F491728

General Info

Members Datasets Scaffolds Average Seq Length
1211 695 980 198

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10117045|Ga0075364_101170451
Length 233
Sequence LHVNAPLFAGLCGLGSAAIEHAKRKETPMSLQVYLAFVAACVALALLPGPNVTLVIANGLRYGTRAAMISIAGTQAGLAVVIGIVALGLATLMATMGYWFDWVRFAGAAYLVWLGIKMVRAPVEGIDADTPPAPPRGGFFLQGMMVLLSNPKVLVFFGAFIPQFVDMEKNHILQVGILGATFMVTAALTDMVYAVAAGRARQFFSARRTRLLSRISGGFMIGGGVWLALTRAR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
30 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
46 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
47 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
48 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
49 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
50 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
51 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
52 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
53 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
54 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
55 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
56 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
57 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
58 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
59 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
60 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
61 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
64 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
65 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
66 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
74 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
75 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
76 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
77 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
78 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
79 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
80 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
81 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
82 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
83 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
84 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
85 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
86 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
87 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
88 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
89 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
90 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
91 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
92 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
93 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
94 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
95 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
96 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
97 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
98 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
99 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
100 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
101 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
102 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
103 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
104 2904699407
105 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2906610324
108 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
109 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
110 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
111 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
112 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
115 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2922425934
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
124 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
125 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
126 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
127 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
128 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
129 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
130 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
131 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
134 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
135 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
136 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
137 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
138 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
139 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
140 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
141 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
142 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
143 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
144 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
145 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
147 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
148 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
149 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
150 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
151 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
152 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
153 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
154 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
155 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
156 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
157 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
158 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
159 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
160 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
161 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
164 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
165 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
166 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
167 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
168 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
169 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
170 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
171 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
174 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
175 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
176 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
179 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
180 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
181 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
182 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
183 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
184 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
185 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
186 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
187 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
188 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
189 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
190 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
191 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
192 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
193 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
194 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
195 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
196 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
197 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
198 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
199 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
202 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
203 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
204 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
205 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
206 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
207 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
208 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
209 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
210 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
211 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
212 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
213 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
214 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
215 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
216 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
217 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
218 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
219 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
220 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
221 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
222 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
223 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
224 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
225 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
226 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
227 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
228 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
229 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
230 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
231 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
232 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
233 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
234 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
235 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
236 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
237 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
238 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
239 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
240 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
241 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
242 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
243 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
244 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
245 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
246 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
247 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
248 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
249 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
250 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
251 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
252 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
253 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
254 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
255 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
256 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
257 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
258 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
259 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
260 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
261 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
262 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
263 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
264 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
265 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
266 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
267 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
268 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
269 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
270 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
271 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
272 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
273 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
274 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
275 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
276 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
277 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
278 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
279 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
280 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
281 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
282 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
283 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
284 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
285 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
286 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
287 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
288 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
289 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
290 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
291 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
292 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
293 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
294 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
295 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
296 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
297 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
298 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
299 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
300 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
301 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
302 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
303 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
304 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
305 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
306 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
307 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
308 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
309 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
310 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
311 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
312 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
313 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
314 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
315 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
316 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
317 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
318 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
319 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
320 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
321 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
322 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
323 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
324 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
325 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
328 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
329 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
332 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
333 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
335 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
395 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
396 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
397 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
398 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
400 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
404 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
405 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
406 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
407 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
408 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
409 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
410 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
411 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
412 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
413 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
414 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
415 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
416 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
417 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
418 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
419 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
420 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
421 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
422 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
423 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
424 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
425 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
426 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
427 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
428 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
429 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
430 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
431 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
432 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
433 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
434 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
435 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
436 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
437 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
438 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
439 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
440 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
441 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
442 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
443 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
444 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
445 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
446 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
447 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
448 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
449 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
450 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
451 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
452 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
453 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
454 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
455 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
456 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
457 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
458 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
459 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
460 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
461 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
462 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
463 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
464 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
465 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
466 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
467 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
468 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
469 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
470 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
471 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
472 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
473 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
474 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
475 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
476 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
477 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
478 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
479 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
480 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
481 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
482 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
483 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
484 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
485 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
486 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
487 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
488 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
489 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
490 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
491 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
492 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
493 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
494 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
495 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
496 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
497 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
498 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
499 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
500 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
501 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
502 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
503 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
504 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
505 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
506 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
507 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
508 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
509 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
510 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
511 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
512 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
513 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
514 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
515 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
516 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
517 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
518 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
519 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
520 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
521 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
522 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
523 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
524 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
525 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
526 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
527 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
528 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
529 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
530 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
531 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
532 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
533 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
534 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
535 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
536 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
537 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
538 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
539 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
540 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
541 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
542 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
543 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
544 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
545 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
546 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
547 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
548 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
549 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
550 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
551 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
552 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
553 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
554 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
555 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
556 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
557 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
558 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
559 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
560 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
561 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
562 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
563 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
564 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
565 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
566 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
567 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
568 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
569 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
570 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
571 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
572 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
573 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
574 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
577 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
578 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
581 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
582 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
583 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
584 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
585 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
586 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
587 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
588 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
589 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
590 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
591 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
592 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
593 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
594 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
595 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
596 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
597 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
598 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
599 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
600 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
601 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
602 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
603 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
604 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
605 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
606 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
607 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
608 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
609 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
610 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
611 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
612 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
613 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
614 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
615 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
616 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
617 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
618 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
619 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
620 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
621 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
622 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
623 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
624 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
625 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
626 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
627 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
628 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
629 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
630 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
631 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
632 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
633 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
634 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
635 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
636 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
637 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
638 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
639 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
640 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
641 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
642 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
643 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
644 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
645 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
646 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
647 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
648 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
649 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
650 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
651 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
652 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
653 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
654 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
655 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
656 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
657 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
658 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
659 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
660 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
661 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
662 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
663 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
664 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
665 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
666 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
667 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
668 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
669 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
670 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
671 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
672 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
673 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
674 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
675 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
676 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
677 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
678 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
679 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
680 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
681 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
682 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
683 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
684 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
685 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
686 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
687 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
688 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
689 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
690 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
691 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
692 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
693 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
694 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
695 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.18
Metatranscriptomes 0.08
Isolates 18.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.07
Nodule 15.19
Rhizoplane 4.38
Rhizosphere 57.23
Stem 0
Stem Tuber 0
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10037975 3300001989 Bacteria 1620
2 JGI25151J46595_10000212 3300003187 Bacteria 70741
3 JGI25406J46586_10000956 3300003203 Bacteria 13581
4 JGI25153J46596_10001416 3300003215 Bacteria 14364
5 JGI25153J46596_10004729 3300003215 Bacteria 7255
6 JGI25153J46596_10009931 3300003215 Bacteria 4358
7 JGI25153J46596_10013535 3300003215 Bacteria 3440
8 JGI25153J46596_10044984 3300003215 Bacteria 1322
9 JGI25160J50197_1004779 3300003354 Bacteria 5784
10 JGI25404J52841_10003837 3300003659 Bacteria 3006
11 Ga0055539_1012486 3300003752 Bacteria 1043
12 Ga0055524_1033317 3300003775 Bacteria 1444
13 Ga0065165_1001827 3300005262 Bacteria 20819
14 Ga0065165_1005579 3300005262 Bacteria 6986
15 Ga0070676_10033104 3300005328 Bacteria 2964
16 Ga0070683_100003663 3300005329 Bacteria 12524
17 Ga0070683_100682068 3300005329 Bacteria 984
18 Ga0070683_100743556 3300005329 Bacteria 940
19 Ga0070683_100969944 3300005329 Bacteria 816
20 Ga0070690_100321732 3300005330 Bacteria 1115
21 Ga0070690_100543668 3300005330 Bacteria 875
22 Ga0068869_100072632 3300005334 Bacteria 2549
23 Ga0070666_10168944 3300005335 Bacteria 1531
24 Ga0070680_100036538 3300005336 Bacteria 3968
25 Ga0070680_100427128 3300005336 Bacteria 1130
26 Ga0070682_100096953 3300005337 Bacteria 1940
27 Ga0070682_100287131 3300005337 Bacteria 1202
28 Ga0070682_100362227 3300005337 Bacteria 1085
29 Ga0070682_100402362 3300005337 Bacteria 1036
30 Ga0068868_100017949 3300005338 Bacteria 5280
31 Ga0068868_100135706 3300005338 Bacteria 2017
32 Ga0068868_100396172 3300005338 Bacteria 1191
33 Ga0070660_100366651 3300005339 Bacteria 1188
34 Ga0070689_100420274 3300005340 Bacteria 1133
35 Ga0070668_100224497 3300005347 Bacteria 1551
36 Ga0070668_100252506 3300005347 Bacteria 1464
37 Ga0070669_100230463 3300005353 Bacteria 1468
38 Ga0070675_100822117 3300005354 Bacteria 850
39 Ga0070671_100105113 3300005355 Bacteria 2370
40 Ga0070671_100116480 3300005355 Bacteria 2246
41 Ga0070674_100060347 3300005356 Bacteria 2643
42 Ga0070674_100166175 3300005356 Bacteria 1678
43 Ga0070673_100039832 3300005364 Bacteria 3600
44 Ga0070673_100210296 3300005364 Bacteria 1680
45 Ga0070673_100456064 3300005364 Bacteria 1151
46 Ga0070659_100309946 3300005366 Bacteria 1318
47 Ga0070667_100062534 3300005367 Bacteria 3154
48 Ga0070667_100150984 3300005367 Bacteria 2041
49 Ga0070709_10000542 3300005434 Bacteria 22119
50 Ga0070709_10001810 3300005434 Bacteria 11590
51 Ga0070709_10014082 3300005434 Bacteria 4515
52 Ga0070709_10062101 3300005434 Bacteria 2381
53 Ga0070709_10169753 3300005434 Bacteria 1523
54 Ga0070714_100000739 3300005435 Bacteria 23156
55 Ga0070714_100027307 3300005435 Bacteria 4726
56 Ga0070714_100250094 3300005435 Bacteria 1639
57 Ga0070714_100674821 3300005435 Bacteria 996
58 Ga0070713_100057137 3300005436 Bacteria 3247
59 Ga0070713_100080503 3300005436 Bacteria 2777
60 Ga0070713_100105722 3300005436 Bacteria 2446
61 Ga0070713_100886146 3300005436 Bacteria 858
62 Ga0070710_10015076 3300005437 Bacteria 3903
63 Ga0070710_10076409 3300005437 Bacteria 1944
64 Ga0070710_10078972 3300005437 Bacteria 1916
65 Ga0070710_10145812 3300005437 Bacteria 1456
66 Ga0070701_10055938 3300005438 Bacteria 2063
67 Ga0070701_10265742 3300005438 Bacteria 1041
68 Ga0070711_100001343 3300005439 Bacteria 13436
69 Ga0070711_100001693 3300005439 Bacteria 12214
70 Ga0070711_100098736 3300005439 Bacteria 2120
71 Ga0070700_100039031 3300005441 Bacteria 2898
72 Ga0070700_100227305 3300005441 Bacteria 1326
73 Ga0070708_100126243 3300005445 Bacteria 2365
74 Ga0070663_100015528 3300005455 Bacteria 4920
75 Ga0070663_100018140 3300005455 Bacteria 4607
76 Ga0070663_100030326 3300005455 Bacteria 3704
77 Ga0070663_100180131 3300005455 Bacteria 1639
78 Ga0070678_100043585 3300005456 Bacteria 3197
79 Ga0070678_100084853 3300005456 Bacteria 2412
80 Ga0070678_100394586 3300005456 Bacteria 1201
81 Ga0070678_100651572 3300005456 Bacteria 945
82 Ga0070662_100119590 3300005457 Bacteria 2017
83 Ga0070681_10016302 3300005458 Bacteria 7414
84 Ga0070681_10331122 3300005458 Bacteria 1432
85 Ga0070681_10467567 3300005458 Bacteria 1174
86 Ga0068867_100207547 3300005459 Bacteria 1571
87 Ga0070707_100806320 3300005468 Bacteria 903
88 Ga0070698_100061232 3300005471 Bacteria 3798
89 Ga0070679_100069266 3300005530 Bacteria 3519
90 Ga0070679_100118161 3300005530 Bacteria 2636
91 Ga0070684_100002732 3300005535 Bacteria 13046
92 Ga0070684_100035349 3300005535 Bacteria 4276
93 Ga0068853_100024770 3300005539 Bacteria 5034
94 Ga0068853_100099598 3300005539 Bacteria 2568
95 Ga0068853_100100270 3300005539 Bacteria 2560
96 Ga0068853_100981588 3300005539 Bacteria 813
97 Ga0068853_101045875 3300005539 Bacteria 787
98 Ga0070672_100175704 3300005543 Bacteria 1783
99 Ga0070686_100520757 3300005544 Bacteria 926
100 Ga0070693_100064160 3300005547 Bacteria 2143
101 Ga0070693_100116072 3300005547 Bacteria 1654
102 Ga0070665_100002394 3300005548 Bacteria 20689
103 Ga0070665_100005213 3300005548 Bacteria 13447
104 Ga0070665_100006911 3300005548 Bacteria 11532
105 Ga0070665_100051132 3300005548 Bacteria 4145
106 Ga0070665_100159586 3300005548 Bacteria 2257
107 Ga0070665_100170354 3300005548 Bacteria 2178
108 Ga0068855_100295314 3300005563 Bacteria 1795
109 Ga0068855_100884991 3300005563 Bacteria 944
110 Ga0070664_100262610 3300005564 Bacteria 1554
111 Ga0070664_100804585 3300005564 Bacteria 879
112 Ga0068854_100192544 3300005578 Bacteria 1599
113 Ga0068854_100194811 3300005578 Bacteria 1590
114 Ga0068856_100010975 3300005614 Bacteria 8795
115 Ga0068852_100060857 3300005616 Bacteria 3279
116 Ga0068852_100200070 3300005616 Bacteria 1890
117 Ga0068859_100518645 3300005617 Bacteria 1287
118 Ga0068859_100929525 3300005617 Bacteria 954
119 Ga0068864_100023044 3300005618 Bacteria 5226
120 Ga0068864_100187641 3300005618 Bacteria 1894
121 Ga0068864_100200341 3300005618 Bacteria 1833
122 Ga0068861_100126036 3300005719 Bacteria 2072
123 Ga0068861_100375327 3300005719 Bacteria 1255
124 Ga0068861_100737502 3300005719 Bacteria 919
125 Ga0068861_100924709 3300005719 Bacteria 828
126 Ga0068851_10267047 3300005834 Bacteria 975
127 Ga0068863_100133441 3300005841 Bacteria 2372
128 Ga0068863_100247303 3300005841 Bacteria 1722
129 Ga0068858_100116128 3300005842 Bacteria 2501
130 Ga0068858_100538518 3300005842 Bacteria 1130
131 Ga0068860_100292318 3300005843 Bacteria 1595
132 Ga0068860_100437853 3300005843 Bacteria 1298
133 Ga0068862_100052503 3300005844 Bacteria 3488
134 Ga0081455_10006750 3300005937 Bacteria 12251
135 Ga0081455_10062291 3300005937 Bacteria 3136
136 Ga0081538_10013960 3300005981 Bacteria 6325
137 Ga0081538_10057728 3300005981 Bacteria 2258
138 Ga0081540_1003811 3300005983 Bacteria 11795
139 Ga0081540_1007099 3300005983 Bacteria 8046
140 Ga0081540_1007462 3300005983 Bacteria 7787
141 Ga0081540_1013188 3300005983 Bacteria 5390
142 Ga0081540_1014734 3300005983 Bacteria 4991
143 Ga0081540_1016073 3300005983 Bacteria 4707
144 Ga0081540_1016372 3300005983 Bacteria 4642
145 Ga0081540_1029699 3300005983 Bacteria 3041
146 Ga0081539_10001182 3300005985 Bacteria 47183
147 Ga0081539_10022473 3300005985 Bacteria 4170
148 Ga0070717_10019596 3300006028 Bacteria 5309
149 Ga0070717_10036927 3300006028 Bacteria 3965
150 Ga0070717_10198897 3300006028 Bacteria 1755
151 Ga0070717_10745229 3300006028 Bacteria 890
152 Ga0075365_10118488 3300006038 Bacteria 1824
153 Ga0075365_10135975 3300006038 Bacteria 1703
154 Ga0075365_10306764 3300006038 Bacteria 1117
155 Ga0075365_10329353 3300006038 Bacteria 1076
156 Ga0075365_10453708 3300006038 Bacteria 905
157 Ga0075368_10018742 3300006042 Bacteria 2605
158 Ga0075368_10023629 3300006042 Bacteria 2350
159 Ga0075368_10033993 3300006042 Bacteria 1985
160 Ga0075363_100044787 3300006048 Bacteria 2345
161 Ga0075363_100053429 3300006048 Bacteria 2159
162 Ga0075363_100062994 3300006048 Bacteria 2000
163 Ga0075363_100110319 3300006048 Bacteria 1529
164 Ga0075364_10007367 3300006051 Bacteria 6532
165 Ga0075364_10082233 3300006051 Bacteria 2131
166 Ga0075364_10117045 3300006051 Bacteria 1782
167 Ga0070715_10000259 3300006163 Bacteria 12814
168 Ga0070715_10013984 3300006163 Bacteria 2960
169 Ga0070715_10065718 3300006163 Bacteria 1606
170 Ga0070716_100014423 3300006173 Bacteria 4047
171 Ga0070716_100023117 3300006173 Bacteria 3293
172 Ga0070716_100063132 3300006173 Bacteria 2150
173 Ga0070716_100082549 3300006173 Bacteria 1922
174 Ga0070712_100015526 3300006175 Bacteria 4909
175 Ga0070712_100078491 3300006175 Bacteria 2384
176 Ga0070712_100225106 3300006175 Bacteria 1487
177 Ga0070712_100295579 3300006175 Bacteria 1309
178 Ga0070712_100355044 3300006175 Bacteria 1201
179 Ga0070712_100738384 3300006175 Bacteria 842
180 Ga0075362_10110646 3300006177 Bacteria 1293
181 Ga0075367_10036272 3300006178 Bacteria 2858
182 Ga0075367_10071753 3300006178 Bacteria 2084
183 Ga0075367_10104051 3300006178 Bacteria 1738
184 Ga0075369_10113709 3300006186 Bacteria 1221
185 Ga0075369_10114072 3300006186 Bacteria 1219
186 Ga0075369_10120610 3300006186 Bacteria 1187
187 Ga0075366_10029236 3300006195 Bacteria 3237
188 Ga0075366_10105246 3300006195 Bacteria 1696
189 Ga0097621_100025887 3300006237 Bacteria 4596
190 Ga0097621_100276798 3300006237 Bacteria 1476
191 Ga0097621_100528133 3300006237 Bacteria 1072
192 Ga0075370_10015394 3300006353 Bacteria 4095
193 Ga0075370_10027830 3300006353 Bacteria 3139
194 Ga0075370_10192316 3300006353 Bacteria 1202
195 Ga0068871_100266722 3300006358 Bacteria 1495
196 Ga0075428_100395782 3300006844 Bacteria 1481
197 Ga0075433_10164951 3300006852 Bacteria 1972
198 Ga0075433_10173278 3300006852 Bacteria 1920
199 Ga0075433_10608976 3300006852 Bacteria 959
200 Ga0075434_100000032 3300006871 Bacteria 63711
201 Ga0075434_100086670 3300006871 Bacteria 3132
202 Ga0075434_100355554 3300006871 Bacteria 1486
203 Ga0075434_100756021 3300006871 Bacteria 989
204 Ga0068865_100036018 3300006881 Bacteria 3333
205 Ga0068865_100273986 3300006881 Bacteria 1341
206 Ga0068865_100322726 3300006881 Bacteria 1243
207 Ga0075436_100061935 3300006914 Bacteria 2586
208 Ga0075436_100252916 3300006914 Bacteria 1255
209 Ga0097620_100518604 3300006931 Bacteria 1287
210 Ga0097620_100929468 3300006931 Bacteria 954
211 Ga0099825_1025526 3300006941 Bacteria 3276
212 Ga0099825_1027160 3300006941 Bacteria 2948
213 Ga0099824_1006625 3300006942 Bacteria 15796
214 Ga0099824_1015178 3300006942 Bacteria 7399
215 Ga0099822_1003046 3300006943 Bacteria 21323
216 Ga0099823_1022654 3300006944 Bacteria 5802
217 Ga0075435_100115462 3300007076 Bacteria 2235
218 Ga0099794_10031783 3300007265 Bacteria 2474
219 Ga0099795_10050225 3300007788 Bacteria 1516
220 Ga0105250_10178299 3300009092 Bacteria 891
221 Ga0105240_10515571 3300009093 Bacteria 1327
222 Ga0111539_10000041 3300009094 Bacteria 131679
223 Ga0111539_10095255 3300009094 Bacteria 3497
224 Ga0111539_10321914 3300009094 Bacteria 1799
225 Ga0111539_10725138 3300009094 Bacteria 1157
226 Ga0105245_10003142 3300009098 Bacteria 14776
227 Ga0105245_10470478 3300009098 Bacteria 1268
228 Ga0105247_10020411 3300009101 Bacteria 3983
229 Ga0105247_10173827 3300009101 Bacteria 1434
230 Ga0105247_10208434 3300009101 Bacteria 1317
231 Ga0105247_10215633 3300009101 Bacteria 1297
232 Ga0105247_10418772 3300009101 Bacteria 958
233 Ga0105247_10631891 3300009101 Bacteria 798
234 Ga0114129_10367988 3300009147 Bacteria 1901
235 Ga0114129_10491130 3300009147 Bacteria 1605
236 Ga0114129_10613486 3300009147 Bacteria 1408
237 Ga0105243_10215241 3300009148 Bacteria 1694
238 Ga0105242_10034037 3300009176 Bacteria 4083
239 Ga0105248_10113899 3300009177 Bacteria 3050
240 Ga0105248_10358079 3300009177 Bacteria 1643
241 Ga0105248_10775741 3300009177 Bacteria 1082
242 Ga0105248_11434161 3300009177 Bacteria 781
243 Ga0105237_10188668 3300009545 Bacteria 2062
244 Ga0105237_10265806 3300009545 Bacteria 1718
245 Ga0105237_10417534 3300009545 Bacteria 1347
246 Ga0105237_11226030 3300009545 Bacteria 757
247 Ga0105238_10330753 3300009551 Bacteria 1510
248 Ga0105238_10608766 3300009551 Bacteria 1101
249 Ga0105238_10889928 3300009551 Bacteria 908
250 Ga0105249_10284382 3300009553 Bacteria 1653
251 Ga0105249_10359346 3300009553 Bacteria 1477
252 Ga0099796_10008400 3300010159 Bacteria 2751
253 Ga0099796_10153151 3300010159 Bacteria 909
254 Ga0105239_10034860 3300010375 Bacteria 5528
255 Ga0105239_10088222 3300010375 Bacteria 3420
256 Ga0105239_10412923 3300010375 Bacteria 1528
257 Ga0105246_10052887 3300011119 Bacteria 2793
258 Ga0105246_11040625 3300011119 Bacteria 744
259 Ga0157343_1010179 3300012488 Bacteria 707
260 Ga0157370_10376148 3300013104 Bacteria 1308
261 Ga0157370_10723833 3300013104 Bacteria 907
262 Ga0157369_10008826 3300013105 Bacteria 11547
263 Ga0157369_10010164 3300013105 Bacteria 10742
264 Ga0157369_10248477 3300013105 Bacteria 1857
265 Ga0157374_10013680 3300013296 Bacteria 7089
266 Ga0157374_10047448 3300013296 Bacteria 3983
267 Ga0157374_10212506 3300013296 Bacteria 1897
268 Ga0157378_10822711 3300013297 Bacteria 956
269 Ga0163162_10120701 3300013306 Bacteria 2725
270 Ga0163162_11031758 3300013306 Bacteria 930
271 Ga0163162_11374083 3300013306 Bacteria 803
272 Ga0157372_10767652 3300013307 Bacteria 1121
273 Ga0157372_11331699 3300013307 Bacteria 828
274 Ga0157375_10073559 3300013308 Bacteria 3437
275 Ga0157375_10079107 3300013308 Bacteria 3323
276 Ga0157375_10787518 3300013308 Bacteria 1100
277 Ga0157375_11141754 3300013308 Bacteria 913
278 Ga0157375_11923246 3300013308 Bacteria 702
279 Ga0163163_10033065 3300014325 Bacteria 5000
280 Ga0157380_10014539 3300014326 Bacteria 5760
281 Ga0157380_11036227 3300014326 Bacteria 856
282 Ga0182008_10214972 3300014497 Bacteria 982
283 Ga0157377_10135122 3300014745 Bacteria 1510
284 Ga0157377_10190164 3300014745 Bacteria 1297
285 Ga0157379_10162321 3300014968 Bacteria 2017
286 Ga0157379_10596906 3300014968 Bacteria 1030
287 Ga0157376_10063001 3300014969 Bacteria 3122
288 Ga0157376_10719565 3300014969 Bacteria 1005
289 Ga0182006_1086770 3300015261 Bacteria 1132
290 Ga0163161_10006317 3300017792 Bacteria 8202
291 Ga0163161_10203406 3300017792 Bacteria 1527
292 Ga0214544_1000163 3300021320 Bacteria 101631
293 Ga0214542_1000156 3300021321 Bacteria 101631
294 Ga0214545_1000078 3300021324 Bacteria 101631
295 Ga0214543_1000136 3300021327 Bacteria 101629
296 Ga0214543_1043876 3300021327 Bacteria 1065
297 Ga0213873_10037378 3300021358 Bacteria 1237
298 Ga0213873_10056117 3300021358 Bacteria 1055
299 Ga0213872_10044316 3300021361 Bacteria 2025
300 Ga0213874_10024497 3300021377 Bacteria 1693
301 Ga0213874_10067548 3300021377 Bacteria 1133
302 Ga0213874_10126299 3300021377 Bacteria 874
303 Ga0213876_10004130 3300021384 Bacteria 8156
304 Ga0213876_10244026 3300021384 Bacteria 955
305 Ga0209563_101608 3300025230 Bacteria 5843
306 Ga0209677_111207 3300025253 Bacteria 1416
307 Ga0209233_1002828 3300025261 Bacteria 6235
308 Ga0209130_1000804 3300025284 Bacteria 26631
309 Ga0209025_1000779 3300025294 Bacteria 52611
310 Ga0209025_1088134 3300025294 Bacteria 1025
311 Ga0209564_1000532 3300025295 Bacteria 61903
312 Ga0209564_1053486 3300025295 Bacteria 961
313 Ga0209758_1000109 3300025297 Bacteria 214759
314 Ga0209758_1000938 3300025297 Bacteria 39351
315 Ga0209758_1002619 3300025297 Bacteria 17898
316 Ga0209758_1004105 3300025297 Bacteria 12479
317 Ga0209758_1009535 3300025297 Bacteria 6007
318 Ga0209758_1009647 3300025297 Bacteria 5949
319 Ga0209758_1009772 3300025297 Bacteria 5882
320 Ga0209758_1015925 3300025297 Bacteria 3856
321 Ga0209256_1003201 3300025299 Bacteria 11828
322 Ga0207426_1000066 3300025302 Bacteria 351182
323 Ga0207426_1002293 3300025302 Bacteria 12619
324 Ga0209051_1024905 3300025303 Bacteria 2449
325 Ga0209257_1001604 3300025304 Bacteria 25883
326 Ga0207697_10080014 3300025315 Bacteria 1376
327 Ga0207692_10273505 3300025898 Bacteria 1019
328 Ga0207692_10333384 3300025898 Bacteria 931
329 Ga0207710_10118987 3300025900 Bacteria 1260
330 Ga0207710_10151631 3300025900 Bacteria 1125
331 Ga0207710_10153151 3300025900 Bacteria 1119
332 Ga0207710_10323821 3300025900 Bacteria 782
333 Ga0207688_10125717 3300025901 Bacteria 1499
334 Ga0207688_10219437 3300025901 Bacteria 1145
335 Ga0207680_10213777 3300025903 Bacteria 1319
336 Ga0207680_10419666 3300025903 Bacteria 947
337 Ga0207647_10002766 3300025904 Bacteria 13239
338 Ga0207647_10088462 3300025904 Bacteria 1849
339 Ga0207685_10246065 3300025905 Bacteria 863
340 Ga0207685_10348431 3300025905 Bacteria 746
341 Ga0207699_10017411 3300025906 Bacteria 3780
342 Ga0207699_10034307 3300025906 Bacteria 2877
343 Ga0207699_10184785 3300025906 Bacteria 1403
344 Ga0207699_10412559 3300025906 Bacteria 963
345 Ga0207699_10487129 3300025906 Bacteria 889
346 Ga0207645_10038963 3300025907 Bacteria 3046
347 Ga0207705_10153732 3300025909 Bacteria 1725
348 Ga0207684_10303315 3300025910 Bacteria 1377
349 Ga0207707_10001660 3300025912 Bacteria 20546
350 Ga0207707_10006974 3300025912 Bacteria 9854
351 Ga0207707_10545566 3300025912 Bacteria 985
352 Ga0207695_10476172 3300025913 Bacteria 1131
353 Ga0207671_10029152 3300025914 Bacteria 4123
354 Ga0207671_10108395 3300025914 Bacteria 2111
355 Ga0207671_10422732 3300025914 Bacteria 1060
356 Ga0207671_10693079 3300025914 Bacteria 810
357 Ga0207693_10002055 3300025915 Bacteria 17603
358 Ga0207693_10017696 3300025915 Bacteria 5683
359 Ga0207693_10035497 3300025915 Bacteria 3930
360 Ga0207693_10071194 3300025915 Bacteria 2721
361 Ga0207693_10187764 3300025915 Bacteria 1627
362 Ga0207693_10319737 3300025915 Bacteria 1215
363 Ga0207693_10353540 3300025915 Bacteria 1150
364 Ga0207693_10510810 3300025915 Bacteria 938
365 Ga0207663_10000268 3300025916 Bacteria 22554
366 Ga0207663_10006117 3300025916 Bacteria 6125
367 Ga0207660_10156422 3300025917 Bacteria 1755
368 Ga0207660_10263399 3300025917 Bacteria 1364
369 Ga0207660_10374813 3300025917 Bacteria 1143
370 Ga0207662_10025844 3300025918 Bacteria 3384
371 Ga0207657_10051937 3300025919 Bacteria 3561
372 Ga0207657_10117281 3300025919 Bacteria 2193
373 Ga0207649_10048682 3300025920 Bacteria 2615
374 Ga0207652_10010388 3300025921 Bacteria 7496
375 Ga0207652_10010980 3300025921 Bacteria 7302
376 Ga0207652_10226582 3300025921 Bacteria 1685
377 Ga0207652_10688550 3300025921 Bacteria 913
378 Ga0207646_10656567 3300025922 Bacteria 939
379 Ga0207646_10854170 3300025922 Bacteria 809
380 Ga0207681_10187774 3300025923 Bacteria 1579
381 Ga0207681_10218325 3300025923 Bacteria 1474
382 Ga0207694_10293812 3300025924 Bacteria 1337
383 Ga0207694_10876994 3300025924 Bacteria 759
384 Ga0207687_10013783 3300025927 Bacteria 5281
385 Ga0207700_10029573 3300025928 Bacteria 3868
386 Ga0207700_10039961 3300025928 Bacteria 3420
387 Ga0207700_10040532 3300025928 Bacteria 3400
388 Ga0207700_10043510 3300025928 Bacteria 3299
389 Ga0207700_10098776 3300025928 Bacteria 2323
390 Ga0207700_10662511 3300025928 Bacteria 931
391 Ga0207664_10015168 3300025929 Bacteria 5584
392 Ga0207664_10024402 3300025929 Bacteria 4544
393 Ga0207664_10102951 3300025929 Bacteria 2362
394 Ga0207664_10232462 3300025929 Bacteria 1603
395 Ga0207664_10680448 3300025929 Bacteria 925
396 Ga0207664_11027879 3300025929 Bacteria 738
397 Ga0207644_10174292 3300025931 Bacteria 1681
398 Ga0207644_10314340 3300025931 Bacteria 1265
399 Ga0207690_10130306 3300025932 Bacteria 1840
400 Ga0207690_10173140 3300025932 Bacteria 1619
401 Ga0207706_10208702 3300025933 Bacteria 1712
402 Ga0207686_10124259 3300025934 Bacteria 1761
403 Ga0207670_10329772 3300025936 Bacteria 1203
404 Ga0207670_10441195 3300025936 Bacteria 1048
405 Ga0207669_10193825 3300025937 Bacteria 1468
406 Ga0207704_10113298 3300025938 Bacteria 1839
407 Ga0207665_10005120 3300025939 Bacteria 8755
408 Ga0207665_10023354 3300025939 Bacteria 4074
409 Ga0207665_10023387 3300025939 Bacteria 4071
410 Ga0207665_10153462 3300025939 Bacteria 1651
411 Ga0207665_10254616 3300025939 Bacteria 1298
412 Ga0207691_10053838 3300025940 Bacteria 3672
413 Ga0207691_10132406 3300025940 Bacteria 2201
414 Ga0207691_10323236 3300025940 Bacteria 1323
415 Ga0207711_10294765 3300025941 Bacteria 1495
416 Ga0207711_11083088 3300025941 Bacteria 742
417 Ga0207689_10356783 3300025942 Bacteria 1216
418 Ga0207661_10003335 3300025944 Bacteria 11139
419 Ga0207661_10064261 3300025944 Bacteria 2974
420 Ga0207679_10348087 3300025945 Bacteria 1291
421 Ga0207679_10379129 3300025945 Bacteria 1239
422 Ga0207679_10899390 3300025945 Bacteria 810
423 Ga0207667_10224824 3300025949 Bacteria 1923
424 Ga0207667_10586780 3300025949 Bacteria 1125
425 Ga0207667_10600425 3300025949 Bacteria 1110
426 Ga0207651_10176473 3300025960 Bacteria 1690
427 Ga0207651_10177073 3300025960 Bacteria 1688
428 Ga0207651_10320869 3300025960 Bacteria 1295
429 Ga0207651_10354753 3300025960 Bacteria 1236
430 Ga0207712_10236413 3300025961 Bacteria 1470
431 Ga0207668_10026980 3300025972 Bacteria 3737
432 Ga0207668_10491175 3300025972 Bacteria 1054
433 Ga0207658_10050424 3300025986 Bacteria 3063
434 Ga0207658_10505270 3300025986 Bacteria 1077
435 Ga0207677_10006386 3300026023 Bacteria 6465
436 Ga0207677_10397371 3300026023 Bacteria 1168
437 Ga0207677_10753186 3300026023 Bacteria 868
438 Ga0207677_11181619 3300026023 Bacteria 700
439 Ga0207703_10066622 3300026035 Bacteria 2963
440 Ga0207703_10252147 3300026035 Bacteria 1591
441 Ga0207703_10471257 3300026035 Bacteria 1176
442 Ga0207639_10342341 3300026041 Bacteria 1333
443 Ga0207678_10023600 3300026067 Bacteria 5379
444 Ga0207678_10032634 3300026067 Bacteria 4538
445 Ga0207678_10057246 3300026067 Bacteria 3354
446 Ga0207678_10066250 3300026067 Bacteria 3102
447 Ga0207678_10114338 3300026067 Bacteria 2303
448 Ga0207678_10279546 3300026067 Bacteria 1432
449 Ga0207678_10675784 3300026067 Bacteria 908
450 Ga0207678_10966962 3300026067 Bacteria 753
451 Ga0207708_10085232 3300026075 Bacteria 2430
452 Ga0207708_10323893 3300026075 Bacteria 1258
453 Ga0207702_10008332 3300026078 Bacteria 8751
454 Ga0207702_10143973 3300026078 Bacteria 2160
455 Ga0207641_11027634 3300026088 Bacteria 821
456 Ga0207648_10055076 3300026089 Bacteria 3472
457 Ga0207648_10212002 3300026089 Bacteria 1720
458 Ga0207648_10221584 3300026089 Bacteria 1681
459 Ga0207648_10383102 3300026089 Bacteria 1272
460 Ga0207676_10351522 3300026095 Bacteria 1363
461 Ga0207676_10418626 3300026095 Bacteria 1256
462 Ga0207676_11354940 3300026095 Bacteria 707
463 Ga0207674_10193637 3300026116 Bacteria 1983
464 Ga0207675_100027594 3300026118 Bacteria 5288
465 Ga0207675_100436573 3300026118 Bacteria 1295
466 Ga0207683_10005742 3300026121 Bacteria 10643
467 Ga0207683_10018090 3300026121 Bacteria 6009
468 Ga0207683_10975556 3300026121 Bacteria 787
469 Ga0207698_10179454 3300026142 Bacteria 1874
470 Ga0207698_10221475 3300026142 Bacteria 1710
471 Ga0207698_10666618 3300026142 Bacteria 1032
472 Ga0209389_1000019 3300027296 Bacteria 172067
473 Ga0209389_1000880 3300027296 Bacteria 19469
474 Ga0209589_1000007 3300027357 Bacteria 425699
475 Ga0209589_1000897 3300027357 Bacteria 45637
476 Ga0209489_100008 3300027361 Bacteria 425699
477 Ga0209489_100033 3300027361 Bacteria 172166
478 Ga0209489_100110 3300027361 Bacteria 117680
479 Ga0209700_100009 3300027363 Bacteria 425699
480 Ga0209700_100012 3300027363 Bacteria 357892
481 Ga0209179_1038004 3300027512 Bacteria 1006
482 Ga0207428_10038011 3300027907 Bacteria 3916
483 Ga0207428_10524136 3300027907 Bacteria 859
484 Ga0268266_10001169 3300028379 Bacteria 32459
485 Ga0268266_10002165 3300028379 Bacteria 21557
486 Ga0268266_10449696 3300028379 Bacteria 1224
487 Ga0268266_10656684 3300028379 Bacteria 1009
488 Ga0268265_11009214 3300028380 Bacteria 822
489 Ga0268264_10000458 3300028381 Bacteria 55551
490 Ga0268264_10400618 3300028381 Bacteria 1319
491 Ga0268264_11026485 3300028381 Bacteria 832
492 Ga0307517_10000196 3300028786 Bacteria 102384
493 Ga0307515_10118872 3300028794 Bacteria 3012
494 Ga0307515_10146364 3300028794 Bacteria 2499
495 Ga0307511_10077257 3300030521 Bacteria 2372
496 Ga0265330_10024732 3300031235 Bacteria 2723
497 Ga0265330_10027960 3300031235 Bacteria 2545
498 Ga0265332_10001366 3300031238 Bacteria 13841
499 Ga0265332_10013847 3300031238 Bacteria 3571
500 Ga0265325_10009040 3300031241 Bacteria 5846
501 Ga0265329_10040123 3300031242 Bacteria 1502
502 Ga0265340_10014446 3300031247 Bacteria 4122
503 Ga0265340_10105297 3300031247 Bacteria 1308
504 Ga0265339_10008955 3300031249 Bacteria 6331
505 Ga0265339_10049967 3300031249 Bacteria 2288
506 Ga0265339_10065967 3300031249 Bacteria 1939
507 Ga0265331_10032855 3300031250 Bacteria 2568
508 Ga0265331_10045552 3300031250 Bacteria 2117
509 Ga0265331_10140398 3300031250 Bacteria 1099
510 Ga0265316_10456226 3300031344 Bacteria 916
511 Ga0307513_10084532 3300031456 Bacteria 3259
512 Ga0307513_10391228 3300031456 Bacteria 1127
513 Ga0307509_10031336 3300031507 Bacteria 5871
514 Ga0307509_10110235 3300031507 Bacteria 2759
515 Ga0307408_100527841 3300031548 Bacteria 1038
516 Ga0307408_100826594 3300031548 Bacteria 843
517 Ga0307508_10000541 3300031616 Bacteria 44822
518 Ga0307508_10126665 3300031616 Bacteria 2157
519 Ga0307508_10264664 3300031616 Bacteria 1313
520 Ga0307508_10452287 3300031616 Bacteria 877
521 Ga0307514_10401300 3300031649 Bacteria 700
522 Ga0316575_10172963 3300031665 Bacteria 896
523 Ga0316579_10132590 3300031691 Bacteria 1201
524 Ga0265314_10006103 3300031711 Bacteria 10708
525 Ga0265314_10036736 3300031711 Bacteria 3556
526 Ga0265314_10068081 3300031711 Bacteria 2395
527 Ga0265342_10000093 3300031712 Bacteria 98424
528 Ga0265342_10022338 3300031712 Bacteria 4024
529 Ga0265342_10022364 3300031712 Bacteria 4020
530 Ga0265342_10070889 3300031712 Bacteria 2032
531 Ga0307516_10004746 3300031730 Bacteria 16605
532 Ga0307516_10040357 3300031730 Bacteria 4647
533 Ga0307413_10032229 3300031824 Bacteria 2968
534 Ga0307410_10094860 3300031852 Bacteria 2126
535 Ga0307407_10095969 3300031903 Bacteria 1829
536 Ga0307409_100003189 3300031995 Bacteria 8819
537 Ga0307409_100338494 3300031995 Bacteria 1415
538 Ga0307416_100014520 3300032002 Bacteria 5404
539 Ga0307416_100080816 3300032002 Bacteria 2746
540 Ga0307416_101432414 3300032002 Bacteria 797
541 Ga0307415_100358692 3300032126 Bacteria 1230
542 Ga0316583_10001162 3300032133 Bacteria 8616
543 Ga0307507_10034314 3300033179 Bacteria 5244
544 Ga0307510_10138019 3300033180 Bacteria 2090
545 Ga0315911_1000012 3300033442 Bacteria 248988
546 Ga0373926_0053706 3300035083 Bacteria 1459
547 Ga0373934_0021442 3300035086 Bacteria 2487
548 Ga0373934_0045694 3300035086 Bacteria 1732
549 Ga0373923_0006204 3300035111 Bacteria 4113
550 Ga0373941_0062628 3300035115 Bacteria 1215
551 Ga0373945_0335011 3300035116 Bacteria 654
552 Ga0373953_0079623 3300035117 Bacteria 1360
553 Ga0373954_0005528 3300035118 Bacteria 5468
554 Ga0373954_0026019 3300035118 Bacteria 2679
555 Ga0373956_0001286 3300035119 Bacteria 10388
556 Ga0373956_0023981 3300035119 Bacteria 2624
557 Ga0373943_0061942 3300035170 Bacteria 1872
558 Ga0373955_0056849 3300035172 Bacteria 2147
559 Ga0373924_0065013 3300035410 Bacteria 1532
560 Ga0373924_0075561 3300035410 Bacteria 1426
561 Ga0373924_0151675 3300035410 Bacteria 1014
562 Ga0373931_0550711 3300035691 Bacteria 749
563 Ga0373935_0083518 3300035692 Bacteria 2079
564 Ga0373935_0083861 3300035692 Bacteria 2075
565 Ga0373935_0493932 3300035692 Bacteria 888
566 Ga0373927_0022900 3300035695 Bacteria 4092
567 Ga0373927_0029664 3300035695 Bacteria 3567
568 Ga0373927_0060534 3300035695 Bacteria 2450
569 Ga0373927_0193761 3300035695 Bacteria 1334
570 Ga0373933_0000127 3300035724 Bacteria 48988
571 Ga0373933_0069436 3300035724 Bacteria 2141
572 Ga0373933_0240895 3300035724 Bacteria 1163
573 Ga0373933_0265210 3300035724 Bacteria 1108
574 Ga0373947_0005065 3300035725 Bacteria 7718
575 Ga0373947_0008493 3300035725 Bacteria 5915
576 Ga0373947_0093784 3300035725 Bacteria 1877
577 Ga0373937_0027265 3300036401 Bacteria 5166
578 Ga0373937_0089249 3300036401 Bacteria 2854
579 Ga0373937_0238302 3300036401 Bacteria 1714
580 Ga0373937_0296980 3300036401 Bacteria 1526
581 Ga0373937_0669900 3300036401 Bacteria 983
582 Ga0372808_002511 3300036459 Bacteria 2126
583 Ga0373925_0052881 3300037068 Bacteria 3035
584 Ga0373925_0625057 3300037068 Bacteria 887
585 Ga0395900_0023448 3300037418 Bacteria 6316
586 Ga0395900_0030083 3300037418 Bacteria 5574
587 Ga0395898_0102724 3300037466 Bacteria 2743
588 Ga0395898_0958390 3300037466 Bacteria 792
589 Ga0395905_0081904 3300037471 Bacteria 3024
590 Ga0395905_0831561 3300037471 Bacteria 826
591 Ga0436364_1241072 3300037853 Bacteria 2480
592 Ga0395901_0080688 3300038443 Bacteria 3397
593 Ga0395901_0102114 3300038443 Bacteria 3009
594 Ga0436365_0232459 3300039437 Bacteria 11864
595 Ga0436365_0368752 3300039437 Bacteria 1935
596 Ga0436365_0547166 3300039437 Bacteria 1516
597 Ga0436365_0577077 3300039437 Bacteria 1343
598 Ga0436365_0776846 3300039437 Bacteria 1466
599 Ga0436365_1062598 3300039437 Bacteria 1731
600 Ga0436360_0330088 3300039438 Bacteria 2572
601 Ga0436360_1334781 3300039438 Bacteria 2285
602 Ga0436361_0862252 3300039447 Bacteria 2036
603 Ga0436363_0756020 3300039450 Bacteria 1438
604 Ga0436363_0771534 3300039450 Bacteria 1606
605 Ga0436363_0779713 3300039450 Bacteria 4486
606 Ga0436363_1042782 3300039450 Bacteria 5407
607 Ga0436362_0134504 3300039453 Bacteria 2150
608 Ga0436362_0394184 3300039453 Bacteria 3497
609 Ga0439465_0072418 3300041413 Bacteria 1157
610 Ga0439465_0122487 3300041413 Bacteria 913
611 Ga0451791_1147245 3300041451 Bacteria 739
612 Ga0451802_1371745 3300041460 Bacteria 920
613 Ga0451853_1426409 3300041512 Bacteria 803
614 Ga0439431_0031868 3300041997 Bacteria 1312
615 Ga0439458_0052730 3300042157 Bacteria 1006
616 Ga0439459_0087167 3300042438 Bacteria 746
617 Ga0466969_0027941 3300044656 Bacteria 2887
618 Ga0466969_0215109 3300044656 Bacteria 875
619 Ga0466972_0000115 3300044658 Bacteria 68073
620 Ga0466965_0099238 3300044683 Bacteria 1488
621 Ga0466966_0000632 3300044684 Bacteria 22387
622 Ga0466966_0057282 3300044684 Bacteria 2464
623 Ga0466966_0084103 3300044684 Bacteria 1980
624 Ga0466961_0000897 3300044693 Bacteria 18504
625 Ga0466963_0370225 3300044694 Bacteria 1009
626 Ga0466971_0120924 3300044719 Bacteria 1212
627 Ga0466957_0139098 3300044842 Bacteria 1563
628 Ga0466960_0020623 3300044901 Bacteria 2922
629 Ga0466960_0284354 3300044901 Bacteria 928
630 Ga0466959_0004435 3300045049 Bacteria 9399
631 Ga0466959_0035818 3300045049 Bacteria 3667
632 Ga0466959_0298228 3300045049 Bacteria 1104
633 Ga0451576_0934075 3300045051 Bacteria 910
634 Ga0466967_0135506 3300045976 Bacteria 2290
635 Ga0466967_0245825 3300045976 Bacteria 1707
636 Ga0466967_0268645 3300045976 Bacteria 1634
637 Ga0495592_0140292 3300046454 Bacteria 1682
638 Ga0495603_0097065 3300046455 Bacteria 1721
639 Ga0495629_0028607 3300046459 Bacteria 3955
640 Ga0495638_0023867 3300046460 Bacteria 3994
641 Ga0495638_0030772 3300046460 Bacteria 3451
642 Ga0495638_0091842 3300046460 Bacteria 1827
643 Ga0495651_0022721 3300046462 Bacteria 4875
644 Ga0495651_0043109 3300046462 Bacteria 3501
645 Ga0495651_0063776 3300046462 Bacteria 2816
646 Ga0495651_0090764 3300046462 Bacteria 2291
647 Ga0495651_0252196 3300046462 Bacteria 1204
648 Ga0495653_0088004 3300046463 Bacteria 2280
649 Ga0495650_0110195 3300046471 Bacteria 1023
650 Ga0495580_0360360 3300046472 Bacteria 984
651 Ga0495580_0627811 3300046472 Bacteria 708
652 Ga0495605_0109212 3300046474 Bacteria 1264
653 Ga0495639_0127713 3300046475 Bacteria 1216
654 Ga0495664_0043121 3300046477 Bacteria 2673
655 Ga0495664_0043518 3300046477 Bacteria 2661
656 Ga0495664_0091342 3300046477 Bacteria 1830
657 Ga0495596_0098022 3300046500 Bacteria 1138
658 Ga0495608_0097641 3300046511 Bacteria 1896
659 Ga0495610_0120719 3300046512 Bacteria 1149
660 Ga0495616_0186379 3300046513 Bacteria 919
661 Ga0495618_0100421 3300046514 Bacteria 1852
662 Ga0495618_0173006 3300046514 Bacteria 1374
663 Ga0495620_0056120 3300046515 Bacteria 1658
664 Ga0495620_0108146 3300046515 Bacteria 1104
665 Ga0495628_0018136 3300046516 Bacteria 5836
666 Ga0495628_0204353 3300046516 Bacteria 1487
667 Ga0495628_0375163 3300046516 Bacteria 1042
668 Ga0495630_0186812 3300046517 Bacteria 1581
669 Ga0495631_0173670 3300046518 Bacteria 924
670 Ga0495632_0175322 3300046519 Bacteria 984
671 Ga0495643_0011165 3300046522 Bacteria 5488
672 Ga0495643_0244724 3300046522 Bacteria 840
673 Ga0495644_0163388 3300046523 Bacteria 854
674 Ga0495648_0008154 3300046524 Bacteria 8268
675 Ga0495648_0035226 3300046524 Bacteria 3247
676 Ga0495648_0087725 3300046524 Bacteria 1751
677 Ga0495648_0101946 3300046524 Bacteria 1582
678 Ga0495648_0146599 3300046524 Bacteria 1236
679 Ga0495648_0323115 3300046524 Bacteria 714
680 Ga0495666_0211888 3300046526 Bacteria 889
681 Ga0495652_0004702 3300046529 Bacteria 13012
682 Ga0495652_0126608 3300046529 Bacteria 2028
683 Ga0495654_0020872 3300046530 Bacteria 3411
684 Ga0495640_0206161 3300046533 Bacteria 1244
685 Ga0495640_0320815 3300046533 Bacteria 960
686 Ga0495587_0031425 3300046536 Bacteria 3215
687 Ga0495587_0058205 3300046536 Bacteria 2271
688 Ga0495597_0315452 3300046542 Bacteria 605
689 Ga0495645_0061947 3300046543 Bacteria 2710
690 Ga0495645_0069362 3300046543 Bacteria 2545
691 Ga0495645_0096018 3300046543 Bacteria 2112
692 Ga0495622_0025030 3300046557 Bacteria 2787
693 Ga0495622_0031167 3300046557 Bacteria 2493
694 Ga0495622_0127254 3300046557 Bacteria 1161
695 Ga0495633_0204791 3300046558 Bacteria 905
696 Ga0495667_0075923 3300046559 Bacteria 2186
697 Ga0495667_0118424 3300046559 Bacteria 1710
698 Ga0495667_0141940 3300046559 Bacteria 1547
699 Ga0495656_0026298 3300046615 Bacteria 2316
700 Ga0495668_0140594 3300046616 Bacteria 1321
701 Ga0495668_0232388 3300046616 Bacteria 1010
702 Ga0495625_0138384 3300046660 Bacteria 1644
703 Ga0495625_0150178 3300046660 Bacteria 1567
704 Ga0495635_0003655 3300046663 Bacteria 10669
705 Ga0495661_0142722 3300046665 Bacteria 1301
706 Ga0495661_0321456 3300046665 Bacteria 769
707 Ga0495588_0024575 3300046674 Bacteria 2994
708 Ga0495657_0010925 3300046675 Bacteria 6812
709 Ga0495657_0361892 3300046675 Bacteria 857
710 Ga0495599_0004038 3300046678 Bacteria 8639
711 Ga0495599_0008515 3300046678 Bacteria 6240
712 Ga0495599_0222184 3300046678 Bacteria 1155
713 Ga0495623_0032867 3300046679 Bacteria 3332
714 Ga0495623_0054800 3300046679 Bacteria 2515
715 Ga0495623_0250544 3300046679 Bacteria 996
716 Ga0495646_0019570 3300046680 Bacteria 4283
717 Ga0495646_0064544 3300046680 Bacteria 2170
718 Ga0495658_0069551 3300046683 Bacteria 2041
719 Ga0495658_0472031 3300046683 Bacteria 802
720 Ga0495613_0039815 3300046689 Bacteria 3483
721 Ga0495613_0713501 3300046689 Bacteria 659
722 Ga0495670_0008140 3300046691 Bacteria 5153
723 Ga0495649_0143514 3300046694 Bacteria 1256
724 Ga0495589_0164040 3300046794 Bacteria 1058
725 Ga0495600_0090783 3300046809 Bacteria 1992
726 Ga0495600_0188173 3300046809 Bacteria 1328
727 Ga0495600_0464161 3300046809 Bacteria 782
728 Ga0495581_0270178 3300047315 Bacteria 994
729 Ga0495604_0076979 3300047317 Bacteria 2508
730 Ga0495604_0077995 3300047317 Bacteria 2487
731 Ga0495604_0142584 3300047317 Bacteria 1710
732 Ga0495674_0045519 3300047319 Bacteria 3896
733 Ga0495674_0083343 3300047319 Bacteria 2741
734 Ga0495674_0447778 3300047319 Bacteria 1038
735 Ga0495672_0025107 3300047320 Bacteria 3822
736 Ga0495672_0052351 3300047320 Bacteria 2398
737 Ga0495672_0273113 3300047320 Bacteria 811
738 Ga0495680_0001058 3300047322 Bacteria 30479
739 Ga0495680_0075816 3300047322 Bacteria 2551
740 Ga0495675_0019629 3300047444 Bacteria 4293
741 Ga0495675_0045612 3300047444 Bacteria 2791
742 Ga0495685_138410 3300047447 Bacteria 794
743 Ga0495673_0144152 3300047469 Bacteria 926
744 Ga0495684_0009528 3300047471 Bacteria 7487
745 Ga0495684_0089430 3300047471 Bacteria 2333
746 Ga0495684_0097252 3300047471 Bacteria 2227
747 Ga0495684_0518169 3300047471 Bacteria 817
748 Ga0495686_0027319 3300047472 Bacteria 3728
749 Ga0495686_0117128 3300047472 Bacteria 1592
750 Ga0495686_0203178 3300047472 Bacteria 1136
751 Ga0495686_0252232 3300047472 Bacteria 991
752 Ga0495593_0009950 3300047673 Bacteria 5513
753 Ga0495602_0033384 3300048088 Bacteria 4828
754 Ga0495602_0073454 3300048088 Bacteria 2911
755 Ga0495602_0117596 3300048088 Bacteria 2145
756 Ga0495626_0234328 3300048091 Bacteria 741
757 Ga0496100_0567242 3300048903 Bacteria 879
758 Ga0496100_0640240 3300048903 Bacteria 827
759 Ga0496101_0032337 3300048904 Bacteria 3682
760 Ga0496101_0593743 3300048904 Bacteria 875
761 Ga0496102_0010822 3300048905 Bacteria 7854
762 Ga0496102_0027568 3300048905 Bacteria 5072
763 Ga0496102_0128519 3300048905 Bacteria 2370
764 Ga0496102_0243168 3300048905 Bacteria 1697
765 Ga0496102_0798025 3300048905 Bacteria 866
766 Ga0496103_0152319 3300048906 Bacteria 1481
767 Ga0496103_0189649 3300048906 Bacteria 1322
768 Ga0496103_0325757 3300048906 Bacteria 988
769 Ga0496103_0355448 3300048906 Bacteria 942
770 Ga0496104_0023058 3300048907 Bacteria 5720
771 Ga0496104_0058026 3300048907 Bacteria 3663
772 Ga0496104_0080689 3300048907 Bacteria 3102
773 Ga0496104_0219268 3300048907 Bacteria 1814
774 Ga0496105_0003256 3300048908 Bacteria 11964
775 Ga0496105_0050230 3300048908 Bacteria 3445
776 Ga0496105_0100928 3300048908 Bacteria 2383
777 Ga0496105_0127573 3300048908 Bacteria 2097
778 Ga0496106_0000590 3300048909 Bacteria 25948
779 Ga0496106_0019427 3300048909 Bacteria 5039
780 Ga0496106_0021369 3300048909 Bacteria 4806
781 Ga0496107_0021351 3300048910 Bacteria 4576
782 Ga0496107_0068714 3300048910 Bacteria 2571
783 Ga0496108_0070106 3300048911 Bacteria 2958
784 Ga0496108_0208148 3300048911 Bacteria 1698
785 Ga0496109_0115275 3300048912 Bacteria 2500
786 Ga0496109_0153408 3300048912 Bacteria 2157
787 Ga0496109_0230326 3300048912 Bacteria 1743
788 Ga0496109_0251566 3300048912 Bacteria 1664
789 Ga0496109_0362814 3300048912 Bacteria 1369
790 Ga0496110_0041874 3300048913 Bacteria 3998
791 Ga0496110_0160405 3300048913 Bacteria 2038
792 Ga0496110_0677798 3300048913 Bacteria 932
793 Ga0496111_0012746 3300048914 Bacteria 5700
794 Ga0496111_0063387 3300048914 Bacteria 2681
795 Ga0496111_0405883 3300048914 Bacteria 1007
796 Ga0496112_0108545 3300048915 Bacteria 2745
797 Ga0496112_0173926 3300048915 Bacteria 2118
798 Ga0496112_0180646 3300048915 Bacteria 2074
799 Ga0496112_0202408 3300048915 Bacteria 1944
800 Ga0496113_0022651 3300048916 Bacteria 4448
801 Ga0496114_0361114 3300048917 Bacteria 1285
802 Ga0496115_0006885 3300048918 Bacteria 8350
803 Ga0496115_0126002 3300048918 Bacteria 2110
804 Ga0496115_0140467 3300048918 Bacteria 1993
805 Ga0496115_0409522 3300048918 Bacteria 1099
806 Ga0496116_0002646 3300048919 Bacteria 18551
807 Ga0496116_0039136 3300048919 Bacteria 3282
808 Ga0496116_0112190 3300048919 Bacteria 1599
809 Ga0496117_0038406 3300048920 Bacteria 3550
810 Ga0496117_0084805 3300048920 Bacteria 2065
811 Ga0496117_0181706 3300048920 Bacteria 1208
812 Ga0496118_0006524 3300048921 Bacteria 12776
813 Ga0496118_0044149 3300048921 Bacteria 3493
814 Ga0496119_0043790 3300048922 Bacteria 2825
815 Ga0496120_0051799 3300048923 Bacteria 2342
816 Ga0496120_0088658 3300048923 Bacteria 1658
817 Ga0496120_0096386 3300048923 Bacteria 1571
818 Ga0496121_0000125 3300048924 Bacteria 169274
819 Ga0496121_0001272 3300048924 Bacteria 43421
820 Ga0496121_0008599 3300048924 Bacteria 11955
821 Ga0496121_0076460 3300048924 Bacteria 2669
822 Ga0496121_0143072 3300048924 Bacteria 1771
823 Ga0496121_0210360 3300048924 Bacteria 1378
824 Ga0496122_0056702 3300048925 Bacteria 2918
825 Ga0496122_0142229 3300048925 Bacteria 1498
826 Ga0496122_0277218 3300048925 Bacteria 919
827 Ga0496123_0027721 3300048926 Bacteria 4212
828 Ga0496123_0088597 3300048926 Bacteria 1847
829 Ga0496123_0135646 3300048926 Bacteria 1355
830 Ga0496124_0001012 3300048927 Bacteria 44554
831 Ga0496124_0094473 3300048927 Bacteria 2432
832 Ga0496124_0311498 3300048927 Bacteria 1132
833 Ga0496124_0398720 3300048927 Bacteria 956
834 Ga0496125_0001016 3300048928 Bacteria 43614
835 Ga0496125_0008788 3300048928 Bacteria 10506
836 Ga0496126_0003769 3300048929 Bacteria 18829
837 Ga0496126_0012961 3300048929 Bacteria 8511
838 Ga0496126_0022781 3300048929 Bacteria 6084
839 Ga0496126_0027303 3300048929 Bacteria 5455
840 Ga0496126_0029959 3300048929 Bacteria 5164
841 Ga0496126_0032681 3300048929 Bacteria 4900
842 Ga0496126_0061654 3300048929 Bacteria 3368
843 Ga0496126_0078583 3300048929 Bacteria 2923
844 Ga0496126_0081800 3300048929 Bacteria 2854
845 Ga0496126_0085263 3300048929 Bacteria 2785
846 Ga0496126_0170056 3300048929 Bacteria 1857
847 Ga0496126_0259269 3300048929 Bacteria 1446
848 Ga0496126_0265198 3300048929 Bacteria 1427
849 Ga0496126_0402242 3300048929 Bacteria 1110
850 Ga0496126_0556911 3300048929 Bacteria 909
851 Ga0496126_0676223 3300048929 Bacteria 805
852 Ga0496126_0786820 3300048929 Bacteria 731
853 Ga0495682_0143113 3300049460 Bacteria 854
854 Ga0501033_0117026 3300049570 Bacteria 1936
855 Ga0501038_0706806 3300049574 Bacteria 755
856 Ga0501039_0057355 3300049575 Bacteria 3016
857 Ga0501041_0292468 3300049577 Bacteria 1026
858 Ga0501042_0273844 3300049578 Bacteria 1219
859 Ga0501046_0039535 3300049580 Bacteria 3777
860 Ga0501046_0174727 3300049580 Bacteria 1609
861 Ga0501047_0072069 3300049581 Bacteria 3325
862 Ga0501048_0077515 3300049582 Bacteria 2346
863 Ga0501070_0104112 3300049586 Bacteria 2347
864 Ga0501071_0137284 3300049587 Bacteria 1820
865 Ga0501072_0049809 3300049588 Bacteria 3298
866 Ga0501073_0260568 3300049589 Bacteria 1197
867 Ga0501075_0179208 3300049591 Bacteria 1617
868 Ga0501076_0159958 3300049592 Bacteria 1834
869 Ga0501077_0545093 3300049593 Bacteria 744
870 Ga0501080_0072507 3300049742 Bacteria 3204
871 Ga0501080_0242339 3300049742 Bacteria 1645
872 Ga0501080_0364310 3300049742 Bacteria 1304
873 Ga0501081_0559946 3300049743 Bacteria 854
874 Ga0501044_0457937 3300049823 Bacteria 1181
875 Ga0501045_0027388 3300049824 Bacteria 4107
876 nmdc:mga03n38_16872_c1 3300050490 Bacteria 2849
877 nmdc:mga00v17_42220_c1 3300050491 Bacteria 2742
878 nmdc:mga00v17_54226_c1 3300050491 Bacteria 2445
879 nmdc:mga0yw44_214191_c1 3300050492 Bacteria 1275
880 nmdc:mga0yw44_242129_c1 3300050492 Bacteria 1199
881 nmdc:mga0yw44_64875_c1 3300050492 Bacteria 2249
882 nmdc:mga0yw44_92377_c1 3300050492 Bacteria 1915
883 nmdc:mga0k408_171755_c1 3300050493 Bacteria 1292
884 nmdc:mga06z11_12821_c1 3300050494 Bacteria 3657
885 nmdc:mga04h51_20547_c1 3300050495 Bacteria 1973
886 nmdc:mga07m45_146321_c1 3300050496 Bacteria 1370
887 nmdc:mga07m45_200702_c1 3300050496 Bacteria 1160
888 nmdc:mga05p37_140395_c2 3300050507 Bacteria 2131
889 nmdc:mga05p37_387592_c1 3300050507 Bacteria 1635
890 nmdc:mga06r32_869395_c1 3300050510 Bacteria 859
891 nmdc:mga08y16_247761_c1 3300050511 Bacteria 1841
892 nmdc:mga08y16_279_c1 3300050511 Bacteria 46569
893 nmdc:mga08y16_72636_c1 3300050511 Bacteria 3585
894 nmdc:mga0n895_12272_c1 3300050512 Bacteria 7679
895 nmdc:mga0n895_289223_c1 3300050512 Bacteria 1662
896 nmdc:mga0n895_49730_c1 3300050512 Bacteria 4109
897 nmdc:mga0rr50_258019_c1 3300050513 Bacteria 1450
898 nmdc:mga0rr50_3590_c1 3300050513 Bacteria 8967
899 nmdc:mga08x19_241078_c1 3300050514 Bacteria 1246
900 nmdc:mga0a205_25005_c1 3300050515 Bacteria 5685
901 nmdc:mga0a205_62216_c3 3300050515 Bacteria 2157
902 nmdc:mga0a205_671334_c1 3300050515 Bacteria 887
903 nmdc:mga0sz30_188296_c1 3300050516 Bacteria 916
904 Ga0495601_0034790 3300053077 Bacteria 3143
905 Ga0495601_0049041 3300053077 Bacteria 2661
906 Ga0495601_0210260 3300053077 Bacteria 1271
907 Ga0495612_0052290 3300053078 Bacteria 1680
908 Ga0495612_0073744 3300053078 Bacteria 1426
909 Ga0500635_0002719 3300053080 Bacteria 4389
910 Ga0495595_0025394 3300053084 Bacteria 2625
911 Ga0495619_0020514 3300053085 Bacteria 4210
912 Ga0495619_0023185 3300053085 Bacteria 3977
913 Ga0495619_0509436 3300053085 Bacteria 827
914 Ga0500578_0035459 3300053086 Bacteria 3205
915 Ga0500578_0056796 3300053086 Bacteria 2503
916 Ga0500643_000013 3300053087 Bacteria 324296
917 Ga0500643_025224 3300053087 Bacteria 1878
918 Ga0500651_0164309 3300053093 Bacteria 1326
919 Ga0500566_0000329 3300053094 Bacteria 25790
920 Ga0500566_0084133 3300053094 Bacteria 1766
921 Ga0500566_0141646 3300053094 Bacteria 1275
922 Ga0500641_0003878 3300053096 Bacteria 5284
923 Ga0500641_0021761 3300053096 Bacteria 2449
924 Ga0500650_0000589 3300053098 Bacteria 9417
925 Ga0500554_011172 3300053102 Bacteria 2215
926 Ga0500556_0000238 3300053104 Bacteria 44627
927 Ga0500556_0127841 3300053104 Bacteria 994
928 Ga0500562_010221 3300053108 Bacteria 2376
929 Ga0500572_031194 3300053111 Bacteria 1487
930 Ga0500592_000637 3300053116 Bacteria 5743
931 Ga0500593_001238 3300053117 Bacteria 9242
932 Ga0500594_0027947 3300053118 Bacteria 1464
933 Ga0500595_002526 3300053119 Bacteria 9002
934 Ga0500595_002841 3300053119 Bacteria 8317
935 Ga0500607_027031 3300053121 Bacteria 3186
936 Ga0500608_095611 3300053122 Bacteria 1382
937 Ga0500642_0000108 3300053130 Bacteria 40058
938 Ga0500642_0049086 3300053130 Bacteria 1856
939 Ga0500652_002951 3300053131 Bacteria 5124
940 Ga0500658_0042410 3300053134 Bacteria 1828
941 Ga0500658_0057738 3300053134 Bacteria 1605
942 Ga0500559_0000839 3300053136 Bacteria 19888
943 Ga0500559_0006971 3300053136 Bacteria 5052
944 Ga0500559_0195659 3300053136 Bacteria 953
945 Ga0500564_024677 3300053138 Bacteria 2760
946 Ga0500568_0011393 3300053139 Bacteria 4131
947 Ga0500568_0018904 3300053139 Bacteria 3006
948 Ga0500568_0021247 3300053139 Bacteria 2795
949 Ga0500586_001118 3300053145 Bacteria 5546
950 Ga0500588_0076625 3300053146 Bacteria 1109
951 Ga0500590_044585 3300053148 Bacteria 2272
952 Ga0500590_059453 3300053148 Bacteria 1923
953 Ga0500603_000622 3300053150 Bacteria 8735
954 Ga0500603_152853 3300053150 Bacteria 716
955 Ga0500604_0004045 3300053151 Bacteria 3907
956 Ga0500604_0054951 3300053151 Bacteria 1237
957 Ga0500604_0055446 3300053151 Bacteria 1233
958 Ga0500616_0000197 3300053153 Bacteria 98372
959 Ga0500616_0006713 3300053153 Bacteria 7470
960 Ga0500616_0035875 3300053153 Bacteria 2694
961 Ga0500619_020679 3300053154 Bacteria 1885
962 Ga0500622_0002972 3300053156 Bacteria 11750
963 Ga0500622_0060366 3300053156 Bacteria 1934
964 Ga0500627_0049036 3300053158 Bacteria 1836
965 Ga0500636_0000390 3300053177 Bacteria 24204
966 Ga0500636_0002715 3300053177 Bacteria 9842
967 Ga0500637_0026031 3300053178 Bacteria 3220
968 Ga0500637_0036800 3300053178 Bacteria 2748
969 Ga0500570_119848 3300053724 Bacteria 1037
970 Ga0500645_035466 3300053730 Bacteria 1486
971 Ga0500552_036996 3300053733 Bacteria 779
972 Ga0500596_003929 3300053735 Bacteria 2777
973 Ga0500599_003770 3300053736 Bacteria 1859
974 Ga0501084_0771424 3300054114 Bacteria 810
975 Ga0500661_046636 3300055283 Bacteria 771
976 Ga0590075_009648 3300059424 Bacteria 2316
977 Ga0590077_016095 3300059426 Bacteria 1567
978 Ga0501082_0069839 3300060353 Bacteria 3025
979 Ga0466962_0078375 3300061719 Bacteria 1579
980 Ga0530510_0075038 3300061734 Bacteria 2456

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10212506 Ga0157374_102125061 153
2 3300039438 Ga0436360_0330088 Ga0436360_0330088_586_1200 162
3 3300048928 Ga0496125_0001016 Ga0496125_0001016_39202_39819 163
4 3300048929 Ga0496126_0676223 Ga0496126_0676223_16_567 165
5 3300035691 Ga0373931_0550711 Ga0373931_0550711_13_555 166
6 3300009094 Ga0111539_10725138 Ga0111539_107251382 167
7 3300046542 Ga0495597_0315452 Ga0495597_0315452_17_568 170
8 3300050511 nmdc:mga08y16_72636_c1 nmdc:mga08y16_72636_c1_19_570 170
9 3300041512 Ga0451853_1426409 Ga0451853_1426409_18_569 171
10 3300035692 Ga0373935_0493932 Ga0373935_0493932_298_870 176
11 3300021358 Ga0213873_10056117 Ga0213873_100561172 178
12 3300021384 Ga0213876_10004130 Ga0213876_100041306 178
13 3300021384 Ga0213876_10244026 Ga0213876_102440262 178
14 3300031649 Ga0307514_10401300 Ga0307514_104013001 178
15 3300039437 Ga0436365_0232459 Ga0436365_0232459_9092_9709 178
16 3300039437 Ga0436365_0776846 Ga0436365_0776846_717_1337 178
17 3300039450 Ga0436363_0771534 Ga0436363_0771534_512_1129 178
18 3300039453 Ga0436362_0394184 Ga0436362_0394184_19_636 178
19 3300005436 Ga0070713_100886146 Ga0070713_1008861461 179
20 3300005437 Ga0070710_10076409 Ga0070710_100764093 179
21 3300006163 Ga0070715_10065718 Ga0070715_100657182 179
22 3300006173 Ga0070716_100063132 Ga0070716_1000631322 179
23 3300006175 Ga0070712_100225106 Ga0070712_1002251061 179
24 3300025906 Ga0207699_10412559 Ga0207699_104125591 179
25 3300025915 Ga0207693_10002055 Ga0207693_1000205511 179
26 3300025929 Ga0207664_10680448 Ga0207664_106804481 179
27 3300025939 Ga0207665_10023354 Ga0207665_100233543 179
28 3300039437 Ga0436365_0577077 Ga0436365_0577077_618_1235 179
29 3300039437 Ga0436365_1062598 Ga0436365_1062598_585_1238 179
30 3300048929 Ga0496126_0556911 Ga0496126_0556911_129_746 179
31 3300025940 Ga0207691_10323236 Ga0207691_103232362 180
32 3300005434 Ga0070709_10001810 Ga0070709_1000181015 181
33 3300005435 Ga0070714_100000739 Ga0070714_10000073921 181
34 3300005437 Ga0070710_10015076 Ga0070710_100150762 181
35 3300005439 Ga0070711_100001343 Ga0070711_1000013432 181
36 3300005539 Ga0068853_100099598 Ga0068853_1000995982 181
37 3300006028 Ga0070717_10745229 Ga0070717_107452291 181
38 3300006163 Ga0070715_10000259 Ga0070715_100002599 181
39 3300006173 Ga0070716_100082549 Ga0070716_1000825491 181
40 3300009553 Ga0105249_10359346 Ga0105249_103593462 181
41 3300013104 Ga0157370_10376148 Ga0157370_103761482 181
42 3300013105 Ga0157369_10008826 Ga0157369_100088264 181
43 3300025904 Ga0207647_10088462 Ga0207647_100884622 181
44 3300025905 Ga0207685_10246065 Ga0207685_102460651 181
45 3300025906 Ga0207699_10184785 Ga0207699_101847852 181
46 3300025914 Ga0207671_10693079 Ga0207671_106930792 181
47 3300025915 Ga0207693_10017696 Ga0207693_100176962 181
48 3300025916 Ga0207663_10000268 Ga0207663_100002688 181
49 3300025928 Ga0207700_10098776 Ga0207700_100987762 181
50 3300025929 Ga0207664_10015168 Ga0207664_100151683 181
51 3300025939 Ga0207665_10005120 Ga0207665_100051209 181
52 3300026142 Ga0207698_10666618 Ga0207698_106666182 181
53 3300037466 Ga0395898_0958390 Ga0395898_0958390_76_693 181
54 3300005329 Ga0070683_100743556 Ga0070683_1007435561 182
55 3300005334 Ga0068869_100072632 Ga0068869_1000726324 182
56 3300005338 Ga0068868_100135706 Ga0068868_1001357063 182
57 3300005456 Ga0070678_100084853 Ga0070678_1000848533 182
58 3300005564 Ga0070664_100804585 Ga0070664_1008045852 182
59 3300005618 Ga0068864_100187641 Ga0068864_1001876413 182
60 3300006237 Ga0097621_100276798 Ga0097621_1002767982 182
61 3300009551 Ga0105238_10330753 Ga0105238_103307533 182
62 3300010375 Ga0105239_10034860 Ga0105239_100348604 182
63 3300011119 Ga0105246_10052887 Ga0105246_100528874 182
64 3300013308 Ga0157375_10079107 Ga0157375_100791074 182
65 3300013308 Ga0157375_11141754 Ga0157375_111417541 182
66 3300014969 Ga0157376_10063001 Ga0157376_100630013 182
67 3300017792 Ga0163161_10203406 Ga0163161_102034062 182
68 3300025900 Ga0207710_10153151 Ga0207710_101531512 182
69 3300025945 Ga0207679_10899390 Ga0207679_108993901 182
70 3300025960 Ga0207651_10320869 Ga0207651_103208693 182
71 3300026023 Ga0207677_10006386 Ga0207677_100063862 182
72 3300026067 Ga0207678_10114338 Ga0207678_101143384 182
73 3300026121 Ga0207683_10005742 Ga0207683_100057423 182
74 3300026142 Ga0207698_10179454 Ga0207698_101794541 182
75 3300030521 Ga0307511_10077257 Ga0307511_100772572 182
76 3300031507 Ga0307509_10031336 Ga0307509_100313367 182
77 3300031616 Ga0307508_10264664 Ga0307508_102646642 182
78 3300031730 Ga0307516_10004746 Ga0307516_1000474614 182
79 3300033179 Ga0307507_10034314 Ga0307507_100343143 182
80 3300035083 Ga0373926_0053706 Ga0373926_0053706_68_685 182
81 3300035116 Ga0373945_0335011 Ga0373945_0335011_14_631 182
82 3300035695 Ga0373927_0022900 Ga0373927_0022900_3070_3687 182
83 3300035725 Ga0373947_0093784 Ga0373947_0093784_801_1418 182
84 3300046475 Ga0495639_0127713 Ga0495639_0127713_64_720 182
85 3300046533 Ga0495640_0320815 Ga0495640_0320815_262_879 182
86 3300046557 Ga0495622_0127254 Ga0495622_0127254_96_713 182
87 3300046683 Ga0495658_0069551 Ga0495658_0069551_658_1314 182
88 3300048904 Ga0496101_0032337 Ga0496101_0032337_1575_2192 182
89 3300048905 Ga0496102_0010822 Ga0496102_0010822_5033_5650 182
90 3300048906 Ga0496103_0325757 Ga0496103_0325757_41_658 182
91 3300048908 Ga0496105_0127573 Ga0496105_0127573_481_1098 182
92 3300048909 Ga0496106_0000590 Ga0496106_0000590_20659_21276 182
93 3300048909 Ga0496106_0019427 Ga0496106_0019427_3413_4030 182
94 3300048910 Ga0496107_0021351 Ga0496107_0021351_3930_4547 182
95 3300048911 Ga0496108_0070106 Ga0496108_0070106_413_1030 182
96 3300048911 Ga0496108_0208148 Ga0496108_0208148_730_1347 182
97 3300048912 Ga0496109_0153408 Ga0496109_0153408_642_1259 182
98 3300048914 Ga0496111_0012746 Ga0496111_0012746_3418_4035 182
99 3300048915 Ga0496112_0202408 Ga0496112_0202408_700_1317 182
100 3300048916 Ga0496113_0022651 Ga0496113_0022651_68_685 182
101 3300048918 Ga0496115_0006885 Ga0496115_0006885_3316_3933 182
102 3300048920 Ga0496117_0038406 Ga0496117_0038406_60_677 182
103 3300048921 Ga0496118_0006524 Ga0496118_0006524_11328_11945 182
104 3300048924 Ga0496121_0001272 Ga0496121_0001272_19671_20288 182
105 3300048927 Ga0496124_0001012 Ga0496124_0001012_7835_8452 182
106 3300048929 Ga0496126_0022781 Ga0496126_0022781_2239_2856 182
107 3300053094 Ga0500566_0084133 Ga0500566_0084133_127_783 182
108 3300053094 Ga0500566_0141646 Ga0500566_0141646_417_1034 182
109 3300053119 Ga0500595_002841 Ga0500595_002841_3009_3665 182
110 3300053136 Ga0500559_0195659 Ga0500559_0195659_127_744 182
111 3300053148 Ga0500590_044585 Ga0500590_044585_245_862 182
112 3300053150 Ga0500603_152853 Ga0500603_152853_78_695 182
113 3300053178 Ga0500637_0026031 Ga0500637_0026031_270_926 182
114 3300053733 Ga0500552_036996 Ga0500552_036996_98_715 182
115 3300053735 Ga0500596_003929 Ga0500596_003929_151_768 182
116 3300005841 Ga0068863_100247303 Ga0068863_1002473032 183
117 3300006237 Ga0097621_100528133 Ga0097621_1005281332 183
118 3300013307 Ga0157372_11331699 Ga0157372_113316992 183
119 3300026088 Ga0207641_11027634 Ga0207641_110276341 183
120 3300037418 Ga0395900_0030083 Ga0395900_0030083_823_1446 183
121 3300038443 Ga0395901_0080688 Ga0395901_0080688_2639_3262 183
122 3300048918 Ga0496115_0126002 Ga0496115_0126002_160_774 183
123 3300048929 Ga0496126_0081800 Ga0496126_0081800_2004_2618 183
124 3300025941 Ga0207711_11083088 Ga0207711_110830881 184
125 3300005434 Ga0070709_10169753 Ga0070709_101697531 185
126 3300005435 Ga0070714_100250094 Ga0070714_1002500942 185
127 3300005435 Ga0070714_100674821 Ga0070714_1006748212 185
128 3300006028 Ga0070717_10036927 Ga0070717_100369273 185
129 3300006914 Ga0075436_100252916 Ga0075436_1002529162 185
130 3300025906 Ga0207699_10487129 Ga0207699_104871291 185
131 3300025914 Ga0207671_10422732 Ga0207671_104227322 185
132 3300025928 Ga0207700_10040532 Ga0207700_100405324 185
133 3300025929 Ga0207664_10232462 Ga0207664_102324621 185
134 3300031456 Ga0307513_10391228 Ga0307513_103912281 185
135 3300037466 Ga0395898_0102724 Ga0395898_0102724_1200_1844 185
136 3300048929 Ga0496126_0170056 Ga0496126_0170056_661_1278 185
137 3300050514 nmdc:mga08x19_241078_c1 nmdc:mga08x19_241078_c1_214_858 185
138 iso_pu_bacteria 2889033259 2889036730 185
139 3300005337 Ga0070682_100287131 Ga0070682_1002871312 186
140 3300005547 Ga0070693_100064160 Ga0070693_1000641603 186
141 3300009545 Ga0105237_11226030 Ga0105237_112260302 186
142 3300025915 Ga0207693_10319737 Ga0207693_103197372 186
143 3300025920 Ga0207649_10048682 Ga0207649_100486823 186
144 3300025921 Ga0207652_10688550 Ga0207652_106885502 186
145 3300025928 Ga0207700_10029573 Ga0207700_100295735 186
146 3300025945 Ga0207679_10348087 Ga0207679_103480871 186
147 3300026067 Ga0207678_10066250 Ga0207678_100662503 186
148 3300037853 Ga0436364_1241072 Ga0436364_1241072_1557_2171 186
149 iso_pu_bacteria 2844533157 2844537021 186
150 3300005614 Ga0068856_100010975 Ga0068856_1000109752 187
151 3300007788 Ga0099795_10050225 Ga0099795_100502252 187
152 3300009093 Ga0105240_10515571 Ga0105240_105155711 187
153 3300010159 Ga0099796_10153151 Ga0099796_101531511 187
154 3300025297 Ga0209758_1002619 Ga0209758_100261913 187
155 3300026078 Ga0207702_10008332 Ga0207702_100083321 187
156 3300031711 Ga0265314_10006103 Ga0265314_100061039 187
157 3300031712 Ga0265342_10022338 Ga0265342_100223383 187
158 3300044719 Ga0466971_0120924 Ga0466971_0120924_80_703 187
159 3300046675 Ga0495657_0361892 Ga0495657_0361892_84_701 187
160 3300047320 Ga0495672_0052351 Ga0495672_0052351_933_1550 187
161 3300061719 Ga0466962_0078375 Ga0466962_0078375_193_816 187
162 3300006173 Ga0070716_100023117 Ga0070716_1000231172 188
163 3300010159 Ga0099796_10008400 Ga0099796_100084003 188
164 3300025939 Ga0207665_10153462 Ga0207665_101534622 188
165 3300027512 Ga0209179_1038004 Ga0209179_10380041 188
166 3300035692 Ga0373935_0083861 Ga0373935_0083861_1184_1801 188
167 3300035695 Ga0373927_0029664 Ga0373927_0029664_2389_3006 188
168 3300035725 Ga0373947_0005065 Ga0373947_0005065_2620_3237 188
169 3300037068 Ga0373925_0052881 Ga0373925_0052881_52_669 188
170 3300005354 Ga0070675_100822117 Ga0070675_1008221171 189
171 3300005437 Ga0070710_10145812 Ga0070710_101458122 189
172 3300005543 Ga0070672_100175704 Ga0070672_1001757042 189
173 3300005616 Ga0068852_100060857 Ga0068852_1000608573 189
174 3300006175 Ga0070712_100295579 Ga0070712_1002955792 189
175 3300006852 Ga0075433_10164951 Ga0075433_101649513 189
176 3300006914 Ga0075436_100061935 Ga0075436_1000619353 189
177 3300007076 Ga0075435_100115462 Ga0075435_1001154622 189
178 3300025898 Ga0207692_10273505 Ga0207692_102735051 189
179 3300025915 Ga0207693_10353540 Ga0207693_103535402 189
180 3300025940 Ga0207691_10132406 Ga0207691_101324061 189
181 3300035695 Ga0373927_0193761 Ga0373927_0193761_41_652 189
182 3300045051 Ga0451576_0934075 Ga0451576_0934075_97_708 189
183 3300050512 nmdc:mga0n895_289223_c1 nmdc:mga0n895_289223_c1_758_1369 189
184 3300050513 nmdc:mga0rr50_258019_c1 nmdc:mga0rr50_258019_c1_515_1126 189
185 3300050515 nmdc:mga0a205_25005_c1 nmdc:mga0a205_25005_c1_1058_1669 189
186 3300003187 JGI25151J46595_10000212 JGI25151J46595_1000021225 190
187 3300003215 JGI25153J46596_10044984 JGI25153J46596_100449841 190
188 3300003354 JGI25160J50197_1004779 JGI25160J50197_10047795 190
189 3300005335 Ga0070666_10168944 Ga0070666_101689442 190
190 3300005338 Ga0068868_100017949 Ga0068868_1000179496 190
191 3300005353 Ga0070669_100230463 Ga0070669_1002304631 190
192 3300005356 Ga0070674_100166175 Ga0070674_1001661752 190
193 3300005364 Ga0070673_100039832 Ga0070673_1000398323 190
194 3300005364 Ga0070673_100210296 Ga0070673_1002102963 190
195 3300005439 Ga0070711_100098736 Ga0070711_1000987362 190
196 3300005441 Ga0070700_100227305 Ga0070700_1002273051 190
197 3300005544 Ga0070686_100520757 Ga0070686_1005207572 190
198 3300005563 Ga0068855_100884991 Ga0068855_1008849912 190
199 3300005618 Ga0068864_100023044 Ga0068864_1000230444 190
200 3300005719 Ga0068861_100126036 Ga0068861_1001260363 190
201 3300005719 Ga0068861_100375327 Ga0068861_1003753271 190
202 3300005843 Ga0068860_100437853 Ga0068860_1004378532 190
203 3300005981 Ga0081538_10013960 Ga0081538_100139601 190
204 3300005981 Ga0081538_10057728 Ga0081538_100577282 190
205 3300006237 Ga0097621_100025887 Ga0097621_1000258873 190
206 3300006844 Ga0075428_100395782 Ga0075428_1003957822 190
207 3300006852 Ga0075433_10173278 Ga0075433_101732783 190
208 3300006852 Ga0075433_10608976 Ga0075433_106089762 190
209 3300006871 Ga0075434_100000032 Ga0075434_1000000328 190
210 3300006881 Ga0068865_100036018 Ga0068865_1000360182 190
211 3300009094 Ga0111539_10000041 Ga0111539_1000004164 190
212 3300009094 Ga0111539_10321914 Ga0111539_103219142 190
213 3300009098 Ga0105245_10003142 Ga0105245_1000314210 190
214 3300009101 Ga0105247_10173827 Ga0105247_101738272 190
215 3300009147 Ga0114129_10367988 Ga0114129_103679883 190
216 3300009147 Ga0114129_10613486 Ga0114129_106134861 190
217 3300009177 Ga0105248_10358079 Ga0105248_103580793 190
218 3300013308 Ga0157375_11923246 Ga0157375_119232461 190
219 3300014326 Ga0157380_10014539 Ga0157380_100145396 190
220 3300014326 Ga0157380_11036227 Ga0157380_110362271 190
221 3300025284 Ga0209130_1000804 Ga0209130_10008044 190
222 3300025294 Ga0209025_1000779 Ga0209025_100077926 190
223 3300025294 Ga0209025_1088134 Ga0209025_10881342 190
224 3300025297 Ga0209758_1004105 Ga0209758_10041056 190
225 3300025302 Ga0207426_1000066 Ga0207426_1000066142 190
226 3300025900 Ga0207710_10118987 Ga0207710_101189872 190
227 3300025903 Ga0207680_10213777 Ga0207680_102137772 190
228 3300025917 Ga0207660_10156422 Ga0207660_101564222 190
229 3300025918 Ga0207662_10025844 Ga0207662_100258443 190
230 3300025923 Ga0207681_10187774 Ga0207681_101877742 190
231 3300025927 Ga0207687_10013783 Ga0207687_100137832 190
232 3300025937 Ga0207669_10193825 Ga0207669_101938251 190
233 3300025939 Ga0207665_10254616 Ga0207665_102546161 190
234 3300025960 Ga0207651_10176473 Ga0207651_101764732 190
235 3300025960 Ga0207651_10354753 Ga0207651_103547532 190
236 3300026023 Ga0207677_10397371 Ga0207677_103973712 190
237 3300026075 Ga0207708_10323893 Ga0207708_103238932 190
238 3300026095 Ga0207676_10418626 Ga0207676_104186262 190
239 3300026118 Ga0207675_100436573 Ga0207675_1004365731 190
240 3300027907 Ga0207428_10038011 Ga0207428_100380112 190
241 3300027907 Ga0207428_10524136 Ga0207428_105241361 190
242 3300028381 Ga0268264_10400618 Ga0268264_104006182 190
243 3300031238 Ga0265332_10001366 Ga0265332_100013662 190
244 3300031242 Ga0265329_10040123 Ga0265329_100401231 190
245 3300031247 Ga0265340_10014446 Ga0265340_100144465 190
246 3300031249 Ga0265339_10065967 Ga0265339_100659673 190
247 3300031250 Ga0265331_10045552 Ga0265331_100455523 190
248 3300031548 Ga0307408_100527841 Ga0307408_1005278411 190
249 3300031711 Ga0265314_10068081 Ga0265314_100680811 190
250 3300031712 Ga0265342_10000093 Ga0265342_100000932 190
251 3300031824 Ga0307413_10032229 Ga0307413_100322291 190
252 3300031852 Ga0307410_10094860 Ga0307410_100948604 190
253 3300031903 Ga0307407_10095969 Ga0307407_100959692 190
254 3300031995 Ga0307409_100003189 Ga0307409_1000031899 190
255 3300032002 Ga0307416_100014520 Ga0307416_1000145202 190
256 3300032002 Ga0307416_100080816 Ga0307416_1000808162 190
257 3300032126 Ga0307415_100358692 Ga0307415_1003586921 190
258 3300035170 Ga0373943_0061942 Ga0373943_0061942_648_1277 190
259 3300041997 Ga0439431_0031868 Ga0439431_0031868_165_773 190
260 3300044901 Ga0466960_0284354 Ga0466960_0284354_101_712 190
261 3300046472 Ga0495580_0360360 Ga0495580_0360360_318_947 190
262 3300049570 Ga0501033_0117026 Ga0501033_0117026_230_844 190
263 3300049575 Ga0501039_0057355 Ga0501039_0057355_231_845 190
264 3300049577 Ga0501041_0292468 Ga0501041_0292468_176_790 190
265 3300049578 Ga0501042_0273844 Ga0501042_0273844_532_1146 190
266 3300049580 Ga0501046_0174727 Ga0501046_0174727_329_943 190
267 3300049581 Ga0501047_0072069 Ga0501047_0072069_2101_2715 190
268 3300049582 Ga0501048_0077515 Ga0501048_0077515_1697_2311 190
269 3300049586 Ga0501070_0104112 Ga0501070_0104112_678_1292 190
270 3300049588 Ga0501072_0049809 Ga0501072_0049809_2401_3015 190
271 3300049591 Ga0501075_0179208 Ga0501075_0179208_550_1164 190
272 3300049592 Ga0501076_0159958 Ga0501076_0159958_940_1554 190
273 3300049593 Ga0501077_0545093 Ga0501077_0545093_59_673 190
274 3300049742 Ga0501080_0072507 Ga0501080_0072507_1953_2567 190
275 3300049742 Ga0501080_0364310 Ga0501080_0364310_397_1011 190
276 3300049743 Ga0501081_0559946 Ga0501081_0559946_59_673 190
277 3300049823 Ga0501044_0457937 Ga0501044_0457937_64_678 190
278 3300049824 Ga0501045_0027388 Ga0501045_0027388_2107_2721 190
279 3300050507 nmdc:mga05p37_140395_c2 nmdc:mga05p37_140395_c2_904_1518 190
280 3300050510 nmdc:mga06r32_869395_c1 nmdc:mga06r32_869395_c1_36_650 190
281 3300050511 nmdc:mga08y16_247761_c1 nmdc:mga08y16_247761_c1_718_1332 190
282 3300050511 nmdc:mga08y16_279_c1 nmdc:mga08y16_279_c1_22511_23128 190
283 3300050512 nmdc:mga0n895_12272_c1 nmdc:mga0n895_12272_c1_3889_4503 190
284 3300050513 nmdc:mga0rr50_3590_c1 nmdc:mga0rr50_3590_c1_6707_7321 190
285 3300050515 nmdc:mga0a205_62216_c3 nmdc:mga0a205_62216_c3_1334_1948 190
286 3300050515 nmdc:mga0a205_671334_c1 nmdc:mga0a205_671334_c1_219_836 190
287 3300053117 Ga0500593_001238 Ga0500593_001238_4288_4902 190
288 3300053153 Ga0500616_0006713 Ga0500616_0006713_1156_1770 190
289 3300059424 Ga0590075_009648 Ga0590075_009648_364_1017 190
290 3300059426 Ga0590077_016095 Ga0590077_016095_596_1249 190
291 3300060353 Ga0501082_0069839 Ga0501082_0069839_2360_2974 190
292 3300061734 Ga0530510_0075038 Ga0530510_0075038_305_919 190
293 iso_pu_bacteria 2508501128 2509147940 190
294 iso_pu_bacteria 2513237095 2513648206 190
295 iso_pu_bacteria 2513237096 2513655703 190
296 iso_pu_bacteria 2513237098 2513673421 190
297 iso_pu_bacteria 2513237101 2513697258 190
298 iso_pu_bacteria 2513237137 2513862750 190
299 iso_pu_bacteria 2513237141 2513892970 190
300 iso_pu_bacteria 2513237145 2513916219 190
301 iso_pu_bacteria 2517572143 2517890171 190
302 iso_pu_bacteria 2524023210 2524464735 190
303 iso_pu_bacteria 2524023228 2524538295 190
304 iso_pu_bacteria 2667528175 2671121630 190
305 iso_pu_bacteria 2721755755 2723848695 190
306 iso_pu_bacteria 2728368998 2728751970 190
307 iso_pu_bacteria 2791355197 2793067846 190
308 iso_pu_bacteria 2791355199 2793077498 190
309 iso_pu_bacteria 2816332527 2818239783 190
310 iso_pu_bacteria 2857524615 2857526939 190
311 iso_pu_bacteria 2874604998 2874606178 190
312 iso_pu_bacteria 2876808645 2876814761 190
313 iso_pu_bacteria 2879110137 2879115526 190
314 iso_pu_bacteria 2885374607 2885382313 190
315 iso_pu_bacteria 2885383462 2885388634 190
316 iso_pu_bacteria 2893066018 2893070090 190
317 iso_pu_bacteria 2903748898 2903755187 190
318 iso_pu_bacteria 2903768456 2903776680 190
319 iso_pu_bacteria 2904690495 2904692991 190
320 iso_pu_bacteria 2904699407 2904706654 190
321 iso_pu_bacteria 2906610324 2906612057 190
322 iso_pu_bacteria 2906635258 2906640283 190
323 iso_pu_bacteria 2906660503 2906663611 190
324 iso_pu_bacteria 2908739725 2908740404 190
325 iso_pu_bacteria 2908756301 2908757985 190
326 iso_pu_bacteria 2919073203 2919078059 190
327 iso_pu_bacteria 2922361189 2922363557 190
328 iso_pu_bacteria 2922386360 2922389677 190
329 iso_pu_bacteria 2922425934 2922427237 190
330 iso_pu_bacteria 2935630451 2935636269 190
331 iso_pu_bacteria 2941507105 2941512900 190
332 iso_pu_bacteria 2941515067 2941520798 190
333 iso_pu_bacteria 2941523033 2941528813 190
334 iso_pu_bacteria 3005474847 3005476414 190
335 iso_pu_bacteria 3005506211 3005506960 190
336 iso_pu_bacteria 8006933436 8006937761 190
337 iso_pu_bacteria 8006964411 8006971207 190
338 iso_pu_bacteria 8006973647 8006977789 190
339 iso_pu_bacteria 8006984368 8006986379 190
340 iso_pu_bacteria 8006994254 8006999068 190
341 iso_pu_bacteria 8016522445 8016524803 190
342 iso_pu_bacteria 8016530956 8016538372 190
343 iso_pu_bacteria 8016539877 8016542653 190
344 iso_pu_bacteria 8016548790 8016550621 190
345 iso_pu_bacteria 8016557553 8016559044 190
346 iso_pu_bacteria 8016566248 8016568035 190
347 iso_pu_bacteria 8016575299 8016580720 190
348 iso_pu_bacteria 8016595262 8016596999 190
349 iso_pu_bacteria 8016622563 8016629926 190
350 iso_pu_bacteria 8019530166 8019538042 190
351 iso_pu_bacteria 8019547302 8019548860 190
352 iso_pu_bacteria 8019555841 8019560879 190
353 iso_pu_bacteria 8019565922 8019570963 190
354 iso_pu_bacteria 8056673599 8056675523 190
355 iso_pu_bacteria 8056681323 8056684682 190
356 iso_pu_bacteria 8056689827 8056695494 190
357 3300005347 Ga0070668_100252506 Ga0070668_1002525062 191
358 3300005434 Ga0070709_10014082 Ga0070709_100140826 191
359 3300005436 Ga0070713_100057137 Ga0070713_1000571374 191
360 3300005458 Ga0070681_10016302 Ga0070681_100163026 191
361 3300005530 Ga0070679_100069266 Ga0070679_1000692664 191
362 3300005539 Ga0068853_100981588 Ga0068853_1009815881 191
363 3300006175 Ga0070712_100355044 Ga0070712_1003550442 191
364 3300006178 Ga0075367_10036272 Ga0075367_100362722 191
365 3300006186 Ga0075369_10120610 Ga0075369_101206102 191
366 3300006871 Ga0075434_100086670 Ga0075434_1000866703 191
367 3300009551 Ga0105238_10889928 Ga0105238_108899281 191
368 3300025906 Ga0207699_10017411 Ga0207699_100174112 191
369 3300025912 Ga0207707_10001660 Ga0207707_100016607 191
370 3300025915 Ga0207693_10510810 Ga0207693_105108102 191
371 3300025917 Ga0207660_10263399 Ga0207660_102633992 191
372 3300025921 Ga0207652_10010980 Ga0207652_100109805 191
373 3300025921 Ga0207652_10226582 Ga0207652_102265822 191
374 3300028786 Ga0307517_10000196 Ga0307517_1000019629 191
375 3300028794 Ga0307515_10146364 Ga0307515_101463642 191
376 3300031456 Ga0307513_10084532 Ga0307513_100845324 191
377 3300031665 Ga0316575_10172963 Ga0316575_101729631 191
378 3300031691 Ga0316579_10132590 Ga0316579_101325901 191
379 3300032133 Ga0316583_10001162 Ga0316583_100011625 191
380 3300045976 Ga0466967_0245825 Ga0466967_0245825_891_1508 191
381 3300046660 Ga0495625_0150178 Ga0495625_0150178_63_680 191
382 3300050495 nmdc:mga04h51_20547_c1 nmdc:mga04h51_20547_c1_262_879 191
383 3300050512 nmdc:mga0n895_49730_c1 nmdc:mga0n895_49730_c1_1462_2079 191
384 iso_pu_bacteria 2507262055 2507511816 191
385 iso_pu_bacteria 2508501009 2508545481 191
386 iso_pu_bacteria 2508501042 2508694299 191
387 iso_pu_bacteria 2511231028 2511396722 191
388 iso_pu_bacteria 2513237092 2513626772 191
389 iso_pu_bacteria 2513237094 2513643356 191
390 iso_pu_bacteria 2513237102 2513701916 191
391 iso_pu_bacteria 2513237104 2513720461 191
392 iso_pu_bacteria 2513237161 2514014346 191
393 iso_pu_bacteria 2515154112 2515624778 191
394 iso_pu_bacteria 2524023205 2524438252 191
395 iso_pu_bacteria 2528768022 2528853573 191
396 iso_pu_bacteria 2617270735 2617349570 191
397 iso_pu_bacteria 2617270741 2617376764 191
398 iso_pu_bacteria 2744054633 2745077319 191
399 iso_pu_bacteria 2791355196 2793059693 191
400 iso_pu_bacteria 2802429603 2805919607 191
401 iso_pu_bacteria 2824600985 2824607462 191
402 iso_pu_bacteria 2824609381 2824613373 191
403 iso_pu_bacteria 2824617872 2824624703 191
404 iso_pu_bacteria 2824626560 2824633641 191
405 iso_pu_bacteria 2824635225 2824642510 191
406 iso_pu_bacteria 2824644064 2824650198 191
407 iso_pu_bacteria 2824653114 2824658819 191
408 iso_pu_bacteria 2824661429 2824671041 191
409 iso_pu_bacteria 2824671348 2824678656 191
410 iso_pu_bacteria 2824679649 2824685539 191
411 iso_pu_bacteria 2824687955 2824695322 191
412 iso_pu_bacteria 2824696289 2824700053 191
413 iso_pu_bacteria 2824704595 2824707668 191
414 iso_pu_bacteria 2824714736 2824720038 191
415 iso_pu_bacteria 2824723954 2824730385 191
416 iso_pu_bacteria 2824732956 2824739125 191
417 iso_pu_bacteria 2824746037 2824750639 191
418 iso_pu_bacteria 2824753945 2824757415 191
419 iso_pu_bacteria 2824763712 2824768028 191
420 iso_pu_bacteria 2824773399 2824780193 191
421 iso_pu_bacteria 2838122688 2838130500 191
422 iso_pu_bacteria 2841941048 2841942193 191
423 iso_pu_bacteria 2841949485 2841955347 191
424 iso_pu_bacteria 2841957949 2841963578 191
425 iso_pu_bacteria 2841966195 2841971284 191
426 iso_pu_bacteria 2841974524 2841981576 191
427 iso_pu_bacteria 2841983080 2841987116 191
428 iso_pu_bacteria 2842038055 2842042059 191
429 iso_pu_bacteria 2842045827 2842050102 191
430 iso_pu_bacteria 2844315083 2844321028 191
431 iso_pu_bacteria 2847930680 2847932355 191
432 iso_pu_bacteria 2847939898 2847943602 191
433 iso_pu_bacteria 2849076700 2849077325 191
434 iso_pu_bacteria 2857509624 2857515066 191
435 iso_pu_bacteria 2874590934 2874593656 191
436 iso_pu_bacteria 2874612657 2874614091 191
437 iso_pu_bacteria 2874620515 2874624914 191
438 iso_pu_bacteria 2874628541 2874631042 191
439 iso_pu_bacteria 2874645413 2874648331 191
440 iso_pu_bacteria 2876761206 2876765944 191
441 iso_pu_bacteria 2876761206 2876766493 191
442 iso_pu_bacteria 2876771140 2876774717 191
443 iso_pu_bacteria 2876818435 2876821508 191
444 iso_pu_bacteria 2879074833 2879079285 191
445 iso_pu_bacteria 2879083081 2879091480 191
446 iso_pu_bacteria 2879099564 2879102674 191
447 iso_pu_bacteria 2879127579 2879131288 191
448 iso_pu_bacteria 2879142872 2879144639 191
449 iso_pu_bacteria 2881364244 2881371191 191
450 iso_pu_bacteria 2881665667 2881668066 191
451 iso_pu_bacteria 2885366525 2885374112 191
452 iso_pu_bacteria 2885409591 2885415186 191
453 iso_pu_bacteria 2888378607 2888386438 191
454 iso_pu_bacteria 2888388044 2888391878 191
455 iso_pu_bacteria 2888419890 2888426553 191
456 iso_pu_bacteria 2903727486 2903728466 191
457 iso_pu_bacteria 2904666416 2904669111 191
458 iso_pu_bacteria 2904711408 2904715576 191
459 iso_pu_bacteria 2906602504 2906605315 191
460 iso_pu_bacteria 2906626472 2906634566 191
461 iso_pu_bacteria 2906643746 2906645426 191
462 iso_pu_bacteria 2908775508 2908782660 191
463 iso_pu_bacteria 2922368715 2922370628 191
464 iso_pu_bacteria 2922393267 2922396769 191
465 iso_pu_bacteria 2929615660 2929620196 191
466 iso_pu_bacteria 2929624759 2929629509 191
467 iso_pu_bacteria 2932784394 2932791554 191
468 iso_pu_bacteria 2932794094 2932799330 191
469 iso_pu_bacteria 2932801729 2932802270 191
470 iso_pu_bacteria 2932809354 2932816816 191
471 iso_pu_bacteria 2932818245 2932824007 191
472 iso_pu_bacteria 2932828146 2932835457 191
473 iso_pu_bacteria 2933577622 2933582113 191
474 iso_pu_bacteria 2935608549 2935613546 191
475 iso_pu_bacteria 2935616580 2935621199 191
476 iso_pu_bacteria 2935638405 2935643481 191
477 iso_pu_bacteria 2935648319 2935650536 191
478 iso_pu_bacteria 2935656913 2935662978 191
479 iso_pu_bacteria 2935665750 2935671196 191
480 iso_pu_bacteria 2935675223 2935681201 191
481 iso_pu_bacteria 2935684952 2935689460 191
482 iso_pu_bacteria 2935694250 2935700033 191
483 iso_pu_bacteria 2935703347 2935710757 191
484 iso_pu_bacteria 2935713505 2935720711 191
485 iso_pu_bacteria 2935722832 2935727978 191
486 iso_pu_bacteria 2935732158 2935737426 191
487 iso_pu_bacteria 2935741537 2935746513 191
488 iso_pu_bacteria 2935750917 2935757480 191
489 iso_pu_bacteria 2935760218 2935763857 191
490 iso_pu_bacteria 2935769743 2935776600 191
491 iso_pu_bacteria 2935777560 2935781414 191
492 iso_pu_bacteria 2935785616 2935792510 191
493 iso_pu_bacteria 2935793552 2935797979 191
494 iso_pu_bacteria 2935801545 2935807835 191
495 iso_pu_bacteria 2935810662 2935818260 191
496 iso_pu_bacteria 2935819856 2935824601 191
497 iso_pu_bacteria 2935827899 2935832998 191
498 iso_pu_bacteria 2935837841 2935844330 191
499 iso_pu_bacteria 2935847175 2935851821 191
500 iso_pu_bacteria 2935855204 2935859608 191
501 iso_pu_bacteria 2935864058 2935871327 191
502 iso_pu_bacteria 2935873716 2935879070 191
503 iso_pu_bacteria 2935883170 2935889489 191
504 iso_pu_bacteria 2935908558 2935911173 191
505 iso_pu_bacteria 2935916978 2935920705 191
506 iso_pu_bacteria 2935926038 2935928202 191
507 iso_pu_bacteria 2935934488 2935937847 191
508 iso_pu_bacteria 2935942939 2935945129 191
509 iso_pu_bacteria 2935951376 2935954366 191
510 iso_pu_bacteria 2935959822 2935965569 191
511 iso_pu_bacteria 2935967501 2935971367 191
512 iso_pu_bacteria 2935975950 2935981973 191
513 iso_pu_bacteria 2935984226 2935990791 191
514 iso_pu_bacteria 2935992306 2935996713 191
515 iso_pu_bacteria 2936002035 2936008589 191
516 iso_pu_bacteria 2936011229 2936017108 191
517 iso_pu_bacteria 2936019824 2936026757 191
518 iso_pu_bacteria 2936028420 2936035500 191
519 iso_pu_bacteria 2936037263 2936044922 191
520 iso_pu_bacteria 2936046547 2936053649 191
521 iso_pu_bacteria 2936055302 2936062724 191
522 iso_pu_bacteria 2940556831 2940563696 191
523 iso_pu_bacteria 2941531003 2941537059 191
524 iso_pu_bacteria 2941538514 2941542662 191
525 iso_pu_bacteria 3005483717 3005490141 191
526 iso_pu_bacteria 3005587118 3005591406 191
527 iso_pu_bacteria 3005594810 3005601370 191
528 iso_pu_bacteria 3005710791 3005716812 191
529 iso_pu_bacteria 3005718088 3005724063 191
530 iso_pu_bacteria 8006926726 8006931707 191
531 iso_pu_bacteria 8016511872 8016519559 191
532 iso_pu_bacteria 8016603502 8016607905 191
533 iso_pu_bacteria 8016613128 8016619688 191
534 iso_pu_bacteria 8016630954 8016637272 191
535 iso_pu_bacteria 8017057580 8017065966 191
536 iso_pu_bacteria 8019538911 8019541938 191
537 iso_pu_bacteria 8019576017 8019578684 191
538 iso_pu_bacteria 8019586578 8019596721 191
539 iso_pu_bacteria 8019597564 8019604968 191
540 iso_pu_bacteria 8019619141 8019624222 191
541 iso_pu_bacteria 8019629233 8019637799 191
542 iso_pu_bacteria 8019638758 8019641825 191
543 iso_pu_bacteria 8019648815 8019653753 191
544 iso_pu_bacteria 8019668869 8019675254 191
545 iso_pu_bacteria 8019678201 8019680854 191
546 iso_pu_bacteria 8055742211 8055750051 191
547 iso_pu_bacteria 8056967851 8056975826 191
548 3300003215 JGI25153J46596_10001416 JGI25153J46596_1000141614 192
549 3300005328 Ga0070676_10033104 Ga0070676_100331041 192
550 3300005329 Ga0070683_100969944 Ga0070683_1009699441 192
551 3300005330 Ga0070690_100321732 Ga0070690_1003217322 192
552 3300005336 Ga0070680_100036538 Ga0070680_1000365384 192
553 3300005337 Ga0070682_100402362 Ga0070682_1004023621 192
554 3300005338 Ga0068868_100396172 Ga0068868_1003961722 192
555 3300005347 Ga0070668_100224497 Ga0070668_1002244972 192
556 3300005355 Ga0070671_100105113 Ga0070671_1001051132 192
557 3300005356 Ga0070674_100060347 Ga0070674_1000603473 192
558 3300005364 Ga0070673_100456064 Ga0070673_1004560641 192
559 3300005366 Ga0070659_100309946 Ga0070659_1003099462 192
560 3300005367 Ga0070667_100062534 Ga0070667_1000625342 192
561 3300005367 Ga0070667_100150984 Ga0070667_1001509842 192
562 3300005434 Ga0070709_10000542 Ga0070709_1000054222 192
563 3300005436 Ga0070713_100105722 Ga0070713_1001057222 192
564 3300005437 Ga0070710_10078972 Ga0070710_100789723 192
565 3300005438 Ga0070701_10055938 Ga0070701_100559382 192
566 3300005438 Ga0070701_10265742 Ga0070701_102657422 192
567 3300005439 Ga0070711_100001693 Ga0070711_10000169312 192
568 3300005441 Ga0070700_100039031 Ga0070700_1000390314 192
569 3300005445 Ga0070708_100126243 Ga0070708_1001262432 192
570 3300005455 Ga0070663_100015528 Ga0070663_1000155287 192
571 3300005455 Ga0070663_100018140 Ga0070663_1000181404 192
572 3300005456 Ga0070678_100043585 Ga0070678_1000435851 192
573 3300005456 Ga0070678_100394586 Ga0070678_1003945862 192
574 3300005458 Ga0070681_10467567 Ga0070681_104675671 192
575 3300005459 Ga0068867_100207547 Ga0068867_1002075473 192
576 3300005547 Ga0070693_100116072 Ga0070693_1001160723 192
577 3300005548 Ga0070665_100002394 Ga0070665_10000239413 192
578 3300005548 Ga0070665_100005213 Ga0070665_10000521311 192
579 3300005564 Ga0070664_100262610 Ga0070664_1002626102 192
580 3300005578 Ga0068854_100192544 Ga0068854_1001925442 192
581 3300005617 Ga0068859_100929525 Ga0068859_1009295251 192
582 3300005719 Ga0068861_100924709 Ga0068861_1009247091 192
583 3300005841 Ga0068863_100133441 Ga0068863_1001334413 192
584 3300005842 Ga0068858_100116128 Ga0068858_1001161283 192
585 3300005843 Ga0068860_100292318 Ga0068860_1002923182 192
586 3300005844 Ga0068862_100052503 Ga0068862_1000525035 192
587 3300005983 Ga0081540_1014734 Ga0081540_10147343 192
588 3300005983 Ga0081540_1016073 Ga0081540_10160734 192
589 3300006028 Ga0070717_10198897 Ga0070717_101988972 192
590 3300006038 Ga0075365_10118488 Ga0075365_101184883 192
591 3300006038 Ga0075365_10306764 Ga0075365_103067642 192
592 3300006038 Ga0075365_10453708 Ga0075365_104537081 192
593 3300006042 Ga0075368_10018742 Ga0075368_100187422 192
594 3300006042 Ga0075368_10023629 Ga0075368_100236294 192
595 3300006048 Ga0075363_100044787 Ga0075363_1000447873 192
596 3300006048 Ga0075363_100062994 Ga0075363_1000629942 192
597 3300006048 Ga0075363_100110319 Ga0075363_1001103191 192
598 3300006051 Ga0075364_10082233 Ga0075364_100822333 192
599 3300006163 Ga0070715_10013984 Ga0070715_100139843 192
600 3300006173 Ga0070716_100014423 Ga0070716_1000144232 192
601 3300006175 Ga0070712_100015526 Ga0070712_1000155264 192
602 3300006177 Ga0075362_10110646 Ga0075362_101106461 192
603 3300006178 Ga0075367_10071753 Ga0075367_100717532 192
604 3300006178 Ga0075367_10104051 Ga0075367_101040513 192
605 3300006195 Ga0075366_10105246 Ga0075366_101052463 192
606 3300006353 Ga0075370_10192316 Ga0075370_101923161 192
607 3300006871 Ga0075434_100355554 Ga0075434_1003555543 192
608 3300006871 Ga0075434_100756021 Ga0075434_1007560212 192
609 3300006881 Ga0068865_100273986 Ga0068865_1002739862 192
610 3300006881 Ga0068865_100322726 Ga0068865_1003227262 192
611 3300006931 Ga0097620_100929468 Ga0097620_1009294681 192
612 3300007265 Ga0099794_10031783 Ga0099794_100317832 192
613 3300009092 Ga0105250_10178299 Ga0105250_101782992 192
614 3300009094 Ga0111539_10095255 Ga0111539_100952552 192
615 3300009098 Ga0105245_10470478 Ga0105245_104704782 192
616 3300009101 Ga0105247_10208434 Ga0105247_102084342 192
617 3300009101 Ga0105247_10215633 Ga0105247_102156332 192
618 3300009101 Ga0105247_10631891 Ga0105247_106318911 192
619 3300009148 Ga0105243_10215241 Ga0105243_102152412 192
620 3300009176 Ga0105242_10034037 Ga0105242_100340373 192
621 3300009177 Ga0105248_10113899 Ga0105248_101138992 192
622 3300009177 Ga0105248_10775741 Ga0105248_107757412 192
623 3300009177 Ga0105248_11434161 Ga0105248_114341611 192
624 3300013297 Ga0157378_10822711 Ga0157378_108227111 192
625 3300013306 Ga0163162_10120701 Ga0163162_101207013 192
626 3300013307 Ga0157372_10767652 Ga0157372_107676521 192
627 3300013308 Ga0157375_10787518 Ga0157375_107875182 192
628 3300014968 Ga0157379_10162321 Ga0157379_101623214 192
629 3300014969 Ga0157376_10719565 Ga0157376_107195652 192
630 3300015261 Ga0182006_1086770 Ga0182006_10867702 192
631 3300017792 Ga0163161_10006317 Ga0163161_100063177 192
632 3300025297 Ga0209758_1009647 Ga0209758_10096473 192
633 3300025297 Ga0209758_1015925 Ga0209758_10159253 192
634 3300025898 Ga0207692_10333384 Ga0207692_103333841 192
635 3300025900 Ga0207710_10323821 Ga0207710_103238212 192
636 3300025901 Ga0207688_10125717 Ga0207688_101257173 192
637 3300025903 Ga0207680_10419666 Ga0207680_104196662 192
638 3300025907 Ga0207645_10038963 Ga0207645_100389635 192
639 3300025912 Ga0207707_10545566 Ga0207707_105455661 192
640 3300025914 Ga0207671_10108395 Ga0207671_101083952 192
641 3300025915 Ga0207693_10071194 Ga0207693_100711943 192
642 3300025916 Ga0207663_10006117 Ga0207663_100061176 192
643 3300025919 Ga0207657_10051937 Ga0207657_100519373 192
644 3300025923 Ga0207681_10218325 Ga0207681_102183252 192
645 3300025929 Ga0207664_10102951 Ga0207664_101029512 192
646 3300025931 Ga0207644_10314340 Ga0207644_103143402 192
647 3300025934 Ga0207686_10124259 Ga0207686_101242592 192
648 3300025936 Ga0207670_10441195 Ga0207670_104411951 192
649 3300025938 Ga0207704_10113298 Ga0207704_101132981 192
650 3300025939 Ga0207665_10023387 Ga0207665_100233873 192
651 3300025940 Ga0207691_10053838 Ga0207691_100538384 192
652 3300025941 Ga0207711_10294765 Ga0207711_102947652 192
653 3300025942 Ga0207689_10356783 Ga0207689_103567831 192
654 3300025949 Ga0207667_10586780 Ga0207667_105867802 192
655 3300025960 Ga0207651_10177073 Ga0207651_101770732 192
656 3300025961 Ga0207712_10236413 Ga0207712_102364132 192
657 3300025972 Ga0207668_10491175 Ga0207668_104911752 192
658 3300025986 Ga0207658_10050424 Ga0207658_100504242 192
659 3300025986 Ga0207658_10505270 Ga0207658_105052702 192
660 3300026023 Ga0207677_10753186 Ga0207677_107531861 192
661 3300026035 Ga0207703_10066622 Ga0207703_100666223 192
662 3300026035 Ga0207703_10252147 Ga0207703_102521472 192
663 3300026067 Ga0207678_10023600 Ga0207678_100236002 192
664 3300026075 Ga0207708_10085232 Ga0207708_100852322 192
665 3300026089 Ga0207648_10055076 Ga0207648_100550761 192
666 3300026089 Ga0207648_10212002 Ga0207648_102120022 192
667 3300026089 Ga0207648_10383102 Ga0207648_103831021 192
668 3300026095 Ga0207676_11354940 Ga0207676_113549401 192
669 3300026116 Ga0207674_10193637 Ga0207674_101936373 192
670 3300026118 Ga0207675_100027594 Ga0207675_1000275944 192
671 3300026121 Ga0207683_10018090 Ga0207683_100180902 192
672 3300028379 Ga0268266_10001169 Ga0268266_100011699 192
673 3300028379 Ga0268266_10002165 Ga0268266_1000216525 192
674 3300028380 Ga0268265_11009214 Ga0268265_110092141 192
675 3300028381 Ga0268264_10000458 Ga0268264_1000045823 192
676 3300028381 Ga0268264_11026485 Ga0268264_110264851 192
677 3300031235 Ga0265330_10024732 Ga0265330_100247323 192
678 3300031238 Ga0265332_10013847 Ga0265332_100138472 192
679 3300031241 Ga0265325_10009040 Ga0265325_100090406 192
680 3300031249 Ga0265339_10049967 Ga0265339_100499673 192
681 3300031250 Ga0265331_10032855 Ga0265331_100328553 192
682 3300031344 Ga0265316_10456226 Ga0265316_104562261 192
683 3300031507 Ga0307509_10110235 Ga0307509_101102351 192
684 3300031616 Ga0307508_10000541 Ga0307508_1000054131 192
685 3300031712 Ga0265342_10070889 Ga0265342_100708893 192
686 3300031730 Ga0307516_10040357 Ga0307516_100403573 192
687 3300031995 Ga0307409_100338494 Ga0307409_1003384941 192
688 3300033442 Ga0315911_1000012 Ga0315911_1000012155 192
689 3300035086 Ga0373934_0045694 Ga0373934_0045694_828_1445 192
690 3300035111 Ga0373923_0006204 Ga0373923_0006204_74_691 192
691 3300035115 Ga0373941_0062628 Ga0373941_0062628_518_1135 192
692 3300035117 Ga0373953_0079623 Ga0373953_0079623_346_963 192
693 3300035118 Ga0373954_0005528 Ga0373954_0005528_1161_1778 192
694 3300035119 Ga0373956_0001286 Ga0373956_0001286_3114_3731 192
695 3300035410 Ga0373924_0151675 Ga0373924_0151675_46_663 192
696 3300035724 Ga0373933_0069436 Ga0373933_0069436_446_1063 192
697 3300035725 Ga0373947_0008493 Ga0373947_0008493_3570_4187 192
698 3300036401 Ga0373937_0296980 Ga0373937_0296980_225_842 192
699 3300037068 Ga0373925_0625057 Ga0373925_0625057_248_865 192
700 3300041413 Ga0439465_0072418 Ga0439465_0072418_407_1024 192
701 3300041413 Ga0439465_0122487 Ga0439465_0122487_154_771 192
702 3300042157 Ga0439458_0052730 Ga0439458_0052730_371_988 192
703 3300042438 Ga0439459_0087167 Ga0439459_0087167_47_664 192
704 3300044658 Ga0466972_0000115 Ga0466972_0000115_32869_33489 192
705 3300046459 Ga0495629_0028607 Ga0495629_0028607_257_874 192
706 3300046462 Ga0495651_0252196 Ga0495651_0252196_508_1125 192
707 3300046500 Ga0495596_0098022 Ga0495596_0098022_395_1012 192
708 3300046514 Ga0495618_0100421 Ga0495618_0100421_1168_1785 192
709 3300046515 Ga0495620_0108146 Ga0495620_0108146_45_665 192
710 3300046516 Ga0495628_0204353 Ga0495628_0204353_750_1367 192
711 3300046519 Ga0495632_0175322 Ga0495632_0175322_352_969 192
712 3300046558 Ga0495633_0204791 Ga0495633_0204791_90_707 192
713 3300046559 Ga0495667_0118424 Ga0495667_0118424_743_1360 192
714 3300046615 Ga0495656_0026298 Ga0495656_0026298_269_886 192
715 3300046616 Ga0495668_0232388 Ga0495668_0232388_266_883 192
716 3300046663 Ga0495635_0003655 Ga0495635_0003655_619_1236 192
717 3300046678 Ga0495599_0004038 Ga0495599_0004038_2814_3431 192
718 3300046679 Ga0495623_0032867 Ga0495623_0032867_506_1123 192
719 3300046689 Ga0495613_0713501 Ga0495613_0713501_21_638 192
720 3300046809 Ga0495600_0188173 Ga0495600_0188173_660_1277 192
721 3300047317 Ga0495604_0142584 Ga0495604_0142584_990_1607 192
722 3300047320 Ga0495672_0025107 Ga0495672_0025107_2436_3050 192
723 3300047320 Ga0495672_0273113 Ga0495672_0273113_179_796 192
724 3300047444 Ga0495675_0019629 Ga0495675_0019629_2210_2827 192
725 3300047447 Ga0495685_138410 Ga0495685_138410_80_697 192
726 3300047469 Ga0495673_0144152 Ga0495673_0144152_148_765 192
727 3300047471 Ga0495684_0009528 Ga0495684_0009528_4375_4992 192
728 3300047472 Ga0495686_0203178 Ga0495686_0203178_466_1083 192
729 3300047673 Ga0495593_0009950 Ga0495593_0009950_137_754 192
730 3300048088 Ga0495602_0117596 Ga0495602_0117596_508_1125 192
731 3300048903 Ga0496100_0640240 Ga0496100_0640240_109_726 192
732 3300048905 Ga0496102_0798025 Ga0496102_0798025_217_834 192
733 3300048907 Ga0496104_0080689 Ga0496104_0080689_962_1579 192
734 3300048912 Ga0496109_0251566 Ga0496109_0251566_18_635 192
735 3300048913 Ga0496110_0677798 Ga0496110_0677798_296_913 192
736 3300048917 Ga0496114_0361114 Ga0496114_0361114_536_1153 192
737 3300048918 Ga0496115_0140467 Ga0496115_0140467_996_1613 192
738 3300048918 Ga0496115_0409522 Ga0496115_0409522_195_812 192
739 3300048924 Ga0496121_0143072 Ga0496121_0143072_98_715 192
740 3300048929 Ga0496126_0029959 Ga0496126_0029959_252_869 192
741 3300048929 Ga0496126_0085263 Ga0496126_0085263_2029_2646 192
742 3300048929 Ga0496126_0265198 Ga0496126_0265198_22_639 192
743 3300048929 Ga0496126_0786820 Ga0496126_0786820_49_666 192
744 3300049574 Ga0501038_0706806 Ga0501038_0706806_24_641 192
745 3300049587 Ga0501071_0137284 Ga0501071_0137284_640_1257 192
746 3300050490 nmdc:mga03n38_16872_c1 nmdc:mga03n38_16872_c1_1586_2203 192
747 3300050491 nmdc:mga00v17_54226_c1 nmdc:mga00v17_54226_c1_1466_2083 192
748 3300050492 nmdc:mga0yw44_214191_c1 nmdc:mga0yw44_214191_c1_258_869 192
749 3300050492 nmdc:mga0yw44_92377_c1 nmdc:mga0yw44_92377_c1_914_1531 192
750 3300050494 nmdc:mga06z11_12821_c1 nmdc:mga06z11_12821_c1_2888_3505 192
751 3300053080 Ga0500635_0002719 Ga0500635_0002719_1172_1789 192
752 3300053085 Ga0495619_0020514 Ga0495619_0020514_1384_2001 192
753 3300053096 Ga0500641_0003878 Ga0500641_0003878_510_1127 192
754 3300053102 Ga0500554_011172 Ga0500554_011172_514_1131 192
755 3300053104 Ga0500556_0127841 Ga0500556_0127841_351_962 192
756 3300053150 Ga0500603_000622 Ga0500603_000622_189_806 192
757 3300053151 Ga0500604_0055446 Ga0500604_0055446_289_906 192
758 3300053153 Ga0500616_0035875 Ga0500616_0035875_853_1464 192
759 3300053178 Ga0500637_0036800 Ga0500637_0036800_377_994 192
760 3300054114 Ga0501084_0771424 Ga0501084_0771424_107_724 192
761 3300003215 JGI25153J46596_10004729 JGI25153J46596_100047292 193
762 3300003775 Ga0055524_1033317 Ga0055524_10333172 193
763 3300005262 Ga0065165_1005579 Ga0065165_10055792 193
764 3300005337 Ga0070682_100362227 Ga0070682_1003622272 193
765 3300005468 Ga0070707_100806320 Ga0070707_1008063202 193
766 3300005548 Ga0070665_100051132 Ga0070665_1000511322 193
767 3300005548 Ga0070665_100159586 Ga0070665_1001595863 193
768 3300005548 Ga0070665_100170354 Ga0070665_1001703543 193
769 3300005563 Ga0068855_100295314 Ga0068855_1002953144 193
770 3300005617 Ga0068859_100518645 Ga0068859_1005186451 193
771 3300005618 Ga0068864_100200341 Ga0068864_1002003412 193
772 3300005719 Ga0068861_100737502 Ga0068861_1007375022 193
773 3300005834 Ga0068851_10267047 Ga0068851_102670472 193
774 3300006038 Ga0075365_10135975 Ga0075365_101359753 193
775 3300006042 Ga0075368_10033993 Ga0075368_100339932 193
776 3300006048 Ga0075363_100053429 Ga0075363_1000534292 193
777 3300006051 Ga0075364_10007367 Ga0075364_100073676 193
778 3300006175 Ga0070712_100078491 Ga0070712_1000784912 193
779 3300006186 Ga0075369_10113709 Ga0075369_101137091 193
780 3300006931 Ga0097620_100518604 Ga0097620_1005186041 193
781 3300009545 Ga0105237_10417534 Ga0105237_104175341 193
782 3300013296 Ga0157374_10013680 Ga0157374_100136807 193
783 3300014497 Ga0182008_10214972 Ga0182008_102149722 193
784 3300014745 Ga0157377_10190164 Ga0157377_101901642 193
785 3300014968 Ga0157379_10596906 Ga0157379_105969062 193
786 3300021321 Ga0214542_1000156 Ga0214542_100015686 193
787 3300021324 Ga0214545_1000078 Ga0214545_100007824 193
788 3300021327 Ga0214543_1000136 Ga0214543_100013624 193
789 3300025295 Ga0209564_1053486 Ga0209564_10534861 193
790 3300025297 Ga0209758_1000109 Ga0209758_1000109184 193
791 3300025299 Ga0209256_1003201 Ga0209256_100320110 193
792 3300025303 Ga0209051_1024905 Ga0209051_10249052 193
793 3300025304 Ga0209257_1001604 Ga0209257_100160410 193
794 3300025315 Ga0207697_10080014 Ga0207697_100800142 193
795 3300025901 Ga0207688_10219437 Ga0207688_102194371 193
796 3300025904 Ga0207647_10002766 Ga0207647_100027669 193
797 3300025905 Ga0207685_10348431 Ga0207685_103484312 193
798 3300025914 Ga0207671_10029152 Ga0207671_100291525 193
799 3300025915 Ga0207693_10035497 Ga0207693_100354972 193
800 3300025922 Ga0207646_10656567 Ga0207646_106565672 193
801 3300025931 Ga0207644_10174292 Ga0207644_101742921 193
802 3300026023 Ga0207677_11181619 Ga0207677_111816191 193
803 3300026078 Ga0207702_10143973 Ga0207702_101439732 193
804 3300026095 Ga0207676_10351522 Ga0207676_103515222 193
805 3300028379 Ga0268266_10449696 Ga0268266_104496962 193
806 3300031548 Ga0307408_100826594 Ga0307408_1008265941 193
807 3300031616 Ga0307508_10126665 Ga0307508_101266654 193
808 3300032002 Ga0307416_101432414 Ga0307416_1014324141 193
809 3300036401 Ga0373937_0238302 Ga0373937_0238302_402_1019 193
810 3300036459 Ga0372808_002511 Ga0372808_002511_1350_1967 193
811 3300045976 Ga0466967_0268645 Ga0466967_0268645_538_1158 193
812 3300046462 Ga0495651_0063776 Ga0495651_0063776_493_1110 193
813 3300046522 Ga0495643_0011165 Ga0495643_0011165_51_668 193
814 3300046524 Ga0495648_0087725 Ga0495648_0087725_788_1405 193
815 3300046809 Ga0495600_0464161 Ga0495600_0464161_85_702 193
816 3300048905 Ga0496102_0027568 Ga0496102_0027568_4301_4921 193
817 3300048906 Ga0496103_0152319 Ga0496103_0152319_666_1286 193
818 3300048907 Ga0496104_0219268 Ga0496104_0219268_781_1398 193
819 3300048908 Ga0496105_0050230 Ga0496105_0050230_70_690 193
820 3300048912 Ga0496109_0115275 Ga0496109_0115275_572_1189 193
821 3300048913 Ga0496110_0160405 Ga0496110_0160405_157_774 193
822 3300048914 Ga0496111_0063387 Ga0496111_0063387_40_660 193
823 3300048914 Ga0496111_0405883 Ga0496111_0405883_254_874 193
824 3300048915 Ga0496112_0180646 Ga0496112_0180646_706_1326 193
825 3300048923 Ga0496120_0051799 Ga0496120_0051799_1705_2322 193
826 3300048923 Ga0496120_0088658 Ga0496120_0088658_189_806 193
827 3300048924 Ga0496121_0000125 Ga0496121_0000125_137953_138570 193
828 3300048925 Ga0496122_0277218 Ga0496122_0277218_137_754 193
829 3300048926 Ga0496123_0135646 Ga0496123_0135646_61_678 193
830 3300048927 Ga0496124_0398720 Ga0496124_0398720_293_910 193
831 3300048929 Ga0496126_0032681 Ga0496126_0032681_576_1265 193
832 3300049460 Ga0495682_0143113 Ga0495682_0143113_16_633 193
833 3300050492 nmdc:mga0yw44_64875_c1 nmdc:mga0yw44_64875_c1_1582_2199 193
834 3300050496 nmdc:mga07m45_146321_c1 nmdc:mga07m45_146321_c1_30_647 193
835 3300053119 Ga0500595_002526 Ga0500595_002526_6886_7503 193
836 3300053139 Ga0500568_0021247 Ga0500568_0021247_2139_2756 193
837 3300001989 JGI24739J22299_10037975 JGI24739J22299_100379752 194
838 3300003203 JGI25406J46586_10000956 JGI25406J46586_1000095614 194
839 3300003215 JGI25153J46596_10009931 JGI25153J46596_100099315 194
840 3300003215 JGI25153J46596_10013535 JGI25153J46596_100135354 194
841 3300003659 JGI25404J52841_10003837 JGI25404J52841_100038373 194
842 3300003752 Ga0055539_1012486 Ga0055539_10124862 194
843 3300005262 Ga0065165_1001827 Ga0065165_100182715 194
844 3300005329 Ga0070683_100003663 Ga0070683_1000036631 194
845 3300005329 Ga0070683_100682068 Ga0070683_1006820682 194
846 3300005330 Ga0070690_100543668 Ga0070690_1005436681 194
847 3300005336 Ga0070680_100427128 Ga0070680_1004271281 194
848 3300005337 Ga0070682_100096953 Ga0070682_1000969532 194
849 3300005339 Ga0070660_100366651 Ga0070660_1003666511 194
850 3300005340 Ga0070689_100420274 Ga0070689_1004202742 194
851 3300005355 Ga0070671_100116480 Ga0070671_1001164801 194
852 3300005434 Ga0070709_10062101 Ga0070709_100621012 194
853 3300005435 Ga0070714_100027307 Ga0070714_1000273075 194
854 3300005436 Ga0070713_100080503 Ga0070713_1000805034 194
855 3300005455 Ga0070663_100030326 Ga0070663_1000303264 194
856 3300005455 Ga0070663_100180131 Ga0070663_1001801312 194
857 3300005456 Ga0070678_100651572 Ga0070678_1006515721 194
858 3300005457 Ga0070662_100119590 Ga0070662_1001195901 194
859 3300005458 Ga0070681_10331122 Ga0070681_103311221 194
860 3300005471 Ga0070698_100061232 Ga0070698_1000612324 194
861 3300005530 Ga0070679_100118161 Ga0070679_1001181611 194
862 3300005535 Ga0070684_100002732 Ga0070684_10000273213 194
863 3300005535 Ga0070684_100035349 Ga0070684_1000353492 194
864 3300005539 Ga0068853_100024770 Ga0068853_1000247703 194
865 3300005539 Ga0068853_100100270 Ga0068853_1001002704 194
866 3300005539 Ga0068853_101045875 Ga0068853_1010458751 194
867 3300005548 Ga0070665_100006911 Ga0070665_1000069114 194
868 3300005578 Ga0068854_100194811 Ga0068854_1001948113 194
869 3300005616 Ga0068852_100200070 Ga0068852_1002000703 194
870 3300005842 Ga0068858_100538518 Ga0068858_1005385182 194
871 3300005937 Ga0081455_10006750 Ga0081455_1000675015 194
872 3300005937 Ga0081455_10062291 Ga0081455_100622912 194
873 3300005983 Ga0081540_1003811 Ga0081540_100381113 194
874 3300005983 Ga0081540_1007099 Ga0081540_100709910 194
875 3300005983 Ga0081540_1007462 Ga0081540_10074625 194
876 3300005983 Ga0081540_1013188 Ga0081540_10131883 194
877 3300005983 Ga0081540_1016372 Ga0081540_10163722 194
878 3300005983 Ga0081540_1029699 Ga0081540_10296993 194
879 3300005985 Ga0081539_10001182 Ga0081539_1000118227 194
880 3300005985 Ga0081539_10022473 Ga0081539_100224734 194
881 3300006028 Ga0070717_10019596 Ga0070717_100195965 194
882 3300006038 Ga0075365_10329353 Ga0075365_103293532 194
883 3300006051 Ga0075364_10117045 Ga0075364_101170451 194
884 3300006175 Ga0070712_100738384 Ga0070712_1007383841 194
885 3300006186 Ga0075369_10114072 Ga0075369_101140721 194
886 3300006195 Ga0075366_10029236 Ga0075366_100292362 194
887 3300006353 Ga0075370_10015394 Ga0075370_100153944 194
888 3300006353 Ga0075370_10027830 Ga0075370_100278302 194
889 3300006358 Ga0068871_100266722 Ga0068871_1002667222 194
890 3300006941 Ga0099825_1025526 Ga0099825_10255263 194
891 3300006941 Ga0099825_1027160 Ga0099825_10271603 194
892 3300006942 Ga0099824_1006625 Ga0099824_100662514 194
893 3300006942 Ga0099824_1015178 Ga0099824_10151783 194
894 3300006943 Ga0099822_1003046 Ga0099822_100304623 194
895 3300006944 Ga0099823_1022654 Ga0099823_10226546 194
896 3300009101 Ga0105247_10020411 Ga0105247_100204114 194
897 3300009101 Ga0105247_10418772 Ga0105247_104187722 194
898 3300009147 Ga0114129_10491130 Ga0114129_104911302 194
899 3300009545 Ga0105237_10188668 Ga0105237_101886682 194
900 3300009545 Ga0105237_10265806 Ga0105237_102658063 194
901 3300009551 Ga0105238_10608766 Ga0105238_106087662 194
902 3300009553 Ga0105249_10284382 Ga0105249_102843822 194
903 3300010375 Ga0105239_10088222 Ga0105239_100882221 194
904 3300010375 Ga0105239_10412923 Ga0105239_104129232 194
905 3300011119 Ga0105246_11040625 Ga0105246_110406251 194
906 3300012488 Ga0157343_1010179 Ga0157343_10101791 194
907 3300013104 Ga0157370_10723833 Ga0157370_107238332 194
908 3300013105 Ga0157369_10010164 Ga0157369_100101641 194
909 3300013105 Ga0157369_10248477 Ga0157369_102484774 194
910 3300013296 Ga0157374_10047448 Ga0157374_100474483 194
911 3300013306 Ga0163162_11031758 Ga0163162_110317581 194
912 3300013306 Ga0163162_11374083 Ga0163162_113740832 194
913 3300013308 Ga0157375_10073559 Ga0157375_100735594 194
914 3300014325 Ga0163163_10033065 Ga0163163_100330652 194
915 3300014745 Ga0157377_10135122 Ga0157377_101351221 194
916 3300021320 Ga0214544_1000163 Ga0214544_100016324 194
917 3300021327 Ga0214543_1043876 Ga0214543_10438761 194
918 3300021358 Ga0213873_10037378 Ga0213873_100373782 194
919 3300021361 Ga0213872_10044316 Ga0213872_100443163 194
920 3300021377 Ga0213874_10024497 Ga0213874_100244972 194
921 3300021377 Ga0213874_10067548 Ga0213874_100675481 194
922 3300021377 Ga0213874_10126299 Ga0213874_101262992 194
923 3300025230 Ga0209563_101608 Ga0209563_1016086 194
924 3300025253 Ga0209677_111207 Ga0209677_1112072 194
925 3300025261 Ga0209233_1002828 Ga0209233_10028283 194
926 3300025295 Ga0209564_1000532 Ga0209564_10005324 194
927 3300025297 Ga0209758_1000938 Ga0209758_10009385 194
928 3300025297 Ga0209758_1009535 Ga0209758_10095356 194
929 3300025297 Ga0209758_1009772 Ga0209758_10097728 194
930 3300025302 Ga0207426_1002293 Ga0207426_10022939 194
931 3300025900 Ga0207710_10151631 Ga0207710_101516312 194
932 3300025906 Ga0207699_10034307 Ga0207699_100343074 194
933 3300025909 Ga0207705_10153732 Ga0207705_101537322 194
934 3300025910 Ga0207684_10303315 Ga0207684_103033151 194
935 3300025912 Ga0207707_10006974 Ga0207707_100069743 194
936 3300025913 Ga0207695_10476172 Ga0207695_104761721 194
937 3300025915 Ga0207693_10187764 Ga0207693_101877641 194
938 3300025917 Ga0207660_10374813 Ga0207660_103748131 194
939 3300025919 Ga0207657_10117281 Ga0207657_101172811 194
940 3300025921 Ga0207652_10010388 Ga0207652_100103881 194
941 3300025922 Ga0207646_10854170 Ga0207646_108541701 194
942 3300025924 Ga0207694_10293812 Ga0207694_102938121 194
943 3300025924 Ga0207694_10876994 Ga0207694_108769941 194
944 3300025928 Ga0207700_10039961 Ga0207700_100399613 194
945 3300025928 Ga0207700_10043510 Ga0207700_100435101 194
946 3300025928 Ga0207700_10662511 Ga0207700_106625112 194
947 3300025929 Ga0207664_10024402 Ga0207664_100244024 194
948 3300025929 Ga0207664_11027879 Ga0207664_110278791 194
949 3300025932 Ga0207690_10130306 Ga0207690_101303062 194
950 3300025932 Ga0207690_10173140 Ga0207690_101731401 194
951 3300025933 Ga0207706_10208702 Ga0207706_102087021 194
952 3300025936 Ga0207670_10329772 Ga0207670_103297722 194
953 3300025944 Ga0207661_10003335 Ga0207661_1000333510 194
954 3300025944 Ga0207661_10064261 Ga0207661_100642611 194
955 3300025945 Ga0207679_10379129 Ga0207679_103791291 194
956 3300025949 Ga0207667_10224824 Ga0207667_102248242 194
957 3300025949 Ga0207667_10600425 Ga0207667_106004252 194
958 3300025972 Ga0207668_10026980 Ga0207668_100269804 194
959 3300026035 Ga0207703_10471257 Ga0207703_104712572 194
960 3300026041 Ga0207639_10342341 Ga0207639_103423412 194
961 3300026067 Ga0207678_10032634 Ga0207678_100326347 194
962 3300026067 Ga0207678_10057246 Ga0207678_100572463 194
963 3300026067 Ga0207678_10279546 Ga0207678_102795461 194
964 3300026067 Ga0207678_10675784 Ga0207678_106757841 194
965 3300026067 Ga0207678_10966962 Ga0207678_109669621 194
966 3300026089 Ga0207648_10221584 Ga0207648_102215843 194
967 3300026121 Ga0207683_10975556 Ga0207683_109755561 194
968 3300026142 Ga0207698_10221475 Ga0207698_102214752 194
969 3300027296 Ga0209389_1000019 Ga0209389_100001915 194
970 3300027296 Ga0209389_1000880 Ga0209389_100088019 194
971 3300027357 Ga0209589_1000007 Ga0209589_1000007356 194
972 3300027357 Ga0209589_1000897 Ga0209589_100089719 194
973 3300027361 Ga0209489_100008 Ga0209489_100008356 194
974 3300027361 Ga0209489_100033 Ga0209489_10003315 194
975 3300027361 Ga0209489_100110 Ga0209489_10011087 194
976 3300027363 Ga0209700_100009 Ga0209700_100009356 194
977 3300027363 Ga0209700_100012 Ga0209700_100012352 194
978 3300028379 Ga0268266_10656684 Ga0268266_106566842 194
979 3300028794 Ga0307515_10118872 Ga0307515_101188722 194
980 3300031235 Ga0265330_10027960 Ga0265330_100279605 194
981 3300031247 Ga0265340_10105297 Ga0265340_101052971 194
982 3300031249 Ga0265339_10008955 Ga0265339_100089555 194
983 3300031250 Ga0265331_10140398 Ga0265331_101403982 194
984 3300031616 Ga0307508_10452287 Ga0307508_104522871 194
985 3300031711 Ga0265314_10036736 Ga0265314_100367363 194
986 3300031712 Ga0265342_10022364 Ga0265342_100223642 194
987 3300033180 Ga0307510_10138019 Ga0307510_101380191 194
988 3300035086 Ga0373934_0021442 Ga0373934_0021442_1582_2196 194
989 3300035118 Ga0373954_0026019 Ga0373954_0026019_1076_1690 194
990 3300035119 Ga0373956_0023981 Ga0373956_0023981_479_1093 194
991 3300035172 Ga0373955_0056849 Ga0373955_0056849_315_929 194
992 3300035410 Ga0373924_0065013 Ga0373924_0065013_336_950 194
993 3300035410 Ga0373924_0075561 Ga0373924_0075561_185_802 194
994 3300035692 Ga0373935_0083518 Ga0373935_0083518_1038_1652 194
995 3300035695 Ga0373927_0060534 Ga0373927_0060534_1290_1907 194
996 3300035724 Ga0373933_0000127 Ga0373933_0000127_17143_17760 194
997 3300035724 Ga0373933_0240895 Ga0373933_0240895_130_747 194
998 3300035724 Ga0373933_0265210 Ga0373933_0265210_361_975 194
999 3300036401 Ga0373937_0027265 Ga0373937_0027265_2701_3318 194
1000 3300036401 Ga0373937_0089249 Ga0373937_0089249_373_987 194
1001 3300036401 Ga0373937_0669900 Ga0373937_0669900_193_807 194
1002 3300037418 Ga0395900_0023448 Ga0395900_0023448_3275_3895 194
1003 3300037471 Ga0395905_0081904 Ga0395905_0081904_157_777 194
1004 3300037471 Ga0395905_0831561 Ga0395905_0831561_187_807 194
1005 3300038443 Ga0395901_0102114 Ga0395901_0102114_1479_2099 194
1006 3300039437 Ga0436365_0368752 Ga0436365_0368752_1129_1746 194
1007 3300039437 Ga0436365_0547166 Ga0436365_0547166_645_1259 194
1008 3300039438 Ga0436360_1334781 Ga0436360_1334781_244_861 194
1009 3300039447 Ga0436361_0862252 Ga0436361_0862252_284_901 194
1010 3300039450 Ga0436363_0756020 Ga0436363_0756020_185_805 194
1011 3300039450 Ga0436363_0779713 Ga0436363_0779713_2262_2876 194
1012 3300039450 Ga0436363_1042782 Ga0436363_1042782_2219_2851 194
1013 3300039453 Ga0436362_0134504 Ga0436362_0134504_1229_1846 194
1014 3300041451 Ga0451791_1147245 Ga0451791_1147245_11_631 194
1015 3300041460 Ga0451802_1371745 Ga0451802_1371745_230_850 194
1016 3300044656 Ga0466969_0027941 Ga0466969_0027941_810_1427 194
1017 3300044656 Ga0466969_0215109 Ga0466969_0215109_215_829 194
1018 3300044683 Ga0466965_0099238 Ga0466965_0099238_747_1367 194
1019 3300044684 Ga0466966_0000632 Ga0466966_0000632_16300_16917 194
1020 3300044684 Ga0466966_0057282 Ga0466966_0057282_331_945 194
1021 3300044684 Ga0466966_0084103 Ga0466966_0084103_86_703 194
1022 3300044693 Ga0466961_0000897 Ga0466961_0000897_16419_17036 194
1023 3300044694 Ga0466963_0370225 Ga0466963_0370225_130_750 194
1024 3300044842 Ga0466957_0139098 Ga0466957_0139098_125_742 194
1025 3300044901 Ga0466960_0020623 Ga0466960_0020623_282_902 194
1026 3300045049 Ga0466959_0004435 Ga0466959_0004435_1751_2368 194
1027 3300045049 Ga0466959_0035818 Ga0466959_0035818_309_923 194
1028 3300045049 Ga0466959_0298228 Ga0466959_0298228_355_972 194
1029 3300045976 Ga0466967_0135506 Ga0466967_0135506_1012_1632 194
1030 3300046454 Ga0495592_0140292 Ga0495592_0140292_108_728 194
1031 3300046455 Ga0495603_0097065 Ga0495603_0097065_935_1555 194
1032 3300046460 Ga0495638_0023867 Ga0495638_0023867_2837_3457 194
1033 3300046460 Ga0495638_0030772 Ga0495638_0030772_2583_3200 194
1034 3300046460 Ga0495638_0091842 Ga0495638_0091842_962_1579 194
1035 3300046462 Ga0495651_0022721 Ga0495651_0022721_352_972 194
1036 3300046462 Ga0495651_0043109 Ga0495651_0043109_705_1319 194
1037 3300046462 Ga0495651_0090764 Ga0495651_0090764_739_1353 194
1038 3300046463 Ga0495653_0088004 Ga0495653_0088004_1255_1875 194
1039 3300046471 Ga0495650_0110195 Ga0495650_0110195_236_856 194
1040 3300046472 Ga0495580_0627811 Ga0495580_0627811_45_662 194
1041 3300046474 Ga0495605_0109212 Ga0495605_0109212_311_931 194
1042 3300046477 Ga0495664_0043121 Ga0495664_0043121_1809_2423 194
1043 3300046477 Ga0495664_0043518 Ga0495664_0043518_980_1600 194
1044 3300046477 Ga0495664_0091342 Ga0495664_0091342_643_1263 194
1045 3300046511 Ga0495608_0097641 Ga0495608_0097641_403_1023 194
1046 3300046512 Ga0495610_0120719 Ga0495610_0120719_80_697 194
1047 3300046513 Ga0495616_0186379 Ga0495616_0186379_279_896 194
1048 3300046514 Ga0495618_0173006 Ga0495618_0173006_179_793 194
1049 3300046515 Ga0495620_0056120 Ga0495620_0056120_707_1327 194
1050 3300046516 Ga0495628_0018136 Ga0495628_0018136_1918_2532 194
1051 3300046516 Ga0495628_0375163 Ga0495628_0375163_50_670 194
1052 3300046517 Ga0495630_0186812 Ga0495630_0186812_889_1503 194
1053 3300046518 Ga0495631_0173670 Ga0495631_0173670_192_809 194
1054 3300046522 Ga0495643_0244724 Ga0495643_0244724_184_801 194
1055 3300046523 Ga0495644_0163388 Ga0495644_0163388_190_810 194
1056 3300046524 Ga0495648_0008154 Ga0495648_0008154_1676_2293 194
1057 3300046524 Ga0495648_0035226 Ga0495648_0035226_793_1413 194
1058 3300046524 Ga0495648_0101946 Ga0495648_0101946_428_1048 194
1059 3300046524 Ga0495648_0146599 Ga0495648_0146599_367_984 194
1060 3300046524 Ga0495648_0323115 Ga0495648_0323115_23_643 194
1061 3300046526 Ga0495666_0211888 Ga0495666_0211888_72_689 194
1062 3300046529 Ga0495652_0004702 Ga0495652_0004702_9873_10493 194
1063 3300046529 Ga0495652_0126608 Ga0495652_0126608_591_1205 194
1064 3300046530 Ga0495654_0020872 Ga0495654_0020872_842_1459 194
1065 3300046533 Ga0495640_0206161 Ga0495640_0206161_321_935 194
1066 3300046536 Ga0495587_0031425 Ga0495587_0031425_1865_2485 194
1067 3300046536 Ga0495587_0058205 Ga0495587_0058205_78_692 194
1068 3300046543 Ga0495645_0061947 Ga0495645_0061947_58_672 194
1069 3300046543 Ga0495645_0069362 Ga0495645_0069362_156_776 194
1070 3300046543 Ga0495645_0096018 Ga0495645_0096018_1185_1805 194
1071 3300046557 Ga0495622_0025030 Ga0495622_0025030_548_1168 194
1072 3300046557 Ga0495622_0031167 Ga0495622_0031167_125_742 194
1073 3300046559 Ga0495667_0075923 Ga0495667_0075923_1276_1890 194
1074 3300046559 Ga0495667_0141940 Ga0495667_0141940_722_1342 194
1075 3300046616 Ga0495668_0140594 Ga0495668_0140594_521_1141 194
1076 3300046660 Ga0495625_0138384 Ga0495625_0138384_817_1437 194
1077 3300046665 Ga0495661_0142722 Ga0495661_0142722_661_1281 194
1078 3300046665 Ga0495661_0321456 Ga0495661_0321456_36_656 194
1079 3300046674 Ga0495588_0024575 Ga0495588_0024575_1244_1864 194
1080 3300046675 Ga0495657_0010925 Ga0495657_0010925_1950_2570 194
1081 3300046678 Ga0495599_0008515 Ga0495599_0008515_1708_2328 194
1082 3300046678 Ga0495599_0222184 Ga0495599_0222184_503_1123 194
1083 3300046679 Ga0495623_0054800 Ga0495623_0054800_1132_1752 194
1084 3300046679 Ga0495623_0250544 Ga0495623_0250544_285_899 194
1085 3300046680 Ga0495646_0019570 Ga0495646_0019570_1211_1825 194
1086 3300046680 Ga0495646_0064544 Ga0495646_0064544_941_1561 194
1087 3300046683 Ga0495658_0472031 Ga0495658_0472031_158_778 194
1088 3300046689 Ga0495613_0039815 Ga0495613_0039815_2167_2787 194
1089 3300046691 Ga0495670_0008140 Ga0495670_0008140_782_1399 194
1090 3300046694 Ga0495649_0143514 Ga0495649_0143514_148_768 194
1091 3300046794 Ga0495589_0164040 Ga0495589_0164040_429_1046 194
1092 3300046809 Ga0495600_0090783 Ga0495600_0090783_828_1448 194
1093 3300047315 Ga0495581_0270178 Ga0495581_0270178_23_640 194
1094 3300047317 Ga0495604_0076979 Ga0495604_0076979_1608_2228 194
1095 3300047317 Ga0495604_0077995 Ga0495604_0077995_662_1276 194
1096 3300047319 Ga0495674_0045519 Ga0495674_0045519_1884_2498 194
1097 3300047319 Ga0495674_0083343 Ga0495674_0083343_1242_1862 194
1098 3300047319 Ga0495674_0447778 Ga0495674_0447778_68_685 194
1099 3300047322 Ga0495680_0001058 Ga0495680_0001058_22993_23613 194
1100 3300047322 Ga0495680_0075816 Ga0495680_0075816_341_955 194
1101 3300047444 Ga0495675_0045612 Ga0495675_0045612_903_1517 194
1102 3300047471 Ga0495684_0089430 Ga0495684_0089430_108_728 194
1103 3300047471 Ga0495684_0097252 Ga0495684_0097252_160_774 194
1104 3300047471 Ga0495684_0518169 Ga0495684_0518169_28_642 194
1105 3300047472 Ga0495686_0027319 Ga0495686_0027319_975_1592 194
1106 3300047472 Ga0495686_0117128 Ga0495686_0117128_415_1101 194
1107 3300047472 Ga0495686_0252232 Ga0495686_0252232_321_941 194
1108 3300048088 Ga0495602_0033384 Ga0495602_0033384_2652_3272 194
1109 3300048088 Ga0495602_0073454 Ga0495602_0073454_1059_1673 194
1110 3300048091 Ga0495626_0234328 Ga0495626_0234328_17_637 194
1111 3300048903 Ga0496100_0567242 Ga0496100_0567242_95_712 194
1112 3300048904 Ga0496101_0593743 Ga0496101_0593743_173_793 194
1113 3300048905 Ga0496102_0128519 Ga0496102_0128519_12_632 194
1114 3300048905 Ga0496102_0243168 Ga0496102_0243168_856_1470 194
1115 3300048906 Ga0496103_0189649 Ga0496103_0189649_323_943 194
1116 3300048906 Ga0496103_0355448 Ga0496103_0355448_195_809 194
1117 3300048907 Ga0496104_0023058 Ga0496104_0023058_5040_5654 194
1118 3300048907 Ga0496104_0058026 Ga0496104_0058026_1296_1916 194
1119 3300048908 Ga0496105_0003256 Ga0496105_0003256_1058_1678 194
1120 3300048908 Ga0496105_0100928 Ga0496105_0100928_527_1144 194
1121 3300048909 Ga0496106_0021369 Ga0496106_0021369_3021_3635 194
1122 3300048910 Ga0496107_0068714 Ga0496107_0068714_630_1250 194
1123 3300048912 Ga0496109_0230326 Ga0496109_0230326_561_1181 194
1124 3300048912 Ga0496109_0362814 Ga0496109_0362814_450_1064 194
1125 3300048913 Ga0496110_0041874 Ga0496110_0041874_1099_1713 194
1126 3300048915 Ga0496112_0108545 Ga0496112_0108545_2015_2629 194
1127 3300048915 Ga0496112_0173926 Ga0496112_0173926_167_784 194
1128 3300048919 Ga0496116_0002646 Ga0496116_0002646_14725_15408 194
1129 3300048919 Ga0496116_0039136 Ga0496116_0039136_2079_2699 194
1130 3300048919 Ga0496116_0112190 Ga0496116_0112190_32_652 194
1131 3300048920 Ga0496117_0084805 Ga0496117_0084805_838_1455 194
1132 3300048920 Ga0496117_0181706 Ga0496117_0181706_445_1065 194
1133 3300048921 Ga0496118_0044149 Ga0496118_0044149_822_1439 194
1134 3300048922 Ga0496119_0043790 Ga0496119_0043790_1252_1872 194
1135 3300048923 Ga0496120_0096386 Ga0496120_0096386_321_938 194
1136 3300048924 Ga0496121_0008599 Ga0496121_0008599_9061_9678 194
1137 3300048924 Ga0496121_0076460 Ga0496121_0076460_161_781 194
1138 3300048924 Ga0496121_0210360 Ga0496121_0210360_118_738 194
1139 3300048925 Ga0496122_0056702 Ga0496122_0056702_1347_1979 194
1140 3300048925 Ga0496122_0142229 Ga0496122_0142229_494_1111 194
1141 3300048926 Ga0496123_0027721 Ga0496123_0027721_1468_2085 194
1142 3300048926 Ga0496123_0088597 Ga0496123_0088597_938_1555 194
1143 3300048927 Ga0496124_0094473 Ga0496124_0094473_1266_1883 194
1144 3300048927 Ga0496124_0311498 Ga0496124_0311498_147_764 194
1145 3300048928 Ga0496125_0008788 Ga0496125_0008788_595_1212 194
1146 3300048929 Ga0496126_0003769 Ga0496126_0003769_17996_18613 194
1147 3300048929 Ga0496126_0012961 Ga0496126_0012961_3465_4082 194
1148 3300048929 Ga0496126_0027303 Ga0496126_0027303_4344_4961 194
1149 3300048929 Ga0496126_0061654 Ga0496126_0061654_503_1123 194
1150 3300048929 Ga0496126_0078583 Ga0496126_0078583_1170_1790 194
1151 3300048929 Ga0496126_0259269 Ga0496126_0259269_103_720 194
1152 3300048929 Ga0496126_0402242 Ga0496126_0402242_23_637 194
1153 3300049580 Ga0501046_0039535 Ga0501046_0039535_2921_3541 194
1154 3300049589 Ga0501073_0260568 Ga0501073_0260568_341_961 194
1155 3300049742 Ga0501080_0242339 Ga0501080_0242339_379_999 194
1156 3300050491 nmdc:mga00v17_42220_c1 nmdc:mga00v17_42220_c1_2098_2730 194
1157 3300050492 nmdc:mga0yw44_242129_c1 nmdc:mga0yw44_242129_c1_146_766 194
1158 3300050493 nmdc:mga0k408_171755_c1 nmdc:mga0k408_171755_c1_373_993 194
1159 3300050496 nmdc:mga07m45_200702_c1 nmdc:mga07m45_200702_c1_84_704 194
1160 3300050507 nmdc:mga05p37_387592_c1 nmdc:mga05p37_387592_c1_304_921 194
1161 3300050516 nmdc:mga0sz30_188296_c1 nmdc:mga0sz30_188296_c1_116_817 194
1162 3300053077 Ga0495601_0034790 Ga0495601_0034790_1567_2181 194
1163 3300053077 Ga0495601_0049041 Ga0495601_0049041_396_1016 194
1164 3300053077 Ga0495601_0210260 Ga0495601_0210260_250_870 194
1165 3300053078 Ga0495612_0052290 Ga0495612_0052290_298_912 194
1166 3300053078 Ga0495612_0073744 Ga0495612_0073744_34_654 194
1167 3300053084 Ga0495595_0025394 Ga0495595_0025394_1713_2327 194
1168 3300053085 Ga0495619_0023185 Ga0495619_0023185_1815_2429 194
1169 3300053085 Ga0495619_0509436 Ga0495619_0509436_196_816 194
1170 3300053086 Ga0500578_0035459 Ga0500578_0035459_1293_1913 194
1171 3300053086 Ga0500578_0056796 Ga0500578_0056796_1305_1925 194
1172 3300053087 Ga0500643_000013 Ga0500643_000013_138615_139235 194
1173 3300053087 Ga0500643_025224 Ga0500643_025224_635_1255 194
1174 3300053093 Ga0500651_0164309 Ga0500651_0164309_283_900 194
1175 3300053094 Ga0500566_0000329 Ga0500566_0000329_5001_5618 194
1176 3300053096 Ga0500641_0021761 Ga0500641_0021761_286_906 194
1177 3300053098 Ga0500650_0000589 Ga0500650_0000589_6469_7086 194
1178 3300053104 Ga0500556_0000238 Ga0500556_0000238_37185_37802 194
1179 3300053108 Ga0500562_010221 Ga0500562_010221_184_804 194
1180 3300053111 Ga0500572_031194 Ga0500572_031194_833_1453 194
1181 3300053116 Ga0500592_000637 Ga0500592_000637_2598_3215 194
1182 3300053118 Ga0500594_0027947 Ga0500594_0027947_242_859 194
1183 3300053121 Ga0500607_027031 Ga0500607_027031_1074_1694 194
1184 3300053122 Ga0500608_095611 Ga0500608_095611_569_1186 194
1185 3300053130 Ga0500642_0000108 Ga0500642_0000108_17839_18456 194
1186 3300053130 Ga0500642_0049086 Ga0500642_0049086_991_1611 194
1187 3300053131 Ga0500652_002951 Ga0500652_002951_782_1399 194
1188 3300053134 Ga0500658_0042410 Ga0500658_0042410_204_821 194
1189 3300053134 Ga0500658_0057738 Ga0500658_0057738_561_1181 194
1190 3300053136 Ga0500559_0000839 Ga0500559_0000839_16779_17396 194
1191 3300053136 Ga0500559_0006971 Ga0500559_0006971_396_1016 194
1192 3300053138 Ga0500564_024677 Ga0500564_024677_56_676 194
1193 3300053139 Ga0500568_0011393 Ga0500568_0011393_542_1162 194
1194 3300053139 Ga0500568_0018904 Ga0500568_0018904_758_1411 194
1195 3300053145 Ga0500586_001118 Ga0500586_001118_4192_4809 194
1196 3300053146 Ga0500588_0076625 Ga0500588_0076625_41_661 194
1197 3300053148 Ga0500590_059453 Ga0500590_059453_480_1097 194
1198 3300053151 Ga0500604_0004045 Ga0500604_0004045_2578_3195 194
1199 3300053151 Ga0500604_0054951 Ga0500604_0054951_249_869 194
1200 3300053153 Ga0500616_0000197 Ga0500616_0000197_16625_17242 194
1201 3300053154 Ga0500619_020679 Ga0500619_020679_235_855 194
1202 3300053156 Ga0500622_0002972 Ga0500622_0002972_8603_9220 194
1203 3300053156 Ga0500622_0060366 Ga0500622_0060366_1275_1895 194
1204 3300053158 Ga0500627_0049036 Ga0500627_0049036_730_1350 194
1205 3300053177 Ga0500636_0000390 Ga0500636_0000390_20169_20789 194
1206 3300053177 Ga0500636_0002715 Ga0500636_0002715_137_754 194
1207 3300053724 Ga0500570_119848 Ga0500570_119848_113_730 194
1208 3300053730 Ga0500645_035466 Ga0500645_035466_121_738 194
1209 3300053736 Ga0500599_003770 Ga0500599_003770_788_1408 194
1210 3300055283 Ga0500661_046636 Ga0500661_046636_41_661 194
1211 iso_pu_bacteria 2602042107 2603857549 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

42

231

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.4116 18 192
8evu-assembly1.cif.gz_E cryo em structure of vibrio cholerae nqr 0.4013 3 191
6rw3-assembly2.cif.gz_B the molecular basis for sugar import in malaria parasites. 0.4009 1 187
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.3997 1 193
8f6h-assembly1.cif.gz_B cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex 0.3992 9 188
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6871 4 193 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6751 4 193 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6284 10 189 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5929 10 189 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5123 5 189 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1Y1R4X4-F1-model_v4 Lysine transporter LysE 0.9369 1 193 GO:0005886
GO:0015171
AF-A0A1Y1R4X4-F1-model_v4 Lysine transporter LysE 0.9323 1 193 GO:0005886
GO:0015171
AF-A0A4V3DBE2-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.9267 2 193 GO:0005886
GO:0015171
AF-A0A2A4CU03-F1-model_v4 Lysine transporter LysE 0.9239 3 193 GO:0005886
GO:0015171
AF-A0A2D8YMG6-F1-model_v4 deleted 0.9224 2 193

Feature Viewer

pLDDT pTM Quality
80.57 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map