F491733
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1211 | 686 | 958 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0923208|Ga0436364_0923208_124_1545 |
| Length | 473 |
| Sequence | LEAKRQRPSPAARLKRRNERKGLTRPWHLWQKGRRPTNAEFDMPAPQPPGFETLSLHAGQHPDPVTGARAVPIYQTTSYVFQDADHAAALFNLERAGHIYTRISNPTIAVLEERLAALEDGVGAICTASGMAAMHLAIATLLNAGDHIVASASLYGGTINLLAHTLPRFGITTTFVKPRDLDAFRAAIKPNTRLVIGETIGNPGLEVLDIPKVAEIAHAAKIPLLIDNTFATPYLSKPIELGADIVMHSATKWIGGHGIAIGGAIVDGGRFDWRASGKFGVLTEPYGGYHGIVFDEQFGTAAFIMRARTEGLRDFGACLSPTNAFQLLQGVETLGVRMDRHMQNTQLVLEALKSNKAVDWVLHPSLEDHSDYQLAKTLLPRGAGSIVSFGIKGGRPAGRKFIESLRMISHLANVGDAKTLVIHPASTTHQQMDAEQLKAAGIGEELVRLSVGIEAVADITDDLGSALRVSQRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 23 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 24 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 25 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 26 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 27 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 28 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 29 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 30 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 31 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 32 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 33 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 34 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 35 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 36 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 37 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 38 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 39 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 40 | 2791355199 | |||
| 41 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 42 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 43 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 44 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 45 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 46 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 47 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 48 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 49 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 50 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 51 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 52 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 53 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 54 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 55 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 56 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 57 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 58 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 59 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 60 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 61 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 62 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 63 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 64 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 65 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 66 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 67 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 68 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 69 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 70 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 71 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 72 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 73 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 74 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 75 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 76 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 77 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 78 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 79 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 80 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 81 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 82 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 83 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 84 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 85 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 86 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 87 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 88 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 89 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 90 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 91 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 92 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 93 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 94 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 95 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 96 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 97 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 98 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 99 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 100 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 101 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 102 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 103 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 104 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 105 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 106 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 107 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 108 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 109 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 110 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 111 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 112 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 113 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 114 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 115 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 116 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 117 | 2904699407 | |||
| 118 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 119 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 120 | 2906610324 | |||
| 121 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 122 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 123 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 124 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 125 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 126 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 127 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 128 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 129 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 130 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 131 | 2922368715 | |||
| 132 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 133 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 134 | 2922425934 | |||
| 135 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 136 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 137 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 138 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 139 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 140 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 141 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 142 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 143 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 144 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 145 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 146 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 147 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 148 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 149 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 150 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 151 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 152 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 153 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 154 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 155 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 156 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 157 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 158 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 159 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 160 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 161 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 162 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 163 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 164 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 165 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 166 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 167 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 168 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 169 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 170 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 171 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 172 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 173 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 174 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 175 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 176 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 177 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 178 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 179 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 180 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 181 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 182 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 183 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 184 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 185 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 186 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 187 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 188 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 189 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 190 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 191 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 192 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 193 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 194 | 2939615513 | Lactococcus lactis 1925 | Isolate | Rhizosphere |
| 195 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 196 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 197 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 198 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 199 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 200 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 201 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 202 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 203 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 204 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 205 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 206 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 207 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 208 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 209 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 210 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 211 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 212 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 213 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 214 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 215 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 216 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 217 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 218 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 220 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 222 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 223 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 225 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 227 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 228 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 232 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 235 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 236 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 238 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 239 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 244 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 245 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 248 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 249 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 250 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 251 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 252 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 255 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 256 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 257 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 258 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 259 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 260 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 261 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 262 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 263 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 264 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 265 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 266 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 267 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 268 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 269 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 271 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 272 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 273 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 274 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 275 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 276 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 277 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 278 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 279 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 280 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 281 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 282 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 283 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 284 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 285 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 286 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 287 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 289 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 290 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 291 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 292 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 293 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 303 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 304 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 312 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 316 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 318 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 319 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 320 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 321 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 322 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 323 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 325 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 328 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 329 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 330 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 331 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 332 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 333 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 377 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 378 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 379 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 380 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 385 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 386 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 387 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 388 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 389 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 390 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 391 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 392 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 393 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 394 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 395 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 396 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 397 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 398 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 399 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 400 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 401 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 402 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 403 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 404 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 405 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 406 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 407 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 408 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 409 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 410 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 411 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 412 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 413 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 414 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 415 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 416 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 417 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 418 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 419 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 420 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 421 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 422 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 423 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 424 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 425 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 426 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 427 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 428 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 429 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 430 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 431 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 432 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 433 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 434 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 435 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 436 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 437 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 438 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 439 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 440 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 441 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 442 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 443 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 444 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 445 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 446 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 447 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 448 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 449 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 450 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 451 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 452 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 453 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 454 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 455 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 456 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 457 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 458 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 459 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 460 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 461 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 462 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 463 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 464 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 527 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 528 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 529 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 530 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 531 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 532 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 533 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 534 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 535 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 536 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 537 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 538 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 539 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 540 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 541 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 542 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 543 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 544 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 545 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 546 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 547 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 548 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 549 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 550 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 551 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 552 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 553 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 584 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 585 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 587 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 590 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 591 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 592 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 593 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 594 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 595 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 596 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 597 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 598 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 599 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 600 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 601 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 602 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 603 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 604 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 609 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 610 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 611 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 612 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 613 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 614 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 615 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 616 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 617 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 618 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 619 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 620 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 621 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 622 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 623 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 624 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 625 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 626 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 627 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 628 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 629 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 630 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 631 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 633 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 634 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 635 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 636 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 637 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 638 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 639 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 640 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 641 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 642 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 643 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 644 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 645 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 646 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 647 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 648 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 649 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 650 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 651 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 652 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 653 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 654 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 655 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 656 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 657 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 658 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 659 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 660 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 661 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 662 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 663 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 664 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 665 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 666 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 667 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 668 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 669 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 670 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 671 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 672 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 673 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 674 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 675 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 676 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 677 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 678 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 679 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 680 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 681 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 682 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 683 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 684 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 685 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 686 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.02 |
| Metatranscriptomes | 0.41 |
| Isolates | 20.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.4 |
| Nodule | 15.19 |
| Rhizoplane | 5.37 |
| Rhizosphere | 57.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000038 | 3300003203 | Bacteria | 59759 |
| 2 | JGI25406J46586_10001332 | 3300003203 | Bacteria | 11620 |
| 3 | JGI25153J46596_10001090 | 3300003215 | Bacteria | 16506 |
| 4 | JGI25153J46596_10001143 | 3300003215 | Bacteria | 16067 |
| 5 | JGI25153J46596_10013136 | 3300003215 | Bacteria | 3520 |
| 6 | JGI25160J50197_1009430 | 3300003354 | Bacteria | 3620 |
| 7 | JGI25404J52841_10001402 | 3300003659 | Bacteria | 4228 |
| 8 | JGI25404J52841_10005555 | 3300003659 | Bacteria | 2605 |
| 9 | Ga0055543_1003719 | 3300004625 | Bacteria | 4368 |
| 10 | Ga0065165_1000721 | 3300005262 | Bacteria | 46476 |
| 11 | Ga0065165_1002559 | 3300005262 | Bacteria | 15029 |
| 12 | Ga0065165_1017679 | 3300005262 | Bacteria | 2615 |
| 13 | Ga0065165_1019229 | 3300005262 | Bacteria | 2446 |
| 14 | Ga0070658_10031329 | 3300005327 | Bacteria | 4270 |
| 15 | Ga0070683_100004866 | 3300005329 | Bacteria | 11124 |
| 16 | Ga0070670_100013506 | 3300005331 | Bacteria | 6996 |
| 17 | Ga0068869_100037881 | 3300005334 | Bacteria | 3431 |
| 18 | Ga0068869_100072454 | 3300005334 | Bacteria | 2552 |
| 19 | Ga0070680_100084672 | 3300005336 | Bacteria | 2619 |
| 20 | Ga0070682_100012739 | 3300005337 | Bacteria | 4826 |
| 21 | Ga0068868_100026969 | 3300005338 | Bacteria | 4381 |
| 22 | Ga0068868_100041790 | 3300005338 | Bacteria | 3573 |
| 23 | Ga0068868_100061439 | 3300005338 | Bacteria | 2976 |
| 24 | Ga0070660_100010412 | 3300005339 | Bacteria | 6572 |
| 25 | Ga0070689_100007055 | 3300005340 | Bacteria | 7819 |
| 26 | Ga0070691_10001706 | 3300005341 | Bacteria | 9524 |
| 27 | Ga0070691_10026246 | 3300005341 | Bacteria | 2715 |
| 28 | Ga0070661_100053990 | 3300005344 | Bacteria | 2943 |
| 29 | Ga0070671_100000170 | 3300005355 | Bacteria | 42992 |
| 30 | Ga0070673_100004457 | 3300005364 | Bacteria | 8852 |
| 31 | Ga0070688_100188897 | 3300005365 | Bacteria | 1434 |
| 32 | Ga0070659_100032467 | 3300005366 | Bacteria | 4050 |
| 33 | Ga0070659_100048523 | 3300005366 | Bacteria | 3336 |
| 34 | Ga0070667_100034398 | 3300005367 | Bacteria | 4239 |
| 35 | Ga0070703_10011629 | 3300005406 | Bacteria | 2489 |
| 36 | Ga0070709_10000734 | 3300005434 | Bacteria | 18520 |
| 37 | Ga0070709_10021201 | 3300005434 | Bacteria | 3782 |
| 38 | Ga0070709_10121040 | 3300005434 | Bacteria | 1774 |
| 39 | Ga0070714_100000556 | 3300005435 | Bacteria | 26845 |
| 40 | Ga0070714_100017873 | 3300005435 | Bacteria | 5750 |
| 41 | Ga0070713_100062633 | 3300005436 | Bacteria | 3116 |
| 42 | Ga0070713_100135585 | 3300005436 | Bacteria | 2175 |
| 43 | Ga0070713_100319758 | 3300005436 | Bacteria | 1433 |
| 44 | Ga0070710_10001203 | 3300005437 | Bacteria | 12244 |
| 45 | Ga0070710_10139683 | 3300005437 | Bacteria | 1484 |
| 46 | Ga0070711_100000989 | 3300005439 | Bacteria | 15060 |
| 47 | Ga0070711_100003099 | 3300005439 | Bacteria | 9616 |
| 48 | Ga0070711_100073841 | 3300005439 | Bacteria | 2411 |
| 49 | Ga0070694_100000604 | 3300005444 | Bacteria | 19763 |
| 50 | Ga0070694_100048368 | 3300005444 | Bacteria | 2861 |
| 51 | Ga0070708_100012245 | 3300005445 | Bacteria | 6994 |
| 52 | Ga0070708_100127008 | 3300005445 | Bacteria | 2358 |
| 53 | Ga0070678_100134219 | 3300005456 | Bacteria | 1971 |
| 54 | Ga0070681_10035275 | 3300005458 | Bacteria | 5025 |
| 55 | Ga0070681_10064136 | 3300005458 | Bacteria | 3645 |
| 56 | Ga0070681_10073291 | 3300005458 | Bacteria | 3386 |
| 57 | Ga0070681_10109546 | 3300005458 | Bacteria | 2701 |
| 58 | Ga0068867_100133690 | 3300005459 | Bacteria | 1931 |
| 59 | Ga0070698_100104941 | 3300005471 | Bacteria | 2796 |
| 60 | Ga0070699_100001264 | 3300005518 | Bacteria | 23301 |
| 61 | Ga0070679_100017666 | 3300005530 | Bacteria | 6905 |
| 62 | Ga0070679_100125200 | 3300005530 | Bacteria | 2552 |
| 63 | Ga0070684_100002394 | 3300005535 | Bacteria | 13823 |
| 64 | Ga0070684_100010958 | 3300005535 | Bacteria | 7208 |
| 65 | Ga0070684_100039358 | 3300005535 | Bacteria | 4066 |
| 66 | Ga0070684_100058840 | 3300005535 | Bacteria | 3359 |
| 67 | Ga0070697_100012239 | 3300005536 | Bacteria | 6719 |
| 68 | Ga0068853_100015741 | 3300005539 | Bacteria | 6212 |
| 69 | Ga0070695_100024951 | 3300005545 | Bacteria | 3687 |
| 70 | Ga0070696_100005035 | 3300005546 | Bacteria | 8829 |
| 71 | Ga0070665_100013287 | 3300005548 | Bacteria | 8290 |
| 72 | Ga0070665_100013848 | 3300005548 | Bacteria | 8112 |
| 73 | Ga0070665_100069949 | 3300005548 | Bacteria | 3517 |
| 74 | Ga0070704_100001210 | 3300005549 | Bacteria | 13549 |
| 75 | Ga0070704_100174236 | 3300005549 | Bacteria | 1714 |
| 76 | Ga0068855_100008028 | 3300005563 | Bacteria | 12750 |
| 77 | Ga0068855_100066927 | 3300005563 | Bacteria | 4187 |
| 78 | Ga0068855_100197158 | 3300005563 | Bacteria | 2268 |
| 79 | Ga0068857_100038607 | 3300005577 | Bacteria | 4229 |
| 80 | Ga0068857_100038848 | 3300005577 | Bacteria | 4215 |
| 81 | Ga0068856_100003313 | 3300005614 | Bacteria | 16364 |
| 82 | Ga0068856_100013310 | 3300005614 | Bacteria | 7967 |
| 83 | Ga0068852_100001667 | 3300005616 | Bacteria | 15132 |
| 84 | Ga0068852_100066401 | 3300005616 | Bacteria | 3150 |
| 85 | Ga0068859_100004768 | 3300005617 | Bacteria | 13789 |
| 86 | Ga0068861_100031380 | 3300005719 | Bacteria | 3903 |
| 87 | Ga0068861_100076931 | 3300005719 | Bacteria | 2602 |
| 88 | Ga0068851_10015821 | 3300005834 | Bacteria | 3600 |
| 89 | Ga0068858_100186390 | 3300005842 | Bacteria | 1960 |
| 90 | Ga0068860_100000711 | 3300005843 | Bacteria | 38159 |
| 91 | Ga0068860_100114271 | 3300005843 | Bacteria | 2581 |
| 92 | Ga0068862_100002512 | 3300005844 | Bacteria | 16242 |
| 93 | Ga0068862_100022673 | 3300005844 | Bacteria | 5253 |
| 94 | Ga0068862_100115227 | 3300005844 | Bacteria | 2363 |
| 95 | Ga0081455_10000017 | 3300005937 | Bacteria | 174550 |
| 96 | Ga0081455_10002635 | 3300005937 | Bacteria | 21263 |
| 97 | Ga0081455_10017707 | 3300005937 | Bacteria | 6817 |
| 98 | Ga0081455_10087778 | 3300005937 | Bacteria | 2530 |
| 99 | Ga0081538_10004632 | 3300005981 | Bacteria | 12624 |
| 100 | Ga0081538_10017999 | 3300005981 | Bacteria | 5332 |
| 101 | Ga0081538_10057238 | 3300005981 | Bacteria | 2274 |
| 102 | Ga0081540_1000059 | 3300005983 | Bacteria | 120226 |
| 103 | Ga0081540_1004330 | 3300005983 | Bacteria | 10872 |
| 104 | Ga0081540_1005964 | 3300005983 | Bacteria | 8977 |
| 105 | Ga0081540_1006212 | 3300005983 | Bacteria | 8759 |
| 106 | Ga0081540_1009418 | 3300005983 | Bacteria | 6729 |
| 107 | Ga0081540_1013117 | 3300005983 | Bacteria | 5411 |
| 108 | Ga0081540_1013193 | 3300005983 | Bacteria | 5389 |
| 109 | Ga0081540_1021925 | 3300005983 | Bacteria | 3785 |
| 110 | Ga0081540_1022189 | 3300005983 | Bacteria | 3752 |
| 111 | Ga0081540_1026518 | 3300005983 | Bacteria | 3306 |
| 112 | Ga0081540_1045581 | 3300005983 | Bacteria | 2225 |
| 113 | Ga0081540_1047465 | 3300005983 | Bacteria | 2159 |
| 114 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 115 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 116 | Ga0081539_10027918 | 3300005985 | Bacteria | 3562 |
| 117 | Ga0070717_10000884 | 3300006028 | Bacteria | 19823 |
| 118 | Ga0070717_10007593 | 3300006028 | Bacteria | 8058 |
| 119 | Ga0070717_10028344 | 3300006028 | Bacteria | 4482 |
| 120 | Ga0075365_10000311 | 3300006038 | Bacteria | 17078 |
| 121 | Ga0075365_10055836 | 3300006038 | Bacteria | 2623 |
| 122 | Ga0075365_10109419 | 3300006038 | Bacteria | 1898 |
| 123 | Ga0075365_10111954 | 3300006038 | Bacteria | 1876 |
| 124 | Ga0075368_10003624 | 3300006042 | Bacteria | 5174 |
| 125 | Ga0075368_10004781 | 3300006042 | Bacteria | 4612 |
| 126 | Ga0075363_100001272 | 3300006048 | Bacteria | 9377 |
| 127 | Ga0075363_100043534 | 3300006048 | Bacteria | 2375 |
| 128 | Ga0075364_10001505 | 3300006051 | Bacteria | 12686 |
| 129 | Ga0075364_10050231 | 3300006051 | Bacteria | 2722 |
| 130 | Ga0075364_10135304 | 3300006051 | Bacteria | 1655 |
| 131 | Ga0070715_10001487 | 3300006163 | Bacteria | 6828 |
| 132 | Ga0070716_100005650 | 3300006173 | Bacteria | 6073 |
| 133 | Ga0070712_100024322 | 3300006175 | Bacteria | 4012 |
| 134 | Ga0075362_10001659 | 3300006177 | Bacteria | 7214 |
| 135 | Ga0075362_10010512 | 3300006177 | Bacteria | 3616 |
| 136 | Ga0075367_10001516 | 3300006178 | Bacteria | 10041 |
| 137 | Ga0075367_10017979 | 3300006178 | Bacteria | 3892 |
| 138 | Ga0075367_10028820 | 3300006178 | Bacteria | 3170 |
| 139 | Ga0075367_10040558 | 3300006178 | Bacteria | 2719 |
| 140 | Ga0075367_10133111 | 3300006178 | Bacteria | 1538 |
| 141 | Ga0075369_10030898 | 3300006186 | Bacteria | 2257 |
| 142 | Ga0075369_10035959 | 3300006186 | Bacteria | 2106 |
| 143 | Ga0075370_10021919 | 3300006353 | Bacteria | 3503 |
| 144 | Ga0075370_10053904 | 3300006353 | Bacteria | 2282 |
| 145 | Ga0068871_100098349 | 3300006358 | Bacteria | 2448 |
| 146 | Ga0075428_100201205 | 3300006844 | Bacteria | 2153 |
| 147 | Ga0075430_100125794 | 3300006846 | Bacteria | 2136 |
| 148 | Ga0075431_100002016 | 3300006847 | Bacteria | 19387 |
| 149 | Ga0075434_100011193 | 3300006871 | Bacteria | 8443 |
| 150 | Ga0075434_100024076 | 3300006871 | Bacteria | 5947 |
| 151 | Ga0075429_100012416 | 3300006880 | Bacteria | 7391 |
| 152 | Ga0097620_100004768 | 3300006931 | Bacteria | 13789 |
| 153 | Ga0099825_1020047 | 3300006941 | Bacteria | 4845 |
| 154 | Ga0099824_1012895 | 3300006942 | Bacteria | 8903 |
| 155 | Ga0099822_1003531 | 3300006943 | Bacteria | 20044 |
| 156 | Ga0099823_1007767 | 3300006944 | Bacteria | 10911 |
| 157 | Ga0075435_100053000 | 3300007076 | Bacteria | 3270 |
| 158 | Ga0105240_10005052 | 3300009093 | Bacteria | 19785 |
| 159 | Ga0105240_10302018 | 3300009093 | Bacteria | 1831 |
| 160 | Ga0105240_10402852 | 3300009093 | Bacteria | 1540 |
| 161 | Ga0111539_10317521 | 3300009094 | Bacteria | 1813 |
| 162 | Ga0105245_10001527 | 3300009098 | Bacteria | 20967 |
| 163 | Ga0105245_10008614 | 3300009098 | Bacteria | 8897 |
| 164 | Ga0105247_10016349 | 3300009101 | Bacteria | 4445 |
| 165 | Ga0105247_10068972 | 3300009101 | Bacteria | 2205 |
| 166 | Ga0114129_10068570 | 3300009147 | Bacteria | 4945 |
| 167 | Ga0114129_10086246 | 3300009147 | Bacteria | 4354 |
| 168 | Ga0114129_10196571 | 3300009147 | Bacteria | 2734 |
| 169 | Ga0105241_10009951 | 3300009174 | Bacteria | 6984 |
| 170 | Ga0105248_10049003 | 3300009177 | Bacteria | 4738 |
| 171 | Ga0105237_10001825 | 3300009545 | Bacteria | 27462 |
| 172 | Ga0105237_10073492 | 3300009545 | Bacteria | 3411 |
| 173 | Ga0105237_10092269 | 3300009545 | Bacteria | 3018 |
| 174 | Ga0105237_10179331 | 3300009545 | Bacteria | 2119 |
| 175 | Ga0105238_10047043 | 3300009551 | Bacteria | 4351 |
| 176 | Ga0105238_10099556 | 3300009551 | Bacteria | 2890 |
| 177 | Ga0105028_101203 | 3300009993 | Bacteria | 2732 |
| 178 | Ga0099796_10038186 | 3300010159 | Bacteria | 1610 |
| 179 | Ga0105239_10058217 | 3300010375 | Bacteria | 4240 |
| 180 | Ga0105239_10090880 | 3300010375 | Bacteria | 3368 |
| 181 | Ga0105246_10144712 | 3300011119 | Bacteria | 1792 |
| 182 | Ga0157373_10051862 | 3300013100 | Bacteria | 2920 |
| 183 | Ga0157371_10009033 | 3300013102 | Bacteria | 7880 |
| 184 | Ga0157370_10114337 | 3300013104 | Bacteria | 2521 |
| 185 | Ga0157370_10119024 | 3300013104 | Bacteria | 2466 |
| 186 | Ga0157369_10004066 | 3300013105 | Bacteria | 17322 |
| 187 | Ga0157369_10014664 | 3300013105 | Bacteria | 8843 |
| 188 | Ga0157369_10021176 | 3300013105 | Bacteria | 7269 |
| 189 | Ga0157369_10037827 | 3300013105 | Bacteria | 5281 |
| 190 | Ga0157369_10293897 | 3300013105 | Bacteria | 1691 |
| 191 | Ga0157374_10012732 | 3300013296 | Bacteria | 7328 |
| 192 | Ga0163162_10040120 | 3300013306 | Bacteria | 4680 |
| 193 | Ga0157372_10025437 | 3300013307 | Bacteria | 6436 |
| 194 | Ga0157375_10017268 | 3300013308 | Bacteria | 6508 |
| 195 | Ga0157375_10239327 | 3300013308 | Bacteria | 1975 |
| 196 | Ga0157375_10439566 | 3300013308 | Bacteria | 1470 |
| 197 | Ga0163163_10031880 | 3300014325 | Bacteria | 5090 |
| 198 | Ga0163163_10038268 | 3300014325 | Bacteria | 4674 |
| 199 | Ga0163163_10056783 | 3300014325 | Bacteria | 3869 |
| 200 | Ga0163163_10127689 | 3300014325 | Bacteria | 2581 |
| 201 | Ga0157379_10098154 | 3300014968 | Bacteria | 2630 |
| 202 | Ga0157376_10005380 | 3300014969 | Bacteria | 8949 |
| 203 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 204 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 205 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 206 | Ga0214545_1025698 | 3300021324 | Bacteria | 3350 |
| 207 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 208 | Ga0213872_10018555 | 3300021361 | Bacteria | 3208 |
| 209 | Ga0213876_10010761 | 3300021384 | Bacteria | 4902 |
| 210 | Ga0209677_101607 | 3300025253 | Bacteria | 9538 |
| 211 | Ga0209148_1000216 | 3300025254 | Bacteria | 98209 |
| 212 | Ga0209233_1004139 | 3300025261 | Bacteria | 4992 |
| 213 | Ga0209455_1001447 | 3300025272 | Bacteria | 10717 |
| 214 | Ga0209673_1030417 | 3300025273 | Bacteria | 1701 |
| 215 | Ga0209675_1007363 | 3300025291 | Bacteria | 4232 |
| 216 | Ga0209564_1001014 | 3300025295 | Bacteria | 34834 |
| 217 | Ga0209564_1004938 | 3300025295 | Bacteria | 7883 |
| 218 | Ga0209564_1010262 | 3300025295 | Bacteria | 4339 |
| 219 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 220 | Ga0209758_1000161 | 3300025297 | Bacteria | 154278 |
| 221 | Ga0209758_1001304 | 3300025297 | Bacteria | 30476 |
| 222 | Ga0209758_1007191 | 3300025297 | Bacteria | 7672 |
| 223 | Ga0209758_1009851 | 3300025297 | Bacteria | 5839 |
| 224 | Ga0209758_1015686 | 3300025297 | Bacteria | 3905 |
| 225 | Ga0209758_1035145 | 3300025297 | Bacteria | 1980 |
| 226 | Ga0209256_1007571 | 3300025299 | Bacteria | 5304 |
| 227 | Ga0209256_1013156 | 3300025299 | Bacteria | 3093 |
| 228 | Ga0207426_1000186 | 3300025302 | Bacteria | 154130 |
| 229 | Ga0207426_1001742 | 3300025302 | Bacteria | 16568 |
| 230 | Ga0207426_1012233 | 3300025302 | Bacteria | 3232 |
| 231 | Ga0209257_1000368 | 3300025304 | Bacteria | 91038 |
| 232 | Ga0207653_10002688 | 3300025885 | Bacteria | 5649 |
| 233 | Ga0207692_10002111 | 3300025898 | Bacteria | 7583 |
| 234 | Ga0207692_10024479 | 3300025898 | Bacteria | 2807 |
| 235 | Ga0207710_10020548 | 3300025900 | Bacteria | 2823 |
| 236 | Ga0207710_10042202 | 3300025900 | Bacteria | 2025 |
| 237 | Ga0207688_10042576 | 3300025901 | Bacteria | 2528 |
| 238 | Ga0207647_10036925 | 3300025904 | Bacteria | 3101 |
| 239 | Ga0207699_10002096 | 3300025906 | Bacteria | 9428 |
| 240 | Ga0207699_10014465 | 3300025906 | Bacteria | 4069 |
| 241 | Ga0207705_10135086 | 3300025909 | Bacteria | 1838 |
| 242 | Ga0207684_10064450 | 3300025910 | Bacteria | 3111 |
| 243 | Ga0207684_10097208 | 3300025910 | Bacteria | 2514 |
| 244 | Ga0207654_10029722 | 3300025911 | Bacteria | 2995 |
| 245 | Ga0207707_10002566 | 3300025912 | Bacteria | 16278 |
| 246 | Ga0207707_10004618 | 3300025912 | Bacteria | 12098 |
| 247 | Ga0207707_10012807 | 3300025912 | Bacteria | 7295 |
| 248 | Ga0207707_10016469 | 3300025912 | Bacteria | 6446 |
| 249 | Ga0207707_10095500 | 3300025912 | Bacteria | 2598 |
| 250 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 251 | Ga0207695_10029203 | 3300025913 | Bacteria | 6099 |
| 252 | Ga0207695_10135448 | 3300025913 | Bacteria | 2416 |
| 253 | Ga0207695_10208308 | 3300025913 | Bacteria | 1867 |
| 254 | Ga0207671_10005136 | 3300025914 | Bacteria | 12194 |
| 255 | Ga0207671_10079706 | 3300025914 | Bacteria | 2454 |
| 256 | Ga0207693_10001388 | 3300025915 | Bacteria | 21472 |
| 257 | Ga0207693_10018758 | 3300025915 | Bacteria | 5505 |
| 258 | Ga0207693_10033960 | 3300025915 | Bacteria | 4025 |
| 259 | Ga0207663_10010667 | 3300025916 | Bacteria | 4900 |
| 260 | Ga0207663_10012993 | 3300025916 | Bacteria | 4515 |
| 261 | Ga0207663_10016593 | 3300025916 | Bacteria | 4087 |
| 262 | Ga0207660_10001934 | 3300025917 | Bacteria | 13823 |
| 263 | Ga0207660_10022103 | 3300025917 | Bacteria | 4283 |
| 264 | Ga0207660_10081312 | 3300025917 | Bacteria | 2381 |
| 265 | Ga0207657_10001315 | 3300025919 | Bacteria | 26383 |
| 266 | Ga0207657_10012952 | 3300025919 | Bacteria | 8199 |
| 267 | Ga0207652_10014815 | 3300025921 | Bacteria | 6321 |
| 268 | Ga0207652_10016463 | 3300025921 | Bacteria | 6038 |
| 269 | Ga0207694_10063186 | 3300025924 | Bacteria | 2884 |
| 270 | Ga0207650_10009533 | 3300025925 | Bacteria | 6635 |
| 271 | Ga0207700_10001452 | 3300025928 | Bacteria | 13448 |
| 272 | Ga0207700_10004770 | 3300025928 | Bacteria | 8042 |
| 273 | Ga0207700_10034329 | 3300025928 | Bacteria | 3641 |
| 274 | Ga0207700_10043367 | 3300025928 | Bacteria | 3303 |
| 275 | Ga0207700_10043639 | 3300025928 | Bacteria | 3295 |
| 276 | Ga0207700_10126505 | 3300025928 | Bacteria | 2080 |
| 277 | Ga0207700_10251466 | 3300025928 | Bacteria | 1510 |
| 278 | Ga0207644_10001194 | 3300025931 | Bacteria | 16721 |
| 279 | Ga0207690_10050422 | 3300025932 | Bacteria | 2779 |
| 280 | Ga0207706_10039347 | 3300025933 | Bacteria | 4192 |
| 281 | Ga0207706_10059280 | 3300025933 | Bacteria | 3371 |
| 282 | Ga0207709_10048312 | 3300025935 | Bacteria | 2592 |
| 283 | Ga0207670_10007348 | 3300025936 | Bacteria | 6142 |
| 284 | Ga0207669_10002669 | 3300025937 | Bacteria | 7634 |
| 285 | Ga0207665_10000874 | 3300025939 | Bacteria | 20343 |
| 286 | Ga0207665_10005463 | 3300025939 | Bacteria | 8482 |
| 287 | Ga0207665_10019486 | 3300025939 | Bacteria | 4460 |
| 288 | Ga0207665_10047796 | 3300025939 | Bacteria | 2870 |
| 289 | Ga0207711_10061786 | 3300025941 | Bacteria | 3230 |
| 290 | Ga0207661_10001422 | 3300025944 | Bacteria | 16129 |
| 291 | Ga0207661_10021344 | 3300025944 | Bacteria | 4850 |
| 292 | Ga0207661_10117171 | 3300025944 | Bacteria | 2262 |
| 293 | Ga0207679_10127642 | 3300025945 | Bacteria | 2035 |
| 294 | Ga0207667_10012575 | 3300025949 | Bacteria | 9738 |
| 295 | Ga0207667_10248073 | 3300025949 | Bacteria | 1821 |
| 296 | Ga0207651_10064458 | 3300025960 | Bacteria | 2565 |
| 297 | Ga0207712_10092064 | 3300025961 | Bacteria | 2234 |
| 298 | Ga0207668_10069457 | 3300025972 | Bacteria | 2508 |
| 299 | Ga0207668_10237981 | 3300025972 | Bacteria | 1471 |
| 300 | Ga0207677_10005921 | 3300026023 | Bacteria | 6654 |
| 301 | Ga0207677_10104908 | 3300026023 | Bacteria | 2090 |
| 302 | Ga0207639_10014696 | 3300026041 | Bacteria | 5512 |
| 303 | Ga0207678_10010380 | 3300026067 | Bacteria | 8177 |
| 304 | Ga0207678_10032772 | 3300026067 | Bacteria | 4528 |
| 305 | Ga0207678_10048937 | 3300026067 | Bacteria | 3653 |
| 306 | Ga0207678_10050044 | 3300026067 | Bacteria | 3610 |
| 307 | Ga0207678_10105136 | 3300026067 | Bacteria | 2409 |
| 308 | Ga0207708_10003078 | 3300026075 | Bacteria | 12277 |
| 309 | Ga0207708_10119042 | 3300026075 | Bacteria | 2057 |
| 310 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 311 | Ga0207674_10037716 | 3300026116 | Bacteria | 5023 |
| 312 | Ga0207674_10090075 | 3300026116 | Bacteria | 3059 |
| 313 | Ga0207674_10121292 | 3300026116 | Bacteria | 2582 |
| 314 | Ga0207675_100080248 | 3300026118 | Bacteria | 3059 |
| 315 | Ga0207675_100128525 | 3300026118 | Bacteria | 2402 |
| 316 | Ga0207683_10021712 | 3300026121 | Bacteria | 5502 |
| 317 | Ga0207683_10214283 | 3300026121 | Bacteria | 1753 |
| 318 | Ga0209389_1000062 | 3300027296 | Bacteria | 102842 |
| 319 | Ga0209389_1000072 | 3300027296 | Bacteria | 96795 |
| 320 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 321 | Ga0209589_1000270 | 3300027357 | Bacteria | 65577 |
| 322 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 323 | Ga0209489_100160 | 3300027361 | Bacteria | 102842 |
| 324 | Ga0209489_100206 | 3300027361 | Bacteria | 96866 |
| 325 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 326 | Ga0209700_101128 | 3300027363 | Bacteria | 54168 |
| 327 | Ga0209813_10000705 | 3300027866 | Bacteria | 7645 |
| 328 | Ga0268266_10002101 | 3300028379 | Bacteria | 21999 |
| 329 | Ga0268266_10025141 | 3300028379 | Bacteria | 5068 |
| 330 | Ga0268266_10062907 | 3300028379 | Bacteria | 3203 |
| 331 | Ga0268265_10015487 | 3300028380 | Bacteria | 5219 |
| 332 | Ga0268265_10058818 | 3300028380 | Bacteria | 2937 |
| 333 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 334 | Ga0268264_10007132 | 3300028381 | Bacteria | 9365 |
| 335 | Ga0265337_1022685 | 3300028556 | Bacteria | 1940 |
| 336 | Ga0265326_10025223 | 3300028558 | Bacteria | 1695 |
| 337 | Ga0265319_1029202 | 3300028563 | Bacteria | 1937 |
| 338 | Ga0265334_10045023 | 3300028573 | Bacteria | 1710 |
| 339 | Ga0265318_10044010 | 3300028577 | Bacteria | 1690 |
| 340 | Ga0265323_10031892 | 3300028653 | Bacteria | 1956 |
| 341 | Ga0265336_10000481 | 3300028666 | Bacteria | 23616 |
| 342 | Ga0307517_10000279 | 3300028786 | Bacteria | 88025 |
| 343 | Ga0307515_10012109 | 3300028794 | Bacteria | 16266 |
| 344 | Ga0265338_10000317 | 3300028800 | Bacteria | 87318 |
| 345 | Ga0265324_10007835 | 3300029957 | Bacteria | 4291 |
| 346 | Ga0265324_10009946 | 3300029957 | Bacteria | 3694 |
| 347 | Ga0265324_10015575 | 3300029957 | Bacteria | 2793 |
| 348 | Ga0265328_10000750 | 3300031239 | Bacteria | 15050 |
| 349 | Ga0265328_10011927 | 3300031239 | Bacteria | 3465 |
| 350 | Ga0265328_10042051 | 3300031239 | Bacteria | 1682 |
| 351 | Ga0265340_10006005 | 3300031247 | Bacteria | 6709 |
| 352 | Ga0265331_10000497 | 3300031250 | Bacteria | 37153 |
| 353 | Ga0265331_10032599 | 3300031250 | Bacteria | 2581 |
| 354 | Ga0265327_10000810 | 3300031251 | Bacteria | 47518 |
| 355 | Ga0265327_10005760 | 3300031251 | Bacteria | 10204 |
| 356 | Ga0265316_10025488 | 3300031344 | Bacteria | 4933 |
| 357 | Ga0265316_10039472 | 3300031344 | Bacteria | 3791 |
| 358 | Ga0307509_10024299 | 3300031507 | Bacteria | 6787 |
| 359 | Ga0307408_100154312 | 3300031548 | Bacteria | 1816 |
| 360 | Ga0265313_10001452 | 3300031595 | Bacteria | 22114 |
| 361 | Ga0307508_10000514 | 3300031616 | Bacteria | 46387 |
| 362 | Ga0265314_10021427 | 3300031711 | Bacteria | 4969 |
| 363 | Ga0265314_10036474 | 3300031711 | Bacteria | 3573 |
| 364 | Ga0265314_10065731 | 3300031711 | Bacteria | 2448 |
| 365 | Ga0265314_10100505 | 3300031711 | Bacteria | 1860 |
| 366 | Ga0265342_10012872 | 3300031712 | Bacteria | 5645 |
| 367 | Ga0316576_10013900 | 3300031727 | Bacteria | 5366 |
| 368 | Ga0307516_10001288 | 3300031730 | Bacteria | 34892 |
| 369 | Ga0307516_10010587 | 3300031730 | Bacteria | 10122 |
| 370 | Ga0307516_10212641 | 3300031730 | Bacteria | 1647 |
| 371 | Ga0307413_10037981 | 3300031824 | Bacteria | 2787 |
| 372 | Ga0307416_100257244 | 3300032002 | Bacteria | 1704 |
| 373 | Ga0307510_10035023 | 3300033180 | Bacteria | 5612 |
| 374 | Ga0307510_10042213 | 3300033180 | Bacteria | 4973 |
| 375 | Ga0307510_10115841 | 3300033180 | Bacteria | 2403 |
| 376 | Ga0307510_10117603 | 3300033180 | Bacteria | 2375 |
| 377 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 378 | Ga0373926_0013951 | 3300035083 | Bacteria | 2729 |
| 379 | Ga0373934_0018837 | 3300035086 | Bacteria | 2644 |
| 380 | Ga0373923_0028209 | 3300035111 | Bacteria | 2244 |
| 381 | Ga0373936_0047639 | 3300035113 | Bacteria | 1729 |
| 382 | Ga0373936_0051498 | 3300035113 | Bacteria | 1666 |
| 383 | Ga0373945_0044837 | 3300035116 | Bacteria | 1609 |
| 384 | Ga0373953_0004607 | 3300035117 | Bacteria | 4404 |
| 385 | Ga0373953_0017845 | 3300035117 | Bacteria | 2616 |
| 386 | Ga0373953_0020181 | 3300035117 | Bacteria | 2488 |
| 387 | Ga0373954_0005482 | 3300035118 | Bacteria | 5488 |
| 388 | Ga0373954_0025608 | 3300035118 | Bacteria | 2698 |
| 389 | Ga0373956_0011396 | 3300035119 | Bacteria | 3662 |
| 390 | Ga0373956_0015134 | 3300035119 | Bacteria | 3227 |
| 391 | Ga0373957_0006039 | 3300035120 | Bacteria | 3794 |
| 392 | Ga0373957_0008872 | 3300035120 | Bacteria | 3274 |
| 393 | Ga0373960_0005258 | 3300035121 | Bacteria | 2991 |
| 394 | Ga0373943_0011057 | 3300035170 | Bacteria | 4054 |
| 395 | Ga0373943_0014684 | 3300035170 | Bacteria | 3551 |
| 396 | Ga0373946_0064896 | 3300035171 | Bacteria | 1562 |
| 397 | Ga0373955_0039968 | 3300035172 | Bacteria | 2506 |
| 398 | Ga0373961_0003418 | 3300035241 | Bacteria | 3934 |
| 399 | Ga0316574_0077273 | 3300035398 | Bacteria | 2110 |
| 400 | Ga0373924_0009804 | 3300035410 | Bacteria | 3519 |
| 401 | Ga0373924_0013743 | 3300035410 | Bacteria | 3046 |
| 402 | Ga0373924_0016970 | 3300035410 | Bacteria | 2786 |
| 403 | Ga0373924_0023653 | 3300035410 | Bacteria | 2413 |
| 404 | Ga0373924_0025392 | 3300035410 | Bacteria | 2343 |
| 405 | Ga0373931_0024832 | 3300035691 | Bacteria | 3040 |
| 406 | Ga0373935_0075116 | 3300035692 | Bacteria | 2186 |
| 407 | Ga0373927_0007448 | 3300035695 | Bacteria | 7404 |
| 408 | Ga0373927_0021594 | 3300035695 | Bacteria | 4219 |
| 409 | Ga0373927_0029712 | 3300035695 | Bacteria | 3564 |
| 410 | Ga0373927_0065400 | 3300035695 | Bacteria | 2352 |
| 411 | Ga0373927_0089216 | 3300035695 | Bacteria | 2002 |
| 412 | Ga0373927_0197595 | 3300035695 | Bacteria | 1320 |
| 413 | Ga0373933_0001552 | 3300035724 | Bacteria | 13451 |
| 414 | Ga0373933_0056454 | 3300035724 | Bacteria | 2357 |
| 415 | Ga0373947_0017234 | 3300035725 | Bacteria | 4154 |
| 416 | Ga0373947_0042387 | 3300035725 | Bacteria | 2716 |
| 417 | Ga0373947_0086393 | 3300035725 | Bacteria | 1950 |
| 418 | Ga0373937_0000352 | 3300036401 | Bacteria | 42756 |
| 419 | Ga0373937_0070802 | 3300036401 | Bacteria | 3216 |
| 420 | Ga0316582_0042720 | 3300036647 | Bacteria | 2841 |
| 421 | Ga0373925_0014183 | 3300037068 | Bacteria | 5766 |
| 422 | Ga0373925_0034822 | 3300037068 | Bacteria | 3713 |
| 423 | Ga0373925_0072684 | 3300037068 | Bacteria | 2602 |
| 424 | Ga0395899_0053228 | 3300037312 | Bacteria | 2998 |
| 425 | Ga0395899_0171799 | 3300037312 | Bacteria | 1526 |
| 426 | Ga0395900_0000982 | 3300037418 | Bacteria | 37090 |
| 427 | Ga0395900_0010894 | 3300037418 | Bacteria | 9298 |
| 428 | Ga0395900_0034116 | 3300037418 | Bacteria | 5239 |
| 429 | Ga0395900_0041755 | 3300037418 | Bacteria | 4727 |
| 430 | Ga0395900_0069121 | 3300037418 | Bacteria | 3630 |
| 431 | Ga0395900_0179921 | 3300037418 | Bacteria | 2149 |
| 432 | Ga0395900_0192842 | 3300037418 | Bacteria | 2066 |
| 433 | Ga0395898_0002224 | 3300037466 | Bacteria | 23633 |
| 434 | Ga0395898_0005680 | 3300037466 | Bacteria | 13446 |
| 435 | Ga0395898_0089280 | 3300037466 | Bacteria | 2966 |
| 436 | Ga0395898_0139419 | 3300037466 | Bacteria | 2321 |
| 437 | Ga0395905_0000710 | 3300037471 | Bacteria | 44148 |
| 438 | Ga0395905_0048406 | 3300037471 | Bacteria | 3984 |
| 439 | Ga0436364_0084731 | 3300037853 | Bacteria | 2720 |
| 440 | Ga0436364_0923208 | 3300037853 | Bacteria | 1667 |
| 441 | Ga0395901_0023426 | 3300038443 | Bacteria | 6330 |
| 442 | Ga0395901_0139718 | 3300038443 | Bacteria | 2546 |
| 443 | Ga0400484_04880 | 3300038725 | Bacteria | 7299 |
| 444 | Ga0400485_06767 | 3300038735 | Bacteria | 9144 |
| 445 | Ga0400483_015990 | 3300039062 | Bacteria | 6361 |
| 446 | Ga0400483_179422 | 3300039062 | Bacteria | 17867 |
| 447 | Ga0400483_238094 | 3300039062 | Bacteria | 6286 |
| 448 | Ga0400487_10787 | 3300039110 | Bacteria | 4508 |
| 449 | Ga0436365_0129589 | 3300039437 | Bacteria | 3077 |
| 450 | Ga0436365_0771783 | 3300039437 | Bacteria | 36298 |
| 451 | Ga0436365_1747149 | 3300039437 | Bacteria | 3995 |
| 452 | Ga0436365_1805073 | 3300039437 | Bacteria | 2228 |
| 453 | Ga0436360_0339475 | 3300039438 | Bacteria | 2399 |
| 454 | Ga0436361_0731125 | 3300039447 | Bacteria | 9316 |
| 455 | Ga0436361_0799126 | 3300039447 | Bacteria | 2049 |
| 456 | Ga0436361_0852708 | 3300039447 | Bacteria | 3227 |
| 457 | Ga0436363_1518892 | 3300039450 | Bacteria | 4640 |
| 458 | Ga0436362_0347390 | 3300039453 | Bacteria | 3858 |
| 459 | Ga0439438_010411 | 3300041405 | Bacteria | 2941 |
| 460 | Ga0439465_0013506 | 3300041413 | Bacteria | 2545 |
| 461 | Ga0439435_0029075 | 3300042436 | Bacteria | 1490 |
| 462 | Ga0451577_0313931 | 3300042876 | Bacteria | 1421 |
| 463 | Ga0466972_0000136 | 3300044658 | Bacteria | 60410 |
| 464 | Ga0453683_0095084 | 3300044673 | Bacteria | 1870 |
| 465 | Ga0466965_0045560 | 3300044683 | Bacteria | 2170 |
| 466 | Ga0466966_0002418 | 3300044684 | Bacteria | 12199 |
| 467 | Ga0466961_0000324 | 3300044693 | Bacteria | 31518 |
| 468 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 469 | Ga0453684_0000031 | 3300044712 | Bacteria | 752632 |
| 470 | Ga0453684_0011035 | 3300044712 | Bacteria | 15264 |
| 471 | Ga0466957_0135722 | 3300044842 | Bacteria | 1581 |
| 472 | Ga0466959_0047380 | 3300045049 | Bacteria | 3161 |
| 473 | Ga0466967_0019583 | 3300045976 | Bacteria | 5446 |
| 474 | Ga0466967_0098327 | 3300045976 | Bacteria | 2672 |
| 475 | Ga0466967_0115264 | 3300045976 | Bacteria | 2474 |
| 476 | Ga0466967_0145779 | 3300045976 | Bacteria | 2209 |
| 477 | Ga0495617_017014 | 3300046452 | Bacteria | 2457 |
| 478 | Ga0495592_0018882 | 3300046454 | Bacteria | 5249 |
| 479 | Ga0495592_0051566 | 3300046454 | Bacteria | 3056 |
| 480 | Ga0495592_0054426 | 3300046454 | Bacteria | 2965 |
| 481 | Ga0495592_0107296 | 3300046454 | Bacteria | 1981 |
| 482 | Ga0495592_0126889 | 3300046454 | Bacteria | 1789 |
| 483 | Ga0495603_0000330 | 3300046455 | Bacteria | 25593 |
| 484 | Ga0495603_0002054 | 3300046455 | Bacteria | 11838 |
| 485 | Ga0495603_0040931 | 3300046455 | Bacteria | 2772 |
| 486 | Ga0495603_0094746 | 3300046455 | Bacteria | 1744 |
| 487 | Ga0495629_0000360 | 3300046459 | Bacteria | 38561 |
| 488 | Ga0495629_0024403 | 3300046459 | Bacteria | 4306 |
| 489 | Ga0495629_0037632 | 3300046459 | Bacteria | 3410 |
| 490 | Ga0495638_0006922 | 3300046460 | Bacteria | 8180 |
| 491 | Ga0495641_0005597 | 3300046461 | Bacteria | 8413 |
| 492 | Ga0495651_0021480 | 3300046462 | Bacteria | 5017 |
| 493 | Ga0495651_0024011 | 3300046462 | Bacteria | 4743 |
| 494 | Ga0495651_0026750 | 3300046462 | Bacteria | 4492 |
| 495 | Ga0495651_0030511 | 3300046462 | Bacteria | 4204 |
| 496 | Ga0495651_0088807 | 3300046462 | Bacteria | 2322 |
| 497 | Ga0495653_0003278 | 3300046463 | Bacteria | 12988 |
| 498 | Ga0495653_0011730 | 3300046463 | Bacteria | 7155 |
| 499 | Ga0495653_0051629 | 3300046463 | Bacteria | 3156 |
| 500 | Ga0495580_0001688 | 3300046472 | Bacteria | 19386 |
| 501 | Ga0495582_0000214 | 3300046473 | Bacteria | 32147 |
| 502 | Ga0495639_0000015 | 3300046475 | Bacteria | 80742 |
| 503 | Ga0495639_0030698 | 3300046475 | Bacteria | 2389 |
| 504 | Ga0495639_0033968 | 3300046475 | Bacteria | 2280 |
| 505 | Ga0495662_0004450 | 3300046476 | Bacteria | 7039 |
| 506 | Ga0495664_0001728 | 3300046477 | Bacteria | 11612 |
| 507 | Ga0495664_0016059 | 3300046477 | Bacteria | 4264 |
| 508 | Ga0495664_0024564 | 3300046477 | Bacteria | 3504 |
| 509 | Ga0495664_0061683 | 3300046477 | Bacteria | 2232 |
| 510 | Ga0495585_0105842 | 3300046492 | Bacteria | 1500 |
| 511 | Ga0495594_0001132 | 3300046499 | Bacteria | 13911 |
| 512 | Ga0495594_0093074 | 3300046499 | Bacteria | 1690 |
| 513 | Ga0495606_0003820 | 3300046507 | Bacteria | 15624 |
| 514 | Ga0495606_0082434 | 3300046507 | Bacteria | 1996 |
| 515 | Ga0495608_0002823 | 3300046511 | Bacteria | 12462 |
| 516 | Ga0495608_0009353 | 3300046511 | Bacteria | 6851 |
| 517 | Ga0495608_0021135 | 3300046511 | Bacteria | 4469 |
| 518 | Ga0495618_0002341 | 3300046514 | Bacteria | 12222 |
| 519 | Ga0495618_0032473 | 3300046514 | Bacteria | 3269 |
| 520 | Ga0495628_0001092 | 3300046516 | Bacteria | 24748 |
| 521 | Ga0495628_0044514 | 3300046516 | Bacteria | 3530 |
| 522 | Ga0495628_0071776 | 3300046516 | Bacteria | 2698 |
| 523 | Ga0495630_0011905 | 3300046517 | Bacteria | 6307 |
| 524 | Ga0495630_0080137 | 3300046517 | Bacteria | 2463 |
| 525 | Ga0495648_0027979 | 3300046524 | Bacteria | 3764 |
| 526 | Ga0495648_0075710 | 3300046524 | Bacteria | 1935 |
| 527 | Ga0495666_0056663 | 3300046526 | Bacteria | 1877 |
| 528 | Ga0495652_0002591 | 3300046529 | Bacteria | 18487 |
| 529 | Ga0495652_0007194 | 3300046529 | Bacteria | 10274 |
| 530 | Ga0495652_0009095 | 3300046529 | Bacteria | 9040 |
| 531 | Ga0495652_0010234 | 3300046529 | Bacteria | 8503 |
| 532 | Ga0495652_0024384 | 3300046529 | Bacteria | 5355 |
| 533 | Ga0495652_0053753 | 3300046529 | Bacteria | 3432 |
| 534 | Ga0495665_0033315 | 3300046531 | Bacteria | 2755 |
| 535 | Ga0495640_0002801 | 3300046533 | Bacteria | 14017 |
| 536 | Ga0495640_0003290 | 3300046533 | Bacteria | 12999 |
| 537 | Ga0495640_0006186 | 3300046533 | Bacteria | 9485 |
| 538 | Ga0495640_0013426 | 3300046533 | Bacteria | 6223 |
| 539 | Ga0495640_0076213 | 3300046533 | Bacteria | 2238 |
| 540 | Ga0495586_0038272 | 3300046535 | Bacteria | 2575 |
| 541 | Ga0495587_0000506 | 3300046536 | Bacteria | 27235 |
| 542 | Ga0495587_0020512 | 3300046536 | Bacteria | 4079 |
| 543 | Ga0495645_0018023 | 3300046543 | Bacteria | 5065 |
| 544 | Ga0495645_0029296 | 3300046543 | Bacteria | 4003 |
| 545 | Ga0495645_0053248 | 3300046543 | Bacteria | 2942 |
| 546 | Ga0495622_0002296 | 3300046557 | Bacteria | 9301 |
| 547 | Ga0495622_0008179 | 3300046557 | Bacteria | 4845 |
| 548 | Ga0495667_0001667 | 3300046559 | Bacteria | 14728 |
| 549 | Ga0495667_0021284 | 3300046559 | Bacteria | 4376 |
| 550 | Ga0495667_0026223 | 3300046559 | Bacteria | 3926 |
| 551 | Ga0495667_0026794 | 3300046559 | Bacteria | 3883 |
| 552 | Ga0495667_0034204 | 3300046559 | Bacteria | 3398 |
| 553 | Ga0495667_0078620 | 3300046559 | Bacteria | 2145 |
| 554 | Ga0495656_0005052 | 3300046615 | Bacteria | 4545 |
| 555 | Ga0495656_0006995 | 3300046615 | Bacteria | 3972 |
| 556 | Ga0495668_0095589 | 3300046616 | Bacteria | 1626 |
| 557 | Ga0495634_0000395 | 3300046642 | Bacteria | 42803 |
| 558 | Ga0495634_0018348 | 3300046642 | Bacteria | 4982 |
| 559 | Ga0495634_0030311 | 3300046642 | Bacteria | 3737 |
| 560 | Ga0495634_0045845 | 3300046642 | Bacteria | 2953 |
| 561 | Ga0495634_0086782 | 3300046642 | Bacteria | 2037 |
| 562 | Ga0495635_0000358 | 3300046663 | Bacteria | 29005 |
| 563 | Ga0495635_0001697 | 3300046663 | Bacteria | 14829 |
| 564 | Ga0495635_0004397 | 3300046663 | Bacteria | 9763 |
| 565 | Ga0495635_0035275 | 3300046663 | Bacteria | 3468 |
| 566 | Ga0495659_0060432 | 3300046664 | Bacteria | 1398 |
| 567 | Ga0495661_0006955 | 3300046665 | Bacteria | 7907 |
| 568 | Ga0495588_0015433 | 3300046674 | Bacteria | 3676 |
| 569 | Ga0495588_0090246 | 3300046674 | Bacteria | 1605 |
| 570 | Ga0495657_0005774 | 3300046675 | Bacteria | 9748 |
| 571 | Ga0495599_0020937 | 3300046678 | Bacteria | 4076 |
| 572 | Ga0495599_0026732 | 3300046678 | Bacteria | 3617 |
| 573 | Ga0495599_0096971 | 3300046678 | Bacteria | 1838 |
| 574 | Ga0495623_0004938 | 3300046679 | Bacteria | 8745 |
| 575 | Ga0495623_0010819 | 3300046679 | Bacteria | 5906 |
| 576 | Ga0495623_0013744 | 3300046679 | Bacteria | 5248 |
| 577 | Ga0495623_0025207 | 3300046679 | Bacteria | 3830 |
| 578 | Ga0495646_0022504 | 3300046680 | Bacteria | 3975 |
| 579 | Ga0495646_0024852 | 3300046680 | Bacteria | 3770 |
| 580 | Ga0495646_0027000 | 3300046680 | Bacteria | 3604 |
| 581 | Ga0495646_0029540 | 3300046680 | Bacteria | 3426 |
| 582 | Ga0495646_0056869 | 3300046680 | Bacteria | 2344 |
| 583 | Ga0495647_0004081 | 3300046681 | Bacteria | 4719 |
| 584 | Ga0495647_0019929 | 3300046681 | Bacteria | 2403 |
| 585 | Ga0495658_0000342 | 3300046683 | Bacteria | 26121 |
| 586 | Ga0495658_0003508 | 3300046683 | Bacteria | 7760 |
| 587 | Ga0495669_0024978 | 3300046684 | Bacteria | 2604 |
| 588 | Ga0495613_0023281 | 3300046689 | Bacteria | 4614 |
| 589 | Ga0495613_0029997 | 3300046689 | Bacteria | 4040 |
| 590 | Ga0495624_0021313 | 3300046690 | Bacteria | 4299 |
| 591 | Ga0495624_0052761 | 3300046690 | Bacteria | 2568 |
| 592 | Ga0495670_0063032 | 3300046691 | Bacteria | 1866 |
| 593 | Ga0495671_0015491 | 3300046692 | Bacteria | 4083 |
| 594 | Ga0495649_0006829 | 3300046694 | Bacteria | 7066 |
| 595 | Ga0495649_0088203 | 3300046694 | Bacteria | 1655 |
| 596 | Ga0495600_0007532 | 3300046809 | Bacteria | 6665 |
| 597 | Ga0495600_0008402 | 3300046809 | Bacteria | 6338 |
| 598 | Ga0495600_0061182 | 3300046809 | Bacteria | 2459 |
| 599 | Ga0495581_0000341 | 3300047315 | Bacteria | 23276 |
| 600 | Ga0495581_0020661 | 3300047315 | Bacteria | 3819 |
| 601 | Ga0495581_0088213 | 3300047315 | Bacteria | 1799 |
| 602 | Ga0495604_0000765 | 3300047317 | Bacteria | 27080 |
| 603 | Ga0495604_0008805 | 3300047317 | Bacteria | 7976 |
| 604 | Ga0495604_0030226 | 3300047317 | Bacteria | 4304 |
| 605 | Ga0495674_0000557 | 3300047319 | Bacteria | 34594 |
| 606 | Ga0495674_0003736 | 3300047319 | Bacteria | 14799 |
| 607 | Ga0495674_0038445 | 3300047319 | Bacteria | 4295 |
| 608 | Ga0495674_0043202 | 3300047319 | Bacteria | 4013 |
| 609 | Ga0495674_0057285 | 3300047319 | Bacteria | 3410 |
| 610 | Ga0495674_0057739 | 3300047319 | Bacteria | 3396 |
| 611 | Ga0495672_0106235 | 3300047320 | Bacteria | 1514 |
| 612 | Ga0495676_0083714 | 3300047321 | Bacteria | 2410 |
| 613 | Ga0495680_0001188 | 3300047322 | Bacteria | 28564 |
| 614 | Ga0495680_0004754 | 3300047322 | Bacteria | 12899 |
| 615 | Ga0495680_0026674 | 3300047322 | Bacteria | 4758 |
| 616 | Ga0495680_0102516 | 3300047322 | Bacteria | 2130 |
| 617 | Ga0495675_0002133 | 3300047444 | Bacteria | 11788 |
| 618 | Ga0495675_0011233 | 3300047444 | Bacteria | 5618 |
| 619 | Ga0495675_0020004 | 3300047444 | Bacteria | 4254 |
| 620 | Ga0495675_0031462 | 3300047444 | Bacteria | 3387 |
| 621 | Ga0495684_0000897 | 3300047471 | Bacteria | 24092 |
| 622 | Ga0495684_0001995 | 3300047471 | Bacteria | 16409 |
| 623 | Ga0495684_0033209 | 3300047471 | Bacteria | 3960 |
| 624 | Ga0495684_0047857 | 3300047471 | Bacteria | 3269 |
| 625 | Ga0495684_0052028 | 3300047471 | Bacteria | 3125 |
| 626 | Ga0495686_0124457 | 3300047472 | Bacteria | 1534 |
| 627 | Ga0495593_0000506 | 3300047673 | Bacteria | 22030 |
| 628 | Ga0495593_0031066 | 3300047673 | Bacteria | 2920 |
| 629 | Ga0495602_0002695 | 3300048088 | Bacteria | 18143 |
| 630 | Ga0495602_0026279 | 3300048088 | Bacteria | 5617 |
| 631 | Ga0495602_0116189 | 3300048088 | Bacteria | 2162 |
| 632 | Ga0495614_0084920 | 3300048089 | Bacteria | 1374 |
| 633 | Ga0496100_0020491 | 3300048903 | Bacteria | 3965 |
| 634 | Ga0496100_0080534 | 3300048903 | Bacteria | 2198 |
| 635 | Ga0496100_0147768 | 3300048903 | Bacteria | 1673 |
| 636 | Ga0496101_0000648 | 3300048904 | Bacteria | 20964 |
| 637 | Ga0496101_0041620 | 3300048904 | Bacteria | 3277 |
| 638 | Ga0496102_0003521 | 3300048905 | Bacteria | 13269 |
| 639 | Ga0496102_0067115 | 3300048905 | Bacteria | 3289 |
| 640 | Ga0496103_0058435 | 3300048906 | Bacteria | 2396 |
| 641 | Ga0496104_0013552 | 3300048907 | Bacteria | 7347 |
| 642 | Ga0496104_0018065 | 3300048907 | Bacteria | 6430 |
| 643 | Ga0496104_0037271 | 3300048907 | Bacteria | 4548 |
| 644 | Ga0496104_0049276 | 3300048907 | Bacteria | 3972 |
| 645 | Ga0496104_0085080 | 3300048907 | Bacteria | 3018 |
| 646 | Ga0496104_0086957 | 3300048907 | Bacteria | 2985 |
| 647 | Ga0496104_0181384 | 3300048907 | Bacteria | 2016 |
| 648 | Ga0496105_0027418 | 3300048908 | Bacteria | 4653 |
| 649 | Ga0496105_0052854 | 3300048908 | Bacteria | 3355 |
| 650 | Ga0496105_0092141 | 3300048908 | Bacteria | 2502 |
| 651 | Ga0496106_0001529 | 3300048909 | Bacteria | 17390 |
| 652 | Ga0496106_0007572 | 3300048909 | Bacteria | 8031 |
| 653 | Ga0496106_0011062 | 3300048909 | Bacteria | 6670 |
| 654 | Ga0496106_0038241 | 3300048909 | Bacteria | 3590 |
| 655 | Ga0496106_0162265 | 3300048909 | Bacteria | 1768 |
| 656 | Ga0496106_0202157 | 3300048909 | Bacteria | 1581 |
| 657 | Ga0496107_0004714 | 3300048910 | Bacteria | 9266 |
| 658 | Ga0496107_0045648 | 3300048910 | Bacteria | 3152 |
| 659 | Ga0496107_0067639 | 3300048910 | Bacteria | 2592 |
| 660 | Ga0496108_0000764 | 3300048911 | Bacteria | 25051 |
| 661 | Ga0496108_0033486 | 3300048911 | Bacteria | 4269 |
| 662 | Ga0496108_0067856 | 3300048911 | Bacteria | 3008 |
| 663 | Ga0496108_0200627 | 3300048911 | Bacteria | 1731 |
| 664 | Ga0496109_0002732 | 3300048912 | Bacteria | 14794 |
| 665 | Ga0496109_0004357 | 3300048912 | Bacteria | 11828 |
| 666 | Ga0496109_0206856 | 3300048912 | Bacteria | 1845 |
| 667 | Ga0496110_0002562 | 3300048913 | Bacteria | 13666 |
| 668 | Ga0496110_0003472 | 3300048913 | Bacteria | 12087 |
| 669 | Ga0496110_0026093 | 3300048913 | Bacteria | 4996 |
| 670 | Ga0496110_0096309 | 3300048913 | Bacteria | 2652 |
| 671 | Ga0496110_0112586 | 3300048913 | Bacteria | 2447 |
| 672 | Ga0496110_0266767 | 3300048913 | Bacteria | 1559 |
| 673 | Ga0496110_0327938 | 3300048913 | Bacteria | 1394 |
| 674 | Ga0496111_0001360 | 3300048914 | Bacteria | 13842 |
| 675 | Ga0496111_0003253 | 3300048914 | Bacteria | 10031 |
| 676 | Ga0496112_0000031 | 3300048915 | Bacteria | 120022 |
| 677 | Ga0496112_0004915 | 3300048915 | Bacteria | 11438 |
| 678 | Ga0496112_0004941 | 3300048915 | Bacteria | 11417 |
| 679 | Ga0496112_0008448 | 3300048915 | Bacteria | 9225 |
| 680 | Ga0496112_0041116 | 3300048915 | Bacteria | 4522 |
| 681 | Ga0496112_0069229 | 3300048915 | Bacteria | 3486 |
| 682 | Ga0496112_0075336 | 3300048915 | Bacteria | 3337 |
| 683 | Ga0496112_0179492 | 3300048915 | Bacteria | 2081 |
| 684 | Ga0496113_0001977 | 3300048916 | Bacteria | 11748 |
| 685 | Ga0496113_0047075 | 3300048916 | Bacteria | 3204 |
| 686 | Ga0496113_0050949 | 3300048916 | Bacteria | 3088 |
| 687 | Ga0496114_0009865 | 3300048917 | Bacteria | 7589 |
| 688 | Ga0496114_0151894 | 3300048917 | Bacteria | 2009 |
| 689 | Ga0496114_0230589 | 3300048917 | Bacteria | 1627 |
| 690 | Ga0496115_0009797 | 3300048918 | Bacteria | 7135 |
| 691 | Ga0496115_0073197 | 3300048918 | Bacteria | 2781 |
| 692 | Ga0496115_0083531 | 3300048918 | Bacteria | 2603 |
| 693 | Ga0496115_0094179 | 3300048918 | Bacteria | 2450 |
| 694 | Ga0496115_0116827 | 3300048918 | Bacteria | 2194 |
| 695 | Ga0496115_0118715 | 3300048918 | Bacteria | 2175 |
| 696 | Ga0496116_0014153 | 3300048919 | Bacteria | 6385 |
| 697 | Ga0496117_0000060 | 3300048920 | Bacteria | 258500 |
| 698 | Ga0496117_0009844 | 3300048920 | Bacteria | 8805 |
| 699 | Ga0496117_0034745 | 3300048920 | Bacteria | 3794 |
| 700 | Ga0496117_0071857 | 3300048920 | Bacteria | 2316 |
| 701 | Ga0496117_0159220 | 3300048920 | Bacteria | 1325 |
| 702 | Ga0496118_0005918 | 3300048921 | Bacteria | 13679 |
| 703 | Ga0496118_0013173 | 3300048921 | Bacteria | 7845 |
| 704 | Ga0496118_0040100 | 3300048921 | Bacteria | 3727 |
| 705 | Ga0496118_0058734 | 3300048921 | Bacteria | 2871 |
| 706 | Ga0496118_0121500 | 3300048921 | Bacteria | 1701 |
| 707 | Ga0496118_0146433 | 3300048921 | Bacteria | 1486 |
| 708 | Ga0496119_0028655 | 3300048922 | Bacteria | 3794 |
| 709 | Ga0496120_0014815 | 3300048923 | Bacteria | 5173 |
| 710 | Ga0496121_0000406 | 3300048924 | Bacteria | 85761 |
| 711 | Ga0496121_0000769 | 3300048924 | Bacteria | 58817 |
| 712 | Ga0496121_0002143 | 3300048924 | Bacteria | 30998 |
| 713 | Ga0496121_0012483 | 3300048924 | Bacteria | 9252 |
| 714 | Ga0496121_0027061 | 3300048924 | Bacteria | 5377 |
| 715 | Ga0496121_0068500 | 3300048924 | Bacteria | 2870 |
| 716 | Ga0496121_0077208 | 3300048924 | Bacteria | 2653 |
| 717 | Ga0496121_0110766 | 3300048924 | Bacteria | 2094 |
| 718 | Ga0496122_0040920 | 3300048925 | Bacteria | 3674 |
| 719 | Ga0496122_0042875 | 3300048925 | Bacteria | 3553 |
| 720 | Ga0496123_0066540 | 3300048926 | Bacteria | 2282 |
| 721 | Ga0496124_0002534 | 3300048927 | Bacteria | 23718 |
| 722 | Ga0496124_0044466 | 3300048927 | Bacteria | 3810 |
| 723 | Ga0496124_0221418 | 3300048927 | Bacteria | 1423 |
| 724 | Ga0496125_0003938 | 3300048928 | Bacteria | 17519 |
| 725 | Ga0496125_0003990 | 3300048928 | Bacteria | 17353 |
| 726 | Ga0496125_0028546 | 3300048928 | Bacteria | 5036 |
| 727 | Ga0496125_0064486 | 3300048928 | Bacteria | 2910 |
| 728 | Ga0496126_0010317 | 3300048929 | Bacteria | 9806 |
| 729 | Ga0496126_0034185 | 3300048929 | Bacteria | 4776 |
| 730 | Ga0496126_0051661 | 3300048929 | Bacteria | 3740 |
| 731 | Ga0496126_0095509 | 3300048929 | Bacteria | 2607 |
| 732 | Ga0496126_0161425 | 3300048929 | Bacteria | 1915 |
| 733 | Ga0496126_0172382 | 3300048929 | Bacteria | 1842 |
| 734 | Ga0496126_0234903 | 3300048929 | Bacteria | 1534 |
| 735 | Ga0496126_0242983 | 3300048929 | Bacteria | 1503 |
| 736 | Ga0496126_0268889 | 3300048929 | Bacteria | 1415 |
| 737 | Ga0501305_001889 | 3300049161 | Bacteria | 2155 |
| 738 | Ga0501305_003735 | 3300049161 | Bacteria | 1745 |
| 739 | Ga0495682_0013780 | 3300049460 | Bacteria | 3073 |
| 740 | Ga0501312_000418 | 3300049528 | Bacteria | 3357 |
| 741 | Ga0501312_002551 | 3300049528 | Bacteria | 1975 |
| 742 | Ga0501317_001504 | 3300049533 | Bacteria | 2020 |
| 743 | Ga0501031_0000207 | 3300049568 | Bacteria | 33573 |
| 744 | Ga0501031_0115929 | 3300049568 | Bacteria | 1750 |
| 745 | Ga0501032_0000189 | 3300049569 | Bacteria | 50924 |
| 746 | Ga0501032_0000252 | 3300049569 | Bacteria | 44619 |
| 747 | Ga0501032_0002406 | 3300049569 | Bacteria | 14591 |
| 748 | Ga0501032_0055999 | 3300049569 | Bacteria | 2652 |
| 749 | Ga0501033_0000082 | 3300049570 | Bacteria | 89837 |
| 750 | Ga0501033_0000493 | 3300049570 | Bacteria | 37227 |
| 751 | Ga0501033_0038099 | 3300049570 | Bacteria | 3597 |
| 752 | Ga0501033_0211862 | 3300049570 | Bacteria | 1381 |
| 753 | Ga0501034_0018545 | 3300049571 | Bacteria | 7132 |
| 754 | Ga0501034_0022592 | 3300049571 | Bacteria | 6409 |
| 755 | Ga0501034_0047258 | 3300049571 | Bacteria | 4347 |
| 756 | Ga0501036_0000134 | 3300049572 | Bacteria | 47683 |
| 757 | Ga0501036_0016378 | 3300049572 | Bacteria | 6192 |
| 758 | Ga0501036_0254508 | 3300049572 | Bacteria | 1471 |
| 759 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 760 | Ga0501037_0002190 | 3300049573 | Bacteria | 14128 |
| 761 | Ga0501037_0002324 | 3300049573 | Bacteria | 13742 |
| 762 | Ga0501037_0005438 | 3300049573 | Bacteria | 9278 |
| 763 | Ga0501038_0002725 | 3300049574 | Bacteria | 16472 |
| 764 | Ga0501038_0010145 | 3300049574 | Bacteria | 8622 |
| 765 | Ga0501038_0010211 | 3300049574 | Bacteria | 8593 |
| 766 | Ga0501038_0110841 | 3300049574 | Bacteria | 2274 |
| 767 | Ga0501038_0136765 | 3300049574 | Bacteria | 2007 |
| 768 | Ga0501039_0000064 | 3300049575 | Bacteria | 83415 |
| 769 | Ga0501039_0000123 | 3300049575 | Bacteria | 53579 |
| 770 | Ga0501039_0004985 | 3300049575 | Bacteria | 10074 |
| 771 | Ga0501039_0041161 | 3300049575 | Bacteria | 3568 |
| 772 | Ga0501039_0061672 | 3300049575 | Bacteria | 2904 |
| 773 | Ga0501039_0142212 | 3300049575 | Bacteria | 1885 |
| 774 | Ga0501040_0010754 | 3300049576 | Bacteria | 5984 |
| 775 | Ga0501041_0006153 | 3300049577 | Bacteria | 7013 |
| 776 | Ga0501041_0109994 | 3300049577 | Bacteria | 1709 |
| 777 | Ga0501042_0007944 | 3300049578 | Bacteria | 6979 |
| 778 | Ga0501042_0010034 | 3300049578 | Bacteria | 6332 |
| 779 | Ga0501042_0016034 | 3300049578 | Bacteria | 5140 |
| 780 | Ga0501042_0028604 | 3300049578 | Bacteria | 3929 |
| 781 | Ga0501042_0032220 | 3300049578 | Bacteria | 3711 |
| 782 | Ga0501043_0000999 | 3300049579 | Bacteria | 24883 |
| 783 | Ga0501043_0007904 | 3300049579 | Bacteria | 8406 |
| 784 | Ga0501043_0010418 | 3300049579 | Bacteria | 7283 |
| 785 | Ga0501043_0108403 | 3300049579 | Bacteria | 2181 |
| 786 | Ga0501046_0000434 | 3300049580 | Bacteria | 41950 |
| 787 | Ga0501046_0012628 | 3300049580 | Bacteria | 7181 |
| 788 | Ga0501047_0000131 | 3300049581 | Bacteria | 91079 |
| 789 | Ga0501047_0000866 | 3300049581 | Bacteria | 30920 |
| 790 | Ga0501048_0002325 | 3300049582 | Bacteria | 14503 |
| 791 | Ga0501048_0010161 | 3300049582 | Bacteria | 7041 |
| 792 | Ga0501048_0012442 | 3300049582 | Bacteria | 6330 |
| 793 | Ga0501067_0000628 | 3300049583 | Bacteria | 18974 |
| 794 | Ga0501067_0007650 | 3300049583 | Bacteria | 6007 |
| 795 | Ga0501068_0000080 | 3300049584 | Bacteria | 39376 |
| 796 | Ga0501068_0008999 | 3300049584 | Bacteria | 5572 |
| 797 | Ga0501068_0057044 | 3300049584 | Bacteria | 2367 |
| 798 | Ga0501069_0002904 | 3300049585 | Bacteria | 8802 |
| 799 | Ga0501069_0029899 | 3300049585 | Bacteria | 2990 |
| 800 | Ga0501069_0054403 | 3300049585 | Bacteria | 2229 |
| 801 | Ga0501070_0000209 | 3300049586 | Bacteria | 55271 |
| 802 | Ga0501070_0004437 | 3300049586 | Bacteria | 12052 |
| 803 | Ga0501070_0025205 | 3300049586 | Bacteria | 4987 |
| 804 | Ga0501070_0027934 | 3300049586 | Bacteria | 4733 |
| 805 | Ga0501070_0143436 | 3300049586 | Bacteria | 1972 |
| 806 | Ga0501071_0008177 | 3300049587 | Bacteria | 6902 |
| 807 | Ga0501071_0008392 | 3300049587 | Bacteria | 6826 |
| 808 | Ga0501071_0033785 | 3300049587 | Bacteria | 3635 |
| 809 | Ga0501071_0120488 | 3300049587 | Bacteria | 1944 |
| 810 | Ga0501071_0172348 | 3300049587 | Bacteria | 1620 |
| 811 | Ga0501072_0000378 | 3300049588 | Bacteria | 31856 |
| 812 | Ga0501072_0001448 | 3300049588 | Bacteria | 17791 |
| 813 | Ga0501072_0015136 | 3300049588 | Bacteria | 5915 |
| 814 | Ga0501073_0000062 | 3300049589 | Bacteria | 66884 |
| 815 | Ga0501073_0014131 | 3300049589 | Bacteria | 5798 |
| 816 | Ga0501073_0051826 | 3300049589 | Bacteria | 2874 |
| 817 | Ga0501074_0000642 | 3300049590 | Bacteria | 21686 |
| 818 | Ga0501074_0002216 | 3300049590 | Bacteria | 13485 |
| 819 | Ga0501075_0005258 | 3300049591 | Bacteria | 8849 |
| 820 | Ga0501075_0076901 | 3300049591 | Bacteria | 2525 |
| 821 | Ga0501075_0122453 | 3300049591 | Bacteria | 1980 |
| 822 | Ga0501076_0017280 | 3300049592 | Bacteria | 5480 |
| 823 | Ga0501076_0024246 | 3300049592 | Bacteria | 4687 |
| 824 | Ga0501076_0183263 | 3300049592 | Bacteria | 1707 |
| 825 | Ga0501076_0228976 | 3300049592 | Bacteria | 1519 |
| 826 | Ga0501077_0004743 | 3300049593 | Bacteria | 8266 |
| 827 | Ga0501077_0040966 | 3300049593 | Bacteria | 2949 |
| 828 | Ga0501077_0075708 | 3300049593 | Bacteria | 2131 |
| 829 | Ga0501079_0006018 | 3300049741 | Bacteria | 9088 |
| 830 | Ga0501079_0016419 | 3300049741 | Bacteria | 5653 |
| 831 | Ga0501079_0031135 | 3300049741 | Bacteria | 4100 |
| 832 | Ga0501079_0131467 | 3300049741 | Bacteria | 1948 |
| 833 | Ga0501079_0177568 | 3300049741 | Bacteria | 1661 |
| 834 | Ga0501080_0000200 | 3300049742 | Bacteria | 44051 |
| 835 | Ga0501080_0012893 | 3300049742 | Bacteria | 7671 |
| 836 | Ga0501080_0037072 | 3300049742 | Bacteria | 4552 |
| 837 | Ga0501080_0043316 | 3300049742 | Bacteria | 4192 |
| 838 | Ga0501080_0048542 | 3300049742 | Bacteria | 3951 |
| 839 | Ga0501080_0185967 | 3300049742 | Bacteria | 1910 |
| 840 | Ga0501081_0003080 | 3300049743 | Bacteria | 10587 |
| 841 | Ga0501081_0100683 | 3300049743 | Bacteria | 2042 |
| 842 | Ga0501083_0000199 | 3300049744 | Bacteria | 38479 |
| 843 | Ga0501083_0000628 | 3300049744 | Bacteria | 22814 |
| 844 | Ga0501083_0007134 | 3300049744 | Bacteria | 7935 |
| 845 | Ga0501035_0000123 | 3300049822 | Bacteria | 93734 |
| 846 | Ga0501035_0000598 | 3300049822 | Bacteria | 39723 |
| 847 | Ga0501035_0039684 | 3300049822 | Bacteria | 4259 |
| 848 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 849 | Ga0501044_0000887 | 3300049823 | Bacteria | 36069 |
| 850 | Ga0501044_0009069 | 3300049823 | Bacteria | 10872 |
| 851 | Ga0501044_0021553 | 3300049823 | Bacteria | 6871 |
| 852 | Ga0501044_0042937 | 3300049823 | Bacteria | 4699 |
| 853 | Ga0501045_0001526 | 3300049824 | Bacteria | 15418 |
| 854 | Ga0501045_0009596 | 3300049824 | Bacteria | 6774 |
| 855 | Ga0501045_0036173 | 3300049824 | Bacteria | 3585 |
| 856 | nmdc:mga03683_25957_c2 | 3300050489 | Bacteria | 1924 |
| 857 | nmdc:mga03n38_54330_c1 | 3300050490 | Bacteria | 1800 |
| 858 | nmdc:mga03n38_748_c1 | 3300050490 | Bacteria | 8589 |
| 859 | nmdc:mga00v17_3459_c1 | 3300050491 | Bacteria | 8171 |
| 860 | nmdc:mga0yw44_17358_c1 | 3300050492 | Bacteria | 3915 |
| 861 | nmdc:mga0yw44_4498_c1 | 3300050492 | Bacteria | 6406 |
| 862 | nmdc:mga0yw44_49835_c1 | 3300050492 | Bacteria | 2529 |
| 863 | nmdc:mga0yw44_89146_c1 | 3300050492 | Bacteria | 1946 |
| 864 | nmdc:mga06z11_205_c1 | 3300050494 | Bacteria | 23665 |
| 865 | nmdc:mga06z11_27492_c1 | 3300050494 | Bacteria | 2719 |
| 866 | nmdc:mga06z11_53356_c1 | 3300050494 | Bacteria | 2079 |
| 867 | nmdc:mga06z11_6231_c1 | 3300050494 | Bacteria | 4834 |
| 868 | nmdc:mga06z11_62408_c1 | 3300050494 | Bacteria | 1947 |
| 869 | nmdc:mga06z11_80691_c1 | 3300050494 | Bacteria | 1745 |
| 870 | nmdc:mga04h51_644_c1 | 3300050495 | Bacteria | 8168 |
| 871 | nmdc:mga07m45_25150_c2 | 3300050496 | Bacteria | 2481 |
| 872 | nmdc:mga07m45_2788_c1 | 3300050496 | Bacteria | 8259 |
| 873 | nmdc:mga05p37_120614_c1 | 3300050507 | Bacteria | 3221 |
| 874 | nmdc:mga05p37_165152_c1 | 3300050507 | Bacteria | 2702 |
| 875 | nmdc:mga06r32_4688_c1 | 3300050510 | Bacteria | 12278 |
| 876 | nmdc:mga08y16_371938_c1 | 3300050511 | Bacteria | 1466 |
| 877 | nmdc:mga08y16_53082_c1 | 3300050511 | Bacteria | 4240 |
| 878 | nmdc:mga0n895_11688_c1 | 3300050512 | Bacteria | 7845 |
| 879 | nmdc:mga0n895_33987_c1 | 3300050512 | Bacteria | 4904 |
| 880 | nmdc:mga0rr50_32064_c1 | 3300050513 | Bacteria | 3739 |
| 881 | nmdc:mga0rr50_85747_c1 | 3300050513 | Bacteria | 2441 |
| 882 | nmdc:mga0a205_3751_c1 | 3300050515 | Bacteria | 13606 |
| 883 | nmdc:mga0sz30_13068_c1 | 3300050516 | Bacteria | 3244 |
| 884 | Ga0495601_0000848 | 3300053077 | Bacteria | 16636 |
| 885 | Ga0495601_0069785 | 3300053077 | Bacteria | 2241 |
| 886 | Ga0495612_0014423 | 3300053078 | Bacteria | 3178 |
| 887 | Ga0495612_0015990 | 3300053078 | Bacteria | 3007 |
| 888 | Ga0495595_0002544 | 3300053084 | Bacteria | 7157 |
| 889 | Ga0495595_0005739 | 3300053084 | Bacteria | 5027 |
| 890 | Ga0495595_0013241 | 3300053084 | Bacteria | 3482 |
| 891 | Ga0495619_0000858 | 3300053085 | Bacteria | 19930 |
| 892 | Ga0495619_0006701 | 3300053085 | Bacteria | 7286 |
| 893 | Ga0500578_0043292 | 3300053086 | Bacteria | 2890 |
| 894 | Ga0500578_0045031 | 3300053086 | Bacteria | 2832 |
| 895 | Ga0500643_000111 | 3300053087 | Bacteria | 85038 |
| 896 | Ga0500651_0005693 | 3300053093 | Bacteria | 7135 |
| 897 | Ga0500651_0030707 | 3300053093 | Bacteria | 3382 |
| 898 | Ga0500566_0010251 | 3300053094 | Bacteria | 5525 |
| 899 | Ga0500566_0019553 | 3300053094 | Bacteria | 3976 |
| 900 | Ga0500566_0040898 | 3300053094 | Bacteria | 2679 |
| 901 | Ga0500641_0027912 | 3300053096 | Bacteria | 2200 |
| 902 | Ga0500650_0000250 | 3300053098 | Bacteria | 13119 |
| 903 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 904 | Ga0500557_000034 | 3300053105 | Bacteria | 71225 |
| 905 | Ga0500569_012555 | 3300053109 | Bacteria | 2052 |
| 906 | Ga0500572_000023 | 3300053111 | Bacteria | 47431 |
| 907 | Ga0500594_0018699 | 3300053118 | Bacteria | 1710 |
| 908 | Ga0500595_011567 | 3300053119 | Bacteria | 3446 |
| 909 | Ga0500595_014895 | 3300053119 | Bacteria | 2937 |
| 910 | Ga0500595_031747 | 3300053119 | Bacteria | 1769 |
| 911 | Ga0500607_039743 | 3300053121 | Bacteria | 2552 |
| 912 | Ga0500608_006686 | 3300053122 | Bacteria | 4716 |
| 913 | Ga0500618_010201 | 3300053125 | Bacteria | 2527 |
| 914 | Ga0500642_0000053 | 3300053130 | Bacteria | 71632 |
| 915 | Ga0500642_0000175 | 3300053130 | Bacteria | 26632 |
| 916 | Ga0500642_0016179 | 3300053130 | Bacteria | 2826 |
| 917 | Ga0500642_0025114 | 3300053130 | Bacteria | 2417 |
| 918 | Ga0500652_000441 | 3300053131 | Bacteria | 14718 |
| 919 | Ga0500658_0065659 | 3300053134 | Bacteria | 1520 |
| 920 | Ga0500559_0000146 | 3300053136 | Bacteria | 55375 |
| 921 | Ga0500559_0001416 | 3300053136 | Bacteria | 13619 |
| 922 | Ga0500559_0024210 | 3300053136 | Bacteria | 2581 |
| 923 | Ga0500568_0000733 | 3300053139 | Bacteria | 23549 |
| 924 | Ga0500568_0005060 | 3300053139 | Bacteria | 6905 |
| 925 | Ga0500568_0015018 | 3300053139 | Bacteria | 3475 |
| 926 | Ga0500590_022753 | 3300053148 | Bacteria | 3256 |
| 927 | Ga0500603_006653 | 3300053150 | Bacteria | 2517 |
| 928 | Ga0500604_0002553 | 3300053151 | Bacteria | 4966 |
| 929 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 930 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 931 | Ga0500622_0001837 | 3300053156 | Bacteria | 16081 |
| 932 | Ga0500622_0028058 | 3300053156 | Bacteria | 2964 |
| 933 | Ga0500622_0051363 | 3300053156 | Bacteria | 2122 |
| 934 | Ga0500634_0054221 | 3300053161 | Bacteria | 2149 |
| 935 | Ga0500638_002809 | 3300053162 | Bacteria | 6234 |
| 936 | Ga0500638_091226 | 3300053162 | Bacteria | 1434 |
| 937 | Ga0500636_0000033 | 3300053177 | Bacteria | 72990 |
| 938 | Ga0500636_0002841 | 3300053177 | Bacteria | 9666 |
| 939 | Ga0500636_0045999 | 3300053177 | Bacteria | 2573 |
| 940 | Ga0500637_0000026 | 3300053178 | Bacteria | 59050 |
| 941 | Ga0500637_0001578 | 3300053178 | Bacteria | 9754 |
| 942 | Ga0500625_001985 | 3300053729 | Bacteria | 7415 |
| 943 | Ga0500645_017807 | 3300053730 | Bacteria | 2223 |
| 944 | Ga0500596_001715 | 3300053735 | Bacteria | 4441 |
| 945 | Ga0500599_001352 | 3300053736 | Bacteria | 2801 |
| 946 | Ga0500601_000010 | 3300053737 | Bacteria | 45442 |
| 947 | Ga0501084_0004920 | 3300054114 | Bacteria | 10915 |
| 948 | Ga0501084_0026729 | 3300054114 | Bacteria | 4819 |
| 949 | Ga0501084_0043563 | 3300054114 | Bacteria | 3754 |
| 950 | Ga0501084_0073591 | 3300054114 | Bacteria | 2861 |
| 951 | Ga0501084_0193228 | 3300054114 | Bacteria | 1717 |
| 952 | Ga0501082_0011691 | 3300060353 | Bacteria | 7547 |
| 953 | Ga0501082_0011762 | 3300060353 | Bacteria | 7522 |
| 954 | Ga0501082_0020282 | 3300060353 | Bacteria | 5730 |
| 955 | Ga0501082_0028999 | 3300060353 | Bacteria | 4767 |
| 956 | Ga0501082_0037072 | 3300060353 | Bacteria | 4201 |
| 957 | Ga0530510_0009156 | 3300061734 | Bacteria | 6938 |
| 958 | Ga0530510_0120930 | 3300061734 | Bacteria | 1922 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006186 | Ga0075369_10035959 | Ga0075369_100359592 | 368 |
| 2 | 3300005563 | Ga0068855_100008028 | Ga0068855_1000080286 | 380 |
| 3 | 3300049575 | Ga0501039_0041161 | Ga0501039_0041161_362_1591 | 387 |
| 4 | 3300049578 | Ga0501042_0032220 | Ga0501042_0032220_1755_2984 | 387 |
| 5 | 3300049592 | Ga0501076_0228976 | Ga0501076_0228976_214_1443 | 387 |
| 6 | 3300061734 | Ga0530510_0009156 | Ga0530510_0009156_4730_5959 | 387 |
| 7 | 3300021384 | Ga0213876_10010761 | Ga0213876_100107611 | 393 |
| 8 | 3300039437 | Ga0436365_0129589 | Ga0436365_0129589_1464_2714 | 393 |
| 9 | 3300035695 | Ga0373927_0197595 | Ga0373927_0197595_117_1301 | 394 |
| 10 | 3300035725 | Ga0373947_0042387 | Ga0373947_0042387_37_1221 | 394 |
| 11 | 3300048920 | Ga0496117_0159220 | Ga0496117_0159220_112_1296 | 394 |
| 12 | 3300048921 | Ga0496118_0121500 | Ga0496118_0121500_18_1202 | 394 |
| 13 | 3300048929 | Ga0496126_0242983 | Ga0496126_0242983_309_1493 | 394 |
| 14 | 3300050490 | nmdc:mga03n38_748_c1 | nmdc:mga03n38_748_c1_7353_8537 | 394 |
| 15 | 3300050507 | nmdc:mga05p37_165152_c1 | nmdc:mga05p37_165152_c1_15_1199 | 394 |
| 16 | 3300005471 | Ga0070698_100104941 | Ga0070698_1001049413 | 401 |
| 17 | 3300049570 | Ga0501033_0038099 | Ga0501033_0038099_1313_2521 | 402 |
| 18 | 3300049572 | Ga0501036_0016378 | Ga0501036_0016378_2998_4206 | 402 |
| 19 | 3300049573 | Ga0501037_0005438 | Ga0501037_0005438_294_1502 | 402 |
| 20 | 3300049577 | Ga0501041_0006153 | Ga0501041_0006153_1309_2517 | 402 |
| 21 | 3300049580 | Ga0501046_0012628 | Ga0501046_0012628_3045_4253 | 402 |
| 22 | 3300049582 | Ga0501048_0012442 | Ga0501048_0012442_1741_2949 | 402 |
| 23 | 3300049588 | Ga0501072_0001448 | Ga0501072_0001448_1087_2295 | 402 |
| 24 | 3300049743 | Ga0501081_0100683 | Ga0501081_0100683_395_1603 | 402 |
| 25 | 3300054114 | Ga0501084_0004920 | Ga0501084_0004920_8100_9308 | 402 |
| 26 | 3300031595 | Ga0265313_10001452 | Ga0265313_100014528 | 405 |
| 27 | 3300044673 | Ga0453683_0095084 | Ga0453683_0095084_360_1640 | 406 |
| 28 | 3300044712 | Ga0453684_0011035 | Ga0453684_0011035_3935_5227 | 406 |
| 29 | 3300046477 | Ga0495664_0001728 | Ga0495664_0001728_8031_9251 | 406 |
| 30 | 3300006028 | Ga0070717_10028344 | Ga0070717_100283441 | 408 |
| 31 | 3300005434 | Ga0070709_10021201 | Ga0070709_100212011 | 409 |
| 32 | 3300026116 | Ga0207674_10121292 | Ga0207674_101212922 | 409 |
| 33 | 3300035116 | Ga0373945_0044837 | Ga0373945_0044837_366_1595 | 409 |
| 34 | 3300048929 | Ga0496126_0172382 | Ga0496126_0172382_220_1515 | 411 |
| 35 | 3300005434 | Ga0070709_10000734 | Ga0070709_100007347 | 412 |
| 36 | 3300005435 | Ga0070714_100000556 | Ga0070714_10000055621 | 412 |
| 37 | 3300005437 | Ga0070710_10001203 | Ga0070710_100012036 | 412 |
| 38 | 3300005439 | Ga0070711_100000989 | Ga0070711_1000009896 | 412 |
| 39 | 3300006173 | Ga0070716_100005650 | Ga0070716_1000056506 | 412 |
| 40 | 3300006175 | Ga0070712_100024322 | Ga0070712_1000243223 | 412 |
| 41 | 3300025898 | Ga0207692_10002111 | Ga0207692_100021116 | 412 |
| 42 | 3300025906 | Ga0207699_10014465 | Ga0207699_100144653 | 412 |
| 43 | 3300025915 | Ga0207693_10033960 | Ga0207693_100339604 | 412 |
| 44 | 3300025916 | Ga0207663_10010667 | Ga0207663_100106675 | 412 |
| 45 | 3300025928 | Ga0207700_10004770 | Ga0207700_100047701 | 412 |
| 46 | 3300025939 | Ga0207665_10005463 | Ga0207665_100054633 | 412 |
| 47 | 3300048929 | Ga0496126_0234903 | Ga0496126_0234903_95_1390 | 412 |
| 48 | 3300032002 | Ga0307416_100257244 | Ga0307416_1002572442 | 413 |
| 49 | 3300037418 | Ga0395900_0041755 | Ga0395900_0041755_1899_3194 | 413 |
| 50 | 3300037466 | Ga0395898_0139419 | Ga0395898_0139419_981_2276 | 413 |
| 51 | iso_pu_bacteria | 8019608314 | 8019612890 | 413 |
| 52 | 3300009093 | Ga0105240_10402852 | Ga0105240_104028522 | 415 |
| 53 | 3300013104 | Ga0157370_10119024 | Ga0157370_101190242 | 415 |
| 54 | 3300013105 | Ga0157369_10021176 | Ga0157369_100211763 | 415 |
| 55 | 3300025904 | Ga0207647_10036925 | Ga0207647_100369253 | 415 |
| 56 | 3300025913 | Ga0207695_10135448 | Ga0207695_101354482 | 415 |
| 57 | 3300026116 | Ga0207674_10090075 | Ga0207674_100900752 | 415 |
| 58 | 3300031711 | Ga0265314_10021427 | Ga0265314_100214273 | 415 |
| 59 | 3300031712 | Ga0265342_10012872 | Ga0265342_100128721 | 415 |
| 60 | 3300036647 | Ga0316582_0042720 | Ga0316582_0042720_133_1425 | 415 |
| 61 | 3300053139 | Ga0500568_0005060 | Ga0500568_0005060_2800_4092 | 415 |
| 62 | 3300031727 | Ga0316576_10013900 | Ga0316576_100139004 | 417 |
| 63 | 3300035398 | Ga0316574_0077273 | Ga0316574_0077273_779_2074 | 417 |
| 64 | 3300047471 | Ga0495684_0047857 | Ga0495684_0047857_1452_2705 | 417 |
| 65 | 3300049577 | Ga0501041_0109994 | Ga0501041_0109994_26_1393 | 419 |
| 66 | 3300049578 | Ga0501042_0016034 | Ga0501042_0016034_1832_3199 | 419 |
| 67 | 3300049593 | Ga0501077_0040966 | Ga0501077_0040966_707_2074 | 419 |
| 68 | 3300049824 | Ga0501045_0036173 | Ga0501045_0036173_1495_2862 | 419 |
| 69 | 3300060353 | Ga0501082_0037072 | Ga0501082_0037072_1871_3238 | 419 |
| 70 | 3300025912 | Ga0207707_10095500 | Ga0207707_100955002 | 420 |
| 71 | 3300025921 | Ga0207652_10014815 | Ga0207652_100148153 | 420 |
| 72 | 3300005535 | Ga0070684_100002394 | Ga0070684_1000023943 | 421 |
| 73 | 3300025944 | Ga0207661_10001422 | Ga0207661_1000142212 | 421 |
| 74 | 3300049161 | Ga0501305_003735 | Ga0501305_003735_47_1363 | 421 |
| 75 | 3300049533 | Ga0501317_001504 | Ga0501317_001504_220_1536 | 421 |
| 76 | iso_pu_bacteria | 2939615513 | 2939616628 | 421 |
| 77 | 3300006846 | Ga0075430_100125794 | Ga0075430_1001257942 | 423 |
| 78 | 3300031824 | Ga0307413_10037981 | Ga0307413_100379812 | 423 |
| 79 | 3300049586 | Ga0501070_0027934 | Ga0501070_0027934_2222_3517 | 423 |
| 80 | 3300049586 | Ga0501070_0143436 | Ga0501070_0143436_393_1667 | 423 |
| 81 | 3300014325 | Ga0163163_10127689 | Ga0163163_101276893 | 424 |
| 82 | 3300039447 | Ga0436361_0731125 | Ga0436361_0731125_7868_9181 | 424 |
| 83 | iso_pu_bacteria | 2671180330 | 2672338434 | 424 |
| 84 | iso_pu_bacteria | 2816332186 | 2816865638 | 424 |
| 85 | iso_pu_bacteria | 2842682962 | 2842686398 | 424 |
| 86 | iso_pu_bacteria | 2849139964 | 2849143271 | 424 |
| 87 | iso_pu_bacteria | 2857581216 | 2857583437 | 424 |
| 88 | 3300048920 | Ga0496117_0000060 | Ga0496117_0000060_197901_199181 | 425 |
| 89 | iso_pu_bacteria | 8054280661 | 8054282554 | 425 |
| 90 | 3300038725 | Ga0400484_04880 | Ga0400484_04880_2824_4122 | 427 |
| 91 | iso_pu_bacteria | 2507262055 | 2507504589 | 427 |
| 92 | iso_pu_bacteria | 2508501009 | 2508546017 | 427 |
| 93 | iso_pu_bacteria | 2508501042 | 2508694864 | 427 |
| 94 | iso_pu_bacteria | 2508501128 | 2509149855 | 427 |
| 95 | iso_pu_bacteria | 2511231028 | 2511393401 | 427 |
| 96 | iso_pu_bacteria | 2513237092 | 2513626546 | 427 |
| 97 | iso_pu_bacteria | 2513237094 | 2513638457 | 427 |
| 98 | iso_pu_bacteria | 2513237095 | 2513649369 | 427 |
| 99 | iso_pu_bacteria | 2513237096 | 2513657160 | 427 |
| 100 | iso_pu_bacteria | 2513237098 | 2513674050 | 427 |
| 101 | iso_pu_bacteria | 2513237101 | 2513693746 | 427 |
| 102 | iso_pu_bacteria | 2513237102 | 2513699385 | 427 |
| 103 | iso_pu_bacteria | 2513237104 | 2513714758 | 427 |
| 104 | iso_pu_bacteria | 2513237137 | 2513863154 | 427 |
| 105 | iso_pu_bacteria | 2513237139 | 2513875566 | 427 |
| 106 | iso_pu_bacteria | 2513237141 | 2513889846 | 427 |
| 107 | iso_pu_bacteria | 2513237145 | 2513919168 | 427 |
| 108 | iso_pu_bacteria | 2513237161 | 2514011043 | 427 |
| 109 | iso_pu_bacteria | 2515154112 | 2515624203 | 427 |
| 110 | iso_pu_bacteria | 2517093001 | 2517102908 | 427 |
| 111 | iso_pu_bacteria | 2517572143 | 2517891139 | 427 |
| 112 | iso_pu_bacteria | 2522572158 | 2523104914 | 427 |
| 113 | iso_pu_bacteria | 2524023205 | 2524438723 | 427 |
| 114 | iso_pu_bacteria | 2524023210 | 2524465590 | 427 |
| 115 | iso_pu_bacteria | 2524023228 | 2524533677 | 427 |
| 116 | iso_pu_bacteria | 2528768022 | 2528854441 | 427 |
| 117 | iso_pu_bacteria | 2597490356 | 2599105633 | 427 |
| 118 | iso_pu_bacteria | 2602042107 | 2603857185 | 427 |
| 119 | iso_pu_bacteria | 2617270735 | 2617347587 | 427 |
| 120 | iso_pu_bacteria | 2617270741 | 2617377001 | 427 |
| 121 | iso_pu_bacteria | 2643221651 | 2644291159 | 427 |
| 122 | iso_pu_bacteria | 2667528175 | 2671123259 | 427 |
| 123 | iso_pu_bacteria | 2721755755 | 2723843475 | 427 |
| 124 | iso_pu_bacteria | 2728368998 | 2728755505 | 427 |
| 125 | iso_pu_bacteria | 2738541295 | 2738815298 | 427 |
| 126 | iso_pu_bacteria | 2744054633 | 2745080489 | 427 |
| 127 | iso_pu_bacteria | 2791355196 | 2793063565 | 427 |
| 128 | iso_pu_bacteria | 2791355197 | 2793066482 | 427 |
| 129 | iso_pu_bacteria | 2791355199 | 2793084000 | 427 |
| 130 | iso_pu_bacteria | 2802429603 | 2805921079 | 427 |
| 131 | iso_pu_bacteria | 2816332527 | 2818237049 | 427 |
| 132 | iso_pu_bacteria | 2824600985 | 2824606341 | 427 |
| 133 | iso_pu_bacteria | 2824609381 | 2824612078 | 427 |
| 134 | iso_pu_bacteria | 2824617872 | 2824619223 | 427 |
| 135 | iso_pu_bacteria | 2824626560 | 2824628128 | 427 |
| 136 | iso_pu_bacteria | 2824635225 | 2824636910 | 427 |
| 137 | iso_pu_bacteria | 2824644064 | 2824645706 | 427 |
| 138 | iso_pu_bacteria | 2824653114 | 2824658465 | 427 |
| 139 | iso_pu_bacteria | 2824661429 | 2824668031 | 427 |
| 140 | iso_pu_bacteria | 2824671348 | 2824676767 | 427 |
| 141 | iso_pu_bacteria | 2824679649 | 2824683238 | 427 |
| 142 | iso_pu_bacteria | 2824687955 | 2824694047 | 427 |
| 143 | iso_pu_bacteria | 2824696289 | 2824701594 | 427 |
| 144 | iso_pu_bacteria | 2824704595 | 2824710290 | 427 |
| 145 | iso_pu_bacteria | 2824714736 | 2824715885 | 427 |
| 146 | iso_pu_bacteria | 2824723954 | 2824725373 | 427 |
| 147 | iso_pu_bacteria | 2824732956 | 2824736863 | 427 |
| 148 | iso_pu_bacteria | 2824746037 | 2824747590 | 427 |
| 149 | iso_pu_bacteria | 2824753945 | 2824760916 | 427 |
| 150 | iso_pu_bacteria | 2824763712 | 2824767681 | 427 |
| 151 | iso_pu_bacteria | 2824773399 | 2824777072 | 427 |
| 152 | iso_pu_bacteria | 2838122688 | 2838129179 | 427 |
| 153 | iso_pu_bacteria | 2841941048 | 2841944193 | 427 |
| 154 | iso_pu_bacteria | 2841949485 | 2841954632 | 427 |
| 155 | iso_pu_bacteria | 2841957949 | 2841963065 | 427 |
| 156 | iso_pu_bacteria | 2841966195 | 2841968975 | 427 |
| 157 | iso_pu_bacteria | 2841974524 | 2841979749 | 427 |
| 158 | iso_pu_bacteria | 2841983080 | 2841989655 | 427 |
| 159 | iso_pu_bacteria | 2842038055 | 2842044172 | 427 |
| 160 | iso_pu_bacteria | 2842045827 | 2842051839 | 427 |
| 161 | iso_pu_bacteria | 2842333319 | 2842336467 | 427 |
| 162 | iso_pu_bacteria | 2844315083 | 2844316126 | 427 |
| 163 | iso_pu_bacteria | 2846952575 | 2846954681 | 427 |
| 164 | iso_pu_bacteria | 2847930680 | 2847931824 | 427 |
| 165 | iso_pu_bacteria | 2847939898 | 2847941491 | 427 |
| 166 | iso_pu_bacteria | 2848858292 | 2848859052 | 427 |
| 167 | iso_pu_bacteria | 2849076700 | 2849082402 | 427 |
| 168 | iso_pu_bacteria | 2857509624 | 2857516536 | 427 |
| 169 | iso_pu_bacteria | 2857524615 | 2857524845 | 427 |
| 170 | iso_pu_bacteria | 2874590934 | 2874595511 | 427 |
| 171 | iso_pu_bacteria | 2874604998 | 2874611610 | 427 |
| 172 | iso_pu_bacteria | 2874612657 | 2874615905 | 427 |
| 173 | iso_pu_bacteria | 2874620515 | 2874621514 | 427 |
| 174 | iso_pu_bacteria | 2874628541 | 2874629450 | 427 |
| 175 | iso_pu_bacteria | 2874645413 | 2874647056 | 427 |
| 176 | iso_pu_bacteria | 2876761206 | 2876765884 | 427 |
| 177 | iso_pu_bacteria | 2876771140 | 2876775705 | 427 |
| 178 | iso_pu_bacteria | 2876818435 | 2876823697 | 427 |
| 179 | iso_pu_bacteria | 2879074833 | 2879079796 | 427 |
| 180 | iso_pu_bacteria | 2879083081 | 2879091266 | 427 |
| 181 | iso_pu_bacteria | 2879099564 | 2879103068 | 427 |
| 182 | iso_pu_bacteria | 2879110137 | 2879117474 | 427 |
| 183 | iso_pu_bacteria | 2879127579 | 2879131125 | 427 |
| 184 | iso_pu_bacteria | 2879142872 | 2879150331 | 427 |
| 185 | iso_pu_bacteria | 2881364244 | 2881369808 | 427 |
| 186 | iso_pu_bacteria | 2881665667 | 2881668643 | 427 |
| 187 | iso_pu_bacteria | 2885366525 | 2885368262 | 427 |
| 188 | iso_pu_bacteria | 2885374607 | 2885378231 | 427 |
| 189 | iso_pu_bacteria | 2885383462 | 2885388939 | 427 |
| 190 | iso_pu_bacteria | 2885409591 | 2885413154 | 427 |
| 191 | iso_pu_bacteria | 2888378607 | 2888380243 | 427 |
| 192 | iso_pu_bacteria | 2888388044 | 2888391274 | 427 |
| 193 | iso_pu_bacteria | 2888419890 | 2888427162 | 427 |
| 194 | iso_pu_bacteria | 2889033259 | 2889037788 | 427 |
| 195 | iso_pu_bacteria | 2893066018 | 2893069359 | 427 |
| 196 | iso_pu_bacteria | 2897803580 | 2897804159 | 427 |
| 197 | iso_pu_bacteria | 2903727486 | 2903729472 | 427 |
| 198 | iso_pu_bacteria | 2903748898 | 2903752240 | 427 |
| 199 | iso_pu_bacteria | 2903768456 | 2903775910 | 427 |
| 200 | iso_pu_bacteria | 2904666416 | 2904668183 | 427 |
| 201 | iso_pu_bacteria | 2904690495 | 2904698961 | 427 |
| 202 | iso_pu_bacteria | 2904699407 | 2904701018 | 427 |
| 203 | iso_pu_bacteria | 2904711408 | 2904719968 | 427 |
| 204 | iso_pu_bacteria | 2906602504 | 2906606682 | 427 |
| 205 | iso_pu_bacteria | 2906610324 | 2906616319 | 427 |
| 206 | iso_pu_bacteria | 2906626472 | 2906634551 | 427 |
| 207 | iso_pu_bacteria | 2906635258 | 2906641524 | 427 |
| 208 | iso_pu_bacteria | 2906643746 | 2906652350 | 427 |
| 209 | iso_pu_bacteria | 2906660503 | 2906662898 | 427 |
| 210 | iso_pu_bacteria | 2908739725 | 2908741459 | 427 |
| 211 | iso_pu_bacteria | 2908756301 | 2908758758 | 427 |
| 212 | iso_pu_bacteria | 2908775508 | 2908782907 | 427 |
| 213 | iso_pu_bacteria | 2919073203 | 2919078732 | 427 |
| 214 | iso_pu_bacteria | 2919414237 | 2919416266 | 427 |
| 215 | iso_pu_bacteria | 2922361189 | 2922361731 | 427 |
| 216 | iso_pu_bacteria | 2922368715 | 2922369810 | 427 |
| 217 | iso_pu_bacteria | 2922386360 | 2922387019 | 427 |
| 218 | iso_pu_bacteria | 2922393267 | 2922398767 | 427 |
| 219 | iso_pu_bacteria | 2922425934 | 2922431683 | 427 |
| 220 | iso_pu_bacteria | 2929615660 | 2929622831 | 427 |
| 221 | iso_pu_bacteria | 2929624759 | 2929632065 | 427 |
| 222 | iso_pu_bacteria | 2932784394 | 2932789848 | 427 |
| 223 | iso_pu_bacteria | 2932794094 | 2932796195 | 427 |
| 224 | iso_pu_bacteria | 2932801729 | 2932807769 | 427 |
| 225 | iso_pu_bacteria | 2932809354 | 2932815405 | 427 |
| 226 | iso_pu_bacteria | 2932818245 | 2932825156 | 427 |
| 227 | iso_pu_bacteria | 2932828146 | 2932829324 | 427 |
| 228 | iso_pu_bacteria | 2933577622 | 2933584537 | 427 |
| 229 | iso_pu_bacteria | 2935608549 | 2935614212 | 427 |
| 230 | iso_pu_bacteria | 2935616580 | 2935617757 | 427 |
| 231 | iso_pu_bacteria | 2935630451 | 2935635769 | 427 |
| 232 | iso_pu_bacteria | 2935638405 | 2935643802 | 427 |
| 233 | iso_pu_bacteria | 2935648319 | 2935651419 | 427 |
| 234 | iso_pu_bacteria | 2935656913 | 2935659813 | 427 |
| 235 | iso_pu_bacteria | 2935665750 | 2935670888 | 427 |
| 236 | iso_pu_bacteria | 2935675223 | 2935678221 | 427 |
| 237 | iso_pu_bacteria | 2935684952 | 2935692509 | 427 |
| 238 | iso_pu_bacteria | 2935694250 | 2935699277 | 427 |
| 239 | iso_pu_bacteria | 2935703347 | 2935710084 | 427 |
| 240 | iso_pu_bacteria | 2935713505 | 2935721127 | 427 |
| 241 | iso_pu_bacteria | 2935722832 | 2935730880 | 427 |
| 242 | iso_pu_bacteria | 2935732158 | 2935739816 | 427 |
| 243 | iso_pu_bacteria | 2935741537 | 2935748854 | 427 |
| 244 | iso_pu_bacteria | 2935750917 | 2935758724 | 427 |
| 245 | iso_pu_bacteria | 2935760218 | 2935767786 | 427 |
| 246 | iso_pu_bacteria | 2935769743 | 2935775581 | 427 |
| 247 | iso_pu_bacteria | 2935777560 | 2935779838 | 427 |
| 248 | iso_pu_bacteria | 2935785616 | 2935790109 | 427 |
| 249 | iso_pu_bacteria | 2935793552 | 2935798544 | 427 |
| 250 | iso_pu_bacteria | 2935801545 | 2935806752 | 427 |
| 251 | iso_pu_bacteria | 2935810662 | 2935817915 | 427 |
| 252 | iso_pu_bacteria | 2935819856 | 2935826463 | 427 |
| 253 | iso_pu_bacteria | 2935827899 | 2935834487 | 427 |
| 254 | iso_pu_bacteria | 2935837841 | 2935843788 | 427 |
| 255 | iso_pu_bacteria | 2935847175 | 2935851342 | 427 |
| 256 | iso_pu_bacteria | 2935855204 | 2935856744 | 427 |
| 257 | iso_pu_bacteria | 2935864058 | 2935868223 | 427 |
| 258 | iso_pu_bacteria | 2935873716 | 2935879581 | 427 |
| 259 | iso_pu_bacteria | 2935883170 | 2935887477 | 427 |
| 260 | iso_pu_bacteria | 2935908558 | 2935913306 | 427 |
| 261 | iso_pu_bacteria | 2935916978 | 2935922710 | 427 |
| 262 | iso_pu_bacteria | 2935926038 | 2935930769 | 427 |
| 263 | iso_pu_bacteria | 2935934488 | 2935939897 | 427 |
| 264 | iso_pu_bacteria | 2935942939 | 2935946846 | 427 |
| 265 | iso_pu_bacteria | 2935951376 | 2935955953 | 427 |
| 266 | iso_pu_bacteria | 2935959822 | 2935966250 | 427 |
| 267 | iso_pu_bacteria | 2935967501 | 2935972746 | 427 |
| 268 | iso_pu_bacteria | 2935975950 | 2935982537 | 427 |
| 269 | iso_pu_bacteria | 2935984226 | 2935984521 | 427 |
| 270 | iso_pu_bacteria | 2935992306 | 2935997087 | 427 |
| 271 | iso_pu_bacteria | 2936002035 | 2936009801 | 427 |
| 272 | iso_pu_bacteria | 2936011229 | 2936014229 | 427 |
| 273 | iso_pu_bacteria | 2936019824 | 2936022862 | 427 |
| 274 | iso_pu_bacteria | 2936028420 | 2936030999 | 427 |
| 275 | iso_pu_bacteria | 2936037263 | 2936044687 | 427 |
| 276 | iso_pu_bacteria | 2936046547 | 2936049120 | 427 |
| 277 | iso_pu_bacteria | 2936055302 | 2936055565 | 427 |
| 278 | iso_pu_bacteria | 2936361878 | 2936362461 | 427 |
| 279 | iso_pu_bacteria | 2940556831 | 2940564686 | 427 |
| 280 | iso_pu_bacteria | 2941507105 | 2941512394 | 427 |
| 281 | iso_pu_bacteria | 2941515067 | 2941520101 | 427 |
| 282 | iso_pu_bacteria | 2941523033 | 2941528250 | 427 |
| 283 | iso_pu_bacteria | 2941531003 | 2941534855 | 427 |
| 284 | iso_pu_bacteria | 2941538514 | 2941545036 | 427 |
| 285 | iso_pu_bacteria | 2977254563 | 2977255994 | 427 |
| 286 | iso_pu_bacteria | 2990275345 | 2990276840 | 427 |
| 287 | iso_pu_bacteria | 3001892409 | 3001895281 | 427 |
| 288 | iso_pu_bacteria | 3005474847 | 3005481482 | 427 |
| 289 | iso_pu_bacteria | 3005483717 | 3005490392 | 427 |
| 290 | iso_pu_bacteria | 3005506211 | 3005509802 | 427 |
| 291 | iso_pu_bacteria | 3005587118 | 3005591094 | 427 |
| 292 | iso_pu_bacteria | 3005594810 | 3005595715 | 427 |
| 293 | iso_pu_bacteria | 3005710791 | 3005711692 | 427 |
| 294 | iso_pu_bacteria | 3005718088 | 3005718955 | 427 |
| 295 | iso_pu_bacteria | 3006978542 | 3006981143 | 427 |
| 296 | iso_pu_bacteria | 8006926726 | 8006930568 | 427 |
| 297 | iso_pu_bacteria | 8006933436 | 8006939235 | 427 |
| 298 | iso_pu_bacteria | 8006964411 | 8006966846 | 427 |
| 299 | iso_pu_bacteria | 8006973647 | 8006978893 | 427 |
| 300 | iso_pu_bacteria | 8006984368 | 8006984647 | 427 |
| 301 | iso_pu_bacteria | 8006994254 | 8006994642 | 427 |
| 302 | iso_pu_bacteria | 8016511872 | 8016518923 | 427 |
| 303 | iso_pu_bacteria | 8016522445 | 8016525542 | 427 |
| 304 | iso_pu_bacteria | 8016539877 | 8016543422 | 427 |
| 305 | iso_pu_bacteria | 8016557553 | 8016558286 | 427 |
| 306 | iso_pu_bacteria | 8016566248 | 8016568825 | 427 |
| 307 | iso_pu_bacteria | 8016575299 | 8016581470 | 427 |
| 308 | iso_pu_bacteria | 8016583857 | 8016587192 | 427 |
| 309 | iso_pu_bacteria | 8016595262 | 8016596283 | 427 |
| 310 | iso_pu_bacteria | 8016603502 | 8016607193 | 427 |
| 311 | iso_pu_bacteria | 8016613128 | 8016619091 | 427 |
| 312 | iso_pu_bacteria | 8016622563 | 8016630492 | 427 |
| 313 | iso_pu_bacteria | 8016630954 | 8016636591 | 427 |
| 314 | iso_pu_bacteria | 8017057580 | 8017057766 | 427 |
| 315 | iso_pu_bacteria | 8019530166 | 8019538804 | 427 |
| 316 | iso_pu_bacteria | 8019538911 | 8019541178 | 427 |
| 317 | iso_pu_bacteria | 8019547302 | 8019549438 | 427 |
| 318 | iso_pu_bacteria | 8019555841 | 8019565093 | 427 |
| 319 | iso_pu_bacteria | 8019565922 | 8019575197 | 427 |
| 320 | iso_pu_bacteria | 8019576017 | 8019578014 | 427 |
| 321 | iso_pu_bacteria | 8019597564 | 8019605644 | 427 |
| 322 | iso_pu_bacteria | 8019619141 | 8019623574 | 427 |
| 323 | iso_pu_bacteria | 8019629233 | 8019638577 | 427 |
| 324 | iso_pu_bacteria | 8019638758 | 8019641167 | 427 |
| 325 | iso_pu_bacteria | 8019659431 | 8019666378 | 427 |
| 326 | iso_pu_bacteria | 8019668869 | 8019676040 | 427 |
| 327 | iso_pu_bacteria | 8019678201 | 8019680105 | 427 |
| 328 | iso_pu_bacteria | 8019687851 | 8019693418 | 427 |
| 329 | iso_pu_bacteria | 8054002106 | 8054005951 | 427 |
| 330 | iso_pu_bacteria | 8055742211 | 8055750734 | 427 |
| 331 | iso_pu_bacteria | 8056673599 | 8056680890 | 427 |
| 332 | iso_pu_bacteria | 8056681323 | 8056684257 | 427 |
| 333 | iso_pu_bacteria | 8056689827 | 8056690599 | 427 |
| 334 | iso_pu_bacteria | 8056967851 | 8056970564 | 427 |
| 335 | iso_pu_bacteria | 8057632132 | 8057636137 | 427 |
| 336 | 3300048911 | Ga0496108_0200627 | Ga0496108_0200627_25_1335 | 428 |
| 337 | 3300048913 | Ga0496110_0002562 | Ga0496110_0002562_5408_6718 | 428 |
| 338 | 3300048914 | Ga0496111_0001360 | Ga0496111_0001360_1311_2621 | 428 |
| 339 | 3300005444 | Ga0070694_100048368 | Ga0070694_1000483683 | 429 |
| 340 | 3300005545 | Ga0070695_100024951 | Ga0070695_1000249513 | 429 |
| 341 | 3300005549 | Ga0070704_100174236 | Ga0070704_1001742362 | 429 |
| 342 | 3300005434 | Ga0070709_10121040 | Ga0070709_101210401 | 430 |
| 343 | 3300005435 | Ga0070714_100017873 | Ga0070714_1000178734 | 430 |
| 344 | 3300005436 | Ga0070713_100135585 | Ga0070713_1001355852 | 430 |
| 345 | 3300005981 | Ga0081538_10057238 | Ga0081538_100572382 | 430 |
| 346 | 3300006847 | Ga0075431_100002016 | Ga0075431_1000020166 | 430 |
| 347 | 3300006880 | Ga0075429_100012416 | Ga0075429_1000124166 | 430 |
| 348 | 3300009094 | Ga0111539_10317521 | Ga0111539_103175211 | 430 |
| 349 | 3300009147 | Ga0114129_10068570 | Ga0114129_100685706 | 430 |
| 350 | 3300009551 | Ga0105238_10047043 | Ga0105238_100470433 | 430 |
| 351 | 3300009993 | Ga0105028_101203 | Ga0105028_1012032 | 430 |
| 352 | 3300025291 | Ga0209675_1007363 | Ga0209675_10073635 | 430 |
| 353 | 3300025304 | Ga0209257_1000368 | Ga0209257_100036820 | 430 |
| 354 | 3300025928 | Ga0207700_10043639 | Ga0207700_100436393 | 430 |
| 355 | 3300031344 | Ga0265316_10025488 | Ga0265316_100254883 | 430 |
| 356 | 3300035725 | Ga0373947_0086393 | Ga0373947_0086393_263_1555 | 430 |
| 357 | 3300038735 | Ga0400485_06767 | Ga0400485_06767_4854_6146 | 430 |
| 358 | 3300039062 | Ga0400483_015990 | Ga0400483_015990_4060_5352 | 430 |
| 359 | 3300039437 | Ga0436365_1747149 | Ga0436365_1747149_2534_3826 | 430 |
| 360 | 3300042436 | Ga0439435_0029075 | Ga0439435_0029075_130_1422 | 430 |
| 361 | 3300048926 | Ga0496123_0066540 | Ga0496123_0066540_53_1345 | 430 |
| 362 | 3300049161 | Ga0501305_001889 | Ga0501305_001889_457_1773 | 430 |
| 363 | 3300049528 | Ga0501312_000418 | Ga0501312_000418_645_1961 | 430 |
| 364 | 3300049528 | Ga0501312_002551 | Ga0501312_002551_323_1639 | 430 |
| 365 | 3300049568 | Ga0501031_0115929 | Ga0501031_0115929_211_1503 | 430 |
| 366 | 3300049572 | Ga0501036_0254508 | Ga0501036_0254508_16_1308 | 430 |
| 367 | 3300049574 | Ga0501038_0010211 | Ga0501038_0010211_7182_8474 | 430 |
| 368 | 3300049576 | Ga0501040_0010754 | Ga0501040_0010754_2697_3989 | 430 |
| 369 | 3300049578 | Ga0501042_0010034 | Ga0501042_0010034_887_2179 | 430 |
| 370 | 3300049579 | Ga0501043_0108403 | Ga0501043_0108403_717_2009 | 430 |
| 371 | 3300049584 | Ga0501068_0008999 | Ga0501068_0008999_3314_4606 | 430 |
| 372 | 3300049585 | Ga0501069_0054403 | Ga0501069_0054403_618_1910 | 430 |
| 373 | 3300049587 | Ga0501071_0008392 | Ga0501071_0008392_2020_3312 | 430 |
| 374 | 3300049591 | Ga0501075_0005258 | Ga0501075_0005258_5241_6533 | 430 |
| 375 | 3300049742 | Ga0501080_0012893 | Ga0501080_0012893_1611_2903 | 430 |
| 376 | 3300049742 | Ga0501080_0043316 | Ga0501080_0043316_877_2169 | 430 |
| 377 | 3300049823 | Ga0501044_0009069 | Ga0501044_0009069_2933_4225 | 430 |
| 378 | 3300049824 | Ga0501045_0009596 | Ga0501045_0009596_5258_6550 | 430 |
| 379 | 3300050507 | nmdc:mga05p37_120614_c1 | nmdc:mga05p37_120614_c1_1478_2770 | 430 |
| 380 | 3300050510 | nmdc:mga06r32_4688_c1 | nmdc:mga06r32_4688_c1_3361_4653 | 430 |
| 381 | 3300053151 | Ga0500604_0002553 | Ga0500604_0002553_734_2026 | 430 |
| 382 | 3300054114 | Ga0501084_0026729 | Ga0501084_0026729_418_1710 | 430 |
| 383 | 3300054114 | Ga0501084_0193228 | Ga0501084_0193228_115_1407 | 430 |
| 384 | 3300060353 | Ga0501082_0020282 | Ga0501082_0020282_521_1813 | 430 |
| 385 | 3300003203 | JGI25406J46586_10000038 | JGI25406J46586_1000003825 | 431 |
| 386 | 3300003203 | JGI25406J46586_10001332 | JGI25406J46586_1000133211 | 431 |
| 387 | 3300003215 | JGI25153J46596_10001090 | JGI25153J46596_100010904 | 431 |
| 388 | 3300003215 | JGI25153J46596_10001143 | JGI25153J46596_1000114317 | 431 |
| 389 | 3300003215 | JGI25153J46596_10013136 | JGI25153J46596_100131361 | 431 |
| 390 | 3300003354 | JGI25160J50197_1009430 | JGI25160J50197_10094303 | 431 |
| 391 | 3300003659 | JGI25404J52841_10001402 | JGI25404J52841_100014021 | 431 |
| 392 | 3300003659 | JGI25404J52841_10005555 | JGI25404J52841_100055551 | 431 |
| 393 | 3300004625 | Ga0055543_1003719 | Ga0055543_10037194 | 431 |
| 394 | 3300005262 | Ga0065165_1000721 | Ga0065165_100072122 | 431 |
| 395 | 3300005262 | Ga0065165_1002559 | Ga0065165_100255911 | 431 |
| 396 | 3300005262 | Ga0065165_1017679 | Ga0065165_10176792 | 431 |
| 397 | 3300005262 | Ga0065165_1019229 | Ga0065165_10192293 | 431 |
| 398 | 3300005327 | Ga0070658_10031329 | Ga0070658_100313293 | 431 |
| 399 | 3300005329 | Ga0070683_100004866 | Ga0070683_10000486613 | 431 |
| 400 | 3300005331 | Ga0070670_100013506 | Ga0070670_1000135061 | 431 |
| 401 | 3300005334 | Ga0068869_100037881 | Ga0068869_1000378812 | 431 |
| 402 | 3300005334 | Ga0068869_100072454 | Ga0068869_1000724542 | 431 |
| 403 | 3300005336 | Ga0070680_100084672 | Ga0070680_1000846724 | 431 |
| 404 | 3300005337 | Ga0070682_100012739 | Ga0070682_1000127392 | 431 |
| 405 | 3300005338 | Ga0068868_100026969 | Ga0068868_1000269692 | 431 |
| 406 | 3300005338 | Ga0068868_100041790 | Ga0068868_1000417903 | 431 |
| 407 | 3300005338 | Ga0068868_100061439 | Ga0068868_1000614392 | 431 |
| 408 | 3300005339 | Ga0070660_100010412 | Ga0070660_1000104123 | 431 |
| 409 | 3300005340 | Ga0070689_100007055 | Ga0070689_1000070552 | 431 |
| 410 | 3300005341 | Ga0070691_10001706 | Ga0070691_100017066 | 431 |
| 411 | 3300005341 | Ga0070691_10026246 | Ga0070691_100262461 | 431 |
| 412 | 3300005344 | Ga0070661_100053990 | Ga0070661_1000539903 | 431 |
| 413 | 3300005355 | Ga0070671_100000170 | Ga0070671_10000017018 | 431 |
| 414 | 3300005364 | Ga0070673_100004457 | Ga0070673_1000044574 | 431 |
| 415 | 3300005365 | Ga0070688_100188897 | Ga0070688_1001888971 | 431 |
| 416 | 3300005366 | Ga0070659_100032467 | Ga0070659_1000324673 | 431 |
| 417 | 3300005366 | Ga0070659_100048523 | Ga0070659_1000485233 | 431 |
| 418 | 3300005367 | Ga0070667_100034398 | Ga0070667_1000343984 | 431 |
| 419 | 3300005406 | Ga0070703_10011629 | Ga0070703_100116291 | 431 |
| 420 | 3300005436 | Ga0070713_100062633 | Ga0070713_1000626332 | 431 |
| 421 | 3300005436 | Ga0070713_100319758 | Ga0070713_1003197581 | 431 |
| 422 | 3300005437 | Ga0070710_10139683 | Ga0070710_101396831 | 431 |
| 423 | 3300005439 | Ga0070711_100003099 | Ga0070711_1000030991 | 431 |
| 424 | 3300005439 | Ga0070711_100073841 | Ga0070711_1000738412 | 431 |
| 425 | 3300005444 | Ga0070694_100000604 | Ga0070694_10000060410 | 431 |
| 426 | 3300005445 | Ga0070708_100012245 | Ga0070708_1000122455 | 431 |
| 427 | 3300005445 | Ga0070708_100127008 | Ga0070708_1001270082 | 431 |
| 428 | 3300005456 | Ga0070678_100134219 | Ga0070678_1001342191 | 431 |
| 429 | 3300005458 | Ga0070681_10035275 | Ga0070681_100352752 | 431 |
| 430 | 3300005458 | Ga0070681_10064136 | Ga0070681_100641361 | 431 |
| 431 | 3300005458 | Ga0070681_10073291 | Ga0070681_100732914 | 431 |
| 432 | 3300005458 | Ga0070681_10109546 | Ga0070681_101095464 | 431 |
| 433 | 3300005459 | Ga0068867_100133690 | Ga0068867_1001336902 | 431 |
| 434 | 3300005518 | Ga0070699_100001264 | Ga0070699_10000126411 | 431 |
| 435 | 3300005530 | Ga0070679_100017666 | Ga0070679_1000176663 | 431 |
| 436 | 3300005530 | Ga0070679_100125200 | Ga0070679_1001252004 | 431 |
| 437 | 3300005535 | Ga0070684_100010958 | Ga0070684_1000109588 | 431 |
| 438 | 3300005535 | Ga0070684_100039358 | Ga0070684_1000393582 | 431 |
| 439 | 3300005535 | Ga0070684_100058840 | Ga0070684_1000588404 | 431 |
| 440 | 3300005536 | Ga0070697_100012239 | Ga0070697_1000122394 | 431 |
| 441 | 3300005539 | Ga0068853_100015741 | Ga0068853_1000157414 | 431 |
| 442 | 3300005546 | Ga0070696_100005035 | Ga0070696_1000050353 | 431 |
| 443 | 3300005548 | Ga0070665_100013287 | Ga0070665_1000132875 | 431 |
| 444 | 3300005548 | Ga0070665_100013848 | Ga0070665_1000138483 | 431 |
| 445 | 3300005548 | Ga0070665_100069949 | Ga0070665_1000699492 | 431 |
| 446 | 3300005549 | Ga0070704_100001210 | Ga0070704_10000121015 | 431 |
| 447 | 3300005563 | Ga0068855_100066927 | Ga0068855_1000669272 | 431 |
| 448 | 3300005563 | Ga0068855_100197158 | Ga0068855_1001971582 | 431 |
| 449 | 3300005577 | Ga0068857_100038607 | Ga0068857_1000386073 | 431 |
| 450 | 3300005577 | Ga0068857_100038848 | Ga0068857_1000388485 | 431 |
| 451 | 3300005614 | Ga0068856_100003313 | Ga0068856_10000331316 | 431 |
| 452 | 3300005614 | Ga0068856_100013310 | Ga0068856_1000133103 | 431 |
| 453 | 3300005616 | Ga0068852_100001667 | Ga0068852_1000016673 | 431 |
| 454 | 3300005616 | Ga0068852_100066401 | Ga0068852_1000664013 | 431 |
| 455 | 3300005617 | Ga0068859_100004768 | Ga0068859_1000047685 | 431 |
| 456 | 3300005719 | Ga0068861_100031380 | Ga0068861_1000313803 | 431 |
| 457 | 3300005719 | Ga0068861_100076931 | Ga0068861_1000769312 | 431 |
| 458 | 3300005834 | Ga0068851_10015821 | Ga0068851_100158212 | 431 |
| 459 | 3300005842 | Ga0068858_100186390 | Ga0068858_1001863901 | 431 |
| 460 | 3300005843 | Ga0068860_100000711 | Ga0068860_10000071127 | 431 |
| 461 | 3300005843 | Ga0068860_100114271 | Ga0068860_1001142714 | 431 |
| 462 | 3300005844 | Ga0068862_100002512 | Ga0068862_10000251210 | 431 |
| 463 | 3300005844 | Ga0068862_100022673 | Ga0068862_1000226735 | 431 |
| 464 | 3300005844 | Ga0068862_100115227 | Ga0068862_1001152272 | 431 |
| 465 | 3300005937 | Ga0081455_10000017 | Ga0081455_1000001760 | 431 |
| 466 | 3300005937 | Ga0081455_10002635 | Ga0081455_1000263510 | 431 |
| 467 | 3300005937 | Ga0081455_10017707 | Ga0081455_100177073 | 431 |
| 468 | 3300005937 | Ga0081455_10087778 | Ga0081455_100877782 | 431 |
| 469 | 3300005981 | Ga0081538_10004632 | Ga0081538_1000463211 | 431 |
| 470 | 3300005981 | Ga0081538_10017999 | Ga0081538_100179995 | 431 |
| 471 | 3300005983 | Ga0081540_1000059 | Ga0081540_10000597 | 431 |
| 472 | 3300005983 | Ga0081540_1004330 | Ga0081540_10043302 | 431 |
| 473 | 3300005983 | Ga0081540_1005964 | Ga0081540_10059643 | 431 |
| 474 | 3300005983 | Ga0081540_1006212 | Ga0081540_10062126 | 431 |
| 475 | 3300005983 | Ga0081540_1009418 | Ga0081540_10094182 | 431 |
| 476 | 3300005983 | Ga0081540_1013117 | Ga0081540_10131172 | 431 |
| 477 | 3300005983 | Ga0081540_1013193 | Ga0081540_10131935 | 431 |
| 478 | 3300005983 | Ga0081540_1021925 | Ga0081540_10219253 | 431 |
| 479 | 3300005983 | Ga0081540_1022189 | Ga0081540_10221894 | 431 |
| 480 | 3300005983 | Ga0081540_1026518 | Ga0081540_10265182 | 431 |
| 481 | 3300005983 | Ga0081540_1045581 | Ga0081540_10455812 | 431 |
| 482 | 3300005983 | Ga0081540_1047465 | Ga0081540_10474652 | 431 |
| 483 | 3300005985 | Ga0081539_10000080 | Ga0081539_10000080185 | 431 |
| 484 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022025 | 431 |
| 485 | 3300005985 | Ga0081539_10027918 | Ga0081539_100279182 | 431 |
| 486 | 3300006028 | Ga0070717_10000884 | Ga0070717_1000088415 | 431 |
| 487 | 3300006028 | Ga0070717_10007593 | Ga0070717_100075935 | 431 |
| 488 | 3300006038 | Ga0075365_10000311 | Ga0075365_1000031110 | 431 |
| 489 | 3300006038 | Ga0075365_10055836 | Ga0075365_100558362 | 431 |
| 490 | 3300006038 | Ga0075365_10109419 | Ga0075365_101094191 | 431 |
| 491 | 3300006038 | Ga0075365_10111954 | Ga0075365_101119542 | 431 |
| 492 | 3300006042 | Ga0075368_10003624 | Ga0075368_100036243 | 431 |
| 493 | 3300006042 | Ga0075368_10004781 | Ga0075368_100047813 | 431 |
| 494 | 3300006048 | Ga0075363_100001272 | Ga0075363_1000012728 | 431 |
| 495 | 3300006048 | Ga0075363_100043534 | Ga0075363_1000435342 | 431 |
| 496 | 3300006051 | Ga0075364_10001505 | Ga0075364_100015057 | 431 |
| 497 | 3300006051 | Ga0075364_10050231 | Ga0075364_100502311 | 431 |
| 498 | 3300006051 | Ga0075364_10135304 | Ga0075364_101353041 | 431 |
| 499 | 3300006163 | Ga0070715_10001487 | Ga0070715_100014873 | 431 |
| 500 | 3300006177 | Ga0075362_10001659 | Ga0075362_100016592 | 431 |
| 501 | 3300006177 | Ga0075362_10010512 | Ga0075362_100105122 | 431 |
| 502 | 3300006178 | Ga0075367_10001516 | Ga0075367_100015164 | 431 |
| 503 | 3300006178 | Ga0075367_10017979 | Ga0075367_100179792 | 431 |
| 504 | 3300006178 | Ga0075367_10028820 | Ga0075367_100288203 | 431 |
| 505 | 3300006178 | Ga0075367_10040558 | Ga0075367_100405583 | 431 |
| 506 | 3300006178 | Ga0075367_10133111 | Ga0075367_101331112 | 431 |
| 507 | 3300006186 | Ga0075369_10030898 | Ga0075369_100308982 | 431 |
| 508 | 3300006353 | Ga0075370_10021919 | Ga0075370_100219192 | 431 |
| 509 | 3300006353 | Ga0075370_10053904 | Ga0075370_100539042 | 431 |
| 510 | 3300006358 | Ga0068871_100098349 | Ga0068871_1000983492 | 431 |
| 511 | 3300006844 | Ga0075428_100201205 | Ga0075428_1002012052 | 431 |
| 512 | 3300006871 | Ga0075434_100011193 | Ga0075434_1000111933 | 431 |
| 513 | 3300006871 | Ga0075434_100024076 | Ga0075434_1000240765 | 431 |
| 514 | 3300006931 | Ga0097620_100004768 | Ga0097620_1000047685 | 431 |
| 515 | 3300006941 | Ga0099825_1020047 | Ga0099825_10200473 | 431 |
| 516 | 3300006942 | Ga0099824_1012895 | Ga0099824_10128955 | 431 |
| 517 | 3300006943 | Ga0099822_1003531 | Ga0099822_100353114 | 431 |
| 518 | 3300006944 | Ga0099823_1007767 | Ga0099823_10077673 | 431 |
| 519 | 3300007076 | Ga0075435_100053000 | Ga0075435_1000530002 | 431 |
| 520 | 3300009093 | Ga0105240_10005052 | Ga0105240_1000505213 | 431 |
| 521 | 3300009093 | Ga0105240_10302018 | Ga0105240_103020182 | 431 |
| 522 | 3300009098 | Ga0105245_10001527 | Ga0105245_100015274 | 431 |
| 523 | 3300009098 | Ga0105245_10008614 | Ga0105245_100086145 | 431 |
| 524 | 3300009101 | Ga0105247_10016349 | Ga0105247_100163493 | 431 |
| 525 | 3300009101 | Ga0105247_10068972 | Ga0105247_100689722 | 431 |
| 526 | 3300009147 | Ga0114129_10086246 | Ga0114129_100862462 | 431 |
| 527 | 3300009147 | Ga0114129_10196571 | Ga0114129_101965712 | 431 |
| 528 | 3300009174 | Ga0105241_10009951 | Ga0105241_100099519 | 431 |
| 529 | 3300009177 | Ga0105248_10049003 | Ga0105248_100490035 | 431 |
| 530 | 3300009545 | Ga0105237_10001825 | Ga0105237_1000182521 | 431 |
| 531 | 3300009545 | Ga0105237_10073492 | Ga0105237_100734922 | 431 |
| 532 | 3300009545 | Ga0105237_10092269 | Ga0105237_100922692 | 431 |
| 533 | 3300009545 | Ga0105237_10179331 | Ga0105237_101793312 | 431 |
| 534 | 3300009551 | Ga0105238_10099556 | Ga0105238_100995563 | 431 |
| 535 | 3300010159 | Ga0099796_10038186 | Ga0099796_100381861 | 431 |
| 536 | 3300010375 | Ga0105239_10058217 | Ga0105239_100582172 | 431 |
| 537 | 3300010375 | Ga0105239_10090880 | Ga0105239_100908803 | 431 |
| 538 | 3300011119 | Ga0105246_10144712 | Ga0105246_101447122 | 431 |
| 539 | 3300013100 | Ga0157373_10051862 | Ga0157373_100518621 | 431 |
| 540 | 3300013102 | Ga0157371_10009033 | Ga0157371_100090334 | 431 |
| 541 | 3300013104 | Ga0157370_10114337 | Ga0157370_101143372 | 431 |
| 542 | 3300013105 | Ga0157369_10004066 | Ga0157369_1000406610 | 431 |
| 543 | 3300013105 | Ga0157369_10014664 | Ga0157369_100146646 | 431 |
| 544 | 3300013105 | Ga0157369_10037827 | Ga0157369_100378275 | 431 |
| 545 | 3300013105 | Ga0157369_10293897 | Ga0157369_102938972 | 431 |
| 546 | 3300013296 | Ga0157374_10012732 | Ga0157374_100127324 | 431 |
| 547 | 3300013306 | Ga0163162_10040120 | Ga0163162_100401206 | 431 |
| 548 | 3300013307 | Ga0157372_10025437 | Ga0157372_100254376 | 431 |
| 549 | 3300013308 | Ga0157375_10017268 | Ga0157375_100172684 | 431 |
| 550 | 3300013308 | Ga0157375_10239327 | Ga0157375_102393272 | 431 |
| 551 | 3300013308 | Ga0157375_10439566 | Ga0157375_104395662 | 431 |
| 552 | 3300014325 | Ga0163163_10031880 | Ga0163163_100318801 | 431 |
| 553 | 3300014325 | Ga0163163_10038268 | Ga0163163_100382685 | 431 |
| 554 | 3300014325 | Ga0163163_10056783 | Ga0163163_100567832 | 431 |
| 555 | 3300014968 | Ga0157379_10098154 | Ga0157379_100981543 | 431 |
| 556 | 3300014969 | Ga0157376_10005380 | Ga0157376_100053804 | 431 |
| 557 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007235 | 431 |
| 558 | 3300021321 | Ga0214542_1000007 | Ga0214542_1000007147 | 431 |
| 559 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006146 | 431 |
| 560 | 3300021324 | Ga0214545_1025698 | Ga0214545_10256982 | 431 |
| 561 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009235 | 431 |
| 562 | 3300021361 | Ga0213872_10018555 | Ga0213872_100185554 | 431 |
| 563 | 3300025253 | Ga0209677_101607 | Ga0209677_1016077 | 431 |
| 564 | 3300025254 | Ga0209148_1000216 | Ga0209148_100021654 | 431 |
| 565 | 3300025261 | Ga0209233_1004139 | Ga0209233_10041393 | 431 |
| 566 | 3300025272 | Ga0209455_1001447 | Ga0209455_100144710 | 431 |
| 567 | 3300025273 | Ga0209673_1030417 | Ga0209673_10304171 | 431 |
| 568 | 3300025295 | Ga0209564_1001014 | Ga0209564_100101411 | 431 |
| 569 | 3300025295 | Ga0209564_1004938 | Ga0209564_10049387 | 431 |
| 570 | 3300025295 | Ga0209564_1010262 | Ga0209564_10102623 | 431 |
| 571 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015598 | 431 |
| 572 | 3300025297 | Ga0209758_1000161 | Ga0209758_100016169 | 431 |
| 573 | 3300025297 | Ga0209758_1001304 | Ga0209758_100130422 | 431 |
| 574 | 3300025297 | Ga0209758_1007191 | Ga0209758_10071915 | 431 |
| 575 | 3300025297 | Ga0209758_1009851 | Ga0209758_10098513 | 431 |
| 576 | 3300025297 | Ga0209758_1015686 | Ga0209758_10156865 | 431 |
| 577 | 3300025297 | Ga0209758_1035145 | Ga0209758_10351451 | 431 |
| 578 | 3300025299 | Ga0209256_1007571 | Ga0209256_10075712 | 431 |
| 579 | 3300025299 | Ga0209256_1013156 | Ga0209256_10131562 | 431 |
| 580 | 3300025302 | Ga0207426_1000186 | Ga0207426_1000186121 | 431 |
| 581 | 3300025302 | Ga0207426_1001742 | Ga0207426_10017426 | 431 |
| 582 | 3300025302 | Ga0207426_1012233 | Ga0207426_10122332 | 431 |
| 583 | 3300025885 | Ga0207653_10002688 | Ga0207653_100026884 | 431 |
| 584 | 3300025898 | Ga0207692_10024479 | Ga0207692_100244792 | 431 |
| 585 | 3300025900 | Ga0207710_10020548 | Ga0207710_100205482 | 431 |
| 586 | 3300025900 | Ga0207710_10042202 | Ga0207710_100422022 | 431 |
| 587 | 3300025901 | Ga0207688_10042576 | Ga0207688_100425762 | 431 |
| 588 | 3300025906 | Ga0207699_10002096 | Ga0207699_100020966 | 431 |
| 589 | 3300025909 | Ga0207705_10135086 | Ga0207705_101350861 | 431 |
| 590 | 3300025910 | Ga0207684_10064450 | Ga0207684_100644502 | 431 |
| 591 | 3300025910 | Ga0207684_10097208 | Ga0207684_100972082 | 431 |
| 592 | 3300025911 | Ga0207654_10029722 | Ga0207654_100297222 | 431 |
| 593 | 3300025912 | Ga0207707_10002566 | Ga0207707_1000256613 | 431 |
| 594 | 3300025912 | Ga0207707_10004618 | Ga0207707_100046186 | 431 |
| 595 | 3300025912 | Ga0207707_10012807 | Ga0207707_100128074 | 431 |
| 596 | 3300025912 | Ga0207707_10016469 | Ga0207707_100164696 | 431 |
| 597 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006224 | 431 |
| 598 | 3300025913 | Ga0207695_10029203 | Ga0207695_100292033 | 431 |
| 599 | 3300025913 | Ga0207695_10208308 | Ga0207695_102083082 | 431 |
| 600 | 3300025914 | Ga0207671_10005136 | Ga0207671_100051364 | 431 |
| 601 | 3300025914 | Ga0207671_10079706 | Ga0207671_100797062 | 431 |
| 602 | 3300025915 | Ga0207693_10001388 | Ga0207693_1000138817 | 431 |
| 603 | 3300025915 | Ga0207693_10018758 | Ga0207693_100187583 | 431 |
| 604 | 3300025916 | Ga0207663_10012993 | Ga0207663_100129932 | 431 |
| 605 | 3300025916 | Ga0207663_10016593 | Ga0207663_100165931 | 431 |
| 606 | 3300025917 | Ga0207660_10001934 | Ga0207660_1000193416 | 431 |
| 607 | 3300025917 | Ga0207660_10022103 | Ga0207660_100221032 | 431 |
| 608 | 3300025917 | Ga0207660_10081312 | Ga0207660_100813122 | 431 |
| 609 | 3300025919 | Ga0207657_10001315 | Ga0207657_1000131520 | 431 |
| 610 | 3300025919 | Ga0207657_10012952 | Ga0207657_100129526 | 431 |
| 611 | 3300025921 | Ga0207652_10016463 | Ga0207652_100164632 | 431 |
| 612 | 3300025924 | Ga0207694_10063186 | Ga0207694_100631861 | 431 |
| 613 | 3300025925 | Ga0207650_10009533 | Ga0207650_100095334 | 431 |
| 614 | 3300025928 | Ga0207700_10001452 | Ga0207700_1000145215 | 431 |
| 615 | 3300025928 | Ga0207700_10034329 | Ga0207700_100343292 | 431 |
| 616 | 3300025928 | Ga0207700_10043367 | Ga0207700_100433674 | 431 |
| 617 | 3300025928 | Ga0207700_10126505 | Ga0207700_101265053 | 431 |
| 618 | 3300025928 | Ga0207700_10251466 | Ga0207700_102514661 | 431 |
| 619 | 3300025931 | Ga0207644_10001194 | Ga0207644_100011943 | 431 |
| 620 | 3300025932 | Ga0207690_10050422 | Ga0207690_100504223 | 431 |
| 621 | 3300025933 | Ga0207706_10039347 | Ga0207706_100393473 | 431 |
| 622 | 3300025933 | Ga0207706_10059280 | Ga0207706_100592802 | 431 |
| 623 | 3300025935 | Ga0207709_10048312 | Ga0207709_100483122 | 431 |
| 624 | 3300025936 | Ga0207670_10007348 | Ga0207670_100073483 | 431 |
| 625 | 3300025937 | Ga0207669_10002669 | Ga0207669_100026694 | 431 |
| 626 | 3300025939 | Ga0207665_10000874 | Ga0207665_1000087416 | 431 |
| 627 | 3300025939 | Ga0207665_10019486 | Ga0207665_100194863 | 431 |
| 628 | 3300025939 | Ga0207665_10047796 | Ga0207665_100477962 | 431 |
| 629 | 3300025941 | Ga0207711_10061786 | Ga0207711_100617863 | 431 |
| 630 | 3300025944 | Ga0207661_10021344 | Ga0207661_100213444 | 431 |
| 631 | 3300025944 | Ga0207661_10117171 | Ga0207661_101171712 | 431 |
| 632 | 3300025945 | Ga0207679_10127642 | Ga0207679_101276422 | 431 |
| 633 | 3300025949 | Ga0207667_10012575 | Ga0207667_100125754 | 431 |
| 634 | 3300025949 | Ga0207667_10248073 | Ga0207667_102480732 | 431 |
| 635 | 3300025960 | Ga0207651_10064458 | Ga0207651_100644583 | 431 |
| 636 | 3300025961 | Ga0207712_10092064 | Ga0207712_100920642 | 431 |
| 637 | 3300025972 | Ga0207668_10069457 | Ga0207668_100694572 | 431 |
| 638 | 3300025972 | Ga0207668_10237981 | Ga0207668_102379811 | 431 |
| 639 | 3300026023 | Ga0207677_10005921 | Ga0207677_100059215 | 431 |
| 640 | 3300026023 | Ga0207677_10104908 | Ga0207677_101049081 | 431 |
| 641 | 3300026041 | Ga0207639_10014696 | Ga0207639_100146963 | 431 |
| 642 | 3300026067 | Ga0207678_10010380 | Ga0207678_100103804 | 431 |
| 643 | 3300026067 | Ga0207678_10032772 | Ga0207678_100327722 | 431 |
| 644 | 3300026067 | Ga0207678_10048937 | Ga0207678_100489371 | 431 |
| 645 | 3300026067 | Ga0207678_10050044 | Ga0207678_100500443 | 431 |
| 646 | 3300026067 | Ga0207678_10105136 | Ga0207678_101051362 | 431 |
| 647 | 3300026075 | Ga0207708_10003078 | Ga0207708_1000307810 | 431 |
| 648 | 3300026075 | Ga0207708_10119042 | Ga0207708_101190422 | 431 |
| 649 | 3300026078 | Ga0207702_10000325 | Ga0207702_1000032531 | 431 |
| 650 | 3300026116 | Ga0207674_10037716 | Ga0207674_100377164 | 431 |
| 651 | 3300026118 | Ga0207675_100080248 | Ga0207675_1000802482 | 431 |
| 652 | 3300026118 | Ga0207675_100128525 | Ga0207675_1001285252 | 431 |
| 653 | 3300026121 | Ga0207683_10021712 | Ga0207683_100217125 | 431 |
| 654 | 3300026121 | Ga0207683_10214283 | Ga0207683_102142832 | 431 |
| 655 | 3300027296 | Ga0209389_1000062 | Ga0209389_100006266 | 431 |
| 656 | 3300027296 | Ga0209389_1000072 | Ga0209389_100007212 | 431 |
| 657 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001121 | 431 |
| 658 | 3300027357 | Ga0209589_1000270 | Ga0209589_100027056 | 431 |
| 659 | 3300027361 | Ga0209489_100012 | Ga0209489_10001221 | 431 |
| 660 | 3300027361 | Ga0209489_100160 | Ga0209489_10016066 | 431 |
| 661 | 3300027361 | Ga0209489_100206 | Ga0209489_10020612 | 431 |
| 662 | 3300027363 | Ga0209700_100019 | Ga0209700_10001921 | 431 |
| 663 | 3300027363 | Ga0209700_101128 | Ga0209700_10112845 | 431 |
| 664 | 3300027866 | Ga0209813_10000705 | Ga0209813_100007054 | 431 |
| 665 | 3300028379 | Ga0268266_10002101 | Ga0268266_1000210116 | 431 |
| 666 | 3300028379 | Ga0268266_10025141 | Ga0268266_100251413 | 431 |
| 667 | 3300028379 | Ga0268266_10062907 | Ga0268266_100629072 | 431 |
| 668 | 3300028380 | Ga0268265_10015487 | Ga0268265_100154873 | 431 |
| 669 | 3300028380 | Ga0268265_10058818 | Ga0268265_100588182 | 431 |
| 670 | 3300028381 | Ga0268264_10000065 | Ga0268264_1000006531 | 431 |
| 671 | 3300028381 | Ga0268264_10007132 | Ga0268264_100071326 | 431 |
| 672 | 3300028556 | Ga0265337_1022685 | Ga0265337_10226851 | 431 |
| 673 | 3300028558 | Ga0265326_10025223 | Ga0265326_100252231 | 431 |
| 674 | 3300028563 | Ga0265319_1029202 | Ga0265319_10292022 | 431 |
| 675 | 3300028573 | Ga0265334_10045023 | Ga0265334_100450232 | 431 |
| 676 | 3300028577 | Ga0265318_10044010 | Ga0265318_100440101 | 431 |
| 677 | 3300028653 | Ga0265323_10031892 | Ga0265323_100318922 | 431 |
| 678 | 3300028666 | Ga0265336_10000481 | Ga0265336_100004814 | 431 |
| 679 | 3300028786 | Ga0307517_10000279 | Ga0307517_1000027943 | 431 |
| 680 | 3300028794 | Ga0307515_10012109 | Ga0307515_100121099 | 431 |
| 681 | 3300028800 | Ga0265338_10000317 | Ga0265338_1000031753 | 431 |
| 682 | 3300029957 | Ga0265324_10007835 | Ga0265324_100078355 | 431 |
| 683 | 3300029957 | Ga0265324_10009946 | Ga0265324_100099464 | 431 |
| 684 | 3300029957 | Ga0265324_10015575 | Ga0265324_100155751 | 431 |
| 685 | 3300031239 | Ga0265328_10000750 | Ga0265328_1000075012 | 431 |
| 686 | 3300031239 | Ga0265328_10011927 | Ga0265328_100119273 | 431 |
| 687 | 3300031239 | Ga0265328_10042051 | Ga0265328_100420512 | 431 |
| 688 | 3300031247 | Ga0265340_10006005 | Ga0265340_100060058 | 431 |
| 689 | 3300031250 | Ga0265331_10000497 | Ga0265331_100004977 | 431 |
| 690 | 3300031250 | Ga0265331_10032599 | Ga0265331_100325992 | 431 |
| 691 | 3300031251 | Ga0265327_10000810 | Ga0265327_1000081032 | 431 |
| 692 | 3300031251 | Ga0265327_10005760 | Ga0265327_100057609 | 431 |
| 693 | 3300031344 | Ga0265316_10039472 | Ga0265316_100394723 | 431 |
| 694 | 3300031507 | Ga0307509_10024299 | Ga0307509_100242992 | 431 |
| 695 | 3300031548 | Ga0307408_100154312 | Ga0307408_1001543122 | 431 |
| 696 | 3300031616 | Ga0307508_10000514 | Ga0307508_1000051430 | 431 |
| 697 | 3300031711 | Ga0265314_10036474 | Ga0265314_100364742 | 431 |
| 698 | 3300031711 | Ga0265314_10065731 | Ga0265314_100657312 | 431 |
| 699 | 3300031711 | Ga0265314_10100505 | Ga0265314_101005051 | 431 |
| 700 | 3300031730 | Ga0307516_10001288 | Ga0307516_1000128819 | 431 |
| 701 | 3300031730 | Ga0307516_10010587 | Ga0307516_100105874 | 431 |
| 702 | 3300031730 | Ga0307516_10212641 | Ga0307516_102126412 | 431 |
| 703 | 3300033180 | Ga0307510_10035023 | Ga0307510_100350238 | 431 |
| 704 | 3300033180 | Ga0307510_10042213 | Ga0307510_100422133 | 431 |
| 705 | 3300033180 | Ga0307510_10115841 | Ga0307510_101158413 | 431 |
| 706 | 3300033180 | Ga0307510_10117603 | Ga0307510_101176032 | 431 |
| 707 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003427 | 431 |
| 708 | 3300035083 | Ga0373926_0013951 | Ga0373926_0013951_986_2281 | 431 |
| 709 | 3300035086 | Ga0373934_0018837 | Ga0373934_0018837_1190_2485 | 431 |
| 710 | 3300035111 | Ga0373923_0028209 | Ga0373923_0028209_523_1818 | 431 |
| 711 | 3300035113 | Ga0373936_0047639 | Ga0373936_0047639_172_1467 | 431 |
| 712 | 3300035113 | Ga0373936_0051498 | Ga0373936_0051498_52_1347 | 431 |
| 713 | 3300035117 | Ga0373953_0004607 | Ga0373953_0004607_2962_4257 | 431 |
| 714 | 3300035117 | Ga0373953_0017845 | Ga0373953_0017845_189_1484 | 431 |
| 715 | 3300035117 | Ga0373953_0020181 | Ga0373953_0020181_472_1767 | 431 |
| 716 | 3300035118 | Ga0373954_0005482 | Ga0373954_0005482_2060_3355 | 431 |
| 717 | 3300035118 | Ga0373954_0025608 | Ga0373954_0025608_865_2160 | 431 |
| 718 | 3300035119 | Ga0373956_0011396 | Ga0373956_0011396_994_2289 | 431 |
| 719 | 3300035119 | Ga0373956_0015134 | Ga0373956_0015134_940_2235 | 431 |
| 720 | 3300035120 | Ga0373957_0006039 | Ga0373957_0006039_1508_2803 | 431 |
| 721 | 3300035120 | Ga0373957_0008872 | Ga0373957_0008872_879_2174 | 431 |
| 722 | 3300035121 | Ga0373960_0005258 | Ga0373960_0005258_1487_2782 | 431 |
| 723 | 3300035170 | Ga0373943_0011057 | Ga0373943_0011057_2531_3826 | 431 |
| 724 | 3300035170 | Ga0373943_0014684 | Ga0373943_0014684_1829_3124 | 431 |
| 725 | 3300035171 | Ga0373946_0064896 | Ga0373946_0064896_67_1362 | 431 |
| 726 | 3300035172 | Ga0373955_0039968 | Ga0373955_0039968_551_1846 | 431 |
| 727 | 3300035241 | Ga0373961_0003418 | Ga0373961_0003418_1351_2646 | 431 |
| 728 | 3300035410 | Ga0373924_0009804 | Ga0373924_0009804_29_1324 | 431 |
| 729 | 3300035410 | Ga0373924_0013743 | Ga0373924_0013743_455_1750 | 431 |
| 730 | 3300035410 | Ga0373924_0016970 | Ga0373924_0016970_1029_2324 | 431 |
| 731 | 3300035410 | Ga0373924_0023653 | Ga0373924_0023653_385_1680 | 431 |
| 732 | 3300035410 | Ga0373924_0025392 | Ga0373924_0025392_180_1475 | 431 |
| 733 | 3300035691 | Ga0373931_0024832 | Ga0373931_0024832_229_1524 | 431 |
| 734 | 3300035692 | Ga0373935_0075116 | Ga0373935_0075116_43_1338 | 431 |
| 735 | 3300035695 | Ga0373927_0007448 | Ga0373927_0007448_2546_3841 | 431 |
| 736 | 3300035695 | Ga0373927_0021594 | Ga0373927_0021594_2745_4040 | 431 |
| 737 | 3300035695 | Ga0373927_0029712 | Ga0373927_0029712_1564_2859 | 431 |
| 738 | 3300035695 | Ga0373927_0065400 | Ga0373927_0065400_751_2046 | 431 |
| 739 | 3300035695 | Ga0373927_0089216 | Ga0373927_0089216_653_1948 | 431 |
| 740 | 3300035724 | Ga0373933_0001552 | Ga0373933_0001552_9313_10608 | 431 |
| 741 | 3300035724 | Ga0373933_0056454 | Ga0373933_0056454_607_1902 | 431 |
| 742 | 3300035725 | Ga0373947_0017234 | Ga0373947_0017234_2460_3755 | 431 |
| 743 | 3300036401 | Ga0373937_0000352 | Ga0373937_0000352_34209_35504 | 431 |
| 744 | 3300036401 | Ga0373937_0070802 | Ga0373937_0070802_464_1759 | 431 |
| 745 | 3300037068 | Ga0373925_0014183 | Ga0373925_0014183_451_1746 | 431 |
| 746 | 3300037068 | Ga0373925_0034822 | Ga0373925_0034822_1949_3244 | 431 |
| 747 | 3300037068 | Ga0373925_0072684 | Ga0373925_0072684_632_1927 | 431 |
| 748 | 3300037312 | Ga0395899_0053228 | Ga0395899_0053228_410_1705 | 431 |
| 749 | 3300037312 | Ga0395899_0171799 | Ga0395899_0171799_11_1306 | 431 |
| 750 | 3300037418 | Ga0395900_0000982 | Ga0395900_0000982_7145_8440 | 431 |
| 751 | 3300037418 | Ga0395900_0010894 | Ga0395900_0010894_1500_2795 | 431 |
| 752 | 3300037418 | Ga0395900_0034116 | Ga0395900_0034116_998_2293 | 431 |
| 753 | 3300037418 | Ga0395900_0069121 | Ga0395900_0069121_1210_2505 | 431 |
| 754 | 3300037418 | Ga0395900_0179921 | Ga0395900_0179921_445_1740 | 431 |
| 755 | 3300037418 | Ga0395900_0192842 | Ga0395900_0192842_327_1622 | 431 |
| 756 | 3300037466 | Ga0395898_0002224 | Ga0395898_0002224_15760_17055 | 431 |
| 757 | 3300037466 | Ga0395898_0005680 | Ga0395898_0005680_8033_9328 | 431 |
| 758 | 3300037466 | Ga0395898_0089280 | Ga0395898_0089280_568_1863 | 431 |
| 759 | 3300037471 | Ga0395905_0000710 | Ga0395905_0000710_35324_36619 | 431 |
| 760 | 3300037471 | Ga0395905_0048406 | Ga0395905_0048406_2506_3801 | 431 |
| 761 | 3300037853 | Ga0436364_0084731 | Ga0436364_0084731_1144_2439 | 431 |
| 762 | 3300037853 | Ga0436364_0923208 | Ga0436364_0923208_124_1545 | 431 |
| 763 | 3300038443 | Ga0395901_0023426 | Ga0395901_0023426_142_1437 | 431 |
| 764 | 3300038443 | Ga0395901_0139718 | Ga0395901_0139718_543_1838 | 431 |
| 765 | 3300039062 | Ga0400483_179422 | Ga0400483_179422_5230_6525 | 431 |
| 766 | 3300039062 | Ga0400483_238094 | Ga0400483_238094_4184_5479 | 431 |
| 767 | 3300039110 | Ga0400487_10787 | Ga0400487_10787_1893_3203 | 431 |
| 768 | 3300039437 | Ga0436365_0771783 | Ga0436365_0771783_20479_21774 | 431 |
| 769 | 3300039437 | Ga0436365_1805073 | Ga0436365_1805073_480_1808 | 431 |
| 770 | 3300039438 | Ga0436360_0339475 | Ga0436360_0339475_340_1635 | 431 |
| 771 | 3300039447 | Ga0436361_0799126 | Ga0436361_0799126_128_1423 | 431 |
| 772 | 3300039447 | Ga0436361_0852708 | Ga0436361_0852708_280_1593 | 431 |
| 773 | 3300039450 | Ga0436363_1518892 | Ga0436363_1518892_435_1730 | 431 |
| 774 | 3300039453 | Ga0436362_0347390 | Ga0436362_0347390_1898_3193 | 431 |
| 775 | 3300041405 | Ga0439438_010411 | Ga0439438_010411_1246_2541 | 431 |
| 776 | 3300041413 | Ga0439465_0013506 | Ga0439465_0013506_709_2004 | 431 |
| 777 | 3300042876 | Ga0451577_0313931 | Ga0451577_0313931_103_1404 | 431 |
| 778 | 3300044658 | Ga0466972_0000136 | Ga0466972_0000136_55020_56315 | 431 |
| 779 | 3300044683 | Ga0466965_0045560 | Ga0466965_0045560_604_1899 | 431 |
| 780 | 3300044684 | Ga0466966_0002418 | Ga0466966_0002418_3368_4663 | 431 |
| 781 | 3300044693 | Ga0466961_0000324 | Ga0466961_0000324_10232_11527 | 431 |
| 782 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_753410_754717 | 431 |
| 783 | 3300044712 | Ga0453684_0000031 | Ga0453684_0000031_524282_525583 | 431 |
| 784 | 3300044842 | Ga0466957_0135722 | Ga0466957_0135722_221_1516 | 431 |
| 785 | 3300045049 | Ga0466959_0047380 | Ga0466959_0047380_1533_2828 | 431 |
| 786 | 3300045976 | Ga0466967_0019583 | Ga0466967_0019583_1400_2695 | 431 |
| 787 | 3300045976 | Ga0466967_0098327 | Ga0466967_0098327_1151_2488 | 431 |
| 788 | 3300045976 | Ga0466967_0115264 | Ga0466967_0115264_362_1657 | 431 |
| 789 | 3300045976 | Ga0466967_0145779 | Ga0466967_0145779_62_1381 | 431 |
| 790 | 3300046452 | Ga0495617_017014 | Ga0495617_017014_224_1519 | 431 |
| 791 | 3300046454 | Ga0495592_0018882 | Ga0495592_0018882_2044_3372 | 431 |
| 792 | 3300046454 | Ga0495592_0051566 | Ga0495592_0051566_1199_2494 | 431 |
| 793 | 3300046454 | Ga0495592_0054426 | Ga0495592_0054426_354_1649 | 431 |
| 794 | 3300046454 | Ga0495592_0107296 | Ga0495592_0107296_335_1630 | 431 |
| 795 | 3300046454 | Ga0495592_0126889 | Ga0495592_0126889_313_1608 | 431 |
| 796 | 3300046455 | Ga0495603_0000330 | Ga0495603_0000330_22922_24217 | 431 |
| 797 | 3300046455 | Ga0495603_0002054 | Ga0495603_0002054_9485_10780 | 431 |
| 798 | 3300046455 | Ga0495603_0040931 | Ga0495603_0040931_1115_2410 | 431 |
| 799 | 3300046455 | Ga0495603_0094746 | Ga0495603_0094746_129_1424 | 431 |
| 800 | 3300046459 | Ga0495629_0000360 | Ga0495629_0000360_22643_23938 | 431 |
| 801 | 3300046459 | Ga0495629_0024403 | Ga0495629_0024403_1865_3160 | 431 |
| 802 | 3300046459 | Ga0495629_0037632 | Ga0495629_0037632_144_1439 | 431 |
| 803 | 3300046460 | Ga0495638_0006922 | Ga0495638_0006922_1836_3131 | 431 |
| 804 | 3300046461 | Ga0495641_0005597 | Ga0495641_0005597_5755_7050 | 431 |
| 805 | 3300046462 | Ga0495651_0021480 | Ga0495651_0021480_2234_3529 | 431 |
| 806 | 3300046462 | Ga0495651_0024011 | Ga0495651_0024011_3435_4730 | 431 |
| 807 | 3300046462 | Ga0495651_0026750 | Ga0495651_0026750_915_2210 | 431 |
| 808 | 3300046462 | Ga0495651_0030511 | Ga0495651_0030511_866_2161 | 431 |
| 809 | 3300046462 | Ga0495651_0088807 | Ga0495651_0088807_627_1922 | 431 |
| 810 | 3300046463 | Ga0495653_0003278 | Ga0495653_0003278_6363_7658 | 431 |
| 811 | 3300046463 | Ga0495653_0011730 | Ga0495653_0011730_944_2239 | 431 |
| 812 | 3300046463 | Ga0495653_0051629 | Ga0495653_0051629_1685_2980 | 431 |
| 813 | 3300046472 | Ga0495580_0001688 | Ga0495580_0001688_10050_11345 | 431 |
| 814 | 3300046473 | Ga0495582_0000214 | Ga0495582_0000214_19567_20862 | 431 |
| 815 | 3300046475 | Ga0495639_0000015 | Ga0495639_0000015_72454_73749 | 431 |
| 816 | 3300046475 | Ga0495639_0030698 | Ga0495639_0030698_759_2102 | 431 |
| 817 | 3300046475 | Ga0495639_0033968 | Ga0495639_0033968_561_1856 | 431 |
| 818 | 3300046476 | Ga0495662_0004450 | Ga0495662_0004450_1380_2675 | 431 |
| 819 | 3300046477 | Ga0495664_0016059 | Ga0495664_0016059_581_1876 | 431 |
| 820 | 3300046477 | Ga0495664_0024564 | Ga0495664_0024564_2184_3479 | 431 |
| 821 | 3300046477 | Ga0495664_0061683 | Ga0495664_0061683_17_1312 | 431 |
| 822 | 3300046492 | Ga0495585_0105842 | Ga0495585_0105842_154_1449 | 431 |
| 823 | 3300046499 | Ga0495594_0001132 | Ga0495594_0001132_5956_7251 | 431 |
| 824 | 3300046499 | Ga0495594_0093074 | Ga0495594_0093074_87_1382 | 431 |
| 825 | 3300046507 | Ga0495606_0003820 | Ga0495606_0003820_10319_11614 | 431 |
| 826 | 3300046507 | Ga0495606_0082434 | Ga0495606_0082434_515_1810 | 431 |
| 827 | 3300046511 | Ga0495608_0002823 | Ga0495608_0002823_6954_8249 | 431 |
| 828 | 3300046511 | Ga0495608_0009353 | Ga0495608_0009353_4117_5412 | 431 |
| 829 | 3300046511 | Ga0495608_0021135 | Ga0495608_0021135_489_1784 | 431 |
| 830 | 3300046514 | Ga0495618_0002341 | Ga0495618_0002341_4384_5679 | 431 |
| 831 | 3300046514 | Ga0495618_0032473 | Ga0495618_0032473_1460_2755 | 431 |
| 832 | 3300046516 | Ga0495628_0001092 | Ga0495628_0001092_14099_15394 | 431 |
| 833 | 3300046516 | Ga0495628_0044514 | Ga0495628_0044514_1673_2968 | 431 |
| 834 | 3300046516 | Ga0495628_0071776 | Ga0495628_0071776_353_1648 | 431 |
| 835 | 3300046517 | Ga0495630_0011905 | Ga0495630_0011905_1126_2421 | 431 |
| 836 | 3300046517 | Ga0495630_0080137 | Ga0495630_0080137_358_1653 | 431 |
| 837 | 3300046524 | Ga0495648_0027979 | Ga0495648_0027979_2326_3621 | 431 |
| 838 | 3300046524 | Ga0495648_0075710 | Ga0495648_0075710_33_1328 | 431 |
| 839 | 3300046526 | Ga0495666_0056663 | Ga0495666_0056663_530_1825 | 431 |
| 840 | 3300046529 | Ga0495652_0002591 | Ga0495652_0002591_1238_2533 | 431 |
| 841 | 3300046529 | Ga0495652_0007194 | Ga0495652_0007194_8294_9589 | 431 |
| 842 | 3300046529 | Ga0495652_0009095 | Ga0495652_0009095_4690_5985 | 431 |
| 843 | 3300046529 | Ga0495652_0010234 | Ga0495652_0010234_5628_6923 | 431 |
| 844 | 3300046529 | Ga0495652_0024384 | Ga0495652_0024384_1004_2299 | 431 |
| 845 | 3300046529 | Ga0495652_0053753 | Ga0495652_0053753_1071_2366 | 431 |
| 846 | 3300046531 | Ga0495665_0033315 | Ga0495665_0033315_881_2176 | 431 |
| 847 | 3300046533 | Ga0495640_0002801 | Ga0495640_0002801_11295_12590 | 431 |
| 848 | 3300046533 | Ga0495640_0003290 | Ga0495640_0003290_1842_3137 | 431 |
| 849 | 3300046533 | Ga0495640_0006186 | Ga0495640_0006186_1069_2364 | 431 |
| 850 | 3300046533 | Ga0495640_0013426 | Ga0495640_0013426_3751_5046 | 431 |
| 851 | 3300046533 | Ga0495640_0076213 | Ga0495640_0076213_609_1904 | 431 |
| 852 | 3300046535 | Ga0495586_0038272 | Ga0495586_0038272_929_2224 | 431 |
| 853 | 3300046536 | Ga0495587_0000506 | Ga0495587_0000506_14246_15541 | 431 |
| 854 | 3300046536 | Ga0495587_0020512 | Ga0495587_0020512_2283_3578 | 431 |
| 855 | 3300046543 | Ga0495645_0018023 | Ga0495645_0018023_917_2212 | 431 |
| 856 | 3300046543 | Ga0495645_0029296 | Ga0495645_0029296_38_1333 | 431 |
| 857 | 3300046543 | Ga0495645_0053248 | Ga0495645_0053248_491_1786 | 431 |
| 858 | 3300046557 | Ga0495622_0002296 | Ga0495622_0002296_1021_2316 | 431 |
| 859 | 3300046557 | Ga0495622_0008179 | Ga0495622_0008179_493_1788 | 431 |
| 860 | 3300046559 | Ga0495667_0001667 | Ga0495667_0001667_4853_6148 | 431 |
| 861 | 3300046559 | Ga0495667_0021284 | Ga0495667_0021284_235_1563 | 431 |
| 862 | 3300046559 | Ga0495667_0026223 | Ga0495667_0026223_2095_3390 | 431 |
| 863 | 3300046559 | Ga0495667_0026794 | Ga0495667_0026794_2004_3299 | 431 |
| 864 | 3300046559 | Ga0495667_0034204 | Ga0495667_0034204_864_2159 | 431 |
| 865 | 3300046559 | Ga0495667_0078620 | Ga0495667_0078620_354_1649 | 431 |
| 866 | 3300046615 | Ga0495656_0005052 | Ga0495656_0005052_1574_2869 | 431 |
| 867 | 3300046615 | Ga0495656_0006995 | Ga0495656_0006995_2256_3551 | 431 |
| 868 | 3300046616 | Ga0495668_0095589 | Ga0495668_0095589_321_1616 | 431 |
| 869 | 3300046642 | Ga0495634_0000395 | Ga0495634_0000395_23130_24425 | 431 |
| 870 | 3300046642 | Ga0495634_0018348 | Ga0495634_0018348_2745_4040 | 431 |
| 871 | 3300046642 | Ga0495634_0030311 | Ga0495634_0030311_1196_2491 | 431 |
| 872 | 3300046642 | Ga0495634_0045845 | Ga0495634_0045845_1293_2588 | 431 |
| 873 | 3300046642 | Ga0495634_0086782 | Ga0495634_0086782_505_1800 | 431 |
| 874 | 3300046663 | Ga0495635_0000358 | Ga0495635_0000358_188_1483 | 431 |
| 875 | 3300046663 | Ga0495635_0001697 | Ga0495635_0001697_991_2286 | 431 |
| 876 | 3300046663 | Ga0495635_0004397 | Ga0495635_0004397_4691_5986 | 431 |
| 877 | 3300046663 | Ga0495635_0035275 | Ga0495635_0035275_889_2184 | 431 |
| 878 | 3300046664 | Ga0495659_0060432 | Ga0495659_0060432_37_1332 | 431 |
| 879 | 3300046665 | Ga0495661_0006955 | Ga0495661_0006955_6551_7879 | 431 |
| 880 | 3300046674 | Ga0495588_0015433 | Ga0495588_0015433_460_1755 | 431 |
| 881 | 3300046674 | Ga0495588_0090246 | Ga0495588_0090246_141_1436 | 431 |
| 882 | 3300046675 | Ga0495657_0005774 | Ga0495657_0005774_1556_2851 | 431 |
| 883 | 3300046678 | Ga0495599_0020937 | Ga0495599_0020937_1495_2790 | 431 |
| 884 | 3300046678 | Ga0495599_0026732 | Ga0495599_0026732_2126_3421 | 431 |
| 885 | 3300046678 | Ga0495599_0096971 | Ga0495599_0096971_336_1631 | 431 |
| 886 | 3300046679 | Ga0495623_0004938 | Ga0495623_0004938_3190_4485 | 431 |
| 887 | 3300046679 | Ga0495623_0010819 | Ga0495623_0010819_326_1621 | 431 |
| 888 | 3300046679 | Ga0495623_0013744 | Ga0495623_0013744_1362_2657 | 431 |
| 889 | 3300046679 | Ga0495623_0025207 | Ga0495623_0025207_1971_3266 | 431 |
| 890 | 3300046680 | Ga0495646_0022504 | Ga0495646_0022504_1169_2464 | 431 |
| 891 | 3300046680 | Ga0495646_0024852 | Ga0495646_0024852_434_1729 | 431 |
| 892 | 3300046680 | Ga0495646_0027000 | Ga0495646_0027000_1370_2665 | 431 |
| 893 | 3300046680 | Ga0495646_0029540 | Ga0495646_0029540_1011_2306 | 431 |
| 894 | 3300046680 | Ga0495646_0056869 | Ga0495646_0056869_971_2266 | 431 |
| 895 | 3300046681 | Ga0495647_0004081 | Ga0495647_0004081_1148_2443 | 431 |
| 896 | 3300046681 | Ga0495647_0019929 | Ga0495647_0019929_954_2249 | 431 |
| 897 | 3300046683 | Ga0495658_0000342 | Ga0495658_0000342_19681_20976 | 431 |
| 898 | 3300046683 | Ga0495658_0003508 | Ga0495658_0003508_5913_7208 | 431 |
| 899 | 3300046684 | Ga0495669_0024978 | Ga0495669_0024978_856_2151 | 431 |
| 900 | 3300046689 | Ga0495613_0023281 | Ga0495613_0023281_1514_2809 | 431 |
| 901 | 3300046689 | Ga0495613_0029997 | Ga0495613_0029997_1575_2870 | 431 |
| 902 | 3300046690 | Ga0495624_0021313 | Ga0495624_0021313_339_1634 | 431 |
| 903 | 3300046690 | Ga0495624_0052761 | Ga0495624_0052761_1000_2295 | 431 |
| 904 | 3300046691 | Ga0495670_0063032 | Ga0495670_0063032_289_1584 | 431 |
| 905 | 3300046692 | Ga0495671_0015491 | Ga0495671_0015491_2157_3452 | 431 |
| 906 | 3300046694 | Ga0495649_0006829 | Ga0495649_0006829_4546_5841 | 431 |
| 907 | 3300046694 | Ga0495649_0088203 | Ga0495649_0088203_160_1455 | 431 |
| 908 | 3300046809 | Ga0495600_0007532 | Ga0495600_0007532_326_1621 | 431 |
| 909 | 3300046809 | Ga0495600_0008402 | Ga0495600_0008402_3650_4945 | 431 |
| 910 | 3300046809 | Ga0495600_0061182 | Ga0495600_0061182_623_1918 | 431 |
| 911 | 3300047315 | Ga0495581_0000341 | Ga0495581_0000341_12727_14022 | 431 |
| 912 | 3300047315 | Ga0495581_0020661 | Ga0495581_0020661_758_2053 | 431 |
| 913 | 3300047315 | Ga0495581_0088213 | Ga0495581_0088213_110_1453 | 431 |
| 914 | 3300047317 | Ga0495604_0000765 | Ga0495604_0000765_10841_12136 | 431 |
| 915 | 3300047317 | Ga0495604_0008805 | Ga0495604_0008805_4976_6271 | 431 |
| 916 | 3300047317 | Ga0495604_0030226 | Ga0495604_0030226_2005_3300 | 431 |
| 917 | 3300047319 | Ga0495674_0000557 | Ga0495674_0000557_15756_17051 | 431 |
| 918 | 3300047319 | Ga0495674_0003736 | Ga0495674_0003736_8053_9348 | 431 |
| 919 | 3300047319 | Ga0495674_0038445 | Ga0495674_0038445_176_1471 | 431 |
| 920 | 3300047319 | Ga0495674_0043202 | Ga0495674_0043202_2422_3717 | 431 |
| 921 | 3300047319 | Ga0495674_0057285 | Ga0495674_0057285_1644_2939 | 431 |
| 922 | 3300047319 | Ga0495674_0057739 | Ga0495674_0057739_1379_2674 | 431 |
| 923 | 3300047320 | Ga0495672_0106235 | Ga0495672_0106235_37_1332 | 431 |
| 924 | 3300047321 | Ga0495676_0083714 | Ga0495676_0083714_915_2210 | 431 |
| 925 | 3300047322 | Ga0495680_0001188 | Ga0495680_0001188_15442_16737 | 431 |
| 926 | 3300047322 | Ga0495680_0004754 | Ga0495680_0004754_6961_8256 | 431 |
| 927 | 3300047322 | Ga0495680_0026674 | Ga0495680_0026674_1883_3178 | 431 |
| 928 | 3300047322 | Ga0495680_0102516 | Ga0495680_0102516_482_1777 | 431 |
| 929 | 3300047444 | Ga0495675_0002133 | Ga0495675_0002133_5062_6357 | 431 |
| 930 | 3300047444 | Ga0495675_0011233 | Ga0495675_0011233_1788_3083 | 431 |
| 931 | 3300047444 | Ga0495675_0020004 | Ga0495675_0020004_1189_2484 | 431 |
| 932 | 3300047444 | Ga0495675_0031462 | Ga0495675_0031462_1580_2875 | 431 |
| 933 | 3300047471 | Ga0495684_0000897 | Ga0495684_0000897_11779_13074 | 431 |
| 934 | 3300047471 | Ga0495684_0001995 | Ga0495684_0001995_9787_11082 | 431 |
| 935 | 3300047471 | Ga0495684_0033209 | Ga0495684_0033209_926_2221 | 431 |
| 936 | 3300047471 | Ga0495684_0052028 | Ga0495684_0052028_162_1457 | 431 |
| 937 | 3300047472 | Ga0495686_0124457 | Ga0495686_0124457_107_1402 | 431 |
| 938 | 3300047673 | Ga0495593_0000506 | Ga0495593_0000506_3327_4622 | 431 |
| 939 | 3300047673 | Ga0495593_0031066 | Ga0495593_0031066_1556_2851 | 431 |
| 940 | 3300048088 | Ga0495602_0002695 | Ga0495602_0002695_13048_14343 | 431 |
| 941 | 3300048088 | Ga0495602_0026279 | Ga0495602_0026279_1078_2373 | 431 |
| 942 | 3300048088 | Ga0495602_0116189 | Ga0495602_0116189_287_1582 | 431 |
| 943 | 3300048089 | Ga0495614_0084920 | Ga0495614_0084920_64_1359 | 431 |
| 944 | 3300048903 | Ga0496100_0020491 | Ga0496100_0020491_684_1979 | 431 |
| 945 | 3300048903 | Ga0496100_0080534 | Ga0496100_0080534_325_1620 | 431 |
| 946 | 3300048903 | Ga0496100_0147768 | Ga0496100_0147768_263_1558 | 431 |
| 947 | 3300048904 | Ga0496101_0000648 | Ga0496101_0000648_13908_15203 | 431 |
| 948 | 3300048904 | Ga0496101_0041620 | Ga0496101_0041620_738_2033 | 431 |
| 949 | 3300048905 | Ga0496102_0003521 | Ga0496102_0003521_808_2103 | 431 |
| 950 | 3300048905 | Ga0496102_0067115 | Ga0496102_0067115_1921_3216 | 431 |
| 951 | 3300048906 | Ga0496103_0058435 | Ga0496103_0058435_314_1609 | 431 |
| 952 | 3300048907 | Ga0496104_0013552 | Ga0496104_0013552_2044_3339 | 431 |
| 953 | 3300048907 | Ga0496104_0018065 | Ga0496104_0018065_2730_4025 | 431 |
| 954 | 3300048907 | Ga0496104_0037271 | Ga0496104_0037271_73_1392 | 431 |
| 955 | 3300048907 | Ga0496104_0049276 | Ga0496104_0049276_2153_3448 | 431 |
| 956 | 3300048907 | Ga0496104_0085080 | Ga0496104_0085080_1135_2430 | 431 |
| 957 | 3300048907 | Ga0496104_0086957 | Ga0496104_0086957_1413_2708 | 431 |
| 958 | 3300048907 | Ga0496104_0181384 | Ga0496104_0181384_418_1713 | 431 |
| 959 | 3300048908 | Ga0496105_0027418 | Ga0496105_0027418_2957_4252 | 431 |
| 960 | 3300048908 | Ga0496105_0052854 | Ga0496105_0052854_156_1451 | 431 |
| 961 | 3300048908 | Ga0496105_0092141 | Ga0496105_0092141_560_1855 | 431 |
| 962 | 3300048909 | Ga0496106_0001529 | Ga0496106_0001529_5348_6643 | 431 |
| 963 | 3300048909 | Ga0496106_0007572 | Ga0496106_0007572_6709_8004 | 431 |
| 964 | 3300048909 | Ga0496106_0011062 | Ga0496106_0011062_2929_4224 | 431 |
| 965 | 3300048909 | Ga0496106_0038241 | Ga0496106_0038241_692_1987 | 431 |
| 966 | 3300048909 | Ga0496106_0162265 | Ga0496106_0162265_393_1688 | 431 |
| 967 | 3300048909 | Ga0496106_0202157 | Ga0496106_0202157_255_1550 | 431 |
| 968 | 3300048910 | Ga0496107_0004714 | Ga0496107_0004714_6679_7974 | 431 |
| 969 | 3300048910 | Ga0496107_0045648 | Ga0496107_0045648_1338_2633 | 431 |
| 970 | 3300048910 | Ga0496107_0067639 | Ga0496107_0067639_467_1762 | 431 |
| 971 | 3300048911 | Ga0496108_0000764 | Ga0496108_0000764_21310_22605 | 431 |
| 972 | 3300048911 | Ga0496108_0033486 | Ga0496108_0033486_49_1368 | 431 |
| 973 | 3300048911 | Ga0496108_0067856 | Ga0496108_0067856_401_1696 | 431 |
| 974 | 3300048912 | Ga0496109_0002732 | Ga0496109_0002732_6427_7722 | 431 |
| 975 | 3300048912 | Ga0496109_0004357 | Ga0496109_0004357_2076_3371 | 431 |
| 976 | 3300048912 | Ga0496109_0206856 | Ga0496109_0206856_61_1380 | 431 |
| 977 | 3300048913 | Ga0496110_0003472 | Ga0496110_0003472_6149_7444 | 431 |
| 978 | 3300048913 | Ga0496110_0026093 | Ga0496110_0026093_1729_3024 | 431 |
| 979 | 3300048913 | Ga0496110_0096309 | Ga0496110_0096309_774_2069 | 431 |
| 980 | 3300048913 | Ga0496110_0112586 | Ga0496110_0112586_549_1844 | 431 |
| 981 | 3300048913 | Ga0496110_0266767 | Ga0496110_0266767_231_1526 | 431 |
| 982 | 3300048913 | Ga0496110_0327938 | Ga0496110_0327938_65_1360 | 431 |
| 983 | 3300048914 | Ga0496111_0003253 | Ga0496111_0003253_6473_7768 | 431 |
| 984 | 3300048915 | Ga0496112_0000031 | Ga0496112_0000031_81219_82514 | 431 |
| 985 | 3300048915 | Ga0496112_0004915 | Ga0496112_0004915_8498_9793 | 431 |
| 986 | 3300048915 | Ga0496112_0004941 | Ga0496112_0004941_4839_6134 | 431 |
| 987 | 3300048915 | Ga0496112_0008448 | Ga0496112_0008448_3721_5040 | 431 |
| 988 | 3300048915 | Ga0496112_0041116 | Ga0496112_0041116_648_1943 | 431 |
| 989 | 3300048915 | Ga0496112_0069229 | Ga0496112_0069229_937_2232 | 431 |
| 990 | 3300048915 | Ga0496112_0075336 | Ga0496112_0075336_814_2109 | 431 |
| 991 | 3300048915 | Ga0496112_0179492 | Ga0496112_0179492_640_1935 | 431 |
| 992 | 3300048916 | Ga0496113_0001977 | Ga0496113_0001977_4801_6096 | 431 |
| 993 | 3300048916 | Ga0496113_0047075 | Ga0496113_0047075_199_1494 | 431 |
| 994 | 3300048916 | Ga0496113_0050949 | Ga0496113_0050949_665_1960 | 431 |
| 995 | 3300048917 | Ga0496114_0009865 | Ga0496114_0009865_782_2077 | 431 |
| 996 | 3300048917 | Ga0496114_0151894 | Ga0496114_0151894_68_1363 | 431 |
| 997 | 3300048917 | Ga0496114_0230589 | Ga0496114_0230589_227_1522 | 431 |
| 998 | 3300048918 | Ga0496115_0009797 | Ga0496115_0009797_1942_3237 | 431 |
| 999 | 3300048918 | Ga0496115_0073197 | Ga0496115_0073197_867_2162 | 431 |
| 1000 | 3300048918 | Ga0496115_0083531 | Ga0496115_0083531_173_1468 | 431 |
| 1001 | 3300048918 | Ga0496115_0094179 | Ga0496115_0094179_140_1435 | 431 |
| 1002 | 3300048918 | Ga0496115_0116827 | Ga0496115_0116827_838_2133 | 431 |
| 1003 | 3300048918 | Ga0496115_0118715 | Ga0496115_0118715_577_1872 | 431 |
| 1004 | 3300048919 | Ga0496116_0014153 | Ga0496116_0014153_1692_2987 | 431 |
| 1005 | 3300048920 | Ga0496117_0009844 | Ga0496117_0009844_6820_8115 | 431 |
| 1006 | 3300048920 | Ga0496117_0034745 | Ga0496117_0034745_885_2180 | 431 |
| 1007 | 3300048920 | Ga0496117_0071857 | Ga0496117_0071857_132_1460 | 431 |
| 1008 | 3300048921 | Ga0496118_0005918 | Ga0496118_0005918_3259_4554 | 431 |
| 1009 | 3300048921 | Ga0496118_0013173 | Ga0496118_0013173_6219_7514 | 431 |
| 1010 | 3300048921 | Ga0496118_0040100 | Ga0496118_0040100_1049_2344 | 431 |
| 1011 | 3300048921 | Ga0496118_0058734 | Ga0496118_0058734_655_1950 | 431 |
| 1012 | 3300048921 | Ga0496118_0146433 | Ga0496118_0146433_27_1322 | 431 |
| 1013 | 3300048922 | Ga0496119_0028655 | Ga0496119_0028655_602_1897 | 431 |
| 1014 | 3300048923 | Ga0496120_0014815 | Ga0496120_0014815_1260_2555 | 431 |
| 1015 | 3300048924 | Ga0496121_0000406 | Ga0496121_0000406_76849_78144 | 431 |
| 1016 | 3300048924 | Ga0496121_0000769 | Ga0496121_0000769_53488_54783 | 431 |
| 1017 | 3300048924 | Ga0496121_0002143 | Ga0496121_0002143_20925_22220 | 431 |
| 1018 | 3300048924 | Ga0496121_0012483 | Ga0496121_0012483_5060_6355 | 431 |
| 1019 | 3300048924 | Ga0496121_0027061 | Ga0496121_0027061_3477_4772 | 431 |
| 1020 | 3300048924 | Ga0496121_0068500 | Ga0496121_0068500_851_2146 | 431 |
| 1021 | 3300048924 | Ga0496121_0077208 | Ga0496121_0077208_18_1313 | 431 |
| 1022 | 3300048924 | Ga0496121_0110766 | Ga0496121_0110766_574_1869 | 431 |
| 1023 | 3300048925 | Ga0496122_0040920 | Ga0496122_0040920_1495_2790 | 431 |
| 1024 | 3300048925 | Ga0496122_0042875 | Ga0496122_0042875_868_2196 | 431 |
| 1025 | 3300048927 | Ga0496124_0002534 | Ga0496124_0002534_13589_14884 | 431 |
| 1026 | 3300048927 | Ga0496124_0044466 | Ga0496124_0044466_1738_3033 | 431 |
| 1027 | 3300048927 | Ga0496124_0221418 | Ga0496124_0221418_27_1322 | 431 |
| 1028 | 3300048928 | Ga0496125_0003938 | Ga0496125_0003938_2228_3523 | 431 |
| 1029 | 3300048928 | Ga0496125_0003990 | Ga0496125_0003990_13909_15204 | 431 |
| 1030 | 3300048928 | Ga0496125_0028546 | Ga0496125_0028546_2614_3942 | 431 |
| 1031 | 3300048928 | Ga0496125_0064486 | Ga0496125_0064486_773_2068 | 431 |
| 1032 | 3300048929 | Ga0496126_0010317 | Ga0496126_0010317_3062_4357 | 431 |
| 1033 | 3300048929 | Ga0496126_0034185 | Ga0496126_0034185_1966_3261 | 431 |
| 1034 | 3300048929 | Ga0496126_0051661 | Ga0496126_0051661_2406_3701 | 431 |
| 1035 | 3300048929 | Ga0496126_0095509 | Ga0496126_0095509_493_1788 | 431 |
| 1036 | 3300048929 | Ga0496126_0161425 | Ga0496126_0161425_98_1393 | 431 |
| 1037 | 3300048929 | Ga0496126_0268889 | Ga0496126_0268889_89_1384 | 431 |
| 1038 | 3300049460 | Ga0495682_0013780 | Ga0495682_0013780_1617_2912 | 431 |
| 1039 | 3300049568 | Ga0501031_0000207 | Ga0501031_0000207_4986_6281 | 431 |
| 1040 | 3300049569 | Ga0501032_0000189 | Ga0501032_0000189_13320_14615 | 431 |
| 1041 | 3300049569 | Ga0501032_0000252 | Ga0501032_0000252_24887_26182 | 431 |
| 1042 | 3300049569 | Ga0501032_0002406 | Ga0501032_0002406_9390_10685 | 431 |
| 1043 | 3300049569 | Ga0501032_0055999 | Ga0501032_0055999_1322_2617 | 431 |
| 1044 | 3300049570 | Ga0501033_0000082 | Ga0501033_0000082_41709_43004 | 431 |
| 1045 | 3300049570 | Ga0501033_0000493 | Ga0501033_0000493_26165_27460 | 431 |
| 1046 | 3300049570 | Ga0501033_0211862 | Ga0501033_0211862_32_1327 | 431 |
| 1047 | 3300049571 | Ga0501034_0018545 | Ga0501034_0018545_5552_6847 | 431 |
| 1048 | 3300049571 | Ga0501034_0022592 | Ga0501034_0022592_2984_4285 | 431 |
| 1049 | 3300049571 | Ga0501034_0047258 | Ga0501034_0047258_1587_2882 | 431 |
| 1050 | 3300049572 | Ga0501036_0000134 | Ga0501036_0000134_11248_12543 | 431 |
| 1051 | 3300049573 | Ga0501037_0000050 | Ga0501037_0000050_1286_2581 | 431 |
| 1052 | 3300049573 | Ga0501037_0002190 | Ga0501037_0002190_7627_8922 | 431 |
| 1053 | 3300049573 | Ga0501037_0002324 | Ga0501037_0002324_267_1562 | 431 |
| 1054 | 3300049574 | Ga0501038_0002725 | Ga0501038_0002725_6896_8191 | 431 |
| 1055 | 3300049574 | Ga0501038_0010145 | Ga0501038_0010145_6538_7833 | 431 |
| 1056 | 3300049574 | Ga0501038_0110841 | Ga0501038_0110841_307_1602 | 431 |
| 1057 | 3300049574 | Ga0501038_0136765 | Ga0501038_0136765_619_1914 | 431 |
| 1058 | 3300049575 | Ga0501039_0000064 | Ga0501039_0000064_72786_74081 | 431 |
| 1059 | 3300049575 | Ga0501039_0000123 | Ga0501039_0000123_43646_44941 | 431 |
| 1060 | 3300049575 | Ga0501039_0004985 | Ga0501039_0004985_3011_4306 | 431 |
| 1061 | 3300049575 | Ga0501039_0061672 | Ga0501039_0061672_488_1783 | 431 |
| 1062 | 3300049575 | Ga0501039_0142212 | Ga0501039_0142212_403_1698 | 431 |
| 1063 | 3300049578 | Ga0501042_0007944 | Ga0501042_0007944_1758_3053 | 431 |
| 1064 | 3300049578 | Ga0501042_0028604 | Ga0501042_0028604_719_2014 | 431 |
| 1065 | 3300049579 | Ga0501043_0000999 | Ga0501043_0000999_23182_24477 | 431 |
| 1066 | 3300049579 | Ga0501043_0007904 | Ga0501043_0007904_6890_8185 | 431 |
| 1067 | 3300049579 | Ga0501043_0010418 | Ga0501043_0010418_948_2243 | 431 |
| 1068 | 3300049580 | Ga0501046_0000434 | Ga0501046_0000434_17350_18645 | 431 |
| 1069 | 3300049581 | Ga0501047_0000131 | Ga0501047_0000131_49381_50676 | 431 |
| 1070 | 3300049581 | Ga0501047_0000866 | Ga0501047_0000866_17234_18529 | 431 |
| 1071 | 3300049582 | Ga0501048_0002325 | Ga0501048_0002325_10202_11497 | 431 |
| 1072 | 3300049582 | Ga0501048_0010161 | Ga0501048_0010161_4052_5347 | 431 |
| 1073 | 3300049583 | Ga0501067_0000628 | Ga0501067_0000628_16169_17464 | 431 |
| 1074 | 3300049583 | Ga0501067_0007650 | Ga0501067_0007650_3514_4809 | 431 |
| 1075 | 3300049584 | Ga0501068_0000080 | Ga0501068_0000080_23898_25193 | 431 |
| 1076 | 3300049584 | Ga0501068_0057044 | Ga0501068_0057044_118_1413 | 431 |
| 1077 | 3300049585 | Ga0501069_0002904 | Ga0501069_0002904_2053_3348 | 431 |
| 1078 | 3300049585 | Ga0501069_0029899 | Ga0501069_0029899_215_1510 | 431 |
| 1079 | 3300049586 | Ga0501070_0000209 | Ga0501070_0000209_52979_54274 | 431 |
| 1080 | 3300049586 | Ga0501070_0004437 | Ga0501070_0004437_7633_8928 | 431 |
| 1081 | 3300049586 | Ga0501070_0025205 | Ga0501070_0025205_2266_3561 | 431 |
| 1082 | 3300049587 | Ga0501071_0008177 | Ga0501071_0008177_4982_6277 | 431 |
| 1083 | 3300049587 | Ga0501071_0033785 | Ga0501071_0033785_1933_3228 | 431 |
| 1084 | 3300049587 | Ga0501071_0120488 | Ga0501071_0120488_92_1387 | 431 |
| 1085 | 3300049587 | Ga0501071_0172348 | Ga0501071_0172348_189_1484 | 431 |
| 1086 | 3300049588 | Ga0501072_0000378 | Ga0501072_0000378_27461_28756 | 431 |
| 1087 | 3300049588 | Ga0501072_0015136 | Ga0501072_0015136_3161_4456 | 431 |
| 1088 | 3300049589 | Ga0501073_0000062 | Ga0501073_0000062_51152_52447 | 431 |
| 1089 | 3300049589 | Ga0501073_0014131 | Ga0501073_0014131_2229_3524 | 431 |
| 1090 | 3300049589 | Ga0501073_0051826 | Ga0501073_0051826_948_2243 | 431 |
| 1091 | 3300049590 | Ga0501074_0000642 | Ga0501074_0000642_15486_16781 | 431 |
| 1092 | 3300049590 | Ga0501074_0002216 | Ga0501074_0002216_9799_11094 | 431 |
| 1093 | 3300049591 | Ga0501075_0076901 | Ga0501075_0076901_489_1784 | 431 |
| 1094 | 3300049591 | Ga0501075_0122453 | Ga0501075_0122453_410_1705 | 431 |
| 1095 | 3300049592 | Ga0501076_0017280 | Ga0501076_0017280_619_1914 | 431 |
| 1096 | 3300049592 | Ga0501076_0024246 | Ga0501076_0024246_293_1588 | 431 |
| 1097 | 3300049592 | Ga0501076_0183263 | Ga0501076_0183263_152_1447 | 431 |
| 1098 | 3300049593 | Ga0501077_0004743 | Ga0501077_0004743_6427_7722 | 431 |
| 1099 | 3300049593 | Ga0501077_0075708 | Ga0501077_0075708_253_1548 | 431 |
| 1100 | 3300049741 | Ga0501079_0006018 | Ga0501079_0006018_2813_4108 | 431 |
| 1101 | 3300049741 | Ga0501079_0016419 | Ga0501079_0016419_323_1618 | 431 |
| 1102 | 3300049741 | Ga0501079_0031135 | Ga0501079_0031135_1922_3217 | 431 |
| 1103 | 3300049741 | Ga0501079_0131467 | Ga0501079_0131467_18_1313 | 431 |
| 1104 | 3300049741 | Ga0501079_0177568 | Ga0501079_0177568_333_1628 | 431 |
| 1105 | 3300049742 | Ga0501080_0000200 | Ga0501080_0000200_26024_27319 | 431 |
| 1106 | 3300049742 | Ga0501080_0037072 | Ga0501080_0037072_1833_3128 | 431 |
| 1107 | 3300049742 | Ga0501080_0048542 | Ga0501080_0048542_1413_2708 | 431 |
| 1108 | 3300049742 | Ga0501080_0185967 | Ga0501080_0185967_193_1488 | 431 |
| 1109 | 3300049743 | Ga0501081_0003080 | Ga0501081_0003080_3007_4302 | 431 |
| 1110 | 3300049744 | Ga0501083_0000199 | Ga0501083_0000199_34510_35805 | 431 |
| 1111 | 3300049744 | Ga0501083_0000628 | Ga0501083_0000628_17032_18327 | 431 |
| 1112 | 3300049744 | Ga0501083_0007134 | Ga0501083_0007134_5472_6788 | 431 |
| 1113 | 3300049822 | Ga0501035_0000123 | Ga0501035_0000123_65812_67107 | 431 |
| 1114 | 3300049822 | Ga0501035_0000598 | Ga0501035_0000598_26037_27332 | 431 |
| 1115 | 3300049822 | Ga0501035_0039684 | Ga0501035_0039684_2285_3646 | 431 |
| 1116 | 3300049823 | Ga0501044_0000100 | Ga0501044_0000100_83143_84438 | 431 |
| 1117 | 3300049823 | Ga0501044_0000887 | Ga0501044_0000887_20615_21910 | 431 |
| 1118 | 3300049823 | Ga0501044_0021553 | Ga0501044_0021553_3718_5013 | 431 |
| 1119 | 3300049823 | Ga0501044_0042937 | Ga0501044_0042937_3121_4416 | 431 |
| 1120 | 3300049824 | Ga0501045_0001526 | Ga0501045_0001526_8908_10203 | 431 |
| 1121 | 3300050489 | nmdc:mga03683_25957_c2 | nmdc:mga03683_25957_c2_94_1389 | 431 |
| 1122 | 3300050490 | nmdc:mga03n38_54330_c1 | nmdc:mga03n38_54330_c1_422_1717 | 431 |
| 1123 | 3300050491 | nmdc:mga00v17_3459_c1 | nmdc:mga00v17_3459_c1_872_2167 | 431 |
| 1124 | 3300050492 | nmdc:mga0yw44_17358_c1 | nmdc:mga0yw44_17358_c1_1141_2436 | 431 |
| 1125 | 3300050492 | nmdc:mga0yw44_4498_c1 | nmdc:mga0yw44_4498_c1_5078_6373 | 431 |
| 1126 | 3300050492 | nmdc:mga0yw44_49835_c1 | nmdc:mga0yw44_49835_c1_947_2275 | 431 |
| 1127 | 3300050492 | nmdc:mga0yw44_89146_c1 | nmdc:mga0yw44_89146_c1_78_1373 | 431 |
| 1128 | 3300050494 | nmdc:mga06z11_205_c1 | nmdc:mga06z11_205_c1_7200_8498 | 431 |
| 1129 | 3300050494 | nmdc:mga06z11_27492_c1 | nmdc:mga06z11_27492_c1_278_1573 | 431 |
| 1130 | 3300050494 | nmdc:mga06z11_53356_c1 | nmdc:mga06z11_53356_c1_98_1393 | 431 |
| 1131 | 3300050494 | nmdc:mga06z11_6231_c1 | nmdc:mga06z11_6231_c1_142_1437 | 431 |
| 1132 | 3300050494 | nmdc:mga06z11_62408_c1 | nmdc:mga06z11_62408_c1_386_1681 | 431 |
| 1133 | 3300050494 | nmdc:mga06z11_80691_c1 | nmdc:mga06z11_80691_c1_141_1436 | 431 |
| 1134 | 3300050495 | nmdc:mga04h51_644_c1 | nmdc:mga04h51_644_c1_2615_3913 | 431 |
| 1135 | 3300050496 | nmdc:mga07m45_25150_c2 | nmdc:mga07m45_25150_c2_612_1907 | 431 |
| 1136 | 3300050496 | nmdc:mga07m45_2788_c1 | nmdc:mga07m45_2788_c1_3036_4331 | 431 |
| 1137 | 3300050511 | nmdc:mga08y16_371938_c1 | nmdc:mga08y16_371938_c1_54_1349 | 431 |
| 1138 | 3300050511 | nmdc:mga08y16_53082_c1 | nmdc:mga08y16_53082_c1_60_1355 | 431 |
| 1139 | 3300050512 | nmdc:mga0n895_11688_c1 | nmdc:mga0n895_11688_c1_4718_6013 | 431 |
| 1140 | 3300050512 | nmdc:mga0n895_33987_c1 | nmdc:mga0n895_33987_c1_821_2116 | 431 |
| 1141 | 3300050513 | nmdc:mga0rr50_32064_c1 | nmdc:mga0rr50_32064_c1_1962_3257 | 431 |
| 1142 | 3300050513 | nmdc:mga0rr50_85747_c1 | nmdc:mga0rr50_85747_c1_337_1632 | 431 |
| 1143 | 3300050515 | nmdc:mga0a205_3751_c1 | nmdc:mga0a205_3751_c1_5411_6706 | 431 |
| 1144 | 3300050516 | nmdc:mga0sz30_13068_c1 | nmdc:mga0sz30_13068_c1_1745_3040 | 431 |
| 1145 | 3300053077 | Ga0495601_0000848 | Ga0495601_0000848_11094_12389 | 431 |
| 1146 | 3300053077 | Ga0495601_0069785 | Ga0495601_0069785_913_2208 | 431 |
| 1147 | 3300053078 | Ga0495612_0014423 | Ga0495612_0014423_375_1670 | 431 |
| 1148 | 3300053078 | Ga0495612_0015990 | Ga0495612_0015990_1594_2889 | 431 |
| 1149 | 3300053084 | Ga0495595_0002544 | Ga0495595_0002544_3949_5244 | 431 |
| 1150 | 3300053084 | Ga0495595_0005739 | Ga0495595_0005739_2589_3884 | 431 |
| 1151 | 3300053084 | Ga0495595_0013241 | Ga0495595_0013241_1683_2978 | 431 |
| 1152 | 3300053085 | Ga0495619_0000858 | Ga0495619_0000858_15076_16371 | 431 |
| 1153 | 3300053085 | Ga0495619_0006701 | Ga0495619_0006701_3950_5245 | 431 |
| 1154 | 3300053086 | Ga0500578_0043292 | Ga0500578_0043292_261_1604 | 431 |
| 1155 | 3300053086 | Ga0500578_0045031 | Ga0500578_0045031_499_1827 | 431 |
| 1156 | 3300053087 | Ga0500643_000111 | Ga0500643_000111_82728_84023 | 431 |
| 1157 | 3300053093 | Ga0500651_0005693 | Ga0500651_0005693_626_1921 | 431 |
| 1158 | 3300053093 | Ga0500651_0030707 | Ga0500651_0030707_1030_2358 | 431 |
| 1159 | 3300053094 | Ga0500566_0010251 | Ga0500566_0010251_1112_2440 | 431 |
| 1160 | 3300053094 | Ga0500566_0019553 | Ga0500566_0019553_1763_3058 | 431 |
| 1161 | 3300053094 | Ga0500566_0040898 | Ga0500566_0040898_359_1654 | 431 |
| 1162 | 3300053096 | Ga0500641_0027912 | Ga0500641_0027912_88_1383 | 431 |
| 1163 | 3300053098 | Ga0500650_0000250 | Ga0500650_0000250_8986_10314 | 431 |
| 1164 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_673989_675284 | 431 |
| 1165 | 3300053105 | Ga0500557_000034 | Ga0500557_000034_59354_60649 | 431 |
| 1166 | 3300053109 | Ga0500569_012555 | Ga0500569_012555_298_1626 | 431 |
| 1167 | 3300053111 | Ga0500572_000023 | Ga0500572_000023_15676_16971 | 431 |
| 1168 | 3300053118 | Ga0500594_0018699 | Ga0500594_0018699_99_1394 | 431 |
| 1169 | 3300053119 | Ga0500595_011567 | Ga0500595_011567_833_2128 | 431 |
| 1170 | 3300053119 | Ga0500595_014895 | Ga0500595_014895_722_2017 | 431 |
| 1171 | 3300053119 | Ga0500595_031747 | Ga0500595_031747_307_1602 | 431 |
| 1172 | 3300053121 | Ga0500607_039743 | Ga0500607_039743_357_1652 | 431 |
| 1173 | 3300053122 | Ga0500608_006686 | Ga0500608_006686_1189_2517 | 431 |
| 1174 | 3300053125 | Ga0500618_010201 | Ga0500618_010201_1175_2470 | 431 |
| 1175 | 3300053130 | Ga0500642_0000053 | Ga0500642_0000053_17984_19279 | 431 |
| 1176 | 3300053130 | Ga0500642_0000175 | Ga0500642_0000175_1111_2439 | 431 |
| 1177 | 3300053130 | Ga0500642_0016179 | Ga0500642_0016179_215_1510 | 431 |
| 1178 | 3300053130 | Ga0500642_0025114 | Ga0500642_0025114_523_1866 | 431 |
| 1179 | 3300053131 | Ga0500652_000441 | Ga0500652_000441_608_1936 | 431 |
| 1180 | 3300053134 | Ga0500658_0065659 | Ga0500658_0065659_87_1415 | 431 |
| 1181 | 3300053136 | Ga0500559_0000146 | Ga0500559_0000146_31138_32466 | 431 |
| 1182 | 3300053136 | Ga0500559_0001416 | Ga0500559_0001416_9994_11289 | 431 |
| 1183 | 3300053136 | Ga0500559_0024210 | Ga0500559_0024210_279_1574 | 431 |
| 1184 | 3300053139 | Ga0500568_0000733 | Ga0500568_0000733_21304_22632 | 431 |
| 1185 | 3300053139 | Ga0500568_0015018 | Ga0500568_0015018_851_2146 | 431 |
| 1186 | 3300053148 | Ga0500590_022753 | Ga0500590_022753_913_2208 | 431 |
| 1187 | 3300053150 | Ga0500603_006653 | Ga0500603_006653_1038_2333 | 431 |
| 1188 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_117602_118897 | 431 |
| 1189 | 3300053153 | Ga0500616_0000041 | Ga0500616_0000041_234193_235521 | 431 |
| 1190 | 3300053156 | Ga0500622_0001837 | Ga0500622_0001837_14008_15336 | 431 |
| 1191 | 3300053156 | Ga0500622_0028058 | Ga0500622_0028058_664_1959 | 431 |
| 1192 | 3300053156 | Ga0500622_0051363 | Ga0500622_0051363_231_1574 | 431 |
| 1193 | 3300053161 | Ga0500634_0054221 | Ga0500634_0054221_164_1459 | 431 |
| 1194 | 3300053162 | Ga0500638_002809 | Ga0500638_002809_3234_4529 | 431 |
| 1195 | 3300053162 | Ga0500638_091226 | Ga0500638_091226_76_1371 | 431 |
| 1196 | 3300053177 | Ga0500636_0000033 | Ga0500636_0000033_67986_69281 | 431 |
| 1197 | 3300053177 | Ga0500636_0002841 | Ga0500636_0002841_1004_2332 | 431 |
| 1198 | 3300053177 | Ga0500636_0045999 | Ga0500636_0045999_510_1805 | 431 |
| 1199 | 3300053178 | Ga0500637_0000026 | Ga0500637_0000026_8935_10230 | 431 |
| 1200 | 3300053178 | Ga0500637_0001578 | Ga0500637_0001578_698_1993 | 431 |
| 1201 | 3300053729 | Ga0500625_001985 | Ga0500625_001985_4720_6015 | 431 |
| 1202 | 3300053730 | Ga0500645_017807 | Ga0500645_017807_111_1406 | 431 |
| 1203 | 3300053735 | Ga0500596_001715 | Ga0500596_001715_322_1617 | 431 |
| 1204 | 3300053736 | Ga0500599_001352 | Ga0500599_001352_965_2260 | 431 |
| 1205 | 3300053737 | Ga0500601_000010 | Ga0500601_000010_31803_33098 | 431 |
| 1206 | 3300054114 | Ga0501084_0043563 | Ga0501084_0043563_1046_2341 | 431 |
| 1207 | 3300054114 | Ga0501084_0073591 | Ga0501084_0073591_1443_2738 | 431 |
| 1208 | 3300060353 | Ga0501082_0011691 | Ga0501082_0011691_2698_4014 | 431 |
| 1209 | 3300060353 | Ga0501082_0011762 | Ga0501082_0011762_2806_4101 | 431 |
| 1210 | 3300060353 | Ga0501082_0028999 | Ga0501082_0028999_1081_2376 | 431 |
| 1211 | 3300061734 | Ga0530510_0120930 | Ga0530510_0120930_349_1644 | 431 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eqw-assembly2.cif.gz_B | crystal structure of fub7 | 0.9834 | 8 | 428 |
| 8eqw-assembly4.cif.gz_D | crystal structure of fub7 | 0.9815 | 8 | 430 |
| 8eqw-assembly1.cif.gz_G | crystal structure of fub7 | 0.9809 | 8 | 430 |
| 8eqw-assembly1.cif.gz_A | crystal structure of fub7 | 0.9788 | 8 | 430 |
| 8eqw-assembly3.cif.gz_C | crystal structure of fub7 | 0.9782 | 7 | 430 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q59US5_3_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9861 | 7 | 289 | 3.40.640.10 |
| 4kamA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9832 | 68 | 292 | 3.40.640.10 |
| 5e4zA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9744 | 7 | 291 | 3.40.640.10 |
| af_Q59US5_3_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9725 | 7 | 289 | 3.40.640.10 |
| 3ri6B02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9708 | 295 | 424 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383AF62-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase | 0.999 | 36 | 285 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A537Q2S0-F1-model_v4 | Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) | 0.9958 | 24 | 211 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-T0V080-F1-model_v4 | O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) | 0.9944 | 83 | 305 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A382DB25-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9935 | 7 | 229 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A383AF62-F1-model_v4 | O-acetylhomoserine aminocarboxypropyltransferase | 0.9911 | 36 | 285 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar