_0067639_467_1762 431
971 3300048911 Ga0496108_0000764 Ga0496108_0000764_21310_22605 431
972 3300048911 Ga0496108_0033486 Ga0496108_0033486_49_1368 431
973 3300048911 Ga0496108_0067856 Ga0496108_0067856_401_1696 431
974 3300048912 Ga0496109_0002732 Ga0496109_0002732_6427_7722 431
975 3300048912 Ga0496109_0004357 Ga0496109_0004357_2076_3371 431
976 3300048912 Ga0496109_0206856 Ga0496109_0206856_61_1380 431
977 3300048913 Ga0496110_0003472 Ga0496110_0003472_6149_7444 431
978 3300048913 Ga0496110_0026093 Ga0496110_0026093_1729_3024 431
979 3300048913 Ga0496110_0096309 Ga0496110_0096309_774_2069 431
980 3300048913 Ga0496110_0112586 Ga0496110_0112586_549_1844 431
981 3300048913 Ga0496110_0266767 Ga0496110_0266767_231_1526 431
982 3300048913 Ga0496110_0327938 Ga0496110_0327938_65_1360 431
983 3300048914 Ga0496111_0003253 Ga0496111_0003253_6473_7768 431
984 3300048915 Ga0496112_0000031 Ga0496112_0000031_81219_82514 431
985 3300048915 Ga0496112_0004915 Ga0496112_0004915_8498_9793 431
986 3300048915 Ga0496112_0004941 Ga0496112_0004941_4839_6134 431
987 3300048915 Ga0496112_0008448 Ga0496112_0008448_3721_5040 431
988 3300048915 Ga0496112_0041116 Ga0496112_0041116_648_1943 431
989 3300048915 Ga0496112_0069229 Ga0496112_0069229_937_2232 431
990 3300048915 Ga0496112_0075336 Ga0496112_0075336_814_2109 431
991 3300048915 Ga0496112_0179492 Ga0496112_0179492_640_1935 431
992 3300048916 Ga0496113_0001977 Ga0496113_0001977_4801_6096 431
993 3300048916 Ga0496113_0047075 Ga0496113_0047075_199_1494 431
994 3300048916 Ga0496113_0050949 Ga0496113_0050949_665_1960 431
995 3300048917 Ga0496114_0009865 Ga0496114_0009865_782_2077 431
996 3300048917 Ga0496114_0151894 Ga0496114_0151894_68_1363 431
997 3300048917 Ga0496114_0230589 Ga0496114_0230589_227_1522 431
998 3300048918 Ga0496115_0009797 Ga0496115_0009797_1942_3237 431
999 3300048918 Ga0496115_0073197 Ga0496115_0073197_867_2162 431
1000 3300048918 Ga0496115_0083531 Ga0496115_0083531_173_1468 431
1001 3300048918 Ga0496115_0094179 Ga0496115_0094179_140_1435 431
1002 3300048918 Ga0496115_0116827 Ga0496115_0116827_838_2133 431
1003 3300048918 Ga0496115_0118715 Ga0496115_0118715_577_1872 431
1004 3300048919 Ga0496116_0014153 Ga0496116_0014153_1692_2987 431
1005 3300048920 Ga0496117_0009844 Ga0496117_0009844_6820_8115 431
1006 3300048920 Ga0496117_0034745 Ga0496117_0034745_885_2180 431
1007 3300048920 Ga0496117_0071857 Ga0496117_0071857_132_1460 431
1008 3300048921 Ga0496118_0005918 Ga0496118_0005918_3259_4554 431
1009 3300048921 Ga0496118_0013173 Ga0496118_0013173_6219_7514 431
1010 3300048921 Ga0496118_0040100 Ga0496118_0040100_1049_2344 431
1011 3300048921 Ga0496118_0058734 Ga0496118_0058734_655_1950 431
1012 3300048921 Ga0496118_0146433 Ga0496118_0146433_27_1322 431
1013 3300048922 Ga0496119_0028655 Ga0496119_0028655_602_1897 431
1014 3300048923 Ga0496120_0014815 Ga0496120_0014815_1260_2555 431
1015 3300048924 Ga0496121_0000406 Ga0496121_0000406_76849_78144 431
1016 3300048924 Ga0496121_0000769 Ga0496121_0000769_53488_54783 431
1017 3300048924 Ga0496121_0002143 Ga0496121_0002143_20925_22220 431
1018 3300048924 Ga0496121_0012483 Ga0496121_0012483_5060_6355 431
1019 3300048924 Ga0496121_0027061 Ga0496121_0027061_3477_4772 431
1020 3300048924 Ga0496121_0068500 Ga0496121_0068500_851_2146 431
1021 3300048924 Ga0496121_0077208 Ga0496121_0077208_18_1313 431
1022 3300048924 Ga0496121_0110766 Ga0496121_0110766_574_1869 431
1023 3300048925 Ga0496122_0040920 Ga0496122_0040920_1495_2790 431
1024 3300048925 Ga0496122_0042875 Ga0496122_0042875_868_2196 431
1025 3300048927 Ga0496124_0002534 Ga0496124_0002534_13589_14884 431
1026 3300048927 Ga0496124_0044466 Ga0496124_0044466_1738_3033 431
1027 3300048927 Ga0496124_0221418 Ga0496124_0221418_27_1322 431
1028 3300048928 Ga0496125_0003938 Ga0496125_0003938_2228_3523 431
1029 3300048928 Ga0496125_0003990 Ga0496125_0003990_13909_15204 431
1030 3300048928 Ga0496125_0028546 Ga0496125_0028546_2614_3942 431
1031 3300048928 Ga0496125_0064486 Ga0496125_0064486_773_2068 431
1032 3300048929 Ga0496126_0010317 Ga0496126_0010317_3062_4357 431
1033 3300048929 Ga0496126_0034185 Ga0496126_0034185_1966_3261 431
1034 3300048929 Ga0496126_0051661 Ga0496126_0051661_2406_3701 431
1035 3300048929 Ga0496126_0095509 Ga0496126_0095509_493_1788 431
1036 3300048929 Ga0496126_0161425 Ga0496126_0161425_98_1393 431
1037 3300048929 Ga0496126_0268889 Ga0496126_0268889_89_1384 431
1038 3300049460 Ga0495682_0013780 Ga0495682_0013780_1617_2912 431
1039 3300049568 Ga0501031_0000207 Ga0501031_0000207_4986_6281 431
1040 3300049569 Ga0501032_0000189 Ga0501032_0000189_13320_14615 431
1041 3300049569 Ga0501032_0000252 Ga0501032_0000252_24887_26182 431
1042 3300049569 Ga0501032_0002406 Ga0501032_0002406_9390_10685 431
1043 3300049569 Ga0501032_0055999 Ga0501032_0055999_1322_2617 431
1044 3300049570 Ga0501033_0000082 Ga0501033_0000082_41709_43004 431
1045 3300049570 Ga0501033_0000493 Ga0501033_0000493_26165_27460 431
1046 3300049570 Ga0501033_0211862 Ga0501033_0211862_32_1327 431
1047 3300049571 Ga0501034_0018545 Ga0501034_0018545_5552_6847 431
1048 3300049571 Ga0501034_0022592 Ga0501034_0022592_2984_4285 431
1049 3300049571 Ga0501034_0047258 Ga0501034_0047258_1587_2882 431
1050 3300049572 Ga0501036_0000134 Ga0501036_0000134_11248_12543 431
1051 3300049573 Ga0501037_0000050 Ga0501037_0000050_1286_2581 431
1052 3300049573 Ga0501037_0002190 Ga0501037_0002190_7627_8922 431
1053 3300049573 Ga0501037_0002324 Ga0501037_0002324_267_1562 431
1054 3300049574 Ga0501038_0002725 Ga0501038_0002725_6896_8191 431
1055 3300049574 Ga0501038_0010145 Ga0501038_0010145_6538_7833 431
1056 3300049574 Ga0501038_0110841 Ga0501038_0110841_307_1602 431
1057 3300049574 Ga0501038_0136765 Ga0501038_0136765_619_1914 431
1058 3300049575 Ga0501039_0000064 Ga0501039_0000064_72786_74081 431
1059 3300049575 Ga0501039_0000123 Ga0501039_0000123_43646_44941 431
1060 3300049575 Ga0501039_0004985 Ga0501039_0004985_3011_4306 431
1061 3300049575 Ga0501039_0061672 Ga0501039_0061672_488_1783 431
1062 3300049575 Ga0501039_0142212 Ga0501039_0142212_403_1698 431
1063 3300049578 Ga0501042_0007944 Ga0501042_0007944_1758_3053 431
1064 3300049578 Ga0501042_0028604 Ga0501042_0028604_719_2014 431
1065 3300049579 Ga0501043_0000999 Ga0501043_0000999_23182_24477 431
1066 3300049579 Ga0501043_0007904 Ga0501043_0007904_6890_8185 431
1067 3300049579 Ga0501043_0010418 Ga0501043_0010418_948_2243 431
1068 3300049580 Ga0501046_0000434 Ga0501046_0000434_17350_18645 431
1069 3300049581 Ga0501047_0000131 Ga0501047_0000131_49381_50676 431
1070 3300049581 Ga0501047_0000866 Ga0501047_0000866_17234_18529 431
1071 3300049582 Ga0501048_0002325 Ga0501048_0002325_10202_11497 431
1072 3300049582 Ga0501048_0010161 Ga0501048_0010161_4052_5347 431
1073 3300049583 Ga0501067_0000628 Ga0501067_0000628_16169_17464 431
1074 3300049583 Ga0501067_0007650 Ga0501067_0007650_3514_4809 431
1075 3300049584 Ga0501068_0000080 Ga0501068_0000080_23898_25193 431
1076 3300049584 Ga0501068_0057044 Ga0501068_0057044_118_1413 431
1077 3300049585 Ga0501069_0002904 Ga0501069_0002904_2053_3348 431
1078 3300049585 Ga0501069_0029899 Ga0501069_0029899_215_1510 431
1079 3300049586 Ga0501070_0000209 Ga0501070_0000209_52979_54274 431
1080 3300049586 Ga0501070_0004437 Ga0501070_0004437_7633_8928 431
1081 3300049586 Ga0501070_0025205 Ga0501070_0025205_2266_3561 431
1082 3300049587 Ga0501071_0008177 Ga0501071_0008177_4982_6277 431
1083 3300049587 Ga0501071_0033785 Ga0501071_0033785_1933_3228 431
1084 3300049587 Ga0501071_0120488 Ga0501071_0120488_92_1387 431
1085 3300049587 Ga0501071_0172348 Ga0501071_0172348_189_1484 431
1086 3300049588 Ga0501072_0000378 Ga0501072_0000378_27461_28756 431
1087 3300049588 Ga0501072_0015136 Ga0501072_0015136_3161_4456 431
1088 3300049589 Ga0501073_0000062 Ga0501073_0000062_51152_52447 431
1089 3300049589 Ga0501073_0014131 Ga0501073_0014131_2229_3524 431
1090 3300049589 Ga0501073_0051826 Ga0501073_0051826_948_2243 431
1091 3300049590 Ga0501074_0000642 Ga0501074_0000642_15486_16781 431
1092 3300049590 Ga0501074_0002216 Ga0501074_0002216_9799_11094 431
1093 3300049591 Ga0501075_0076901 Ga0501075_0076901_489_1784 431
1094 3300049591 Ga0501075_0122453 Ga0501075_0122453_410_1705 431
1095 3300049592 Ga0501076_0017280 Ga0501076_0017280_619_1914 431
1096 3300049592 Ga0501076_0024246 Ga0501076_0024246_293_1588 431
1097 3300049592 Ga0501076_0183263 Ga0501076_0183263_152_1447 431
1098 3300049593 Ga0501077_0004743 Ga0501077_0004743_6427_7722 431
1099 3300049593 Ga0501077_0075708 Ga0501077_0075708_253_1548 431
1100 3300049741 Ga0501079_0006018 Ga0501079_0006018_2813_4108 431
1101 3300049741 Ga0501079_0016419 Ga0501079_0016419_323_1618 431
1102 3300049741 Ga0501079_0031135 Ga0501079_0031135_1922_3217 431
1103 3300049741 Ga0501079_0131467 Ga0501079_0131467_18_1313 431
1104 3300049741 Ga0501079_0177568 Ga0501079_0177568_333_1628 431
1105 3300049742 Ga0501080_0000200 Ga0501080_0000200_26024_27319 431
1106 3300049742 Ga0501080_0037072 Ga0501080_0037072_1833_3128 431
1107 3300049742 Ga0501080_0048542 Ga0501080_0048542_1413_2708 431
1108 3300049742 Ga0501080_0185967 Ga0501080_0185967_193_1488 431
1109 3300049743 Ga0501081_0003080 Ga0501081_0003080_3007_4302 431
1110 3300049744 Ga0501083_0000199 Ga0501083_0000199_34510_35805 431
1111 3300049744 Ga0501083_0000628 Ga0501083_0000628_17032_18327 431
1112 3300049744 Ga0501083_0007134 Ga0501083_0007134_5472_6788 431
1113 3300049822 Ga0501035_0000123 Ga0501035_0000123_65812_67107 431
1114 3300049822 Ga0501035_0000598 Ga0501035_0000598_26037_27332 431
1115 3300049822 Ga0501035_0039684 Ga0501035_0039684_2285_3646 431
1116 3300049823 Ga0501044_0000100 Ga0501044_0000100_83143_84438 431
1117 3300049823 Ga0501044_0000887 Ga0501044_0000887_20615_21910 431
1118 3300049823 Ga0501044_0021553 Ga0501044_0021553_3718_5013 431
1119 3300049823 Ga0501044_0042937 Ga0501044_0042937_3121_4416 431
1120 3300049824 Ga0501045_0001526 Ga0501045_0001526_8908_10203 431
1121 3300050489 nmdc:mga03683_25957_c2 nmdc:mga03683_25957_c2_94_1389 431
1122 3300050490 nmdc:mga03n38_54330_c1 nmdc:mga03n38_54330_c1_422_1717 431
1123 3300050491 nmdc:mga00v17_3459_c1 nmdc:mga00v17_3459_c1_872_2167 431
1124 3300050492 nmdc:mga0yw44_17358_c1 nmdc:mga0yw44_17358_c1_1141_2436 431
1125 3300050492 nmdc:mga0yw44_4498_c1 nmdc:mga0yw44_4498_c1_5078_6373 431
1126 3300050492 nmdc:mga0yw44_49835_c1 nmdc:mga0yw44_49835_c1_947_2275 431
1127 3300050492 nmdc:mga0yw44_89146_c1 nmdc:mga0yw44_89146_c1_78_1373 431
1128 3300050494 nmdc:mga06z11_205_c1 nmdc:mga06z11_205_c1_7200_8498 431
1129 3300050494 nmdc:mga06z11_27492_c1 nmdc:mga06z11_27492_c1_278_1573 431
1130 3300050494 nmdc:mga06z11_53356_c1 nmdc:mga06z11_53356_c1_98_1393 431
1131 3300050494 nmdc:mga06z11_6231_c1 nmdc:mga06z11_6231_c1_142_1437 431
1132 3300050494 nmdc:mga06z11_62408_c1 nmdc:mga06z11_62408_c1_386_1681 431
1133 3300050494 nmdc:mga06z11_80691_c1 nmdc:mga06z11_80691_c1_141_1436 431
1134 3300050495 nmdc:mga04h51_644_c1 nmdc:mga04h51_644_c1_2615_3913 431
1135 3300050496 nmdc:mga07m45_25150_c2 nmdc:mga07m45_25150_c2_612_1907 431
1136 3300050496 nmdc:mga07m45_2788_c1 nmdc:mga07m45_2788_c1_3036_4331 431
1137 3300050511 nmdc:mga08y16_371938_c1 nmdc:mga08y16_371938_c1_54_1349 431
1138 3300050511 nmdc:mga08y16_53082_c1 nmdc:mga08y16_53082_c1_60_1355 431
1139 3300050512 nmdc:mga0n895_11688_c1 nmdc:mga0n895_11688_c1_4718_6013 431
1140 3300050512 nmdc:mga0n895_33987_c1 nmdc:mga0n895_33987_c1_821_2116 431
1141 3300050513 nmdc:mga0rr50_32064_c1 nmdc:mga0rr50_32064_c1_1962_3257 431
1142 3300050513 nmdc:mga0rr50_85747_c1 nmdc:mga0rr50_85747_c1_337_1632 431
1143 3300050515 nmdc:mga0a205_3751_c1 nmdc:mga0a205_3751_c1_5411_6706 431
1144 3300050516 nmdc:mga0sz30_13068_c1 nmdc:mga0sz30_13068_c1_1745_3040 431
1145 3300053077 Ga0495601_0000848 Ga0495601_0000848_11094_12389 431
1146 3300053077 Ga0495601_0069785 Ga0495601_0069785_913_2208 431
1147 3300053078 Ga0495612_0014423 Ga0495612_0014423_375_1670 431
1148 3300053078 Ga0495612_0015990 Ga0495612_0015990_1594_2889 431
1149 3300053084 Ga0495595_0002544 Ga0495595_0002544_3949_5244 431
1150 3300053084 Ga0495595_0005739 Ga0495595_0005739_2589_3884 431
1151 3300053084 Ga0495595_0013241 Ga0495595_0013241_1683_2978 431
1152 3300053085 Ga0495619_0000858 Ga0495619_0000858_15076_16371 431
1153 3300053085 Ga0495619_0006701 Ga0495619_0006701_3950_5245 431
1154 3300053086 Ga0500578_0043292 Ga0500578_0043292_261_1604 431
1155 3300053086 Ga0500578_0045031 Ga0500578_0045031_499_1827 431
1156 3300053087 Ga0500643_000111 Ga0500643_000111_82728_84023 431
1157 3300053093 Ga0500651_0005693 Ga0500651_0005693_626_1921 431
1158 3300053093 Ga0500651_0030707 Ga0500651_0030707_1030_2358 431
1159 3300053094 Ga0500566_0010251 Ga0500566_0010251_1112_2440 431
1160 3300053094 Ga0500566_0019553 Ga0500566_0019553_1763_3058 431
1161 3300053094 Ga0500566_0040898 Ga0500566_0040898_359_1654 431
1162 3300053096 Ga0500641_0027912 Ga0500641_0027912_88_1383 431
1163 3300053098 Ga0500650_0000250 Ga0500650_0000250_8986_10314 431
1164 3300053104 Ga0500556_0000003 Ga0500556_0000003_673989_675284 431
1165 3300053105 Ga0500557_000034 Ga0500557_000034_59354_60649 431
1166 3300053109 Ga0500569_012555 Ga0500569_012555_298_1626 431
1167 3300053111 Ga0500572_000023 Ga0500572_000023_15676_16971 431
1168 3300053118 Ga0500594_0018699 Ga0500594_0018699_99_1394 431
1169 3300053119 Ga0500595_011567 Ga0500595_011567_833_2128 431
1170 3300053119 Ga0500595_014895 Ga0500595_014895_722_2017 431
1171 3300053119 Ga0500595_031747 Ga0500595_031747_307_1602 431
1172 3300053121 Ga0500607_039743 Ga0500607_039743_357_1652 431
1173 3300053122 Ga0500608_006686 Ga0500608_006686_1189_2517 431
1174 3300053125 Ga0500618_010201 Ga0500618_010201_1175_2470 431
1175 3300053130 Ga0500642_0000053 Ga0500642_0000053_17984_19279 431
1176 3300053130 Ga0500642_0000175 Ga0500642_0000175_1111_2439 431
1177 3300053130 Ga0500642_0016179 Ga0500642_0016179_215_1510 431
1178 3300053130 Ga0500642_0025114 Ga0500642_0025114_523_1866 431
1179 3300053131 Ga0500652_000441 Ga0500652_000441_608_1936 431
1180 3300053134 Ga0500658_0065659 Ga0500658_0065659_87_1415 431
1181 3300053136 Ga0500559_0000146 Ga0500559_0000146_31138_32466 431
1182 3300053136 Ga0500559_0001416 Ga0500559_0001416_9994_11289 431
1183 3300053136 Ga0500559_0024210 Ga0500559_0024210_279_1574 431
1184 3300053139 Ga0500568_0000733 Ga0500568_0000733_21304_22632 431
1185 3300053139 Ga0500568_0015018 Ga0500568_0015018_851_2146 431
1186 3300053148 Ga0500590_022753 Ga0500590_022753_913_2208 431
1187 3300053150 Ga0500603_006653 Ga0500603_006653_1038_2333 431
1188 3300053153 Ga0500616_0000034 Ga0500616_0000034_117602_118897 431
1189 3300053153 Ga0500616_0000041 Ga0500616_0000041_234193_235521 431
1190 3300053156 Ga0500622_0001837 Ga0500622_0001837_14008_15336 431
1191 3300053156 Ga0500622_0028058 Ga0500622_0028058_664_1959 431
1192 3300053156 Ga0500622_0051363 Ga0500622_0051363_231_1574 431
1193 3300053161 Ga0500634_0054221 Ga0500634_0054221_164_1459 431
1194 3300053162 Ga0500638_002809 Ga0500638_002809_3234_4529 431
1195 3300053162 Ga0500638_091226 Ga0500638_091226_76_1371 431
1196 3300053177 Ga0500636_0000033 Ga0500636_0000033_67986_69281 431
1197 3300053177 Ga0500636_0002841 Ga0500636_0002841_1004_2332 431
1198 3300053177 Ga0500636_0045999 Ga0500636_0045999_510_1805 431
1199 3300053178 Ga0500637_0000026 Ga0500637_0000026_8935_10230 431
1200 3300053178 Ga0500637_0001578 Ga0500637_0001578_698_1993 431
1201 3300053729 Ga0500625_001985 Ga0500625_001985_4720_6015 431
1202 3300053730 Ga0500645_017807 Ga0500645_017807_111_1406 431
1203 3300053735 Ga0500596_001715 Ga0500596_001715_322_1617 431
1204 3300053736 Ga0500599_001352 Ga0500599_001352_965_2260 431
1205 3300053737 Ga0500601_000010 Ga0500601_000010_31803_33098 431
1206 3300054114 Ga0501084_0043563 Ga0501084_0043563_1046_2341 431
1207 3300054114 Ga0501084_0073591 Ga0501084_0073591_1443_2738 431
1208 3300060353 Ga0501082_0011691 Ga0501082_0011691_2698_4014 431
1209 3300060353 Ga0501082_0011762 Ga0501082_0011762_2806_4101 431
1210 3300060353 Ga0501082_0028999 Ga0501082_0028999_1081_2376 431
1211 3300061734 Ga0530510_0120930 Ga0530510_0120930_349_1644 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

52

468

0.98

PF00266

Aminotran_5

Aminotransferase class-V

122

262

0.85

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

83

244

0.83

PF00155

Aminotran_1_2

Aminotransferase class I and II

73

268

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eqw-assembly2.cif.gz_B crystal structure of fub7 0.9834 8 428
8eqw-assembly4.cif.gz_D crystal structure of fub7 0.9815 8 430
8eqw-assembly1.cif.gz_G crystal structure of fub7 0.9809 8 430
8eqw-assembly1.cif.gz_A crystal structure of fub7 0.9788 8 430
8eqw-assembly3.cif.gz_C crystal structure of fub7 0.9782 7 430
ID Description Score Start End Superfamily
af_Q59US5_3_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9861 7 289 3.40.640.10
4kamA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9832 68 292 3.40.640.10
5e4zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9744 7 291 3.40.640.10
af_Q59US5_3_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9725 7 289 3.40.640.10
3ri6B02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9708 295 424 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A383AF62-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase 0.999 36 285 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A537Q2S0-F1-model_v4 Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) 0.9958 24 211 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-T0V080-F1-model_v4 O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) 0.9944 83 305 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A382DB25-F1-model_v4 Aminotransferase class V domain-containing protein 0.9935 7 229 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A383AF62-F1-model_v4 O-acetylhomoserine aminocarboxypropyltransferase 0.9911 36 285 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269

Feature Viewer

pLDDT pTM Quality
93.18 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map