F491728
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1211 | 695 | 980 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10117045|Ga0075364_101170451 |
| Length | 233 |
| Sequence | LHVNAPLFAGLCGLGSAAIEHAKRKETPMSLQVYLAFVAACVALALLPGPNVTLVIANGLRYGTRAAMISIAGTQAGLAVVIGIVALGLATLMATMGYWFDWVRFAGAAYLVWLGIKMVRAPVEGIDADTPPAPPRGGFFLQGMMVLLSNPKVLVFFGAFIPQFVDMEKNHILQVGILGATFMVTAALTDMVYAVAAGRARQFFSARRTRLLSRISGGFMIGGGVWLALTRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 29 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 66 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 72 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 73 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 74 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 75 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 76 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 77 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 78 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 79 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 80 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 81 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 82 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 83 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 84 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 85 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 86 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 87 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 88 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 89 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 90 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 91 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 92 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 93 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 94 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 95 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 96 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 97 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 98 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 99 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 100 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 101 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 102 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 103 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 104 | 2904699407 | |||
| 105 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 106 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 107 | 2906610324 | |||
| 108 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 109 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 110 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 111 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 112 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 113 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 114 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 115 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 116 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 117 | 2922368715 | |||
| 118 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 119 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 120 | 2922425934 | |||
| 121 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 122 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 123 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 124 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 125 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 126 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 127 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 128 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 129 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 130 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 131 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 132 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 133 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 134 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 135 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 136 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 137 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 138 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 139 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 140 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 141 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 142 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 143 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 144 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 145 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 146 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 147 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 148 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 149 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 150 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 151 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 152 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 153 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 154 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 155 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 156 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 157 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 158 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 159 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 160 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 161 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 162 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 163 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 164 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 165 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 166 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 167 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 168 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 169 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 170 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 171 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 172 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 173 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 174 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 175 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 176 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 177 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 178 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 179 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 180 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 181 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 182 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 183 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 184 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 185 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 186 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 187 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 188 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 189 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 190 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 191 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 192 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 193 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 194 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 195 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 196 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 197 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 198 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 204 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 205 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 207 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 208 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 209 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 211 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 220 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 222 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 231 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 232 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 234 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 235 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 236 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 237 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 239 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 242 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 244 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 245 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 246 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 247 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 248 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 249 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 250 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 251 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 252 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 253 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 254 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 255 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 256 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 257 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 258 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 260 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 261 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 262 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 263 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 264 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 265 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 266 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 267 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 268 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 269 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 270 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 272 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 273 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 274 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 275 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 276 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 277 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 278 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 280 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 281 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 282 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 283 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 284 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 285 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 286 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 299 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 301 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 302 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 312 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 313 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 314 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 315 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 316 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 317 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 318 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 319 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 320 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 321 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 322 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 323 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 324 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 325 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 328 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 329 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 330 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 331 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 332 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 333 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 334 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 395 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 396 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 397 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 398 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 400 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 404 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 405 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 406 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 407 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 408 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 409 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 410 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 411 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 412 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 413 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 414 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 415 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 416 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 417 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 418 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 419 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 420 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 421 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 422 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 423 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 424 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 425 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 426 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 427 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 428 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 429 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 430 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 431 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 432 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 433 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 434 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 435 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 436 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 437 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 438 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 439 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 440 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 441 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 442 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 443 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 444 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 445 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 446 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 447 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 448 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 449 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 450 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 451 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 452 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 453 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 454 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 455 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 456 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 457 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 458 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 459 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 460 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 461 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 462 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 463 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 464 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 465 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 466 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 467 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 468 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 469 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 470 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 471 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 472 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 473 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 474 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 475 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 476 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 477 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 478 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 479 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 480 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 481 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 482 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 546 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 547 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 548 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 549 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 550 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 551 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 552 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 553 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 554 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 555 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 556 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 557 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 558 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 559 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 560 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 561 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 562 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 563 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 564 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 565 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 566 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 567 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 568 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 569 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 570 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 571 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 572 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 581 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 583 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 585 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 586 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 587 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 588 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 589 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 590 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 591 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 593 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 594 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 595 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 596 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 597 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 598 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 599 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 600 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 601 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 602 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 603 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 604 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 605 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 606 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 607 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 610 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 613 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 614 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 615 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 616 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 617 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 618 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 619 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 621 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 622 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 623 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 624 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 625 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 626 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 627 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 628 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 629 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 630 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 631 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 632 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 633 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 634 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 635 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 636 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 637 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 638 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 639 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 640 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 641 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 642 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 643 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 644 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 645 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 646 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 647 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 648 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 649 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 650 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 651 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 652 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 653 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 654 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 655 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 656 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 657 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 658 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 659 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 660 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 661 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 662 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 663 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 664 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 665 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 666 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 667 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 668 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 669 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 670 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 671 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 672 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 673 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 674 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 675 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 676 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 677 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 678 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 679 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 680 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 681 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 682 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 683 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 684 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 685 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 686 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 687 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 688 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 689 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 690 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 691 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 692 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 693 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 694 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 695 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.18 |
| Metatranscriptomes | 0.08 |
| Isolates | 18.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.07 |
| Nodule | 15.19 |
| Rhizoplane | 4.38 |
| Rhizosphere | 57.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10037975 | 3300001989 | Bacteria | 1620 |
| 2 | JGI25151J46595_10000212 | 3300003187 | Bacteria | 70741 |
| 3 | JGI25406J46586_10000956 | 3300003203 | Bacteria | 13581 |
| 4 | JGI25153J46596_10001416 | 3300003215 | Bacteria | 14364 |
| 5 | JGI25153J46596_10004729 | 3300003215 | Bacteria | 7255 |
| 6 | JGI25153J46596_10009931 | 3300003215 | Bacteria | 4358 |
| 7 | JGI25153J46596_10013535 | 3300003215 | Bacteria | 3440 |
| 8 | JGI25153J46596_10044984 | 3300003215 | Bacteria | 1322 |
| 9 | JGI25160J50197_1004779 | 3300003354 | Bacteria | 5784 |
| 10 | JGI25404J52841_10003837 | 3300003659 | Bacteria | 3006 |
| 11 | Ga0055539_1012486 | 3300003752 | Bacteria | 1043 |
| 12 | Ga0055524_1033317 | 3300003775 | Bacteria | 1444 |
| 13 | Ga0065165_1001827 | 3300005262 | Bacteria | 20819 |
| 14 | Ga0065165_1005579 | 3300005262 | Bacteria | 6986 |
| 15 | Ga0070676_10033104 | 3300005328 | Bacteria | 2964 |
| 16 | Ga0070683_100003663 | 3300005329 | Bacteria | 12524 |
| 17 | Ga0070683_100682068 | 3300005329 | Bacteria | 984 |
| 18 | Ga0070683_100743556 | 3300005329 | Bacteria | 940 |
| 19 | Ga0070683_100969944 | 3300005329 | Bacteria | 816 |
| 20 | Ga0070690_100321732 | 3300005330 | Bacteria | 1115 |
| 21 | Ga0070690_100543668 | 3300005330 | Bacteria | 875 |
| 22 | Ga0068869_100072632 | 3300005334 | Bacteria | 2549 |
| 23 | Ga0070666_10168944 | 3300005335 | Bacteria | 1531 |
| 24 | Ga0070680_100036538 | 3300005336 | Bacteria | 3968 |
| 25 | Ga0070680_100427128 | 3300005336 | Bacteria | 1130 |
| 26 | Ga0070682_100096953 | 3300005337 | Bacteria | 1940 |
| 27 | Ga0070682_100287131 | 3300005337 | Bacteria | 1202 |
| 28 | Ga0070682_100362227 | 3300005337 | Bacteria | 1085 |
| 29 | Ga0070682_100402362 | 3300005337 | Bacteria | 1036 |
| 30 | Ga0068868_100017949 | 3300005338 | Bacteria | 5280 |
| 31 | Ga0068868_100135706 | 3300005338 | Bacteria | 2017 |
| 32 | Ga0068868_100396172 | 3300005338 | Bacteria | 1191 |
| 33 | Ga0070660_100366651 | 3300005339 | Bacteria | 1188 |
| 34 | Ga0070689_100420274 | 3300005340 | Bacteria | 1133 |
| 35 | Ga0070668_100224497 | 3300005347 | Bacteria | 1551 |
| 36 | Ga0070668_100252506 | 3300005347 | Bacteria | 1464 |
| 37 | Ga0070669_100230463 | 3300005353 | Bacteria | 1468 |
| 38 | Ga0070675_100822117 | 3300005354 | Bacteria | 850 |
| 39 | Ga0070671_100105113 | 3300005355 | Bacteria | 2370 |
| 40 | Ga0070671_100116480 | 3300005355 | Bacteria | 2246 |
| 41 | Ga0070674_100060347 | 3300005356 | Bacteria | 2643 |
| 42 | Ga0070674_100166175 | 3300005356 | Bacteria | 1678 |
| 43 | Ga0070673_100039832 | 3300005364 | Bacteria | 3600 |
| 44 | Ga0070673_100210296 | 3300005364 | Bacteria | 1680 |
| 45 | Ga0070673_100456064 | 3300005364 | Bacteria | 1151 |
| 46 | Ga0070659_100309946 | 3300005366 | Bacteria | 1318 |
| 47 | Ga0070667_100062534 | 3300005367 | Bacteria | 3154 |
| 48 | Ga0070667_100150984 | 3300005367 | Bacteria | 2041 |
| 49 | Ga0070709_10000542 | 3300005434 | Bacteria | 22119 |
| 50 | Ga0070709_10001810 | 3300005434 | Bacteria | 11590 |
| 51 | Ga0070709_10014082 | 3300005434 | Bacteria | 4515 |
| 52 | Ga0070709_10062101 | 3300005434 | Bacteria | 2381 |
| 53 | Ga0070709_10169753 | 3300005434 | Bacteria | 1523 |
| 54 | Ga0070714_100000739 | 3300005435 | Bacteria | 23156 |
| 55 | Ga0070714_100027307 | 3300005435 | Bacteria | 4726 |
| 56 | Ga0070714_100250094 | 3300005435 | Bacteria | 1639 |
| 57 | Ga0070714_100674821 | 3300005435 | Bacteria | 996 |
| 58 | Ga0070713_100057137 | 3300005436 | Bacteria | 3247 |
| 59 | Ga0070713_100080503 | 3300005436 | Bacteria | 2777 |
| 60 | Ga0070713_100105722 | 3300005436 | Bacteria | 2446 |
| 61 | Ga0070713_100886146 | 3300005436 | Bacteria | 858 |
| 62 | Ga0070710_10015076 | 3300005437 | Bacteria | 3903 |
| 63 | Ga0070710_10076409 | 3300005437 | Bacteria | 1944 |
| 64 | Ga0070710_10078972 | 3300005437 | Bacteria | 1916 |
| 65 | Ga0070710_10145812 | 3300005437 | Bacteria | 1456 |
| 66 | Ga0070701_10055938 | 3300005438 | Bacteria | 2063 |
| 67 | Ga0070701_10265742 | 3300005438 | Bacteria | 1041 |
| 68 | Ga0070711_100001343 | 3300005439 | Bacteria | 13436 |
| 69 | Ga0070711_100001693 | 3300005439 | Bacteria | 12214 |
| 70 | Ga0070711_100098736 | 3300005439 | Bacteria | 2120 |
| 71 | Ga0070700_100039031 | 3300005441 | Bacteria | 2898 |
| 72 | Ga0070700_100227305 | 3300005441 | Bacteria | 1326 |
| 73 | Ga0070708_100126243 | 3300005445 | Bacteria | 2365 |
| 74 | Ga0070663_100015528 | 3300005455 | Bacteria | 4920 |
| 75 | Ga0070663_100018140 | 3300005455 | Bacteria | 4607 |
| 76 | Ga0070663_100030326 | 3300005455 | Bacteria | 3704 |
| 77 | Ga0070663_100180131 | 3300005455 | Bacteria | 1639 |
| 78 | Ga0070678_100043585 | 3300005456 | Bacteria | 3197 |
| 79 | Ga0070678_100084853 | 3300005456 | Bacteria | 2412 |
| 80 | Ga0070678_100394586 | 3300005456 | Bacteria | 1201 |
| 81 | Ga0070678_100651572 | 3300005456 | Bacteria | 945 |
| 82 | Ga0070662_100119590 | 3300005457 | Bacteria | 2017 |
| 83 | Ga0070681_10016302 | 3300005458 | Bacteria | 7414 |
| 84 | Ga0070681_10331122 | 3300005458 | Bacteria | 1432 |
| 85 | Ga0070681_10467567 | 3300005458 | Bacteria | 1174 |
| 86 | Ga0068867_100207547 | 3300005459 | Bacteria | 1571 |
| 87 | Ga0070707_100806320 | 3300005468 | Bacteria | 903 |
| 88 | Ga0070698_100061232 | 3300005471 | Bacteria | 3798 |
| 89 | Ga0070679_100069266 | 3300005530 | Bacteria | 3519 |
| 90 | Ga0070679_100118161 | 3300005530 | Bacteria | 2636 |
| 91 | Ga0070684_100002732 | 3300005535 | Bacteria | 13046 |
| 92 | Ga0070684_100035349 | 3300005535 | Bacteria | 4276 |
| 93 | Ga0068853_100024770 | 3300005539 | Bacteria | 5034 |
| 94 | Ga0068853_100099598 | 3300005539 | Bacteria | 2568 |
| 95 | Ga0068853_100100270 | 3300005539 | Bacteria | 2560 |
| 96 | Ga0068853_100981588 | 3300005539 | Bacteria | 813 |
| 97 | Ga0068853_101045875 | 3300005539 | Bacteria | 787 |
| 98 | Ga0070672_100175704 | 3300005543 | Bacteria | 1783 |
| 99 | Ga0070686_100520757 | 3300005544 | Bacteria | 926 |
| 100 | Ga0070693_100064160 | 3300005547 | Bacteria | 2143 |
| 101 | Ga0070693_100116072 | 3300005547 | Bacteria | 1654 |
| 102 | Ga0070665_100002394 | 3300005548 | Bacteria | 20689 |
| 103 | Ga0070665_100005213 | 3300005548 | Bacteria | 13447 |
| 104 | Ga0070665_100006911 | 3300005548 | Bacteria | 11532 |
| 105 | Ga0070665_100051132 | 3300005548 | Bacteria | 4145 |
| 106 | Ga0070665_100159586 | 3300005548 | Bacteria | 2257 |
| 107 | Ga0070665_100170354 | 3300005548 | Bacteria | 2178 |
| 108 | Ga0068855_100295314 | 3300005563 | Bacteria | 1795 |
| 109 | Ga0068855_100884991 | 3300005563 | Bacteria | 944 |
| 110 | Ga0070664_100262610 | 3300005564 | Bacteria | 1554 |
| 111 | Ga0070664_100804585 | 3300005564 | Bacteria | 879 |
| 112 | Ga0068854_100192544 | 3300005578 | Bacteria | 1599 |
| 113 | Ga0068854_100194811 | 3300005578 | Bacteria | 1590 |
| 114 | Ga0068856_100010975 | 3300005614 | Bacteria | 8795 |
| 115 | Ga0068852_100060857 | 3300005616 | Bacteria | 3279 |
| 116 | Ga0068852_100200070 | 3300005616 | Bacteria | 1890 |
| 117 | Ga0068859_100518645 | 3300005617 | Bacteria | 1287 |
| 118 | Ga0068859_100929525 | 3300005617 | Bacteria | 954 |
| 119 | Ga0068864_100023044 | 3300005618 | Bacteria | 5226 |
| 120 | Ga0068864_100187641 | 3300005618 | Bacteria | 1894 |
| 121 | Ga0068864_100200341 | 3300005618 | Bacteria | 1833 |
| 122 | Ga0068861_100126036 | 3300005719 | Bacteria | 2072 |
| 123 | Ga0068861_100375327 | 3300005719 | Bacteria | 1255 |
| 124 | Ga0068861_100737502 | 3300005719 | Bacteria | 919 |
| 125 | Ga0068861_100924709 | 3300005719 | Bacteria | 828 |
| 126 | Ga0068851_10267047 | 3300005834 | Bacteria | 975 |
| 127 | Ga0068863_100133441 | 3300005841 | Bacteria | 2372 |
| 128 | Ga0068863_100247303 | 3300005841 | Bacteria | 1722 |
| 129 | Ga0068858_100116128 | 3300005842 | Bacteria | 2501 |
| 130 | Ga0068858_100538518 | 3300005842 | Bacteria | 1130 |
| 131 | Ga0068860_100292318 | 3300005843 | Bacteria | 1595 |
| 132 | Ga0068860_100437853 | 3300005843 | Bacteria | 1298 |
| 133 | Ga0068862_100052503 | 3300005844 | Bacteria | 3488 |
| 134 | Ga0081455_10006750 | 3300005937 | Bacteria | 12251 |
| 135 | Ga0081455_10062291 | 3300005937 | Bacteria | 3136 |
| 136 | Ga0081538_10013960 | 3300005981 | Bacteria | 6325 |
| 137 | Ga0081538_10057728 | 3300005981 | Bacteria | 2258 |
| 138 | Ga0081540_1003811 | 3300005983 | Bacteria | 11795 |
| 139 | Ga0081540_1007099 | 3300005983 | Bacteria | 8046 |
| 140 | Ga0081540_1007462 | 3300005983 | Bacteria | 7787 |
| 141 | Ga0081540_1013188 | 3300005983 | Bacteria | 5390 |
| 142 | Ga0081540_1014734 | 3300005983 | Bacteria | 4991 |
| 143 | Ga0081540_1016073 | 3300005983 | Bacteria | 4707 |
| 144 | Ga0081540_1016372 | 3300005983 | Bacteria | 4642 |
| 145 | Ga0081540_1029699 | 3300005983 | Bacteria | 3041 |
| 146 | Ga0081539_10001182 | 3300005985 | Bacteria | 47183 |
| 147 | Ga0081539_10022473 | 3300005985 | Bacteria | 4170 |
| 148 | Ga0070717_10019596 | 3300006028 | Bacteria | 5309 |
| 149 | Ga0070717_10036927 | 3300006028 | Bacteria | 3965 |
| 150 | Ga0070717_10198897 | 3300006028 | Bacteria | 1755 |
| 151 | Ga0070717_10745229 | 3300006028 | Bacteria | 890 |
| 152 | Ga0075365_10118488 | 3300006038 | Bacteria | 1824 |
| 153 | Ga0075365_10135975 | 3300006038 | Bacteria | 1703 |
| 154 | Ga0075365_10306764 | 3300006038 | Bacteria | 1117 |
| 155 | Ga0075365_10329353 | 3300006038 | Bacteria | 1076 |
| 156 | Ga0075365_10453708 | 3300006038 | Bacteria | 905 |
| 157 | Ga0075368_10018742 | 3300006042 | Bacteria | 2605 |
| 158 | Ga0075368_10023629 | 3300006042 | Bacteria | 2350 |
| 159 | Ga0075368_10033993 | 3300006042 | Bacteria | 1985 |
| 160 | Ga0075363_100044787 | 3300006048 | Bacteria | 2345 |
| 161 | Ga0075363_100053429 | 3300006048 | Bacteria | 2159 |
| 162 | Ga0075363_100062994 | 3300006048 | Bacteria | 2000 |
| 163 | Ga0075363_100110319 | 3300006048 | Bacteria | 1529 |
| 164 | Ga0075364_10007367 | 3300006051 | Bacteria | 6532 |
| 165 | Ga0075364_10082233 | 3300006051 | Bacteria | 2131 |
| 166 | Ga0075364_10117045 | 3300006051 | Bacteria | 1782 |
| 167 | Ga0070715_10000259 | 3300006163 | Bacteria | 12814 |
| 168 | Ga0070715_10013984 | 3300006163 | Bacteria | 2960 |
| 169 | Ga0070715_10065718 | 3300006163 | Bacteria | 1606 |
| 170 | Ga0070716_100014423 | 3300006173 | Bacteria | 4047 |
| 171 | Ga0070716_100023117 | 3300006173 | Bacteria | 3293 |
| 172 | Ga0070716_100063132 | 3300006173 | Bacteria | 2150 |
| 173 | Ga0070716_100082549 | 3300006173 | Bacteria | 1922 |
| 174 | Ga0070712_100015526 | 3300006175 | Bacteria | 4909 |
| 175 | Ga0070712_100078491 | 3300006175 | Bacteria | 2384 |
| 176 | Ga0070712_100225106 | 3300006175 | Bacteria | 1487 |
| 177 | Ga0070712_100295579 | 3300006175 | Bacteria | 1309 |
| 178 | Ga0070712_100355044 | 3300006175 | Bacteria | 1201 |
| 179 | Ga0070712_100738384 | 3300006175 | Bacteria | 842 |
| 180 | Ga0075362_10110646 | 3300006177 | Bacteria | 1293 |
| 181 | Ga0075367_10036272 | 3300006178 | Bacteria | 2858 |
| 182 | Ga0075367_10071753 | 3300006178 | Bacteria | 2084 |
| 183 | Ga0075367_10104051 | 3300006178 | Bacteria | 1738 |
| 184 | Ga0075369_10113709 | 3300006186 | Bacteria | 1221 |
| 185 | Ga0075369_10114072 | 3300006186 | Bacteria | 1219 |
| 186 | Ga0075369_10120610 | 3300006186 | Bacteria | 1187 |
| 187 | Ga0075366_10029236 | 3300006195 | Bacteria | 3237 |
| 188 | Ga0075366_10105246 | 3300006195 | Bacteria | 1696 |
| 189 | Ga0097621_100025887 | 3300006237 | Bacteria | 4596 |
| 190 | Ga0097621_100276798 | 3300006237 | Bacteria | 1476 |
| 191 | Ga0097621_100528133 | 3300006237 | Bacteria | 1072 |
| 192 | Ga0075370_10015394 | 3300006353 | Bacteria | 4095 |
| 193 | Ga0075370_10027830 | 3300006353 | Bacteria | 3139 |
| 194 | Ga0075370_10192316 | 3300006353 | Bacteria | 1202 |
| 195 | Ga0068871_100266722 | 3300006358 | Bacteria | 1495 |
| 196 | Ga0075428_100395782 | 3300006844 | Bacteria | 1481 |
| 197 | Ga0075433_10164951 | 3300006852 | Bacteria | 1972 |
| 198 | Ga0075433_10173278 | 3300006852 | Bacteria | 1920 |
| 199 | Ga0075433_10608976 | 3300006852 | Bacteria | 959 |
| 200 | Ga0075434_100000032 | 3300006871 | Bacteria | 63711 |
| 201 | Ga0075434_100086670 | 3300006871 | Bacteria | 3132 |
| 202 | Ga0075434_100355554 | 3300006871 | Bacteria | 1486 |
| 203 | Ga0075434_100756021 | 3300006871 | Bacteria | 989 |
| 204 | Ga0068865_100036018 | 3300006881 | Bacteria | 3333 |
| 205 | Ga0068865_100273986 | 3300006881 | Bacteria | 1341 |
| 206 | Ga0068865_100322726 | 3300006881 | Bacteria | 1243 |
| 207 | Ga0075436_100061935 | 3300006914 | Bacteria | 2586 |
| 208 | Ga0075436_100252916 | 3300006914 | Bacteria | 1255 |
| 209 | Ga0097620_100518604 | 3300006931 | Bacteria | 1287 |
| 210 | Ga0097620_100929468 | 3300006931 | Bacteria | 954 |
| 211 | Ga0099825_1025526 | 3300006941 | Bacteria | 3276 |
| 212 | Ga0099825_1027160 | 3300006941 | Bacteria | 2948 |
| 213 | Ga0099824_1006625 | 3300006942 | Bacteria | 15796 |
| 214 | Ga0099824_1015178 | 3300006942 | Bacteria | 7399 |
| 215 | Ga0099822_1003046 | 3300006943 | Bacteria | 21323 |
| 216 | Ga0099823_1022654 | 3300006944 | Bacteria | 5802 |
| 217 | Ga0075435_100115462 | 3300007076 | Bacteria | 2235 |
| 218 | Ga0099794_10031783 | 3300007265 | Bacteria | 2474 |
| 219 | Ga0099795_10050225 | 3300007788 | Bacteria | 1516 |
| 220 | Ga0105250_10178299 | 3300009092 | Bacteria | 891 |
| 221 | Ga0105240_10515571 | 3300009093 | Bacteria | 1327 |
| 222 | Ga0111539_10000041 | 3300009094 | Bacteria | 131679 |
| 223 | Ga0111539_10095255 | 3300009094 | Bacteria | 3497 |
| 224 | Ga0111539_10321914 | 3300009094 | Bacteria | 1799 |
| 225 | Ga0111539_10725138 | 3300009094 | Bacteria | 1157 |
| 226 | Ga0105245_10003142 | 3300009098 | Bacteria | 14776 |
| 227 | Ga0105245_10470478 | 3300009098 | Bacteria | 1268 |
| 228 | Ga0105247_10020411 | 3300009101 | Bacteria | 3983 |
| 229 | Ga0105247_10173827 | 3300009101 | Bacteria | 1434 |
| 230 | Ga0105247_10208434 | 3300009101 | Bacteria | 1317 |
| 231 | Ga0105247_10215633 | 3300009101 | Bacteria | 1297 |
| 232 | Ga0105247_10418772 | 3300009101 | Bacteria | 958 |
| 233 | Ga0105247_10631891 | 3300009101 | Bacteria | 798 |
| 234 | Ga0114129_10367988 | 3300009147 | Bacteria | 1901 |
| 235 | Ga0114129_10491130 | 3300009147 | Bacteria | 1605 |
| 236 | Ga0114129_10613486 | 3300009147 | Bacteria | 1408 |
| 237 | Ga0105243_10215241 | 3300009148 | Bacteria | 1694 |
| 238 | Ga0105242_10034037 | 3300009176 | Bacteria | 4083 |
| 239 | Ga0105248_10113899 | 3300009177 | Bacteria | 3050 |
| 240 | Ga0105248_10358079 | 3300009177 | Bacteria | 1643 |
| 241 | Ga0105248_10775741 | 3300009177 | Bacteria | 1082 |
| 242 | Ga0105248_11434161 | 3300009177 | Bacteria | 781 |
| 243 | Ga0105237_10188668 | 3300009545 | Bacteria | 2062 |
| 244 | Ga0105237_10265806 | 3300009545 | Bacteria | 1718 |
| 245 | Ga0105237_10417534 | 3300009545 | Bacteria | 1347 |
| 246 | Ga0105237_11226030 | 3300009545 | Bacteria | 757 |
| 247 | Ga0105238_10330753 | 3300009551 | Bacteria | 1510 |
| 248 | Ga0105238_10608766 | 3300009551 | Bacteria | 1101 |
| 249 | Ga0105238_10889928 | 3300009551 | Bacteria | 908 |
| 250 | Ga0105249_10284382 | 3300009553 | Bacteria | 1653 |
| 251 | Ga0105249_10359346 | 3300009553 | Bacteria | 1477 |
| 252 | Ga0099796_10008400 | 3300010159 | Bacteria | 2751 |
| 253 | Ga0099796_10153151 | 3300010159 | Bacteria | 909 |
| 254 | Ga0105239_10034860 | 3300010375 | Bacteria | 5528 |
| 255 | Ga0105239_10088222 | 3300010375 | Bacteria | 3420 |
| 256 | Ga0105239_10412923 | 3300010375 | Bacteria | 1528 |
| 257 | Ga0105246_10052887 | 3300011119 | Bacteria | 2793 |
| 258 | Ga0105246_11040625 | 3300011119 | Bacteria | 744 |
| 259 | Ga0157343_1010179 | 3300012488 | Bacteria | 707 |
| 260 | Ga0157370_10376148 | 3300013104 | Bacteria | 1308 |
| 261 | Ga0157370_10723833 | 3300013104 | Bacteria | 907 |
| 262 | Ga0157369_10008826 | 3300013105 | Bacteria | 11547 |
| 263 | Ga0157369_10010164 | 3300013105 | Bacteria | 10742 |
| 264 | Ga0157369_10248477 | 3300013105 | Bacteria | 1857 |
| 265 | Ga0157374_10013680 | 3300013296 | Bacteria | 7089 |
| 266 | Ga0157374_10047448 | 3300013296 | Bacteria | 3983 |
| 267 | Ga0157374_10212506 | 3300013296 | Bacteria | 1897 |
| 268 | Ga0157378_10822711 | 3300013297 | Bacteria | 956 |
| 269 | Ga0163162_10120701 | 3300013306 | Bacteria | 2725 |
| 270 | Ga0163162_11031758 | 3300013306 | Bacteria | 930 |
| 271 | Ga0163162_11374083 | 3300013306 | Bacteria | 803 |
| 272 | Ga0157372_10767652 | 3300013307 | Bacteria | 1121 |
| 273 | Ga0157372_11331699 | 3300013307 | Bacteria | 828 |
| 274 | Ga0157375_10073559 | 3300013308 | Bacteria | 3437 |
| 275 | Ga0157375_10079107 | 3300013308 | Bacteria | 3323 |
| 276 | Ga0157375_10787518 | 3300013308 | Bacteria | 1100 |
| 277 | Ga0157375_11141754 | 3300013308 | Bacteria | 913 |
| 278 | Ga0157375_11923246 | 3300013308 | Bacteria | 702 |
| 279 | Ga0163163_10033065 | 3300014325 | Bacteria | 5000 |
| 280 | Ga0157380_10014539 | 3300014326 | Bacteria | 5760 |
| 281 | Ga0157380_11036227 | 3300014326 | Bacteria | 856 |
| 282 | Ga0182008_10214972 | 3300014497 | Bacteria | 982 |
| 283 | Ga0157377_10135122 | 3300014745 | Bacteria | 1510 |
| 284 | Ga0157377_10190164 | 3300014745 | Bacteria | 1297 |
| 285 | Ga0157379_10162321 | 3300014968 | Bacteria | 2017 |
| 286 | Ga0157379_10596906 | 3300014968 | Bacteria | 1030 |
| 287 | Ga0157376_10063001 | 3300014969 | Bacteria | 3122 |
| 288 | Ga0157376_10719565 | 3300014969 | Bacteria | 1005 |
| 289 | Ga0182006_1086770 | 3300015261 | Bacteria | 1132 |
| 290 | Ga0163161_10006317 | 3300017792 | Bacteria | 8202 |
| 291 | Ga0163161_10203406 | 3300017792 | Bacteria | 1527 |
| 292 | Ga0214544_1000163 | 3300021320 | Bacteria | 101631 |
| 293 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 294 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 295 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 296 | Ga0214543_1043876 | 3300021327 | Bacteria | 1065 |
| 297 | Ga0213873_10037378 | 3300021358 | Bacteria | 1237 |
| 298 | Ga0213873_10056117 | 3300021358 | Bacteria | 1055 |
| 299 | Ga0213872_10044316 | 3300021361 | Bacteria | 2025 |
| 300 | Ga0213874_10024497 | 3300021377 | Bacteria | 1693 |
| 301 | Ga0213874_10067548 | 3300021377 | Bacteria | 1133 |
| 302 | Ga0213874_10126299 | 3300021377 | Bacteria | 874 |
| 303 | Ga0213876_10004130 | 3300021384 | Bacteria | 8156 |
| 304 | Ga0213876_10244026 | 3300021384 | Bacteria | 955 |
| 305 | Ga0209563_101608 | 3300025230 | Bacteria | 5843 |
| 306 | Ga0209677_111207 | 3300025253 | Bacteria | 1416 |
| 307 | Ga0209233_1002828 | 3300025261 | Bacteria | 6235 |
| 308 | Ga0209130_1000804 | 3300025284 | Bacteria | 26631 |
| 309 | Ga0209025_1000779 | 3300025294 | Bacteria | 52611 |
| 310 | Ga0209025_1088134 | 3300025294 | Bacteria | 1025 |
| 311 | Ga0209564_1000532 | 3300025295 | Bacteria | 61903 |
| 312 | Ga0209564_1053486 | 3300025295 | Bacteria | 961 |
| 313 | Ga0209758_1000109 | 3300025297 | Bacteria | 214759 |
| 314 | Ga0209758_1000938 | 3300025297 | Bacteria | 39351 |
| 315 | Ga0209758_1002619 | 3300025297 | Bacteria | 17898 |
| 316 | Ga0209758_1004105 | 3300025297 | Bacteria | 12479 |
| 317 | Ga0209758_1009535 | 3300025297 | Bacteria | 6007 |
| 318 | Ga0209758_1009647 | 3300025297 | Bacteria | 5949 |
| 319 | Ga0209758_1009772 | 3300025297 | Bacteria | 5882 |
| 320 | Ga0209758_1015925 | 3300025297 | Bacteria | 3856 |
| 321 | Ga0209256_1003201 | 3300025299 | Bacteria | 11828 |
| 322 | Ga0207426_1000066 | 3300025302 | Bacteria | 351182 |
| 323 | Ga0207426_1002293 | 3300025302 | Bacteria | 12619 |
| 324 | Ga0209051_1024905 | 3300025303 | Bacteria | 2449 |
| 325 | Ga0209257_1001604 | 3300025304 | Bacteria | 25883 |
| 326 | Ga0207697_10080014 | 3300025315 | Bacteria | 1376 |
| 327 | Ga0207692_10273505 | 3300025898 | Bacteria | 1019 |
| 328 | Ga0207692_10333384 | 3300025898 | Bacteria | 931 |
| 329 | Ga0207710_10118987 | 3300025900 | Bacteria | 1260 |
| 330 | Ga0207710_10151631 | 3300025900 | Bacteria | 1125 |
| 331 | Ga0207710_10153151 | 3300025900 | Bacteria | 1119 |
| 332 | Ga0207710_10323821 | 3300025900 | Bacteria | 782 |
| 333 | Ga0207688_10125717 | 3300025901 | Bacteria | 1499 |
| 334 | Ga0207688_10219437 | 3300025901 | Bacteria | 1145 |
| 335 | Ga0207680_10213777 | 3300025903 | Bacteria | 1319 |
| 336 | Ga0207680_10419666 | 3300025903 | Bacteria | 947 |
| 337 | Ga0207647_10002766 | 3300025904 | Bacteria | 13239 |
| 338 | Ga0207647_10088462 | 3300025904 | Bacteria | 1849 |
| 339 | Ga0207685_10246065 | 3300025905 | Bacteria | 863 |
| 340 | Ga0207685_10348431 | 3300025905 | Bacteria | 746 |
| 341 | Ga0207699_10017411 | 3300025906 | Bacteria | 3780 |
| 342 | Ga0207699_10034307 | 3300025906 | Bacteria | 2877 |
| 343 | Ga0207699_10184785 | 3300025906 | Bacteria | 1403 |
| 344 | Ga0207699_10412559 | 3300025906 | Bacteria | 963 |
| 345 | Ga0207699_10487129 | 3300025906 | Bacteria | 889 |
| 346 | Ga0207645_10038963 | 3300025907 | Bacteria | 3046 |
| 347 | Ga0207705_10153732 | 3300025909 | Bacteria | 1725 |
| 348 | Ga0207684_10303315 | 3300025910 | Bacteria | 1377 |
| 349 | Ga0207707_10001660 | 3300025912 | Bacteria | 20546 |
| 350 | Ga0207707_10006974 | 3300025912 | Bacteria | 9854 |
| 351 | Ga0207707_10545566 | 3300025912 | Bacteria | 985 |
| 352 | Ga0207695_10476172 | 3300025913 | Bacteria | 1131 |
| 353 | Ga0207671_10029152 | 3300025914 | Bacteria | 4123 |
| 354 | Ga0207671_10108395 | 3300025914 | Bacteria | 2111 |
| 355 | Ga0207671_10422732 | 3300025914 | Bacteria | 1060 |
| 356 | Ga0207671_10693079 | 3300025914 | Bacteria | 810 |
| 357 | Ga0207693_10002055 | 3300025915 | Bacteria | 17603 |
| 358 | Ga0207693_10017696 | 3300025915 | Bacteria | 5683 |
| 359 | Ga0207693_10035497 | 3300025915 | Bacteria | 3930 |
| 360 | Ga0207693_10071194 | 3300025915 | Bacteria | 2721 |
| 361 | Ga0207693_10187764 | 3300025915 | Bacteria | 1627 |
| 362 | Ga0207693_10319737 | 3300025915 | Bacteria | 1215 |
| 363 | Ga0207693_10353540 | 3300025915 | Bacteria | 1150 |
| 364 | Ga0207693_10510810 | 3300025915 | Bacteria | 938 |
| 365 | Ga0207663_10000268 | 3300025916 | Bacteria | 22554 |
| 366 | Ga0207663_10006117 | 3300025916 | Bacteria | 6125 |
| 367 | Ga0207660_10156422 | 3300025917 | Bacteria | 1755 |
| 368 | Ga0207660_10263399 | 3300025917 | Bacteria | 1364 |
| 369 | Ga0207660_10374813 | 3300025917 | Bacteria | 1143 |
| 370 | Ga0207662_10025844 | 3300025918 | Bacteria | 3384 |
| 371 | Ga0207657_10051937 | 3300025919 | Bacteria | 3561 |
| 372 | Ga0207657_10117281 | 3300025919 | Bacteria | 2193 |
| 373 | Ga0207649_10048682 | 3300025920 | Bacteria | 2615 |
| 374 | Ga0207652_10010388 | 3300025921 | Bacteria | 7496 |
| 375 | Ga0207652_10010980 | 3300025921 | Bacteria | 7302 |
| 376 | Ga0207652_10226582 | 3300025921 | Bacteria | 1685 |
| 377 | Ga0207652_10688550 | 3300025921 | Bacteria | 913 |
| 378 | Ga0207646_10656567 | 3300025922 | Bacteria | 939 |
| 379 | Ga0207646_10854170 | 3300025922 | Bacteria | 809 |
| 380 | Ga0207681_10187774 | 3300025923 | Bacteria | 1579 |
| 381 | Ga0207681_10218325 | 3300025923 | Bacteria | 1474 |
| 382 | Ga0207694_10293812 | 3300025924 | Bacteria | 1337 |
| 383 | Ga0207694_10876994 | 3300025924 | Bacteria | 759 |
| 384 | Ga0207687_10013783 | 3300025927 | Bacteria | 5281 |
| 385 | Ga0207700_10029573 | 3300025928 | Bacteria | 3868 |
| 386 | Ga0207700_10039961 | 3300025928 | Bacteria | 3420 |
| 387 | Ga0207700_10040532 | 3300025928 | Bacteria | 3400 |
| 388 | Ga0207700_10043510 | 3300025928 | Bacteria | 3299 |
| 389 | Ga0207700_10098776 | 3300025928 | Bacteria | 2323 |
| 390 | Ga0207700_10662511 | 3300025928 | Bacteria | 931 |
| 391 | Ga0207664_10015168 | 3300025929 | Bacteria | 5584 |
| 392 | Ga0207664_10024402 | 3300025929 | Bacteria | 4544 |
| 393 | Ga0207664_10102951 | 3300025929 | Bacteria | 2362 |
| 394 | Ga0207664_10232462 | 3300025929 | Bacteria | 1603 |
| 395 | Ga0207664_10680448 | 3300025929 | Bacteria | 925 |
| 396 | Ga0207664_11027879 | 3300025929 | Bacteria | 738 |
| 397 | Ga0207644_10174292 | 3300025931 | Bacteria | 1681 |
| 398 | Ga0207644_10314340 | 3300025931 | Bacteria | 1265 |
| 399 | Ga0207690_10130306 | 3300025932 | Bacteria | 1840 |
| 400 | Ga0207690_10173140 | 3300025932 | Bacteria | 1619 |
| 401 | Ga0207706_10208702 | 3300025933 | Bacteria | 1712 |
| 402 | Ga0207686_10124259 | 3300025934 | Bacteria | 1761 |
| 403 | Ga0207670_10329772 | 3300025936 | Bacteria | 1203 |
| 404 | Ga0207670_10441195 | 3300025936 | Bacteria | 1048 |
| 405 | Ga0207669_10193825 | 3300025937 | Bacteria | 1468 |
| 406 | Ga0207704_10113298 | 3300025938 | Bacteria | 1839 |
| 407 | Ga0207665_10005120 | 3300025939 | Bacteria | 8755 |
| 408 | Ga0207665_10023354 | 3300025939 | Bacteria | 4074 |
| 409 | Ga0207665_10023387 | 3300025939 | Bacteria | 4071 |
| 410 | Ga0207665_10153462 | 3300025939 | Bacteria | 1651 |
| 411 | Ga0207665_10254616 | 3300025939 | Bacteria | 1298 |
| 412 | Ga0207691_10053838 | 3300025940 | Bacteria | 3672 |
| 413 | Ga0207691_10132406 | 3300025940 | Bacteria | 2201 |
| 414 | Ga0207691_10323236 | 3300025940 | Bacteria | 1323 |
| 415 | Ga0207711_10294765 | 3300025941 | Bacteria | 1495 |
| 416 | Ga0207711_11083088 | 3300025941 | Bacteria | 742 |
| 417 | Ga0207689_10356783 | 3300025942 | Bacteria | 1216 |
| 418 | Ga0207661_10003335 | 3300025944 | Bacteria | 11139 |
| 419 | Ga0207661_10064261 | 3300025944 | Bacteria | 2974 |
| 420 | Ga0207679_10348087 | 3300025945 | Bacteria | 1291 |
| 421 | Ga0207679_10379129 | 3300025945 | Bacteria | 1239 |
| 422 | Ga0207679_10899390 | 3300025945 | Bacteria | 810 |
| 423 | Ga0207667_10224824 | 3300025949 | Bacteria | 1923 |
| 424 | Ga0207667_10586780 | 3300025949 | Bacteria | 1125 |
| 425 | Ga0207667_10600425 | 3300025949 | Bacteria | 1110 |
| 426 | Ga0207651_10176473 | 3300025960 | Bacteria | 1690 |
| 427 | Ga0207651_10177073 | 3300025960 | Bacteria | 1688 |
| 428 | Ga0207651_10320869 | 3300025960 | Bacteria | 1295 |
| 429 | Ga0207651_10354753 | 3300025960 | Bacteria | 1236 |
| 430 | Ga0207712_10236413 | 3300025961 | Bacteria | 1470 |
| 431 | Ga0207668_10026980 | 3300025972 | Bacteria | 3737 |
| 432 | Ga0207668_10491175 | 3300025972 | Bacteria | 1054 |
| 433 | Ga0207658_10050424 | 3300025986 | Bacteria | 3063 |
| 434 | Ga0207658_10505270 | 3300025986 | Bacteria | 1077 |
| 435 | Ga0207677_10006386 | 3300026023 | Bacteria | 6465 |
| 436 | Ga0207677_10397371 | 3300026023 | Bacteria | 1168 |
| 437 | Ga0207677_10753186 | 3300026023 | Bacteria | 868 |
| 438 | Ga0207677_11181619 | 3300026023 | Bacteria | 700 |
| 439 | Ga0207703_10066622 | 3300026035 | Bacteria | 2963 |
| 440 | Ga0207703_10252147 | 3300026035 | Bacteria | 1591 |
| 441 | Ga0207703_10471257 | 3300026035 | Bacteria | 1176 |
| 442 | Ga0207639_10342341 | 3300026041 | Bacteria | 1333 |
| 443 | Ga0207678_10023600 | 3300026067 | Bacteria | 5379 |
| 444 | Ga0207678_10032634 | 3300026067 | Bacteria | 4538 |
| 445 | Ga0207678_10057246 | 3300026067 | Bacteria | 3354 |
| 446 | Ga0207678_10066250 | 3300026067 | Bacteria | 3102 |
| 447 | Ga0207678_10114338 | 3300026067 | Bacteria | 2303 |
| 448 | Ga0207678_10279546 | 3300026067 | Bacteria | 1432 |
| 449 | Ga0207678_10675784 | 3300026067 | Bacteria | 908 |
| 450 | Ga0207678_10966962 | 3300026067 | Bacteria | 753 |
| 451 | Ga0207708_10085232 | 3300026075 | Bacteria | 2430 |
| 452 | Ga0207708_10323893 | 3300026075 | Bacteria | 1258 |
| 453 | Ga0207702_10008332 | 3300026078 | Bacteria | 8751 |
| 454 | Ga0207702_10143973 | 3300026078 | Bacteria | 2160 |
| 455 | Ga0207641_11027634 | 3300026088 | Bacteria | 821 |
| 456 | Ga0207648_10055076 | 3300026089 | Bacteria | 3472 |
| 457 | Ga0207648_10212002 | 3300026089 | Bacteria | 1720 |
| 458 | Ga0207648_10221584 | 3300026089 | Bacteria | 1681 |
| 459 | Ga0207648_10383102 | 3300026089 | Bacteria | 1272 |
| 460 | Ga0207676_10351522 | 3300026095 | Bacteria | 1363 |
| 461 | Ga0207676_10418626 | 3300026095 | Bacteria | 1256 |
| 462 | Ga0207676_11354940 | 3300026095 | Bacteria | 707 |
| 463 | Ga0207674_10193637 | 3300026116 | Bacteria | 1983 |
| 464 | Ga0207675_100027594 | 3300026118 | Bacteria | 5288 |
| 465 | Ga0207675_100436573 | 3300026118 | Bacteria | 1295 |
| 466 | Ga0207683_10005742 | 3300026121 | Bacteria | 10643 |
| 467 | Ga0207683_10018090 | 3300026121 | Bacteria | 6009 |
| 468 | Ga0207683_10975556 | 3300026121 | Bacteria | 787 |
| 469 | Ga0207698_10179454 | 3300026142 | Bacteria | 1874 |
| 470 | Ga0207698_10221475 | 3300026142 | Bacteria | 1710 |
| 471 | Ga0207698_10666618 | 3300026142 | Bacteria | 1032 |
| 472 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 473 | Ga0209389_1000880 | 3300027296 | Bacteria | 19469 |
| 474 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 475 | Ga0209589_1000897 | 3300027357 | Bacteria | 45637 |
| 476 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 477 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 478 | Ga0209489_100110 | 3300027361 | Bacteria | 117680 |
| 479 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 480 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 481 | Ga0209179_1038004 | 3300027512 | Bacteria | 1006 |
| 482 | Ga0207428_10038011 | 3300027907 | Bacteria | 3916 |
| 483 | Ga0207428_10524136 | 3300027907 | Bacteria | 859 |
| 484 | Ga0268266_10001169 | 3300028379 | Bacteria | 32459 |
| 485 | Ga0268266_10002165 | 3300028379 | Bacteria | 21557 |
| 486 | Ga0268266_10449696 | 3300028379 | Bacteria | 1224 |
| 487 | Ga0268266_10656684 | 3300028379 | Bacteria | 1009 |
| 488 | Ga0268265_11009214 | 3300028380 | Bacteria | 822 |
| 489 | Ga0268264_10000458 | 3300028381 | Bacteria | 55551 |
| 490 | Ga0268264_10400618 | 3300028381 | Bacteria | 1319 |
| 491 | Ga0268264_11026485 | 3300028381 | Bacteria | 832 |
| 492 | Ga0307517_10000196 | 3300028786 | Bacteria | 102384 |
| 493 | Ga0307515_10118872 | 3300028794 | Bacteria | 3012 |
| 494 | Ga0307515_10146364 | 3300028794 | Bacteria | 2499 |
| 495 | Ga0307511_10077257 | 3300030521 | Bacteria | 2372 |
| 496 | Ga0265330_10024732 | 3300031235 | Bacteria | 2723 |
| 497 | Ga0265330_10027960 | 3300031235 | Bacteria | 2545 |
| 498 | Ga0265332_10001366 | 3300031238 | Bacteria | 13841 |
| 499 | Ga0265332_10013847 | 3300031238 | Bacteria | 3571 |
| 500 | Ga0265325_10009040 | 3300031241 | Bacteria | 5846 |
| 501 | Ga0265329_10040123 | 3300031242 | Bacteria | 1502 |
| 502 | Ga0265340_10014446 | 3300031247 | Bacteria | 4122 |
| 503 | Ga0265340_10105297 | 3300031247 | Bacteria | 1308 |
| 504 | Ga0265339_10008955 | 3300031249 | Bacteria | 6331 |
| 505 | Ga0265339_10049967 | 3300031249 | Bacteria | 2288 |
| 506 | Ga0265339_10065967 | 3300031249 | Bacteria | 1939 |
| 507 | Ga0265331_10032855 | 3300031250 | Bacteria | 2568 |
| 508 | Ga0265331_10045552 | 3300031250 | Bacteria | 2117 |
| 509 | Ga0265331_10140398 | 3300031250 | Bacteria | 1099 |
| 510 | Ga0265316_10456226 | 3300031344 | Bacteria | 916 |
| 511 | Ga0307513_10084532 | 3300031456 | Bacteria | 3259 |
| 512 | Ga0307513_10391228 | 3300031456 | Bacteria | 1127 |
| 513 | Ga0307509_10031336 | 3300031507 | Bacteria | 5871 |
| 514 | Ga0307509_10110235 | 3300031507 | Bacteria | 2759 |
| 515 | Ga0307408_100527841 | 3300031548 | Bacteria | 1038 |
| 516 | Ga0307408_100826594 | 3300031548 | Bacteria | 843 |
| 517 | Ga0307508_10000541 | 3300031616 | Bacteria | 44822 |
| 518 | Ga0307508_10126665 | 3300031616 | Bacteria | 2157 |
| 519 | Ga0307508_10264664 | 3300031616 | Bacteria | 1313 |
| 520 | Ga0307508_10452287 | 3300031616 | Bacteria | 877 |
| 521 | Ga0307514_10401300 | 3300031649 | Bacteria | 700 |
| 522 | Ga0316575_10172963 | 3300031665 | Bacteria | 896 |
| 523 | Ga0316579_10132590 | 3300031691 | Bacteria | 1201 |
| 524 | Ga0265314_10006103 | 3300031711 | Bacteria | 10708 |
| 525 | Ga0265314_10036736 | 3300031711 | Bacteria | 3556 |
| 526 | Ga0265314_10068081 | 3300031711 | Bacteria | 2395 |
| 527 | Ga0265342_10000093 | 3300031712 | Bacteria | 98424 |
| 528 | Ga0265342_10022338 | 3300031712 | Bacteria | 4024 |
| 529 | Ga0265342_10022364 | 3300031712 | Bacteria | 4020 |
| 530 | Ga0265342_10070889 | 3300031712 | Bacteria | 2032 |
| 531 | Ga0307516_10004746 | 3300031730 | Bacteria | 16605 |
| 532 | Ga0307516_10040357 | 3300031730 | Bacteria | 4647 |
| 533 | Ga0307413_10032229 | 3300031824 | Bacteria | 2968 |
| 534 | Ga0307410_10094860 | 3300031852 | Bacteria | 2126 |
| 535 | Ga0307407_10095969 | 3300031903 | Bacteria | 1829 |
| 536 | Ga0307409_100003189 | 3300031995 | Bacteria | 8819 |
| 537 | Ga0307409_100338494 | 3300031995 | Bacteria | 1415 |
| 538 | Ga0307416_100014520 | 3300032002 | Bacteria | 5404 |
| 539 | Ga0307416_100080816 | 3300032002 | Bacteria | 2746 |
| 540 | Ga0307416_101432414 | 3300032002 | Bacteria | 797 |
| 541 | Ga0307415_100358692 | 3300032126 | Bacteria | 1230 |
| 542 | Ga0316583_10001162 | 3300032133 | Bacteria | 8616 |
| 543 | Ga0307507_10034314 | 3300033179 | Bacteria | 5244 |
| 544 | Ga0307510_10138019 | 3300033180 | Bacteria | 2090 |
| 545 | Ga0315911_1000012 | 3300033442 | Bacteria | 248988 |
| 546 | Ga0373926_0053706 | 3300035083 | Bacteria | 1459 |
| 547 | Ga0373934_0021442 | 3300035086 | Bacteria | 2487 |
| 548 | Ga0373934_0045694 | 3300035086 | Bacteria | 1732 |
| 549 | Ga0373923_0006204 | 3300035111 | Bacteria | 4113 |
| 550 | Ga0373941_0062628 | 3300035115 | Bacteria | 1215 |
| 551 | Ga0373945_0335011 | 3300035116 | Bacteria | 654 |
| 552 | Ga0373953_0079623 | 3300035117 | Bacteria | 1360 |
| 553 | Ga0373954_0005528 | 3300035118 | Bacteria | 5468 |
| 554 | Ga0373954_0026019 | 3300035118 | Bacteria | 2679 |
| 555 | Ga0373956_0001286 | 3300035119 | Bacteria | 10388 |
| 556 | Ga0373956_0023981 | 3300035119 | Bacteria | 2624 |
| 557 | Ga0373943_0061942 | 3300035170 | Bacteria | 1872 |
| 558 | Ga0373955_0056849 | 3300035172 | Bacteria | 2147 |
| 559 | Ga0373924_0065013 | 3300035410 | Bacteria | 1532 |
| 560 | Ga0373924_0075561 | 3300035410 | Bacteria | 1426 |
| 561 | Ga0373924_0151675 | 3300035410 | Bacteria | 1014 |
| 562 | Ga0373931_0550711 | 3300035691 | Bacteria | 749 |
| 563 | Ga0373935_0083518 | 3300035692 | Bacteria | 2079 |
| 564 | Ga0373935_0083861 | 3300035692 | Bacteria | 2075 |
| 565 | Ga0373935_0493932 | 3300035692 | Bacteria | 888 |
| 566 | Ga0373927_0022900 | 3300035695 | Bacteria | 4092 |
| 567 | Ga0373927_0029664 | 3300035695 | Bacteria | 3567 |
| 568 | Ga0373927_0060534 | 3300035695 | Bacteria | 2450 |
| 569 | Ga0373927_0193761 | 3300035695 | Bacteria | 1334 |
| 570 | Ga0373933_0000127 | 3300035724 | Bacteria | 48988 |
| 571 | Ga0373933_0069436 | 3300035724 | Bacteria | 2141 |
| 572 | Ga0373933_0240895 | 3300035724 | Bacteria | 1163 |
| 573 | Ga0373933_0265210 | 3300035724 | Bacteria | 1108 |
| 574 | Ga0373947_0005065 | 3300035725 | Bacteria | 7718 |
| 575 | Ga0373947_0008493 | 3300035725 | Bacteria | 5915 |
| 576 | Ga0373947_0093784 | 3300035725 | Bacteria | 1877 |
| 577 | Ga0373937_0027265 | 3300036401 | Bacteria | 5166 |
| 578 | Ga0373937_0089249 | 3300036401 | Bacteria | 2854 |
| 579 | Ga0373937_0238302 | 3300036401 | Bacteria | 1714 |
| 580 | Ga0373937_0296980 | 3300036401 | Bacteria | 1526 |
| 581 | Ga0373937_0669900 | 3300036401 | Bacteria | 983 |
| 582 | Ga0372808_002511 | 3300036459 | Bacteria | 2126 |
| 583 | Ga0373925_0052881 | 3300037068 | Bacteria | 3035 |
| 584 | Ga0373925_0625057 | 3300037068 | Bacteria | 887 |
| 585 | Ga0395900_0023448 | 3300037418 | Bacteria | 6316 |
| 586 | Ga0395900_0030083 | 3300037418 | Bacteria | 5574 |
| 587 | Ga0395898_0102724 | 3300037466 | Bacteria | 2743 |
| 588 | Ga0395898_0958390 | 3300037466 | Bacteria | 792 |
| 589 | Ga0395905_0081904 | 3300037471 | Bacteria | 3024 |
| 590 | Ga0395905_0831561 | 3300037471 | Bacteria | 826 |
| 591 | Ga0436364_1241072 | 3300037853 | Bacteria | 2480 |
| 592 | Ga0395901_0080688 | 3300038443 | Bacteria | 3397 |
| 593 | Ga0395901_0102114 | 3300038443 | Bacteria | 3009 |
| 594 | Ga0436365_0232459 | 3300039437 | Bacteria | 11864 |
| 595 | Ga0436365_0368752 | 3300039437 | Bacteria | 1935 |
| 596 | Ga0436365_0547166 | 3300039437 | Bacteria | 1516 |
| 597 | Ga0436365_0577077 | 3300039437 | Bacteria | 1343 |
| 598 | Ga0436365_0776846 | 3300039437 | Bacteria | 1466 |
| 599 | Ga0436365_1062598 | 3300039437 | Bacteria | 1731 |
| 600 | Ga0436360_0330088 | 3300039438 | Bacteria | 2572 |
| 601 | Ga0436360_1334781 | 3300039438 | Bacteria | 2285 |
| 602 | Ga0436361_0862252 | 3300039447 | Bacteria | 2036 |
| 603 | Ga0436363_0756020 | 3300039450 | Bacteria | 1438 |
| 604 | Ga0436363_0771534 | 3300039450 | Bacteria | 1606 |
| 605 | Ga0436363_0779713 | 3300039450 | Bacteria | 4486 |
| 606 | Ga0436363_1042782 | 3300039450 | Bacteria | 5407 |
| 607 | Ga0436362_0134504 | 3300039453 | Bacteria | 2150 |
| 608 | Ga0436362_0394184 | 3300039453 | Bacteria | 3497 |
| 609 | Ga0439465_0072418 | 3300041413 | Bacteria | 1157 |
| 610 | Ga0439465_0122487 | 3300041413 | Bacteria | 913 |
| 611 | Ga0451791_1147245 | 3300041451 | Bacteria | 739 |
| 612 | Ga0451802_1371745 | 3300041460 | Bacteria | 920 |
| 613 | Ga0451853_1426409 | 3300041512 | Bacteria | 803 |
| 614 | Ga0439431_0031868 | 3300041997 | Bacteria | 1312 |
| 615 | Ga0439458_0052730 | 3300042157 | Bacteria | 1006 |
| 616 | Ga0439459_0087167 | 3300042438 | Bacteria | 746 |
| 617 | Ga0466969_0027941 | 3300044656 | Bacteria | 2887 |
| 618 | Ga0466969_0215109 | 3300044656 | Bacteria | 875 |
| 619 | Ga0466972_0000115 | 3300044658 | Bacteria | 68073 |
| 620 | Ga0466965_0099238 | 3300044683 | Bacteria | 1488 |
| 621 | Ga0466966_0000632 | 3300044684 | Bacteria | 22387 |
| 622 | Ga0466966_0057282 | 3300044684 | Bacteria | 2464 |
| 623 | Ga0466966_0084103 | 3300044684 | Bacteria | 1980 |
| 624 | Ga0466961_0000897 | 3300044693 | Bacteria | 18504 |
| 625 | Ga0466963_0370225 | 3300044694 | Bacteria | 1009 |
| 626 | Ga0466971_0120924 | 3300044719 | Bacteria | 1212 |
| 627 | Ga0466957_0139098 | 3300044842 | Bacteria | 1563 |
| 628 | Ga0466960_0020623 | 3300044901 | Bacteria | 2922 |
| 629 | Ga0466960_0284354 | 3300044901 | Bacteria | 928 |
| 630 | Ga0466959_0004435 | 3300045049 | Bacteria | 9399 |
| 631 | Ga0466959_0035818 | 3300045049 | Bacteria | 3667 |
| 632 | Ga0466959_0298228 | 3300045049 | Bacteria | 1104 |
| 633 | Ga0451576_0934075 | 3300045051 | Bacteria | 910 |
| 634 | Ga0466967_0135506 | 3300045976 | Bacteria | 2290 |
| 635 | Ga0466967_0245825 | 3300045976 | Bacteria | 1707 |
| 636 | Ga0466967_0268645 | 3300045976 | Bacteria | 1634 |
| 637 | Ga0495592_0140292 | 3300046454 | Bacteria | 1682 |
| 638 | Ga0495603_0097065 | 3300046455 | Bacteria | 1721 |
| 639 | Ga0495629_0028607 | 3300046459 | Bacteria | 3955 |
| 640 | Ga0495638_0023867 | 3300046460 | Bacteria | 3994 |
| 641 | Ga0495638_0030772 | 3300046460 | Bacteria | 3451 |
| 642 | Ga0495638_0091842 | 3300046460 | Bacteria | 1827 |
| 643 | Ga0495651_0022721 | 3300046462 | Bacteria | 4875 |
| 644 | Ga0495651_0043109 | 3300046462 | Bacteria | 3501 |
| 645 | Ga0495651_0063776 | 3300046462 | Bacteria | 2816 |
| 646 | Ga0495651_0090764 | 3300046462 | Bacteria | 2291 |
| 647 | Ga0495651_0252196 | 3300046462 | Bacteria | 1204 |
| 648 | Ga0495653_0088004 | 3300046463 | Bacteria | 2280 |
| 649 | Ga0495650_0110195 | 3300046471 | Bacteria | 1023 |
| 650 | Ga0495580_0360360 | 3300046472 | Bacteria | 984 |
| 651 | Ga0495580_0627811 | 3300046472 | Bacteria | 708 |
| 652 | Ga0495605_0109212 | 3300046474 | Bacteria | 1264 |
| 653 | Ga0495639_0127713 | 3300046475 | Bacteria | 1216 |
| 654 | Ga0495664_0043121 | 3300046477 | Bacteria | 2673 |
| 655 | Ga0495664_0043518 | 3300046477 | Bacteria | 2661 |
| 656 | Ga0495664_0091342 | 3300046477 | Bacteria | 1830 |
| 657 | Ga0495596_0098022 | 3300046500 | Bacteria | 1138 |
| 658 | Ga0495608_0097641 | 3300046511 | Bacteria | 1896 |
| 659 | Ga0495610_0120719 | 3300046512 | Bacteria | 1149 |
| 660 | Ga0495616_0186379 | 3300046513 | Bacteria | 919 |
| 661 | Ga0495618_0100421 | 3300046514 | Bacteria | 1852 |
| 662 | Ga0495618_0173006 | 3300046514 | Bacteria | 1374 |
| 663 | Ga0495620_0056120 | 3300046515 | Bacteria | 1658 |
| 664 | Ga0495620_0108146 | 3300046515 | Bacteria | 1104 |
| 665 | Ga0495628_0018136 | 3300046516 | Bacteria | 5836 |
| 666 | Ga0495628_0204353 | 3300046516 | Bacteria | 1487 |
| 667 | Ga0495628_0375163 | 3300046516 | Bacteria | 1042 |
| 668 | Ga0495630_0186812 | 3300046517 | Bacteria | 1581 |
| 669 | Ga0495631_0173670 | 3300046518 | Bacteria | 924 |
| 670 | Ga0495632_0175322 | 3300046519 | Bacteria | 984 |
| 671 | Ga0495643_0011165 | 3300046522 | Bacteria | 5488 |
| 672 | Ga0495643_0244724 | 3300046522 | Bacteria | 840 |
| 673 | Ga0495644_0163388 | 3300046523 | Bacteria | 854 |
| 674 | Ga0495648_0008154 | 3300046524 | Bacteria | 8268 |
| 675 | Ga0495648_0035226 | 3300046524 | Bacteria | 3247 |
| 676 | Ga0495648_0087725 | 3300046524 | Bacteria | 1751 |
| 677 | Ga0495648_0101946 | 3300046524 | Bacteria | 1582 |
| 678 | Ga0495648_0146599 | 3300046524 | Bacteria | 1236 |
| 679 | Ga0495648_0323115 | 3300046524 | Bacteria | 714 |
| 680 | Ga0495666_0211888 | 3300046526 | Bacteria | 889 |
| 681 | Ga0495652_0004702 | 3300046529 | Bacteria | 13012 |
| 682 | Ga0495652_0126608 | 3300046529 | Bacteria | 2028 |
| 683 | Ga0495654_0020872 | 3300046530 | Bacteria | 3411 |
| 684 | Ga0495640_0206161 | 3300046533 | Bacteria | 1244 |
| 685 | Ga0495640_0320815 | 3300046533 | Bacteria | 960 |
| 686 | Ga0495587_0031425 | 3300046536 | Bacteria | 3215 |
| 687 | Ga0495587_0058205 | 3300046536 | Bacteria | 2271 |
| 688 | Ga0495597_0315452 | 3300046542 | Bacteria | 605 |
| 689 | Ga0495645_0061947 | 3300046543 | Bacteria | 2710 |
| 690 | Ga0495645_0069362 | 3300046543 | Bacteria | 2545 |
| 691 | Ga0495645_0096018 | 3300046543 | Bacteria | 2112 |
| 692 | Ga0495622_0025030 | 3300046557 | Bacteria | 2787 |
| 693 | Ga0495622_0031167 | 3300046557 | Bacteria | 2493 |
| 694 | Ga0495622_0127254 | 3300046557 | Bacteria | 1161 |
| 695 | Ga0495633_0204791 | 3300046558 | Bacteria | 905 |
| 696 | Ga0495667_0075923 | 3300046559 | Bacteria | 2186 |
| 697 | Ga0495667_0118424 | 3300046559 | Bacteria | 1710 |
| 698 | Ga0495667_0141940 | 3300046559 | Bacteria | 1547 |
| 699 | Ga0495656_0026298 | 3300046615 | Bacteria | 2316 |
| 700 | Ga0495668_0140594 | 3300046616 | Bacteria | 1321 |
| 701 | Ga0495668_0232388 | 3300046616 | Bacteria | 1010 |
| 702 | Ga0495625_0138384 | 3300046660 | Bacteria | 1644 |
| 703 | Ga0495625_0150178 | 3300046660 | Bacteria | 1567 |
| 704 | Ga0495635_0003655 | 3300046663 | Bacteria | 10669 |
| 705 | Ga0495661_0142722 | 3300046665 | Bacteria | 1301 |
| 706 | Ga0495661_0321456 | 3300046665 | Bacteria | 769 |
| 707 | Ga0495588_0024575 | 3300046674 | Bacteria | 2994 |
| 708 | Ga0495657_0010925 | 3300046675 | Bacteria | 6812 |
| 709 | Ga0495657_0361892 | 3300046675 | Bacteria | 857 |
| 710 | Ga0495599_0004038 | 3300046678 | Bacteria | 8639 |
| 711 | Ga0495599_0008515 | 3300046678 | Bacteria | 6240 |
| 712 | Ga0495599_0222184 | 3300046678 | Bacteria | 1155 |
| 713 | Ga0495623_0032867 | 3300046679 | Bacteria | 3332 |
| 714 | Ga0495623_0054800 | 3300046679 | Bacteria | 2515 |
| 715 | Ga0495623_0250544 | 3300046679 | Bacteria | 996 |
| 716 | Ga0495646_0019570 | 3300046680 | Bacteria | 4283 |
| 717 | Ga0495646_0064544 | 3300046680 | Bacteria | 2170 |
| 718 | Ga0495658_0069551 | 3300046683 | Bacteria | 2041 |
| 719 | Ga0495658_0472031 | 3300046683 | Bacteria | 802 |
| 720 | Ga0495613_0039815 | 3300046689 | Bacteria | 3483 |
| 721 | Ga0495613_0713501 | 3300046689 | Bacteria | 659 |
| 722 | Ga0495670_0008140 | 3300046691 | Bacteria | 5153 |
| 723 | Ga0495649_0143514 | 3300046694 | Bacteria | 1256 |
| 724 | Ga0495589_0164040 | 3300046794 | Bacteria | 1058 |
| 725 | Ga0495600_0090783 | 3300046809 | Bacteria | 1992 |
| 726 | Ga0495600_0188173 | 3300046809 | Bacteria | 1328 |
| 727 | Ga0495600_0464161 | 3300046809 | Bacteria | 782 |
| 728 | Ga0495581_0270178 | 3300047315 | Bacteria | 994 |
| 729 | Ga0495604_0076979 | 3300047317 | Bacteria | 2508 |
| 730 | Ga0495604_0077995 | 3300047317 | Bacteria | 2487 |
| 731 | Ga0495604_0142584 | 3300047317 | Bacteria | 1710 |
| 732 | Ga0495674_0045519 | 3300047319 | Bacteria | 3896 |
| 733 | Ga0495674_0083343 | 3300047319 | Bacteria | 2741 |
| 734 | Ga0495674_0447778 | 3300047319 | Bacteria | 1038 |
| 735 | Ga0495672_0025107 | 3300047320 | Bacteria | 3822 |
| 736 | Ga0495672_0052351 | 3300047320 | Bacteria | 2398 |
| 737 | Ga0495672_0273113 | 3300047320 | Bacteria | 811 |
| 738 | Ga0495680_0001058 | 3300047322 | Bacteria | 30479 |
| 739 | Ga0495680_0075816 | 3300047322 | Bacteria | 2551 |
| 740 | Ga0495675_0019629 | 3300047444 | Bacteria | 4293 |
| 741 | Ga0495675_0045612 | 3300047444 | Bacteria | 2791 |
| 742 | Ga0495685_138410 | 3300047447 | Bacteria | 794 |
| 743 | Ga0495673_0144152 | 3300047469 | Bacteria | 926 |
| 744 | Ga0495684_0009528 | 3300047471 | Bacteria | 7487 |
| 745 | Ga0495684_0089430 | 3300047471 | Bacteria | 2333 |
| 746 | Ga0495684_0097252 | 3300047471 | Bacteria | 2227 |
| 747 | Ga0495684_0518169 | 3300047471 | Bacteria | 817 |
| 748 | Ga0495686_0027319 | 3300047472 | Bacteria | 3728 |
| 749 | Ga0495686_0117128 | 3300047472 | Bacteria | 1592 |
| 750 | Ga0495686_0203178 | 3300047472 | Bacteria | 1136 |
| 751 | Ga0495686_0252232 | 3300047472 | Bacteria | 991 |
| 752 | Ga0495593_0009950 | 3300047673 | Bacteria | 5513 |
| 753 | Ga0495602_0033384 | 3300048088 | Bacteria | 4828 |
| 754 | Ga0495602_0073454 | 3300048088 | Bacteria | 2911 |
| 755 | Ga0495602_0117596 | 3300048088 | Bacteria | 2145 |
| 756 | Ga0495626_0234328 | 3300048091 | Bacteria | 741 |
| 757 | Ga0496100_0567242 | 3300048903 | Bacteria | 879 |
| 758 | Ga0496100_0640240 | 3300048903 | Bacteria | 827 |
| 759 | Ga0496101_0032337 | 3300048904 | Bacteria | 3682 |
| 760 | Ga0496101_0593743 | 3300048904 | Bacteria | 875 |
| 761 | Ga0496102_0010822 | 3300048905 | Bacteria | 7854 |
| 762 | Ga0496102_0027568 | 3300048905 | Bacteria | 5072 |
| 763 | Ga0496102_0128519 | 3300048905 | Bacteria | 2370 |
| 764 | Ga0496102_0243168 | 3300048905 | Bacteria | 1697 |
| 765 | Ga0496102_0798025 | 3300048905 | Bacteria | 866 |
| 766 | Ga0496103_0152319 | 3300048906 | Bacteria | 1481 |
| 767 | Ga0496103_0189649 | 3300048906 | Bacteria | 1322 |
| 768 | Ga0496103_0325757 | 3300048906 | Bacteria | 988 |
| 769 | Ga0496103_0355448 | 3300048906 | Bacteria | 942 |
| 770 | Ga0496104_0023058 | 3300048907 | Bacteria | 5720 |
| 771 | Ga0496104_0058026 | 3300048907 | Bacteria | 3663 |
| 772 | Ga0496104_0080689 | 3300048907 | Bacteria | 3102 |
| 773 | Ga0496104_0219268 | 3300048907 | Bacteria | 1814 |
| 774 | Ga0496105_0003256 | 3300048908 | Bacteria | 11964 |
| 775 | Ga0496105_0050230 | 3300048908 | Bacteria | 3445 |
| 776 | Ga0496105_0100928 | 3300048908 | Bacteria | 2383 |
| 777 | Ga0496105_0127573 | 3300048908 | Bacteria | 2097 |
| 778 | Ga0496106_0000590 | 3300048909 | Bacteria | 25948 |
| 779 | Ga0496106_0019427 | 3300048909 | Bacteria | 5039 |
| 780 | Ga0496106_0021369 | 3300048909 | Bacteria | 4806 |
| 781 | Ga0496107_0021351 | 3300048910 | Bacteria | 4576 |
| 782 | Ga0496107_0068714 | 3300048910 | Bacteria | 2571 |
| 783 | Ga0496108_0070106 | 3300048911 | Bacteria | 2958 |
| 784 | Ga0496108_0208148 | 3300048911 | Bacteria | 1698 |
| 785 | Ga0496109_0115275 | 3300048912 | Bacteria | 2500 |
| 786 | Ga0496109_0153408 | 3300048912 | Bacteria | 2157 |
| 787 | Ga0496109_0230326 | 3300048912 | Bacteria | 1743 |
| 788 | Ga0496109_0251566 | 3300048912 | Bacteria | 1664 |
| 789 | Ga0496109_0362814 | 3300048912 | Bacteria | 1369 |
| 790 | Ga0496110_0041874 | 3300048913 | Bacteria | 3998 |
| 791 | Ga0496110_0160405 | 3300048913 | Bacteria | 2038 |
| 792 | Ga0496110_0677798 | 3300048913 | Bacteria | 932 |
| 793 | Ga0496111_0012746 | 3300048914 | Bacteria | 5700 |
| 794 | Ga0496111_0063387 | 3300048914 | Bacteria | 2681 |
| 795 | Ga0496111_0405883 | 3300048914 | Bacteria | 1007 |
| 796 | Ga0496112_0108545 | 3300048915 | Bacteria | 2745 |
| 797 | Ga0496112_0173926 | 3300048915 | Bacteria | 2118 |
| 798 | Ga0496112_0180646 | 3300048915 | Bacteria | 2074 |
| 799 | Ga0496112_0202408 | 3300048915 | Bacteria | 1944 |
| 800 | Ga0496113_0022651 | 3300048916 | Bacteria | 4448 |
| 801 | Ga0496114_0361114 | 3300048917 | Bacteria | 1285 |
| 802 | Ga0496115_0006885 | 3300048918 | Bacteria | 8350 |
| 803 | Ga0496115_0126002 | 3300048918 | Bacteria | 2110 |
| 804 | Ga0496115_0140467 | 3300048918 | Bacteria | 1993 |
| 805 | Ga0496115_0409522 | 3300048918 | Bacteria | 1099 |
| 806 | Ga0496116_0002646 | 3300048919 | Bacteria | 18551 |
| 807 | Ga0496116_0039136 | 3300048919 | Bacteria | 3282 |
| 808 | Ga0496116_0112190 | 3300048919 | Bacteria | 1599 |
| 809 | Ga0496117_0038406 | 3300048920 | Bacteria | 3550 |
| 810 | Ga0496117_0084805 | 3300048920 | Bacteria | 2065 |
| 811 | Ga0496117_0181706 | 3300048920 | Bacteria | 1208 |
| 812 | Ga0496118_0006524 | 3300048921 | Bacteria | 12776 |
| 813 | Ga0496118_0044149 | 3300048921 | Bacteria | 3493 |
| 814 | Ga0496119_0043790 | 3300048922 | Bacteria | 2825 |
| 815 | Ga0496120_0051799 | 3300048923 | Bacteria | 2342 |
| 816 | Ga0496120_0088658 | 3300048923 | Bacteria | 1658 |
| 817 | Ga0496120_0096386 | 3300048923 | Bacteria | 1571 |
| 818 | Ga0496121_0000125 | 3300048924 | Bacteria | 169274 |
| 819 | Ga0496121_0001272 | 3300048924 | Bacteria | 43421 |
| 820 | Ga0496121_0008599 | 3300048924 | Bacteria | 11955 |
| 821 | Ga0496121_0076460 | 3300048924 | Bacteria | 2669 |
| 822 | Ga0496121_0143072 | 3300048924 | Bacteria | 1771 |
| 823 | Ga0496121_0210360 | 3300048924 | Bacteria | 1378 |
| 824 | Ga0496122_0056702 | 3300048925 | Bacteria | 2918 |
| 825 | Ga0496122_0142229 | 3300048925 | Bacteria | 1498 |
| 826 | Ga0496122_0277218 | 3300048925 | Bacteria | 919 |
| 827 | Ga0496123_0027721 | 3300048926 | Bacteria | 4212 |
| 828 | Ga0496123_0088597 | 3300048926 | Bacteria | 1847 |
| 829 | Ga0496123_0135646 | 3300048926 | Bacteria | 1355 |
| 830 | Ga0496124_0001012 | 3300048927 | Bacteria | 44554 |
| 831 | Ga0496124_0094473 | 3300048927 | Bacteria | 2432 |
| 832 | Ga0496124_0311498 | 3300048927 | Bacteria | 1132 |
| 833 | Ga0496124_0398720 | 3300048927 | Bacteria | 956 |
| 834 | Ga0496125_0001016 | 3300048928 | Bacteria | 43614 |
| 835 | Ga0496125_0008788 | 3300048928 | Bacteria | 10506 |
| 836 | Ga0496126_0003769 | 3300048929 | Bacteria | 18829 |
| 837 | Ga0496126_0012961 | 3300048929 | Bacteria | 8511 |
| 838 | Ga0496126_0022781 | 3300048929 | Bacteria | 6084 |
| 839 | Ga0496126_0027303 | 3300048929 | Bacteria | 5455 |
| 840 | Ga0496126_0029959 | 3300048929 | Bacteria | 5164 |
| 841 | Ga0496126_0032681 | 3300048929 | Bacteria | 4900 |
| 842 | Ga0496126_0061654 | 3300048929 | Bacteria | 3368 |
| 843 | Ga0496126_0078583 | 3300048929 | Bacteria | 2923 |
| 844 | Ga0496126_0081800 | 3300048929 | Bacteria | 2854 |
| 845 | Ga0496126_0085263 | 3300048929 | Bacteria | 2785 |
| 846 | Ga0496126_0170056 | 3300048929 | Bacteria | 1857 |
| 847 | Ga0496126_0259269 | 3300048929 | Bacteria | 1446 |
| 848 | Ga0496126_0265198 | 3300048929 | Bacteria | 1427 |
| 849 | Ga0496126_0402242 | 3300048929 | Bacteria | 1110 |
| 850 | Ga0496126_0556911 | 3300048929 | Bacteria | 909 |
| 851 | Ga0496126_0676223 | 3300048929 | Bacteria | 805 |
| 852 | Ga0496126_0786820 | 3300048929 | Bacteria | 731 |
| 853 | Ga0495682_0143113 | 3300049460 | Bacteria | 854 |
| 854 | Ga0501033_0117026 | 3300049570 | Bacteria | 1936 |
| 855 | Ga0501038_0706806 | 3300049574 | Bacteria | 755 |
| 856 | Ga0501039_0057355 | 3300049575 | Bacteria | 3016 |
| 857 | Ga0501041_0292468 | 3300049577 | Bacteria | 1026 |
| 858 | Ga0501042_0273844 | 3300049578 | Bacteria | 1219 |
| 859 | Ga0501046_0039535 | 3300049580 | Bacteria | 3777 |
| 860 | Ga0501046_0174727 | 3300049580 | Bacteria | 1609 |
| 861 | Ga0501047_0072069 | 3300049581 | Bacteria | 3325 |
| 862 | Ga0501048_0077515 | 3300049582 | Bacteria | 2346 |
| 863 | Ga0501070_0104112 | 3300049586 | Bacteria | 2347 |
| 864 | Ga0501071_0137284 | 3300049587 | Bacteria | 1820 |
| 865 | Ga0501072_0049809 | 3300049588 | Bacteria | 3298 |
| 866 | Ga0501073_0260568 | 3300049589 | Bacteria | 1197 |
| 867 | Ga0501075_0179208 | 3300049591 | Bacteria | 1617 |
| 868 | Ga0501076_0159958 | 3300049592 | Bacteria | 1834 |
| 869 | Ga0501077_0545093 | 3300049593 | Bacteria | 744 |
| 870 | Ga0501080_0072507 | 3300049742 | Bacteria | 3204 |
| 871 | Ga0501080_0242339 | 3300049742 | Bacteria | 1645 |
| 872 | Ga0501080_0364310 | 3300049742 | Bacteria | 1304 |
| 873 | Ga0501081_0559946 | 3300049743 | Bacteria | 854 |
| 874 | Ga0501044_0457937 | 3300049823 | Bacteria | 1181 |
| 875 | Ga0501045_0027388 | 3300049824 | Bacteria | 4107 |
| 876 | nmdc:mga03n38_16872_c1 | 3300050490 | Bacteria | 2849 |
| 877 | nmdc:mga00v17_42220_c1 | 3300050491 | Bacteria | 2742 |
| 878 | nmdc:mga00v17_54226_c1 | 3300050491 | Bacteria | 2445 |
| 879 | nmdc:mga0yw44_214191_c1 | 3300050492 | Bacteria | 1275 |
| 880 | nmdc:mga0yw44_242129_c1 | 3300050492 | Bacteria | 1199 |
| 881 | nmdc:mga0yw44_64875_c1 | 3300050492 | Bacteria | 2249 |
| 882 | nmdc:mga0yw44_92377_c1 | 3300050492 | Bacteria | 1915 |
| 883 | nmdc:mga0k408_171755_c1 | 3300050493 | Bacteria | 1292 |
| 884 | nmdc:mga06z11_12821_c1 | 3300050494 | Bacteria | 3657 |
| 885 | nmdc:mga04h51_20547_c1 | 3300050495 | Bacteria | 1973 |
| 886 | nmdc:mga07m45_146321_c1 | 3300050496 | Bacteria | 1370 |
| 887 | nmdc:mga07m45_200702_c1 | 3300050496 | Bacteria | 1160 |
| 888 | nmdc:mga05p37_140395_c2 | 3300050507 | Bacteria | 2131 |
| 889 | nmdc:mga05p37_387592_c1 | 3300050507 | Bacteria | 1635 |
| 890 | nmdc:mga06r32_869395_c1 | 3300050510 | Bacteria | 859 |
| 891 | nmdc:mga08y16_247761_c1 | 3300050511 | Bacteria | 1841 |
| 892 | nmdc:mga08y16_279_c1 | 3300050511 | Bacteria | 46569 |
| 893 | nmdc:mga08y16_72636_c1 | 3300050511 | Bacteria | 3585 |
| 894 | nmdc:mga0n895_12272_c1 | 3300050512 | Bacteria | 7679 |
| 895 | nmdc:mga0n895_289223_c1 | 3300050512 | Bacteria | 1662 |
| 896 | nmdc:mga0n895_49730_c1 | 3300050512 | Bacteria | 4109 |
| 897 | nmdc:mga0rr50_258019_c1 | 3300050513 | Bacteria | 1450 |
| 898 | nmdc:mga0rr50_3590_c1 | 3300050513 | Bacteria | 8967 |
| 899 | nmdc:mga08x19_241078_c1 | 3300050514 | Bacteria | 1246 |
| 900 | nmdc:mga0a205_25005_c1 | 3300050515 | Bacteria | 5685 |
| 901 | nmdc:mga0a205_62216_c3 | 3300050515 | Bacteria | 2157 |
| 902 | nmdc:mga0a205_671334_c1 | 3300050515 | Bacteria | 887 |
| 903 | nmdc:mga0sz30_188296_c1 | 3300050516 | Bacteria | 916 |
| 904 | Ga0495601_0034790 | 3300053077 | Bacteria | 3143 |
| 905 | Ga0495601_0049041 | 3300053077 | Bacteria | 2661 |
| 906 | Ga0495601_0210260 | 3300053077 | Bacteria | 1271 |
| 907 | Ga0495612_0052290 | 3300053078 | Bacteria | 1680 |
| 908 | Ga0495612_0073744 | 3300053078 | Bacteria | 1426 |
| 909 | Ga0500635_0002719 | 3300053080 | Bacteria | 4389 |
| 910 | Ga0495595_0025394 | 3300053084 | Bacteria | 2625 |
| 911 | Ga0495619_0020514 | 3300053085 | Bacteria | 4210 |
| 912 | Ga0495619_0023185 | 3300053085 | Bacteria | 3977 |
| 913 | Ga0495619_0509436 | 3300053085 | Bacteria | 827 |
| 914 | Ga0500578_0035459 | 3300053086 | Bacteria | 3205 |
| 915 | Ga0500578_0056796 | 3300053086 | Bacteria | 2503 |
| 916 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 917 | Ga0500643_025224 | 3300053087 | Bacteria | 1878 |
| 918 | Ga0500651_0164309 | 3300053093 | Bacteria | 1326 |
| 919 | Ga0500566_0000329 | 3300053094 | Bacteria | 25790 |
| 920 | Ga0500566_0084133 | 3300053094 | Bacteria | 1766 |
| 921 | Ga0500566_0141646 | 3300053094 | Bacteria | 1275 |
| 922 | Ga0500641_0003878 | 3300053096 | Bacteria | 5284 |
| 923 | Ga0500641_0021761 | 3300053096 | Bacteria | 2449 |
| 924 | Ga0500650_0000589 | 3300053098 | Bacteria | 9417 |
| 925 | Ga0500554_011172 | 3300053102 | Bacteria | 2215 |
| 926 | Ga0500556_0000238 | 3300053104 | Bacteria | 44627 |
| 927 | Ga0500556_0127841 | 3300053104 | Bacteria | 994 |
| 928 | Ga0500562_010221 | 3300053108 | Bacteria | 2376 |
| 929 | Ga0500572_031194 | 3300053111 | Bacteria | 1487 |
| 930 | Ga0500592_000637 | 3300053116 | Bacteria | 5743 |
| 931 | Ga0500593_001238 | 3300053117 | Bacteria | 9242 |
| 932 | Ga0500594_0027947 | 3300053118 | Bacteria | 1464 |
| 933 | Ga0500595_002526 | 3300053119 | Bacteria | 9002 |
| 934 | Ga0500595_002841 | 3300053119 | Bacteria | 8317 |
| 935 | Ga0500607_027031 | 3300053121 | Bacteria | 3186 |
| 936 | Ga0500608_095611 | 3300053122 | Bacteria | 1382 |
| 937 | Ga0500642_0000108 | 3300053130 | Bacteria | 40058 |
| 938 | Ga0500642_0049086 | 3300053130 | Bacteria | 1856 |
| 939 | Ga0500652_002951 | 3300053131 | Bacteria | 5124 |
| 940 | Ga0500658_0042410 | 3300053134 | Bacteria | 1828 |
| 941 | Ga0500658_0057738 | 3300053134 | Bacteria | 1605 |
| 942 | Ga0500559_0000839 | 3300053136 | Bacteria | 19888 |
| 943 | Ga0500559_0006971 | 3300053136 | Bacteria | 5052 |
| 944 | Ga0500559_0195659 | 3300053136 | Bacteria | 953 |
| 945 | Ga0500564_024677 | 3300053138 | Bacteria | 2760 |
| 946 | Ga0500568_0011393 | 3300053139 | Bacteria | 4131 |
| 947 | Ga0500568_0018904 | 3300053139 | Bacteria | 3006 |
| 948 | Ga0500568_0021247 | 3300053139 | Bacteria | 2795 |
| 949 | Ga0500586_001118 | 3300053145 | Bacteria | 5546 |
| 950 | Ga0500588_0076625 | 3300053146 | Bacteria | 1109 |
| 951 | Ga0500590_044585 | 3300053148 | Bacteria | 2272 |
| 952 | Ga0500590_059453 | 3300053148 | Bacteria | 1923 |
| 953 | Ga0500603_000622 | 3300053150 | Bacteria | 8735 |
| 954 | Ga0500603_152853 | 3300053150 | Bacteria | 716 |
| 955 | Ga0500604_0004045 | 3300053151 | Bacteria | 3907 |
| 956 | Ga0500604_0054951 | 3300053151 | Bacteria | 1237 |
| 957 | Ga0500604_0055446 | 3300053151 | Bacteria | 1233 |
| 958 | Ga0500616_0000197 | 3300053153 | Bacteria | 98372 |
| 959 | Ga0500616_0006713 | 3300053153 | Bacteria | 7470 |
| 960 | Ga0500616_0035875 | 3300053153 | Bacteria | 2694 |
| 961 | Ga0500619_020679 | 3300053154 | Bacteria | 1885 |
| 962 | Ga0500622_0002972 | 3300053156 | Bacteria | 11750 |
| 963 | Ga0500622_0060366 | 3300053156 | Bacteria | 1934 |
| 964 | Ga0500627_0049036 | 3300053158 | Bacteria | 1836 |
| 965 | Ga0500636_0000390 | 3300053177 | Bacteria | 24204 |
| 966 | Ga0500636_0002715 | 3300053177 | Bacteria | 9842 |
| 967 | Ga0500637_0026031 | 3300053178 | Bacteria | 3220 |
| 968 | Ga0500637_0036800 | 3300053178 | Bacteria | 2748 |
| 969 | Ga0500570_119848 | 3300053724 | Bacteria | 1037 |
| 970 | Ga0500645_035466 | 3300053730 | Bacteria | 1486 |
| 971 | Ga0500552_036996 | 3300053733 | Bacteria | 779 |
| 972 | Ga0500596_003929 | 3300053735 | Bacteria | 2777 |
| 973 | Ga0500599_003770 | 3300053736 | Bacteria | 1859 |
| 974 | Ga0501084_0771424 | 3300054114 | Bacteria | 810 |
| 975 | Ga0500661_046636 | 3300055283 | Bacteria | 771 |
| 976 | Ga0590075_009648 | 3300059424 | Bacteria | 2316 |
| 977 | Ga0590077_016095 | 3300059426 | Bacteria | 1567 |
| 978 | Ga0501082_0069839 | 3300060353 | Bacteria | 3025 |
| 979 | Ga0466962_0078375 | 3300061719 | Bacteria | 1579 |
| 980 | Ga0530510_0075038 | 3300061734 | Bacteria | 2456 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10212506 | Ga0157374_102125061 | 153 |
| 2 | 3300039438 | Ga0436360_0330088 | Ga0436360_0330088_586_1200 | 162 |
| 3 | 3300048928 | Ga0496125_0001016 | Ga0496125_0001016_39202_39819 | 163 |
| 4 | 3300048929 | Ga0496126_0676223 | Ga0496126_0676223_16_567 | 165 |
| 5 | 3300035691 | Ga0373931_0550711 | Ga0373931_0550711_13_555 | 166 |
| 6 | 3300009094 | Ga0111539_10725138 | Ga0111539_107251382 | 167 |
| 7 | 3300046542 | Ga0495597_0315452 | Ga0495597_0315452_17_568 | 170 |
| 8 | 3300050511 | nmdc:mga08y16_72636_c1 | nmdc:mga08y16_72636_c1_19_570 | 170 |
| 9 | 3300041512 | Ga0451853_1426409 | Ga0451853_1426409_18_569 | 171 |
| 10 | 3300035692 | Ga0373935_0493932 | Ga0373935_0493932_298_870 | 176 |
| 11 | 3300021358 | Ga0213873_10056117 | Ga0213873_100561172 | 178 |
| 12 | 3300021384 | Ga0213876_10004130 | Ga0213876_100041306 | 178 |
| 13 | 3300021384 | Ga0213876_10244026 | Ga0213876_102440262 | 178 |
| 14 | 3300031649 | Ga0307514_10401300 | Ga0307514_104013001 | 178 |
| 15 | 3300039437 | Ga0436365_0232459 | Ga0436365_0232459_9092_9709 | 178 |
| 16 | 3300039437 | Ga0436365_0776846 | Ga0436365_0776846_717_1337 | 178 |
| 17 | 3300039450 | Ga0436363_0771534 | Ga0436363_0771534_512_1129 | 178 |
| 18 | 3300039453 | Ga0436362_0394184 | Ga0436362_0394184_19_636 | 178 |
| 19 | 3300005436 | Ga0070713_100886146 | Ga0070713_1008861461 | 179 |
| 20 | 3300005437 | Ga0070710_10076409 | Ga0070710_100764093 | 179 |
| 21 | 3300006163 | Ga0070715_10065718 | Ga0070715_100657182 | 179 |
| 22 | 3300006173 | Ga0070716_100063132 | Ga0070716_1000631322 | 179 |
| 23 | 3300006175 | Ga0070712_100225106 | Ga0070712_1002251061 | 179 |
| 24 | 3300025906 | Ga0207699_10412559 | Ga0207699_104125591 | 179 |
| 25 | 3300025915 | Ga0207693_10002055 | Ga0207693_1000205511 | 179 |
| 26 | 3300025929 | Ga0207664_10680448 | Ga0207664_106804481 | 179 |
| 27 | 3300025939 | Ga0207665_10023354 | Ga0207665_100233543 | 179 |
| 28 | 3300039437 | Ga0436365_0577077 | Ga0436365_0577077_618_1235 | 179 |
| 29 | 3300039437 | Ga0436365_1062598 | Ga0436365_1062598_585_1238 | 179 |
| 30 | 3300048929 | Ga0496126_0556911 | Ga0496126_0556911_129_746 | 179 |
| 31 | 3300025940 | Ga0207691_10323236 | Ga0207691_103232362 | 180 |
| 32 | 3300005434 | Ga0070709_10001810 | Ga0070709_1000181015 | 181 |
| 33 | 3300005435 | Ga0070714_100000739 | Ga0070714_10000073921 | 181 |
| 34 | 3300005437 | Ga0070710_10015076 | Ga0070710_100150762 | 181 |
| 35 | 3300005439 | Ga0070711_100001343 | Ga0070711_1000013432 | 181 |
| 36 | 3300005539 | Ga0068853_100099598 | Ga0068853_1000995982 | 181 |
| 37 | 3300006028 | Ga0070717_10745229 | Ga0070717_107452291 | 181 |
| 38 | 3300006163 | Ga0070715_10000259 | Ga0070715_100002599 | 181 |
| 39 | 3300006173 | Ga0070716_100082549 | Ga0070716_1000825491 | 181 |
| 40 | 3300009553 | Ga0105249_10359346 | Ga0105249_103593462 | 181 |
| 41 | 3300013104 | Ga0157370_10376148 | Ga0157370_103761482 | 181 |
| 42 | 3300013105 | Ga0157369_10008826 | Ga0157369_100088264 | 181 |
| 43 | 3300025904 | Ga0207647_10088462 | Ga0207647_100884622 | 181 |
| 44 | 3300025905 | Ga0207685_10246065 | Ga0207685_102460651 | 181 |
| 45 | 3300025906 | Ga0207699_10184785 | Ga0207699_101847852 | 181 |
| 46 | 3300025914 | Ga0207671_10693079 | Ga0207671_106930792 | 181 |
| 47 | 3300025915 | Ga0207693_10017696 | Ga0207693_100176962 | 181 |
| 48 | 3300025916 | Ga0207663_10000268 | Ga0207663_100002688 | 181 |
| 49 | 3300025928 | Ga0207700_10098776 | Ga0207700_100987762 | 181 |
| 50 | 3300025929 | Ga0207664_10015168 | Ga0207664_100151683 | 181 |
| 51 | 3300025939 | Ga0207665_10005120 | Ga0207665_100051209 | 181 |
| 52 | 3300026142 | Ga0207698_10666618 | Ga0207698_106666182 | 181 |
| 53 | 3300037466 | Ga0395898_0958390 | Ga0395898_0958390_76_693 | 181 |
| 54 | 3300005329 | Ga0070683_100743556 | Ga0070683_1007435561 | 182 |
| 55 | 3300005334 | Ga0068869_100072632 | Ga0068869_1000726324 | 182 |
| 56 | 3300005338 | Ga0068868_100135706 | Ga0068868_1001357063 | 182 |
| 57 | 3300005456 | Ga0070678_100084853 | Ga0070678_1000848533 | 182 |
| 58 | 3300005564 | Ga0070664_100804585 | Ga0070664_1008045852 | 182 |
| 59 | 3300005618 | Ga0068864_100187641 | Ga0068864_1001876413 | 182 |
| 60 | 3300006237 | Ga0097621_100276798 | Ga0097621_1002767982 | 182 |
| 61 | 3300009551 | Ga0105238_10330753 | Ga0105238_103307533 | 182 |
| 62 | 3300010375 | Ga0105239_10034860 | Ga0105239_100348604 | 182 |
| 63 | 3300011119 | Ga0105246_10052887 | Ga0105246_100528874 | 182 |
| 64 | 3300013308 | Ga0157375_10079107 | Ga0157375_100791074 | 182 |
| 65 | 3300013308 | Ga0157375_11141754 | Ga0157375_111417541 | 182 |
| 66 | 3300014969 | Ga0157376_10063001 | Ga0157376_100630013 | 182 |
| 67 | 3300017792 | Ga0163161_10203406 | Ga0163161_102034062 | 182 |
| 68 | 3300025900 | Ga0207710_10153151 | Ga0207710_101531512 | 182 |
| 69 | 3300025945 | Ga0207679_10899390 | Ga0207679_108993901 | 182 |
| 70 | 3300025960 | Ga0207651_10320869 | Ga0207651_103208693 | 182 |
| 71 | 3300026023 | Ga0207677_10006386 | Ga0207677_100063862 | 182 |
| 72 | 3300026067 | Ga0207678_10114338 | Ga0207678_101143384 | 182 |
| 73 | 3300026121 | Ga0207683_10005742 | Ga0207683_100057423 | 182 |
| 74 | 3300026142 | Ga0207698_10179454 | Ga0207698_101794541 | 182 |
| 75 | 3300030521 | Ga0307511_10077257 | Ga0307511_100772572 | 182 |
| 76 | 3300031507 | Ga0307509_10031336 | Ga0307509_100313367 | 182 |
| 77 | 3300031616 | Ga0307508_10264664 | Ga0307508_102646642 | 182 |
| 78 | 3300031730 | Ga0307516_10004746 | Ga0307516_1000474614 | 182 |
| 79 | 3300033179 | Ga0307507_10034314 | Ga0307507_100343143 | 182 |
| 80 | 3300035083 | Ga0373926_0053706 | Ga0373926_0053706_68_685 | 182 |
| 81 | 3300035116 | Ga0373945_0335011 | Ga0373945_0335011_14_631 | 182 |
| 82 | 3300035695 | Ga0373927_0022900 | Ga0373927_0022900_3070_3687 | 182 |
| 83 | 3300035725 | Ga0373947_0093784 | Ga0373947_0093784_801_1418 | 182 |
| 84 | 3300046475 | Ga0495639_0127713 | Ga0495639_0127713_64_720 | 182 |
| 85 | 3300046533 | Ga0495640_0320815 | Ga0495640_0320815_262_879 | 182 |
| 86 | 3300046557 | Ga0495622_0127254 | Ga0495622_0127254_96_713 | 182 |
| 87 | 3300046683 | Ga0495658_0069551 | Ga0495658_0069551_658_1314 | 182 |
| 88 | 3300048904 | Ga0496101_0032337 | Ga0496101_0032337_1575_2192 | 182 |
| 89 | 3300048905 | Ga0496102_0010822 | Ga0496102_0010822_5033_5650 | 182 |
| 90 | 3300048906 | Ga0496103_0325757 | Ga0496103_0325757_41_658 | 182 |
| 91 | 3300048908 | Ga0496105_0127573 | Ga0496105_0127573_481_1098 | 182 |
| 92 | 3300048909 | Ga0496106_0000590 | Ga0496106_0000590_20659_21276 | 182 |
| 93 | 3300048909 | Ga0496106_0019427 | Ga0496106_0019427_3413_4030 | 182 |
| 94 | 3300048910 | Ga0496107_0021351 | Ga0496107_0021351_3930_4547 | 182 |
| 95 | 3300048911 | Ga0496108_0070106 | Ga0496108_0070106_413_1030 | 182 |
| 96 | 3300048911 | Ga0496108_0208148 | Ga0496108_0208148_730_1347 | 182 |
| 97 | 3300048912 | Ga0496109_0153408 | Ga0496109_0153408_642_1259 | 182 |
| 98 | 3300048914 | Ga0496111_0012746 | Ga0496111_0012746_3418_4035 | 182 |
| 99 | 3300048915 | Ga0496112_0202408 | Ga0496112_0202408_700_1317 | 182 |
| 100 | 3300048916 | Ga0496113_0022651 | Ga0496113_0022651_68_685 | 182 |
| 101 | 3300048918 | Ga0496115_0006885 | Ga0496115_0006885_3316_3933 | 182 |
| 102 | 3300048920 | Ga0496117_0038406 | Ga0496117_0038406_60_677 | 182 |
| 103 | 3300048921 | Ga0496118_0006524 | Ga0496118_0006524_11328_11945 | 182 |
| 104 | 3300048924 | Ga0496121_0001272 | Ga0496121_0001272_19671_20288 | 182 |
| 105 | 3300048927 | Ga0496124_0001012 | Ga0496124_0001012_7835_8452 | 182 |
| 106 | 3300048929 | Ga0496126_0022781 | Ga0496126_0022781_2239_2856 | 182 |
| 107 | 3300053094 | Ga0500566_0084133 | Ga0500566_0084133_127_783 | 182 |
| 108 | 3300053094 | Ga0500566_0141646 | Ga0500566_0141646_417_1034 | 182 |
| 109 | 3300053119 | Ga0500595_002841 | Ga0500595_002841_3009_3665 | 182 |
| 110 | 3300053136 | Ga0500559_0195659 | Ga0500559_0195659_127_744 | 182 |
| 111 | 3300053148 | Ga0500590_044585 | Ga0500590_044585_245_862 | 182 |
| 112 | 3300053150 | Ga0500603_152853 | Ga0500603_152853_78_695 | 182 |
| 113 | 3300053178 | Ga0500637_0026031 | Ga0500637_0026031_270_926 | 182 |
| 114 | 3300053733 | Ga0500552_036996 | Ga0500552_036996_98_715 | 182 |
| 115 | 3300053735 | Ga0500596_003929 | Ga0500596_003929_151_768 | 182 |
| 116 | 3300005841 | Ga0068863_100247303 | Ga0068863_1002473032 | 183 |
| 117 | 3300006237 | Ga0097621_100528133 | Ga0097621_1005281332 | 183 |
| 118 | 3300013307 | Ga0157372_11331699 | Ga0157372_113316992 | 183 |
| 119 | 3300026088 | Ga0207641_11027634 | Ga0207641_110276341 | 183 |
| 120 | 3300037418 | Ga0395900_0030083 | Ga0395900_0030083_823_1446 | 183 |
| 121 | 3300038443 | Ga0395901_0080688 | Ga0395901_0080688_2639_3262 | 183 |
| 122 | 3300048918 | Ga0496115_0126002 | Ga0496115_0126002_160_774 | 183 |
| 123 | 3300048929 | Ga0496126_0081800 | Ga0496126_0081800_2004_2618 | 183 |
| 124 | 3300025941 | Ga0207711_11083088 | Ga0207711_110830881 | 184 |
| 125 | 3300005434 | Ga0070709_10169753 | Ga0070709_101697531 | 185 |
| 126 | 3300005435 | Ga0070714_100250094 | Ga0070714_1002500942 | 185 |
| 127 | 3300005435 | Ga0070714_100674821 | Ga0070714_1006748212 | 185 |
| 128 | 3300006028 | Ga0070717_10036927 | Ga0070717_100369273 | 185 |
| 129 | 3300006914 | Ga0075436_100252916 | Ga0075436_1002529162 | 185 |
| 130 | 3300025906 | Ga0207699_10487129 | Ga0207699_104871291 | 185 |
| 131 | 3300025914 | Ga0207671_10422732 | Ga0207671_104227322 | 185 |
| 132 | 3300025928 | Ga0207700_10040532 | Ga0207700_100405324 | 185 |
| 133 | 3300025929 | Ga0207664_10232462 | Ga0207664_102324621 | 185 |
| 134 | 3300031456 | Ga0307513_10391228 | Ga0307513_103912281 | 185 |
| 135 | 3300037466 | Ga0395898_0102724 | Ga0395898_0102724_1200_1844 | 185 |
| 136 | 3300048929 | Ga0496126_0170056 | Ga0496126_0170056_661_1278 | 185 |
| 137 | 3300050514 | nmdc:mga08x19_241078_c1 | nmdc:mga08x19_241078_c1_214_858 | 185 |
| 138 | iso_pu_bacteria | 2889033259 | 2889036730 | 185 |
| 139 | 3300005337 | Ga0070682_100287131 | Ga0070682_1002871312 | 186 |
| 140 | 3300005547 | Ga0070693_100064160 | Ga0070693_1000641603 | 186 |
| 141 | 3300009545 | Ga0105237_11226030 | Ga0105237_112260302 | 186 |
| 142 | 3300025915 | Ga0207693_10319737 | Ga0207693_103197372 | 186 |
| 143 | 3300025920 | Ga0207649_10048682 | Ga0207649_100486823 | 186 |
| 144 | 3300025921 | Ga0207652_10688550 | Ga0207652_106885502 | 186 |
| 145 | 3300025928 | Ga0207700_10029573 | Ga0207700_100295735 | 186 |
| 146 | 3300025945 | Ga0207679_10348087 | Ga0207679_103480871 | 186 |
| 147 | 3300026067 | Ga0207678_10066250 | Ga0207678_100662503 | 186 |
| 148 | 3300037853 | Ga0436364_1241072 | Ga0436364_1241072_1557_2171 | 186 |
| 149 | iso_pu_bacteria | 2844533157 | 2844537021 | 186 |
| 150 | 3300005614 | Ga0068856_100010975 | Ga0068856_1000109752 | 187 |
| 151 | 3300007788 | Ga0099795_10050225 | Ga0099795_100502252 | 187 |
| 152 | 3300009093 | Ga0105240_10515571 | Ga0105240_105155711 | 187 |
| 153 | 3300010159 | Ga0099796_10153151 | Ga0099796_101531511 | 187 |
| 154 | 3300025297 | Ga0209758_1002619 | Ga0209758_100261913 | 187 |
| 155 | 3300026078 | Ga0207702_10008332 | Ga0207702_100083321 | 187 |
| 156 | 3300031711 | Ga0265314_10006103 | Ga0265314_100061039 | 187 |
| 157 | 3300031712 | Ga0265342_10022338 | Ga0265342_100223383 | 187 |
| 158 | 3300044719 | Ga0466971_0120924 | Ga0466971_0120924_80_703 | 187 |
| 159 | 3300046675 | Ga0495657_0361892 | Ga0495657_0361892_84_701 | 187 |
| 160 | 3300047320 | Ga0495672_0052351 | Ga0495672_0052351_933_1550 | 187 |
| 161 | 3300061719 | Ga0466962_0078375 | Ga0466962_0078375_193_816 | 187 |
| 162 | 3300006173 | Ga0070716_100023117 | Ga0070716_1000231172 | 188 |
| 163 | 3300010159 | Ga0099796_10008400 | Ga0099796_100084003 | 188 |
| 164 | 3300025939 | Ga0207665_10153462 | Ga0207665_101534622 | 188 |
| 165 | 3300027512 | Ga0209179_1038004 | Ga0209179_10380041 | 188 |
| 166 | 3300035692 | Ga0373935_0083861 | Ga0373935_0083861_1184_1801 | 188 |
| 167 | 3300035695 | Ga0373927_0029664 | Ga0373927_0029664_2389_3006 | 188 |
| 168 | 3300035725 | Ga0373947_0005065 | Ga0373947_0005065_2620_3237 | 188 |
| 169 | 3300037068 | Ga0373925_0052881 | Ga0373925_0052881_52_669 | 188 |
| 170 | 3300005354 | Ga0070675_100822117 | Ga0070675_1008221171 | 189 |
| 171 | 3300005437 | Ga0070710_10145812 | Ga0070710_101458122 | 189 |
| 172 | 3300005543 | Ga0070672_100175704 | Ga0070672_1001757042 | 189 |
| 173 | 3300005616 | Ga0068852_100060857 | Ga0068852_1000608573 | 189 |
| 174 | 3300006175 | Ga0070712_100295579 | Ga0070712_1002955792 | 189 |
| 175 | 3300006852 | Ga0075433_10164951 | Ga0075433_101649513 | 189 |
| 176 | 3300006914 | Ga0075436_100061935 | Ga0075436_1000619353 | 189 |
| 177 | 3300007076 | Ga0075435_100115462 | Ga0075435_1001154622 | 189 |
| 178 | 3300025898 | Ga0207692_10273505 | Ga0207692_102735051 | 189 |
| 179 | 3300025915 | Ga0207693_10353540 | Ga0207693_103535402 | 189 |
| 180 | 3300025940 | Ga0207691_10132406 | Ga0207691_101324061 | 189 |
| 181 | 3300035695 | Ga0373927_0193761 | Ga0373927_0193761_41_652 | 189 |
| 182 | 3300045051 | Ga0451576_0934075 | Ga0451576_0934075_97_708 | 189 |
| 183 | 3300050512 | nmdc:mga0n895_289223_c1 | nmdc:mga0n895_289223_c1_758_1369 | 189 |
| 184 | 3300050513 | nmdc:mga0rr50_258019_c1 | nmdc:mga0rr50_258019_c1_515_1126 | 189 |
| 185 | 3300050515 | nmdc:mga0a205_25005_c1 | nmdc:mga0a205_25005_c1_1058_1669 | 189 |
| 186 | 3300003187 | JGI25151J46595_10000212 | JGI25151J46595_1000021225 | 190 |
| 187 | 3300003215 | JGI25153J46596_10044984 | JGI25153J46596_100449841 | 190 |
| 188 | 3300003354 | JGI25160J50197_1004779 | JGI25160J50197_10047795 | 190 |
| 189 | 3300005335 | Ga0070666_10168944 | Ga0070666_101689442 | 190 |
| 190 | 3300005338 | Ga0068868_100017949 | Ga0068868_1000179496 | 190 |
| 191 | 3300005353 | Ga0070669_100230463 | Ga0070669_1002304631 | 190 |
| 192 | 3300005356 | Ga0070674_100166175 | Ga0070674_1001661752 | 190 |
| 193 | 3300005364 | Ga0070673_100039832 | Ga0070673_1000398323 | 190 |
| 194 | 3300005364 | Ga0070673_100210296 | Ga0070673_1002102963 | 190 |
| 195 | 3300005439 | Ga0070711_100098736 | Ga0070711_1000987362 | 190 |
| 196 | 3300005441 | Ga0070700_100227305 | Ga0070700_1002273051 | 190 |
| 197 | 3300005544 | Ga0070686_100520757 | Ga0070686_1005207572 | 190 |
| 198 | 3300005563 | Ga0068855_100884991 | Ga0068855_1008849912 | 190 |
| 199 | 3300005618 | Ga0068864_100023044 | Ga0068864_1000230444 | 190 |
| 200 | 3300005719 | Ga0068861_100126036 | Ga0068861_1001260363 | 190 |
| 201 | 3300005719 | Ga0068861_100375327 | Ga0068861_1003753271 | 190 |
| 202 | 3300005843 | Ga0068860_100437853 | Ga0068860_1004378532 | 190 |
| 203 | 3300005981 | Ga0081538_10013960 | Ga0081538_100139601 | 190 |
| 204 | 3300005981 | Ga0081538_10057728 | Ga0081538_100577282 | 190 |
| 205 | 3300006237 | Ga0097621_100025887 | Ga0097621_1000258873 | 190 |
| 206 | 3300006844 | Ga0075428_100395782 | Ga0075428_1003957822 | 190 |
| 207 | 3300006852 | Ga0075433_10173278 | Ga0075433_101732783 | 190 |
| 208 | 3300006852 | Ga0075433_10608976 | Ga0075433_106089762 | 190 |
| 209 | 3300006871 | Ga0075434_100000032 | Ga0075434_1000000328 | 190 |
| 210 | 3300006881 | Ga0068865_100036018 | Ga0068865_1000360182 | 190 |
| 211 | 3300009094 | Ga0111539_10000041 | Ga0111539_1000004164 | 190 |
| 212 | 3300009094 | Ga0111539_10321914 | Ga0111539_103219142 | 190 |
| 213 | 3300009098 | Ga0105245_10003142 | Ga0105245_1000314210 | 190 |
| 214 | 3300009101 | Ga0105247_10173827 | Ga0105247_101738272 | 190 |
| 215 | 3300009147 | Ga0114129_10367988 | Ga0114129_103679883 | 190 |
| 216 | 3300009147 | Ga0114129_10613486 | Ga0114129_106134861 | 190 |
| 217 | 3300009177 | Ga0105248_10358079 | Ga0105248_103580793 | 190 |
| 218 | 3300013308 | Ga0157375_11923246 | Ga0157375_119232461 | 190 |
| 219 | 3300014326 | Ga0157380_10014539 | Ga0157380_100145396 | 190 |
| 220 | 3300014326 | Ga0157380_11036227 | Ga0157380_110362271 | 190 |
| 221 | 3300025284 | Ga0209130_1000804 | Ga0209130_10008044 | 190 |
| 222 | 3300025294 | Ga0209025_1000779 | Ga0209025_100077926 | 190 |
| 223 | 3300025294 | Ga0209025_1088134 | Ga0209025_10881342 | 190 |
| 224 | 3300025297 | Ga0209758_1004105 | Ga0209758_10041056 | 190 |
| 225 | 3300025302 | Ga0207426_1000066 | Ga0207426_1000066142 | 190 |
| 226 | 3300025900 | Ga0207710_10118987 | Ga0207710_101189872 | 190 |
| 227 | 3300025903 | Ga0207680_10213777 | Ga0207680_102137772 | 190 |
| 228 | 3300025917 | Ga0207660_10156422 | Ga0207660_101564222 | 190 |
| 229 | 3300025918 | Ga0207662_10025844 | Ga0207662_100258443 | 190 |
| 230 | 3300025923 | Ga0207681_10187774 | Ga0207681_101877742 | 190 |
| 231 | 3300025927 | Ga0207687_10013783 | Ga0207687_100137832 | 190 |
| 232 | 3300025937 | Ga0207669_10193825 | Ga0207669_101938251 | 190 |
| 233 | 3300025939 | Ga0207665_10254616 | Ga0207665_102546161 | 190 |
| 234 | 3300025960 | Ga0207651_10176473 | Ga0207651_101764732 | 190 |
| 235 | 3300025960 | Ga0207651_10354753 | Ga0207651_103547532 | 190 |
| 236 | 3300026023 | Ga0207677_10397371 | Ga0207677_103973712 | 190 |
| 237 | 3300026075 | Ga0207708_10323893 | Ga0207708_103238932 | 190 |
| 238 | 3300026095 | Ga0207676_10418626 | Ga0207676_104186262 | 190 |
| 239 | 3300026118 | Ga0207675_100436573 | Ga0207675_1004365731 | 190 |
| 240 | 3300027907 | Ga0207428_10038011 | Ga0207428_100380112 | 190 |
| 241 | 3300027907 | Ga0207428_10524136 | Ga0207428_105241361 | 190 |
| 242 | 3300028381 | Ga0268264_10400618 | Ga0268264_104006182 | 190 |
| 243 | 3300031238 | Ga0265332_10001366 | Ga0265332_100013662 | 190 |
| 244 | 3300031242 | Ga0265329_10040123 | Ga0265329_100401231 | 190 |
| 245 | 3300031247 | Ga0265340_10014446 | Ga0265340_100144465 | 190 |
| 246 | 3300031249 | Ga0265339_10065967 | Ga0265339_100659673 | 190 |
| 247 | 3300031250 | Ga0265331_10045552 | Ga0265331_100455523 | 190 |
| 248 | 3300031548 | Ga0307408_100527841 | Ga0307408_1005278411 | 190 |
| 249 | 3300031711 | Ga0265314_10068081 | Ga0265314_100680811 | 190 |
| 250 | 3300031712 | Ga0265342_10000093 | Ga0265342_100000932 | 190 |
| 251 | 3300031824 | Ga0307413_10032229 | Ga0307413_100322291 | 190 |
| 252 | 3300031852 | Ga0307410_10094860 | Ga0307410_100948604 | 190 |
| 253 | 3300031903 | Ga0307407_10095969 | Ga0307407_100959692 | 190 |
| 254 | 3300031995 | Ga0307409_100003189 | Ga0307409_1000031899 | 190 |
| 255 | 3300032002 | Ga0307416_100014520 | Ga0307416_1000145202 | 190 |
| 256 | 3300032002 | Ga0307416_100080816 | Ga0307416_1000808162 | 190 |
| 257 | 3300032126 | Ga0307415_100358692 | Ga0307415_1003586921 | 190 |
| 258 | 3300035170 | Ga0373943_0061942 | Ga0373943_0061942_648_1277 | 190 |
| 259 | 3300041997 | Ga0439431_0031868 | Ga0439431_0031868_165_773 | 190 |
| 260 | 3300044901 | Ga0466960_0284354 | Ga0466960_0284354_101_712 | 190 |
| 261 | 3300046472 | Ga0495580_0360360 | Ga0495580_0360360_318_947 | 190 |
| 262 | 3300049570 | Ga0501033_0117026 | Ga0501033_0117026_230_844 | 190 |
| 263 | 3300049575 | Ga0501039_0057355 | Ga0501039_0057355_231_845 | 190 |
| 264 | 3300049577 | Ga0501041_0292468 | Ga0501041_0292468_176_790 | 190 |
| 265 | 3300049578 | Ga0501042_0273844 | Ga0501042_0273844_532_1146 | 190 |
| 266 | 3300049580 | Ga0501046_0174727 | Ga0501046_0174727_329_943 | 190 |
| 267 | 3300049581 | Ga0501047_0072069 | Ga0501047_0072069_2101_2715 | 190 |
| 268 | 3300049582 | Ga0501048_0077515 | Ga0501048_0077515_1697_2311 | 190 |
| 269 | 3300049586 | Ga0501070_0104112 | Ga0501070_0104112_678_1292 | 190 |
| 270 | 3300049588 | Ga0501072_0049809 | Ga0501072_0049809_2401_3015 | 190 |
| 271 | 3300049591 | Ga0501075_0179208 | Ga0501075_0179208_550_1164 | 190 |
| 272 | 3300049592 | Ga0501076_0159958 | Ga0501076_0159958_940_1554 | 190 |
| 273 | 3300049593 | Ga0501077_0545093 | Ga0501077_0545093_59_673 | 190 |
| 274 | 3300049742 | Ga0501080_0072507 | Ga0501080_0072507_1953_2567 | 190 |
| 275 | 3300049742 | Ga0501080_0364310 | Ga0501080_0364310_397_1011 | 190 |
| 276 | 3300049743 | Ga0501081_0559946 | Ga0501081_0559946_59_673 | 190 |
| 277 | 3300049823 | Ga0501044_0457937 | Ga0501044_0457937_64_678 | 190 |
| 278 | 3300049824 | Ga0501045_0027388 | Ga0501045_0027388_2107_2721 | 190 |
| 279 | 3300050507 | nmdc:mga05p37_140395_c2 | nmdc:mga05p37_140395_c2_904_1518 | 190 |
| 280 | 3300050510 | nmdc:mga06r32_869395_c1 | nmdc:mga06r32_869395_c1_36_650 | 190 |
| 281 | 3300050511 | nmdc:mga08y16_247761_c1 | nmdc:mga08y16_247761_c1_718_1332 | 190 |
| 282 | 3300050511 | nmdc:mga08y16_279_c1 | nmdc:mga08y16_279_c1_22511_23128 | 190 |
| 283 | 3300050512 | nmdc:mga0n895_12272_c1 | nmdc:mga0n895_12272_c1_3889_4503 | 190 |
| 284 | 3300050513 | nmdc:mga0rr50_3590_c1 | nmdc:mga0rr50_3590_c1_6707_7321 | 190 |
| 285 | 3300050515 | nmdc:mga0a205_62216_c3 | nmdc:mga0a205_62216_c3_1334_1948 | 190 |
| 286 | 3300050515 | nmdc:mga0a205_671334_c1 | nmdc:mga0a205_671334_c1_219_836 | 190 |
| 287 | 3300053117 | Ga0500593_001238 | Ga0500593_001238_4288_4902 | 190 |
| 288 | 3300053153 | Ga0500616_0006713 | Ga0500616_0006713_1156_1770 | 190 |
| 289 | 3300059424 | Ga0590075_009648 | Ga0590075_009648_364_1017 | 190 |
| 290 | 3300059426 | Ga0590077_016095 | Ga0590077_016095_596_1249 | 190 |
| 291 | 3300060353 | Ga0501082_0069839 | Ga0501082_0069839_2360_2974 | 190 |
| 292 | 3300061734 | Ga0530510_0075038 | Ga0530510_0075038_305_919 | 190 |
| 293 | iso_pu_bacteria | 2508501128 | 2509147940 | 190 |
| 294 | iso_pu_bacteria | 2513237095 | 2513648206 | 190 |
| 295 | iso_pu_bacteria | 2513237096 | 2513655703 | 190 |
| 296 | iso_pu_bacteria | 2513237098 | 2513673421 | 190 |
| 297 | iso_pu_bacteria | 2513237101 | 2513697258 | 190 |
| 298 | iso_pu_bacteria | 2513237137 | 2513862750 | 190 |
| 299 | iso_pu_bacteria | 2513237141 | 2513892970 | 190 |
| 300 | iso_pu_bacteria | 2513237145 | 2513916219 | 190 |
| 301 | iso_pu_bacteria | 2517572143 | 2517890171 | 190 |
| 302 | iso_pu_bacteria | 2524023210 | 2524464735 | 190 |
| 303 | iso_pu_bacteria | 2524023228 | 2524538295 | 190 |
| 304 | iso_pu_bacteria | 2667528175 | 2671121630 | 190 |
| 305 | iso_pu_bacteria | 2721755755 | 2723848695 | 190 |
| 306 | iso_pu_bacteria | 2728368998 | 2728751970 | 190 |
| 307 | iso_pu_bacteria | 2791355197 | 2793067846 | 190 |
| 308 | iso_pu_bacteria | 2791355199 | 2793077498 | 190 |
| 309 | iso_pu_bacteria | 2816332527 | 2818239783 | 190 |
| 310 | iso_pu_bacteria | 2857524615 | 2857526939 | 190 |
| 311 | iso_pu_bacteria | 2874604998 | 2874606178 | 190 |
| 312 | iso_pu_bacteria | 2876808645 | 2876814761 | 190 |
| 313 | iso_pu_bacteria | 2879110137 | 2879115526 | 190 |
| 314 | iso_pu_bacteria | 2885374607 | 2885382313 | 190 |
| 315 | iso_pu_bacteria | 2885383462 | 2885388634 | 190 |
| 316 | iso_pu_bacteria | 2893066018 | 2893070090 | 190 |
| 317 | iso_pu_bacteria | 2903748898 | 2903755187 | 190 |
| 318 | iso_pu_bacteria | 2903768456 | 2903776680 | 190 |
| 319 | iso_pu_bacteria | 2904690495 | 2904692991 | 190 |
| 320 | iso_pu_bacteria | 2904699407 | 2904706654 | 190 |
| 321 | iso_pu_bacteria | 2906610324 | 2906612057 | 190 |
| 322 | iso_pu_bacteria | 2906635258 | 2906640283 | 190 |
| 323 | iso_pu_bacteria | 2906660503 | 2906663611 | 190 |
| 324 | iso_pu_bacteria | 2908739725 | 2908740404 | 190 |
| 325 | iso_pu_bacteria | 2908756301 | 2908757985 | 190 |
| 326 | iso_pu_bacteria | 2919073203 | 2919078059 | 190 |
| 327 | iso_pu_bacteria | 2922361189 | 2922363557 | 190 |
| 328 | iso_pu_bacteria | 2922386360 | 2922389677 | 190 |
| 329 | iso_pu_bacteria | 2922425934 | 2922427237 | 190 |
| 330 | iso_pu_bacteria | 2935630451 | 2935636269 | 190 |
| 331 | iso_pu_bacteria | 2941507105 | 2941512900 | 190 |
| 332 | iso_pu_bacteria | 2941515067 | 2941520798 | 190 |
| 333 | iso_pu_bacteria | 2941523033 | 2941528813 | 190 |
| 334 | iso_pu_bacteria | 3005474847 | 3005476414 | 190 |
| 335 | iso_pu_bacteria | 3005506211 | 3005506960 | 190 |
| 336 | iso_pu_bacteria | 8006933436 | 8006937761 | 190 |
| 337 | iso_pu_bacteria | 8006964411 | 8006971207 | 190 |
| 338 | iso_pu_bacteria | 8006973647 | 8006977789 | 190 |
| 339 | iso_pu_bacteria | 8006984368 | 8006986379 | 190 |
| 340 | iso_pu_bacteria | 8006994254 | 8006999068 | 190 |
| 341 | iso_pu_bacteria | 8016522445 | 8016524803 | 190 |
| 342 | iso_pu_bacteria | 8016530956 | 8016538372 | 190 |
| 343 | iso_pu_bacteria | 8016539877 | 8016542653 | 190 |
| 344 | iso_pu_bacteria | 8016548790 | 8016550621 | 190 |
| 345 | iso_pu_bacteria | 8016557553 | 8016559044 | 190 |
| 346 | iso_pu_bacteria | 8016566248 | 8016568035 | 190 |
| 347 | iso_pu_bacteria | 8016575299 | 8016580720 | 190 |
| 348 | iso_pu_bacteria | 8016595262 | 8016596999 | 190 |
| 349 | iso_pu_bacteria | 8016622563 | 8016629926 | 190 |
| 350 | iso_pu_bacteria | 8019530166 | 8019538042 | 190 |
| 351 | iso_pu_bacteria | 8019547302 | 8019548860 | 190 |
| 352 | iso_pu_bacteria | 8019555841 | 8019560879 | 190 |
| 353 | iso_pu_bacteria | 8019565922 | 8019570963 | 190 |
| 354 | iso_pu_bacteria | 8056673599 | 8056675523 | 190 |
| 355 | iso_pu_bacteria | 8056681323 | 8056684682 | 190 |
| 356 | iso_pu_bacteria | 8056689827 | 8056695494 | 190 |
| 357 | 3300005347 | Ga0070668_100252506 | Ga0070668_1002525062 | 191 |
| 358 | 3300005434 | Ga0070709_10014082 | Ga0070709_100140826 | 191 |
| 359 | 3300005436 | Ga0070713_100057137 | Ga0070713_1000571374 | 191 |
| 360 | 3300005458 | Ga0070681_10016302 | Ga0070681_100163026 | 191 |
| 361 | 3300005530 | Ga0070679_100069266 | Ga0070679_1000692664 | 191 |
| 362 | 3300005539 | Ga0068853_100981588 | Ga0068853_1009815881 | 191 |
| 363 | 3300006175 | Ga0070712_100355044 | Ga0070712_1003550442 | 191 |
| 364 | 3300006178 | Ga0075367_10036272 | Ga0075367_100362722 | 191 |
| 365 | 3300006186 | Ga0075369_10120610 | Ga0075369_101206102 | 191 |
| 366 | 3300006871 | Ga0075434_100086670 | Ga0075434_1000866703 | 191 |
| 367 | 3300009551 | Ga0105238_10889928 | Ga0105238_108899281 | 191 |
| 368 | 3300025906 | Ga0207699_10017411 | Ga0207699_100174112 | 191 |
| 369 | 3300025912 | Ga0207707_10001660 | Ga0207707_100016607 | 191 |
| 370 | 3300025915 | Ga0207693_10510810 | Ga0207693_105108102 | 191 |
| 371 | 3300025917 | Ga0207660_10263399 | Ga0207660_102633992 | 191 |
| 372 | 3300025921 | Ga0207652_10010980 | Ga0207652_100109805 | 191 |
| 373 | 3300025921 | Ga0207652_10226582 | Ga0207652_102265822 | 191 |
| 374 | 3300028786 | Ga0307517_10000196 | Ga0307517_1000019629 | 191 |
| 375 | 3300028794 | Ga0307515_10146364 | Ga0307515_101463642 | 191 |
| 376 | 3300031456 | Ga0307513_10084532 | Ga0307513_100845324 | 191 |
| 377 | 3300031665 | Ga0316575_10172963 | Ga0316575_101729631 | 191 |
| 378 | 3300031691 | Ga0316579_10132590 | Ga0316579_101325901 | 191 |
| 379 | 3300032133 | Ga0316583_10001162 | Ga0316583_100011625 | 191 |
| 380 | 3300045976 | Ga0466967_0245825 | Ga0466967_0245825_891_1508 | 191 |
| 381 | 3300046660 | Ga0495625_0150178 | Ga0495625_0150178_63_680 | 191 |
| 382 | 3300050495 | nmdc:mga04h51_20547_c1 | nmdc:mga04h51_20547_c1_262_879 | 191 |
| 383 | 3300050512 | nmdc:mga0n895_49730_c1 | nmdc:mga0n895_49730_c1_1462_2079 | 191 |
| 384 | iso_pu_bacteria | 2507262055 | 2507511816 | 191 |
| 385 | iso_pu_bacteria | 2508501009 | 2508545481 | 191 |
| 386 | iso_pu_bacteria | 2508501042 | 2508694299 | 191 |
| 387 | iso_pu_bacteria | 2511231028 | 2511396722 | 191 |
| 388 | iso_pu_bacteria | 2513237092 | 2513626772 | 191 |
| 389 | iso_pu_bacteria | 2513237094 | 2513643356 | 191 |
| 390 | iso_pu_bacteria | 2513237102 | 2513701916 | 191 |
| 391 | iso_pu_bacteria | 2513237104 | 2513720461 | 191 |
| 392 | iso_pu_bacteria | 2513237161 | 2514014346 | 191 |
| 393 | iso_pu_bacteria | 2515154112 | 2515624778 | 191 |
| 394 | iso_pu_bacteria | 2524023205 | 2524438252 | 191 |
| 395 | iso_pu_bacteria | 2528768022 | 2528853573 | 191 |
| 396 | iso_pu_bacteria | 2617270735 | 2617349570 | 191 |
| 397 | iso_pu_bacteria | 2617270741 | 2617376764 | 191 |
| 398 | iso_pu_bacteria | 2744054633 | 2745077319 | 191 |
| 399 | iso_pu_bacteria | 2791355196 | 2793059693 | 191 |
| 400 | iso_pu_bacteria | 2802429603 | 2805919607 | 191 |
| 401 | iso_pu_bacteria | 2824600985 | 2824607462 | 191 |
| 402 | iso_pu_bacteria | 2824609381 | 2824613373 | 191 |
| 403 | iso_pu_bacteria | 2824617872 | 2824624703 | 191 |
| 404 | iso_pu_bacteria | 2824626560 | 2824633641 | 191 |
| 405 | iso_pu_bacteria | 2824635225 | 2824642510 | 191 |
| 406 | iso_pu_bacteria | 2824644064 | 2824650198 | 191 |
| 407 | iso_pu_bacteria | 2824653114 | 2824658819 | 191 |
| 408 | iso_pu_bacteria | 2824661429 | 2824671041 | 191 |
| 409 | iso_pu_bacteria | 2824671348 | 2824678656 | 191 |
| 410 | iso_pu_bacteria | 2824679649 | 2824685539 | 191 |
| 411 | iso_pu_bacteria | 2824687955 | 2824695322 | 191 |
| 412 | iso_pu_bacteria | 2824696289 | 2824700053 | 191 |
| 413 | iso_pu_bacteria | 2824704595 | 2824707668 | 191 |
| 414 | iso_pu_bacteria | 2824714736 | 2824720038 | 191 |
| 415 | iso_pu_bacteria | 2824723954 | 2824730385 | 191 |
| 416 | iso_pu_bacteria | 2824732956 | 2824739125 | 191 |
| 417 | iso_pu_bacteria | 2824746037 | 2824750639 | 191 |
| 418 | iso_pu_bacteria | 2824753945 | 2824757415 | 191 |
| 419 | iso_pu_bacteria | 2824763712 | 2824768028 | 191 |
| 420 | iso_pu_bacteria | 2824773399 | 2824780193 | 191 |
| 421 | iso_pu_bacteria | 2838122688 | 2838130500 | 191 |
| 422 | iso_pu_bacteria | 2841941048 | 2841942193 | 191 |
| 423 | iso_pu_bacteria | 2841949485 | 2841955347 | 191 |
| 424 | iso_pu_bacteria | 2841957949 | 2841963578 | 191 |
| 425 | iso_pu_bacteria | 2841966195 | 2841971284 | 191 |
| 426 | iso_pu_bacteria | 2841974524 | 2841981576 | 191 |
| 427 | iso_pu_bacteria | 2841983080 | 2841987116 | 191 |
| 428 | iso_pu_bacteria | 2842038055 | 2842042059 | 191 |
| 429 | iso_pu_bacteria | 2842045827 | 2842050102 | 191 |
| 430 | iso_pu_bacteria | 2844315083 | 2844321028 | 191 |
| 431 | iso_pu_bacteria | 2847930680 | 2847932355 | 191 |
| 432 | iso_pu_bacteria | 2847939898 | 2847943602 | 191 |
| 433 | iso_pu_bacteria | 2849076700 | 2849077325 | 191 |
| 434 | iso_pu_bacteria | 2857509624 | 2857515066 | 191 |
| 435 | iso_pu_bacteria | 2874590934 | 2874593656 | 191 |
| 436 | iso_pu_bacteria | 2874612657 | 2874614091 | 191 |
| 437 | iso_pu_bacteria | 2874620515 | 2874624914 | 191 |
| 438 | iso_pu_bacteria | 2874628541 | 2874631042 | 191 |
| 439 | iso_pu_bacteria | 2874645413 | 2874648331 | 191 |
| 440 | iso_pu_bacteria | 2876761206 | 2876765944 | 191 |
| 441 | iso_pu_bacteria | 2876761206 | 2876766493 | 191 |
| 442 | iso_pu_bacteria | 2876771140 | 2876774717 | 191 |
| 443 | iso_pu_bacteria | 2876818435 | 2876821508 | 191 |
| 444 | iso_pu_bacteria | 2879074833 | 2879079285 | 191 |
| 445 | iso_pu_bacteria | 2879083081 | 2879091480 | 191 |
| 446 | iso_pu_bacteria | 2879099564 | 2879102674 | 191 |
| 447 | iso_pu_bacteria | 2879127579 | 2879131288 | 191 |
| 448 | iso_pu_bacteria | 2879142872 | 2879144639 | 191 |
| 449 | iso_pu_bacteria | 2881364244 | 2881371191 | 191 |
| 450 | iso_pu_bacteria | 2881665667 | 2881668066 | 191 |
| 451 | iso_pu_bacteria | 2885366525 | 2885374112 | 191 |
| 452 | iso_pu_bacteria | 2885409591 | 2885415186 | 191 |
| 453 | iso_pu_bacteria | 2888378607 | 2888386438 | 191 |
| 454 | iso_pu_bacteria | 2888388044 | 2888391878 | 191 |
| 455 | iso_pu_bacteria | 2888419890 | 2888426553 | 191 |
| 456 | iso_pu_bacteria | 2903727486 | 2903728466 | 191 |
| 457 | iso_pu_bacteria | 2904666416 | 2904669111 | 191 |
| 458 | iso_pu_bacteria | 2904711408 | 2904715576 | 191 |
| 459 | iso_pu_bacteria | 2906602504 | 2906605315 | 191 |
| 460 | iso_pu_bacteria | 2906626472 | 2906634566 | 191 |
| 461 | iso_pu_bacteria | 2906643746 | 2906645426 | 191 |
| 462 | iso_pu_bacteria | 2908775508 | 2908782660 | 191 |
| 463 | iso_pu_bacteria | 2922368715 | 2922370628 | 191 |
| 464 | iso_pu_bacteria | 2922393267 | 2922396769 | 191 |
| 465 | iso_pu_bacteria | 2929615660 | 2929620196 | 191 |
| 466 | iso_pu_bacteria | 2929624759 | 2929629509 | 191 |
| 467 | iso_pu_bacteria | 2932784394 | 2932791554 | 191 |
| 468 | iso_pu_bacteria | 2932794094 | 2932799330 | 191 |
| 469 | iso_pu_bacteria | 2932801729 | 2932802270 | 191 |
| 470 | iso_pu_bacteria | 2932809354 | 2932816816 | 191 |
| 471 | iso_pu_bacteria | 2932818245 | 2932824007 | 191 |
| 472 | iso_pu_bacteria | 2932828146 | 2932835457 | 191 |
| 473 | iso_pu_bacteria | 2933577622 | 2933582113 | 191 |
| 474 | iso_pu_bacteria | 2935608549 | 2935613546 | 191 |
| 475 | iso_pu_bacteria | 2935616580 | 2935621199 | 191 |
| 476 | iso_pu_bacteria | 2935638405 | 2935643481 | 191 |
| 477 | iso_pu_bacteria | 2935648319 | 2935650536 | 191 |
| 478 | iso_pu_bacteria | 2935656913 | 2935662978 | 191 |
| 479 | iso_pu_bacteria | 2935665750 | 2935671196 | 191 |
| 480 | iso_pu_bacteria | 2935675223 | 2935681201 | 191 |
| 481 | iso_pu_bacteria | 2935684952 | 2935689460 | 191 |
| 482 | iso_pu_bacteria | 2935694250 | 2935700033 | 191 |
| 483 | iso_pu_bacteria | 2935703347 | 2935710757 | 191 |
| 484 | iso_pu_bacteria | 2935713505 | 2935720711 | 191 |
| 485 | iso_pu_bacteria | 2935722832 | 2935727978 | 191 |
| 486 | iso_pu_bacteria | 2935732158 | 2935737426 | 191 |
| 487 | iso_pu_bacteria | 2935741537 | 2935746513 | 191 |
| 488 | iso_pu_bacteria | 2935750917 | 2935757480 | 191 |
| 489 | iso_pu_bacteria | 2935760218 | 2935763857 | 191 |
| 490 | iso_pu_bacteria | 2935769743 | 2935776600 | 191 |
| 491 | iso_pu_bacteria | 2935777560 | 2935781414 | 191 |
| 492 | iso_pu_bacteria | 2935785616 | 2935792510 | 191 |
| 493 | iso_pu_bacteria | 2935793552 | 2935797979 | 191 |
| 494 | iso_pu_bacteria | 2935801545 | 2935807835 | 191 |
| 495 | iso_pu_bacteria | 2935810662 | 2935818260 | 191 |
| 496 | iso_pu_bacteria | 2935819856 | 2935824601 | 191 |
| 497 | iso_pu_bacteria | 2935827899 | 2935832998 | 191 |
| 498 | iso_pu_bacteria | 2935837841 | 2935844330 | 191 |
| 499 | iso_pu_bacteria | 2935847175 | 2935851821 | 191 |
| 500 | iso_pu_bacteria | 2935855204 | 2935859608 | 191 |
| 501 | iso_pu_bacteria | 2935864058 | 2935871327 | 191 |
| 502 | iso_pu_bacteria | 2935873716 | 2935879070 | 191 |
| 503 | iso_pu_bacteria | 2935883170 | 2935889489 | 191 |
| 504 | iso_pu_bacteria | 2935908558 | 2935911173 | 191 |
| 505 | iso_pu_bacteria | 2935916978 | 2935920705 | 191 |
| 506 | iso_pu_bacteria | 2935926038 | 2935928202 | 191 |
| 507 | iso_pu_bacteria | 2935934488 | 2935937847 | 191 |
| 508 | iso_pu_bacteria | 2935942939 | 2935945129 | 191 |
| 509 | iso_pu_bacteria | 2935951376 | 2935954366 | 191 |
| 510 | iso_pu_bacteria | 2935959822 | 2935965569 | 191 |
| 511 | iso_pu_bacteria | 2935967501 | 2935971367 | 191 |
| 512 | iso_pu_bacteria | 2935975950 | 2935981973 | 191 |
| 513 | iso_pu_bacteria | 2935984226 | 2935990791 | 191 |
| 514 | iso_pu_bacteria | 2935992306 | 2935996713 | 191 |
| 515 | iso_pu_bacteria | 2936002035 | 2936008589 | 191 |
| 516 | iso_pu_bacteria | 2936011229 | 2936017108 | 191 |
| 517 | iso_pu_bacteria | 2936019824 | 2936026757 | 191 |
| 518 | iso_pu_bacteria | 2936028420 | 2936035500 | 191 |
| 519 | iso_pu_bacteria | 2936037263 | 2936044922 | 191 |
| 520 | iso_pu_bacteria | 2936046547 | 2936053649 | 191 |
| 521 | iso_pu_bacteria | 2936055302 | 2936062724 | 191 |
| 522 | iso_pu_bacteria | 2940556831 | 2940563696 | 191 |
| 523 | iso_pu_bacteria | 2941531003 | 2941537059 | 191 |
| 524 | iso_pu_bacteria | 2941538514 | 2941542662 | 191 |
| 525 | iso_pu_bacteria | 3005483717 | 3005490141 | 191 |
| 526 | iso_pu_bacteria | 3005587118 | 3005591406 | 191 |
| 527 | iso_pu_bacteria | 3005594810 | 3005601370 | 191 |
| 528 | iso_pu_bacteria | 3005710791 | 3005716812 | 191 |
| 529 | iso_pu_bacteria | 3005718088 | 3005724063 | 191 |
| 530 | iso_pu_bacteria | 8006926726 | 8006931707 | 191 |
| 531 | iso_pu_bacteria | 8016511872 | 8016519559 | 191 |
| 532 | iso_pu_bacteria | 8016603502 | 8016607905 | 191 |
| 533 | iso_pu_bacteria | 8016613128 | 8016619688 | 191 |
| 534 | iso_pu_bacteria | 8016630954 | 8016637272 | 191 |
| 535 | iso_pu_bacteria | 8017057580 | 8017065966 | 191 |
| 536 | iso_pu_bacteria | 8019538911 | 8019541938 | 191 |
| 537 | iso_pu_bacteria | 8019576017 | 8019578684 | 191 |
| 538 | iso_pu_bacteria | 8019586578 | 8019596721 | 191 |
| 539 | iso_pu_bacteria | 8019597564 | 8019604968 | 191 |
| 540 | iso_pu_bacteria | 8019619141 | 8019624222 | 191 |
| 541 | iso_pu_bacteria | 8019629233 | 8019637799 | 191 |
| 542 | iso_pu_bacteria | 8019638758 | 8019641825 | 191 |
| 543 | iso_pu_bacteria | 8019648815 | 8019653753 | 191 |
| 544 | iso_pu_bacteria | 8019668869 | 8019675254 | 191 |
| 545 | iso_pu_bacteria | 8019678201 | 8019680854 | 191 |
| 546 | iso_pu_bacteria | 8055742211 | 8055750051 | 191 |
| 547 | iso_pu_bacteria | 8056967851 | 8056975826 | 191 |
| 548 | 3300003215 | JGI25153J46596_10001416 | JGI25153J46596_1000141614 | 192 |
| 549 | 3300005328 | Ga0070676_10033104 | Ga0070676_100331041 | 192 |
| 550 | 3300005329 | Ga0070683_100969944 | Ga0070683_1009699441 | 192 |
| 551 | 3300005330 | Ga0070690_100321732 | Ga0070690_1003217322 | 192 |
| 552 | 3300005336 | Ga0070680_100036538 | Ga0070680_1000365384 | 192 |
| 553 | 3300005337 | Ga0070682_100402362 | Ga0070682_1004023621 | 192 |
| 554 | 3300005338 | Ga0068868_100396172 | Ga0068868_1003961722 | 192 |
| 555 | 3300005347 | Ga0070668_100224497 | Ga0070668_1002244972 | 192 |
| 556 | 3300005355 | Ga0070671_100105113 | Ga0070671_1001051132 | 192 |
| 557 | 3300005356 | Ga0070674_100060347 | Ga0070674_1000603473 | 192 |
| 558 | 3300005364 | Ga0070673_100456064 | Ga0070673_1004560641 | 192 |
| 559 | 3300005366 | Ga0070659_100309946 | Ga0070659_1003099462 | 192 |
| 560 | 3300005367 | Ga0070667_100062534 | Ga0070667_1000625342 | 192 |
| 561 | 3300005367 | Ga0070667_100150984 | Ga0070667_1001509842 | 192 |
| 562 | 3300005434 | Ga0070709_10000542 | Ga0070709_1000054222 | 192 |
| 563 | 3300005436 | Ga0070713_100105722 | Ga0070713_1001057222 | 192 |
| 564 | 3300005437 | Ga0070710_10078972 | Ga0070710_100789723 | 192 |
| 565 | 3300005438 | Ga0070701_10055938 | Ga0070701_100559382 | 192 |
| 566 | 3300005438 | Ga0070701_10265742 | Ga0070701_102657422 | 192 |
| 567 | 3300005439 | Ga0070711_100001693 | Ga0070711_10000169312 | 192 |
| 568 | 3300005441 | Ga0070700_100039031 | Ga0070700_1000390314 | 192 |
| 569 | 3300005445 | Ga0070708_100126243 | Ga0070708_1001262432 | 192 |
| 570 | 3300005455 | Ga0070663_100015528 | Ga0070663_1000155287 | 192 |
| 571 | 3300005455 | Ga0070663_100018140 | Ga0070663_1000181404 | 192 |
| 572 | 3300005456 | Ga0070678_100043585 | Ga0070678_1000435851 | 192 |
| 573 | 3300005456 | Ga0070678_100394586 | Ga0070678_1003945862 | 192 |
| 574 | 3300005458 | Ga0070681_10467567 | Ga0070681_104675671 | 192 |
| 575 | 3300005459 | Ga0068867_100207547 | Ga0068867_1002075473 | 192 |
| 576 | 3300005547 | Ga0070693_100116072 | Ga0070693_1001160723 | 192 |
| 577 | 3300005548 | Ga0070665_100002394 | Ga0070665_10000239413 | 192 |
| 578 | 3300005548 | Ga0070665_100005213 | Ga0070665_10000521311 | 192 |
| 579 | 3300005564 | Ga0070664_100262610 | Ga0070664_1002626102 | 192 |
| 580 | 3300005578 | Ga0068854_100192544 | Ga0068854_1001925442 | 192 |
| 581 | 3300005617 | Ga0068859_100929525 | Ga0068859_1009295251 | 192 |
| 582 | 3300005719 | Ga0068861_100924709 | Ga0068861_1009247091 | 192 |
| 583 | 3300005841 | Ga0068863_100133441 | Ga0068863_1001334413 | 192 |
| 584 | 3300005842 | Ga0068858_100116128 | Ga0068858_1001161283 | 192 |
| 585 | 3300005843 | Ga0068860_100292318 | Ga0068860_1002923182 | 192 |
| 586 | 3300005844 | Ga0068862_100052503 | Ga0068862_1000525035 | 192 |
| 587 | 3300005983 | Ga0081540_1014734 | Ga0081540_10147343 | 192 |
| 588 | 3300005983 | Ga0081540_1016073 | Ga0081540_10160734 | 192 |
| 589 | 3300006028 | Ga0070717_10198897 | Ga0070717_101988972 | 192 |
| 590 | 3300006038 | Ga0075365_10118488 | Ga0075365_101184883 | 192 |
| 591 | 3300006038 | Ga0075365_10306764 | Ga0075365_103067642 | 192 |
| 592 | 3300006038 | Ga0075365_10453708 | Ga0075365_104537081 | 192 |
| 593 | 3300006042 | Ga0075368_10018742 | Ga0075368_100187422 | 192 |
| 594 | 3300006042 | Ga0075368_10023629 | Ga0075368_100236294 | 192 |
| 595 | 3300006048 | Ga0075363_100044787 | Ga0075363_1000447873 | 192 |
| 596 | 3300006048 | Ga0075363_100062994 | Ga0075363_1000629942 | 192 |
| 597 | 3300006048 | Ga0075363_100110319 | Ga0075363_1001103191 | 192 |
| 598 | 3300006051 | Ga0075364_10082233 | Ga0075364_100822333 | 192 |
| 599 | 3300006163 | Ga0070715_10013984 | Ga0070715_100139843 | 192 |
| 600 | 3300006173 | Ga0070716_100014423 | Ga0070716_1000144232 | 192 |
| 601 | 3300006175 | Ga0070712_100015526 | Ga0070712_1000155264 | 192 |
| 602 | 3300006177 | Ga0075362_10110646 | Ga0075362_101106461 | 192 |
| 603 | 3300006178 | Ga0075367_10071753 | Ga0075367_100717532 | 192 |
| 604 | 3300006178 | Ga0075367_10104051 | Ga0075367_101040513 | 192 |
| 605 | 3300006195 | Ga0075366_10105246 | Ga0075366_101052463 | 192 |
| 606 | 3300006353 | Ga0075370_10192316 | Ga0075370_101923161 | 192 |
| 607 | 3300006871 | Ga0075434_100355554 | Ga0075434_1003555543 | 192 |
| 608 | 3300006871 | Ga0075434_100756021 | Ga0075434_1007560212 | 192 |
| 609 | 3300006881 | Ga0068865_100273986 | Ga0068865_1002739862 | 192 |
| 610 | 3300006881 | Ga0068865_100322726 | Ga0068865_1003227262 | 192 |
| 611 | 3300006931 | Ga0097620_100929468 | Ga0097620_1009294681 | 192 |
| 612 | 3300007265 | Ga0099794_10031783 | Ga0099794_100317832 | 192 |
| 613 | 3300009092 | Ga0105250_10178299 | Ga0105250_101782992 | 192 |
| 614 | 3300009094 | Ga0111539_10095255 | Ga0111539_100952552 | 192 |
| 615 | 3300009098 | Ga0105245_10470478 | Ga0105245_104704782 | 192 |
| 616 | 3300009101 | Ga0105247_10208434 | Ga0105247_102084342 | 192 |
| 617 | 3300009101 | Ga0105247_10215633 | Ga0105247_102156332 | 192 |
| 618 | 3300009101 | Ga0105247_10631891 | Ga0105247_106318911 | 192 |
| 619 | 3300009148 | Ga0105243_10215241 | Ga0105243_102152412 | 192 |
| 620 | 3300009176 | Ga0105242_10034037 | Ga0105242_100340373 | 192 |
| 621 | 3300009177 | Ga0105248_10113899 | Ga0105248_101138992 | 192 |
| 622 | 3300009177 | Ga0105248_10775741 | Ga0105248_107757412 | 192 |
| 623 | 3300009177 | Ga0105248_11434161 | Ga0105248_114341611 | 192 |
| 624 | 3300013297 | Ga0157378_10822711 | Ga0157378_108227111 | 192 |
| 625 | 3300013306 | Ga0163162_10120701 | Ga0163162_101207013 | 192 |
| 626 | 3300013307 | Ga0157372_10767652 | Ga0157372_107676521 | 192 |
| 627 | 3300013308 | Ga0157375_10787518 | Ga0157375_107875182 | 192 |
| 628 | 3300014968 | Ga0157379_10162321 | Ga0157379_101623214 | 192 |
| 629 | 3300014969 | Ga0157376_10719565 | Ga0157376_107195652 | 192 |
| 630 | 3300015261 | Ga0182006_1086770 | Ga0182006_10867702 | 192 |
| 631 | 3300017792 | Ga0163161_10006317 | Ga0163161_100063177 | 192 |
| 632 | 3300025297 | Ga0209758_1009647 | Ga0209758_10096473 | 192 |
| 633 | 3300025297 | Ga0209758_1015925 | Ga0209758_10159253 | 192 |
| 634 | 3300025898 | Ga0207692_10333384 | Ga0207692_103333841 | 192 |
| 635 | 3300025900 | Ga0207710_10323821 | Ga0207710_103238212 | 192 |
| 636 | 3300025901 | Ga0207688_10125717 | Ga0207688_101257173 | 192 |
| 637 | 3300025903 | Ga0207680_10419666 | Ga0207680_104196662 | 192 |
| 638 | 3300025907 | Ga0207645_10038963 | Ga0207645_100389635 | 192 |
| 639 | 3300025912 | Ga0207707_10545566 | Ga0207707_105455661 | 192 |
| 640 | 3300025914 | Ga0207671_10108395 | Ga0207671_101083952 | 192 |
| 641 | 3300025915 | Ga0207693_10071194 | Ga0207693_100711943 | 192 |
| 642 | 3300025916 | Ga0207663_10006117 | Ga0207663_100061176 | 192 |
| 643 | 3300025919 | Ga0207657_10051937 | Ga0207657_100519373 | 192 |
| 644 | 3300025923 | Ga0207681_10218325 | Ga0207681_102183252 | 192 |
| 645 | 3300025929 | Ga0207664_10102951 | Ga0207664_101029512 | 192 |
| 646 | 3300025931 | Ga0207644_10314340 | Ga0207644_103143402 | 192 |
| 647 | 3300025934 | Ga0207686_10124259 | Ga0207686_101242592 | 192 |
| 648 | 3300025936 | Ga0207670_10441195 | Ga0207670_104411951 | 192 |
| 649 | 3300025938 | Ga0207704_10113298 | Ga0207704_101132981 | 192 |
| 650 | 3300025939 | Ga0207665_10023387 | Ga0207665_100233873 | 192 |
| 651 | 3300025940 | Ga0207691_10053838 | Ga0207691_100538384 | 192 |
| 652 | 3300025941 | Ga0207711_10294765 | Ga0207711_102947652 | 192 |
| 653 | 3300025942 | Ga0207689_10356783 | Ga0207689_103567831 | 192 |
| 654 | 3300025949 | Ga0207667_10586780 | Ga0207667_105867802 | 192 |
| 655 | 3300025960 | Ga0207651_10177073 | Ga0207651_101770732 | 192 |
| 656 | 3300025961 | Ga0207712_10236413 | Ga0207712_102364132 | 192 |
| 657 | 3300025972 | Ga0207668_10491175 | Ga0207668_104911752 | 192 |
| 658 | 3300025986 | Ga0207658_10050424 | Ga0207658_100504242 | 192 |
| 659 | 3300025986 | Ga0207658_10505270 | Ga0207658_105052702 | 192 |
| 660 | 3300026023 | Ga0207677_10753186 | Ga0207677_107531861 | 192 |
| 661 | 3300026035 | Ga0207703_10066622 | Ga0207703_100666223 | 192 |
| 662 | 3300026035 | Ga0207703_10252147 | Ga0207703_102521472 | 192 |
| 663 | 3300026067 | Ga0207678_10023600 | Ga0207678_100236002 | 192 |
| 664 | 3300026075 | Ga0207708_10085232 | Ga0207708_100852322 | 192 |
| 665 | 3300026089 | Ga0207648_10055076 | Ga0207648_100550761 | 192 |
| 666 | 3300026089 | Ga0207648_10212002 | Ga0207648_102120022 | 192 |
| 667 | 3300026089 | Ga0207648_10383102 | Ga0207648_103831021 | 192 |
| 668 | 3300026095 | Ga0207676_11354940 | Ga0207676_113549401 | 192 |
| 669 | 3300026116 | Ga0207674_10193637 | Ga0207674_101936373 | 192 |
| 670 | 3300026118 | Ga0207675_100027594 | Ga0207675_1000275944 | 192 |
| 671 | 3300026121 | Ga0207683_10018090 | Ga0207683_100180902 | 192 |
| 672 | 3300028379 | Ga0268266_10001169 | Ga0268266_100011699 | 192 |
| 673 | 3300028379 | Ga0268266_10002165 | Ga0268266_1000216525 | 192 |
| 674 | 3300028380 | Ga0268265_11009214 | Ga0268265_110092141 | 192 |
| 675 | 3300028381 | Ga0268264_10000458 | Ga0268264_1000045823 | 192 |
| 676 | 3300028381 | Ga0268264_11026485 | Ga0268264_110264851 | 192 |
| 677 | 3300031235 | Ga0265330_10024732 | Ga0265330_100247323 | 192 |
| 678 | 3300031238 | Ga0265332_10013847 | Ga0265332_100138472 | 192 |
| 679 | 3300031241 | Ga0265325_10009040 | Ga0265325_100090406 | 192 |
| 680 | 3300031249 | Ga0265339_10049967 | Ga0265339_100499673 | 192 |
| 681 | 3300031250 | Ga0265331_10032855 | Ga0265331_100328553 | 192 |
| 682 | 3300031344 | Ga0265316_10456226 | Ga0265316_104562261 | 192 |
| 683 | 3300031507 | Ga0307509_10110235 | Ga0307509_101102351 | 192 |
| 684 | 3300031616 | Ga0307508_10000541 | Ga0307508_1000054131 | 192 |
| 685 | 3300031712 | Ga0265342_10070889 | Ga0265342_100708893 | 192 |
| 686 | 3300031730 | Ga0307516_10040357 | Ga0307516_100403573 | 192 |
| 687 | 3300031995 | Ga0307409_100338494 | Ga0307409_1003384941 | 192 |
| 688 | 3300033442 | Ga0315911_1000012 | Ga0315911_1000012155 | 192 |
| 689 | 3300035086 | Ga0373934_0045694 | Ga0373934_0045694_828_1445 | 192 |
| 690 | 3300035111 | Ga0373923_0006204 | Ga0373923_0006204_74_691 | 192 |
| 691 | 3300035115 | Ga0373941_0062628 | Ga0373941_0062628_518_1135 | 192 |
| 692 | 3300035117 | Ga0373953_0079623 | Ga0373953_0079623_346_963 | 192 |
| 693 | 3300035118 | Ga0373954_0005528 | Ga0373954_0005528_1161_1778 | 192 |
| 694 | 3300035119 | Ga0373956_0001286 | Ga0373956_0001286_3114_3731 | 192 |
| 695 | 3300035410 | Ga0373924_0151675 | Ga0373924_0151675_46_663 | 192 |
| 696 | 3300035724 | Ga0373933_0069436 | Ga0373933_0069436_446_1063 | 192 |
| 697 | 3300035725 | Ga0373947_0008493 | Ga0373947_0008493_3570_4187 | 192 |
| 698 | 3300036401 | Ga0373937_0296980 | Ga0373937_0296980_225_842 | 192 |
| 699 | 3300037068 | Ga0373925_0625057 | Ga0373925_0625057_248_865 | 192 |
| 700 | 3300041413 | Ga0439465_0072418 | Ga0439465_0072418_407_1024 | 192 |
| 701 | 3300041413 | Ga0439465_0122487 | Ga0439465_0122487_154_771 | 192 |
| 702 | 3300042157 | Ga0439458_0052730 | Ga0439458_0052730_371_988 | 192 |
| 703 | 3300042438 | Ga0439459_0087167 | Ga0439459_0087167_47_664 | 192 |
| 704 | 3300044658 | Ga0466972_0000115 | Ga0466972_0000115_32869_33489 | 192 |
| 705 | 3300046459 | Ga0495629_0028607 | Ga0495629_0028607_257_874 | 192 |
| 706 | 3300046462 | Ga0495651_0252196 | Ga0495651_0252196_508_1125 | 192 |
| 707 | 3300046500 | Ga0495596_0098022 | Ga0495596_0098022_395_1012 | 192 |
| 708 | 3300046514 | Ga0495618_0100421 | Ga0495618_0100421_1168_1785 | 192 |
| 709 | 3300046515 | Ga0495620_0108146 | Ga0495620_0108146_45_665 | 192 |
| 710 | 3300046516 | Ga0495628_0204353 | Ga0495628_0204353_750_1367 | 192 |
| 711 | 3300046519 | Ga0495632_0175322 | Ga0495632_0175322_352_969 | 192 |
| 712 | 3300046558 | Ga0495633_0204791 | Ga0495633_0204791_90_707 | 192 |
| 713 | 3300046559 | Ga0495667_0118424 | Ga0495667_0118424_743_1360 | 192 |
| 714 | 3300046615 | Ga0495656_0026298 | Ga0495656_0026298_269_886 | 192 |
| 715 | 3300046616 | Ga0495668_0232388 | Ga0495668_0232388_266_883 | 192 |
| 716 | 3300046663 | Ga0495635_0003655 | Ga0495635_0003655_619_1236 | 192 |
| 717 | 3300046678 | Ga0495599_0004038 | Ga0495599_0004038_2814_3431 | 192 |
| 718 | 3300046679 | Ga0495623_0032867 | Ga0495623_0032867_506_1123 | 192 |
| 719 | 3300046689 | Ga0495613_0713501 | Ga0495613_0713501_21_638 | 192 |
| 720 | 3300046809 | Ga0495600_0188173 | Ga0495600_0188173_660_1277 | 192 |
| 721 | 3300047317 | Ga0495604_0142584 | Ga0495604_0142584_990_1607 | 192 |
| 722 | 3300047320 | Ga0495672_0025107 | Ga0495672_0025107_2436_3050 | 192 |
| 723 | 3300047320 | Ga0495672_0273113 | Ga0495672_0273113_179_796 | 192 |
| 724 | 3300047444 | Ga0495675_0019629 | Ga0495675_0019629_2210_2827 | 192 |
| 725 | 3300047447 | Ga0495685_138410 | Ga0495685_138410_80_697 | 192 |
| 726 | 3300047469 | Ga0495673_0144152 | Ga0495673_0144152_148_765 | 192 |
| 727 | 3300047471 | Ga0495684_0009528 | Ga0495684_0009528_4375_4992 | 192 |
| 728 | 3300047472 | Ga0495686_0203178 | Ga0495686_0203178_466_1083 | 192 |
| 729 | 3300047673 | Ga0495593_0009950 | Ga0495593_0009950_137_754 | 192 |
| 730 | 3300048088 | Ga0495602_0117596 | Ga0495602_0117596_508_1125 | 192 |
| 731 | 3300048903 | Ga0496100_0640240 | Ga0496100_0640240_109_726 | 192 |
| 732 | 3300048905 | Ga0496102_0798025 | Ga0496102_0798025_217_834 | 192 |
| 733 | 3300048907 | Ga0496104_0080689 | Ga0496104_0080689_962_1579 | 192 |
| 734 | 3300048912 | Ga0496109_0251566 | Ga0496109_0251566_18_635 | 192 |
| 735 | 3300048913 | Ga0496110_0677798 | Ga0496110_0677798_296_913 | 192 |
| 736 | 3300048917 | Ga0496114_0361114 | Ga0496114_0361114_536_1153 | 192 |
| 737 | 3300048918 | Ga0496115_0140467 | Ga0496115_0140467_996_1613 | 192 |
| 738 | 3300048918 | Ga0496115_0409522 | Ga0496115_0409522_195_812 | 192 |
| 739 | 3300048924 | Ga0496121_0143072 | Ga0496121_0143072_98_715 | 192 |
| 740 | 3300048929 | Ga0496126_0029959 | Ga0496126_0029959_252_869 | 192 |
| 741 | 3300048929 | Ga0496126_0085263 | Ga0496126_0085263_2029_2646 | 192 |
| 742 | 3300048929 | Ga0496126_0265198 | Ga0496126_0265198_22_639 | 192 |
| 743 | 3300048929 | Ga0496126_0786820 | Ga0496126_0786820_49_666 | 192 |
| 744 | 3300049574 | Ga0501038_0706806 | Ga0501038_0706806_24_641 | 192 |
| 745 | 3300049587 | Ga0501071_0137284 | Ga0501071_0137284_640_1257 | 192 |
| 746 | 3300050490 | nmdc:mga03n38_16872_c1 | nmdc:mga03n38_16872_c1_1586_2203 | 192 |
| 747 | 3300050491 | nmdc:mga00v17_54226_c1 | nmdc:mga00v17_54226_c1_1466_2083 | 192 |
| 748 | 3300050492 | nmdc:mga0yw44_214191_c1 | nmdc:mga0yw44_214191_c1_258_869 | 192 |
| 749 | 3300050492 | nmdc:mga0yw44_92377_c1 | nmdc:mga0yw44_92377_c1_914_1531 | 192 |
| 750 | 3300050494 | nmdc:mga06z11_12821_c1 | nmdc:mga06z11_12821_c1_2888_3505 | 192 |
| 751 | 3300053080 | Ga0500635_0002719 | Ga0500635_0002719_1172_1789 | 192 |
| 752 | 3300053085 | Ga0495619_0020514 | Ga0495619_0020514_1384_2001 | 192 |
| 753 | 3300053096 | Ga0500641_0003878 | Ga0500641_0003878_510_1127 | 192 |
| 754 | 3300053102 | Ga0500554_011172 | Ga0500554_011172_514_1131 | 192 |
| 755 | 3300053104 | Ga0500556_0127841 | Ga0500556_0127841_351_962 | 192 |
| 756 | 3300053150 | Ga0500603_000622 | Ga0500603_000622_189_806 | 192 |
| 757 | 3300053151 | Ga0500604_0055446 | Ga0500604_0055446_289_906 | 192 |
| 758 | 3300053153 | Ga0500616_0035875 | Ga0500616_0035875_853_1464 | 192 |
| 759 | 3300053178 | Ga0500637_0036800 | Ga0500637_0036800_377_994 | 192 |
| 760 | 3300054114 | Ga0501084_0771424 | Ga0501084_0771424_107_724 | 192 |
| 761 | 3300003215 | JGI25153J46596_10004729 | JGI25153J46596_100047292 | 193 |
| 762 | 3300003775 | Ga0055524_1033317 | Ga0055524_10333172 | 193 |
| 763 | 3300005262 | Ga0065165_1005579 | Ga0065165_10055792 | 193 |
| 764 | 3300005337 | Ga0070682_100362227 | Ga0070682_1003622272 | 193 |
| 765 | 3300005468 | Ga0070707_100806320 | Ga0070707_1008063202 | 193 |
| 766 | 3300005548 | Ga0070665_100051132 | Ga0070665_1000511322 | 193 |
| 767 | 3300005548 | Ga0070665_100159586 | Ga0070665_1001595863 | 193 |
| 768 | 3300005548 | Ga0070665_100170354 | Ga0070665_1001703543 | 193 |
| 769 | 3300005563 | Ga0068855_100295314 | Ga0068855_1002953144 | 193 |
| 770 | 3300005617 | Ga0068859_100518645 | Ga0068859_1005186451 | 193 |
| 771 | 3300005618 | Ga0068864_100200341 | Ga0068864_1002003412 | 193 |
| 772 | 3300005719 | Ga0068861_100737502 | Ga0068861_1007375022 | 193 |
| 773 | 3300005834 | Ga0068851_10267047 | Ga0068851_102670472 | 193 |
| 774 | 3300006038 | Ga0075365_10135975 | Ga0075365_101359753 | 193 |
| 775 | 3300006042 | Ga0075368_10033993 | Ga0075368_100339932 | 193 |
| 776 | 3300006048 | Ga0075363_100053429 | Ga0075363_1000534292 | 193 |
| 777 | 3300006051 | Ga0075364_10007367 | Ga0075364_100073676 | 193 |
| 778 | 3300006175 | Ga0070712_100078491 | Ga0070712_1000784912 | 193 |
| 779 | 3300006186 | Ga0075369_10113709 | Ga0075369_101137091 | 193 |
| 780 | 3300006931 | Ga0097620_100518604 | Ga0097620_1005186041 | 193 |
| 781 | 3300009545 | Ga0105237_10417534 | Ga0105237_104175341 | 193 |
| 782 | 3300013296 | Ga0157374_10013680 | Ga0157374_100136807 | 193 |
| 783 | 3300014497 | Ga0182008_10214972 | Ga0182008_102149722 | 193 |
| 784 | 3300014745 | Ga0157377_10190164 | Ga0157377_101901642 | 193 |
| 785 | 3300014968 | Ga0157379_10596906 | Ga0157379_105969062 | 193 |
| 786 | 3300021321 | Ga0214542_1000156 | Ga0214542_100015686 | 193 |
| 787 | 3300021324 | Ga0214545_1000078 | Ga0214545_100007824 | 193 |
| 788 | 3300021327 | Ga0214543_1000136 | Ga0214543_100013624 | 193 |
| 789 | 3300025295 | Ga0209564_1053486 | Ga0209564_10534861 | 193 |
| 790 | 3300025297 | Ga0209758_1000109 | Ga0209758_1000109184 | 193 |
| 791 | 3300025299 | Ga0209256_1003201 | Ga0209256_100320110 | 193 |
| 792 | 3300025303 | Ga0209051_1024905 | Ga0209051_10249052 | 193 |
| 793 | 3300025304 | Ga0209257_1001604 | Ga0209257_100160410 | 193 |
| 794 | 3300025315 | Ga0207697_10080014 | Ga0207697_100800142 | 193 |
| 795 | 3300025901 | Ga0207688_10219437 | Ga0207688_102194371 | 193 |
| 796 | 3300025904 | Ga0207647_10002766 | Ga0207647_100027669 | 193 |
| 797 | 3300025905 | Ga0207685_10348431 | Ga0207685_103484312 | 193 |
| 798 | 3300025914 | Ga0207671_10029152 | Ga0207671_100291525 | 193 |
| 799 | 3300025915 | Ga0207693_10035497 | Ga0207693_100354972 | 193 |
| 800 | 3300025922 | Ga0207646_10656567 | Ga0207646_106565672 | 193 |
| 801 | 3300025931 | Ga0207644_10174292 | Ga0207644_101742921 | 193 |
| 802 | 3300026023 | Ga0207677_11181619 | Ga0207677_111816191 | 193 |
| 803 | 3300026078 | Ga0207702_10143973 | Ga0207702_101439732 | 193 |
| 804 | 3300026095 | Ga0207676_10351522 | Ga0207676_103515222 | 193 |
| 805 | 3300028379 | Ga0268266_10449696 | Ga0268266_104496962 | 193 |
| 806 | 3300031548 | Ga0307408_100826594 | Ga0307408_1008265941 | 193 |
| 807 | 3300031616 | Ga0307508_10126665 | Ga0307508_101266654 | 193 |
| 808 | 3300032002 | Ga0307416_101432414 | Ga0307416_1014324141 | 193 |
| 809 | 3300036401 | Ga0373937_0238302 | Ga0373937_0238302_402_1019 | 193 |
| 810 | 3300036459 | Ga0372808_002511 | Ga0372808_002511_1350_1967 | 193 |
| 811 | 3300045976 | Ga0466967_0268645 | Ga0466967_0268645_538_1158 | 193 |
| 812 | 3300046462 | Ga0495651_0063776 | Ga0495651_0063776_493_1110 | 193 |
| 813 | 3300046522 | Ga0495643_0011165 | Ga0495643_0011165_51_668 | 193 |
| 814 | 3300046524 | Ga0495648_0087725 | Ga0495648_0087725_788_1405 | 193 |
| 815 | 3300046809 | Ga0495600_0464161 | Ga0495600_0464161_85_702 | 193 |
| 816 | 3300048905 | Ga0496102_0027568 | Ga0496102_0027568_4301_4921 | 193 |
| 817 | 3300048906 | Ga0496103_0152319 | Ga0496103_0152319_666_1286 | 193 |
| 818 | 3300048907 | Ga0496104_0219268 | Ga0496104_0219268_781_1398 | 193 |
| 819 | 3300048908 | Ga0496105_0050230 | Ga0496105_0050230_70_690 | 193 |
| 820 | 3300048912 | Ga0496109_0115275 | Ga0496109_0115275_572_1189 | 193 |
| 821 | 3300048913 | Ga0496110_0160405 | Ga0496110_0160405_157_774 | 193 |
| 822 | 3300048914 | Ga0496111_0063387 | Ga0496111_0063387_40_660 | 193 |
| 823 | 3300048914 | Ga0496111_0405883 | Ga0496111_0405883_254_874 | 193 |
| 824 | 3300048915 | Ga0496112_0180646 | Ga0496112_0180646_706_1326 | 193 |
| 825 | 3300048923 | Ga0496120_0051799 | Ga0496120_0051799_1705_2322 | 193 |
| 826 | 3300048923 | Ga0496120_0088658 | Ga0496120_0088658_189_806 | 193 |
| 827 | 3300048924 | Ga0496121_0000125 | Ga0496121_0000125_137953_138570 | 193 |
| 828 | 3300048925 | Ga0496122_0277218 | Ga0496122_0277218_137_754 | 193 |
| 829 | 3300048926 | Ga0496123_0135646 | Ga0496123_0135646_61_678 | 193 |
| 830 | 3300048927 | Ga0496124_0398720 | Ga0496124_0398720_293_910 | 193 |
| 831 | 3300048929 | Ga0496126_0032681 | Ga0496126_0032681_576_1265 | 193 |
| 832 | 3300049460 | Ga0495682_0143113 | Ga0495682_0143113_16_633 | 193 |
| 833 | 3300050492 | nmdc:mga0yw44_64875_c1 | nmdc:mga0yw44_64875_c1_1582_2199 | 193 |
| 834 | 3300050496 | nmdc:mga07m45_146321_c1 | nmdc:mga07m45_146321_c1_30_647 | 193 |
| 835 | 3300053119 | Ga0500595_002526 | Ga0500595_002526_6886_7503 | 193 |
| 836 | 3300053139 | Ga0500568_0021247 | Ga0500568_0021247_2139_2756 | 193 |
| 837 | 3300001989 | JGI24739J22299_10037975 | JGI24739J22299_100379752 | 194 |
| 838 | 3300003203 | JGI25406J46586_10000956 | JGI25406J46586_1000095614 | 194 |
| 839 | 3300003215 | JGI25153J46596_10009931 | JGI25153J46596_100099315 | 194 |
| 840 | 3300003215 | JGI25153J46596_10013535 | JGI25153J46596_100135354 | 194 |
| 841 | 3300003659 | JGI25404J52841_10003837 | JGI25404J52841_100038373 | 194 |
| 842 | 3300003752 | Ga0055539_1012486 | Ga0055539_10124862 | 194 |
| 843 | 3300005262 | Ga0065165_1001827 | Ga0065165_100182715 | 194 |
| 844 | 3300005329 | Ga0070683_100003663 | Ga0070683_1000036631 | 194 |
| 845 | 3300005329 | Ga0070683_100682068 | Ga0070683_1006820682 | 194 |
| 846 | 3300005330 | Ga0070690_100543668 | Ga0070690_1005436681 | 194 |
| 847 | 3300005336 | Ga0070680_100427128 | Ga0070680_1004271281 | 194 |
| 848 | 3300005337 | Ga0070682_100096953 | Ga0070682_1000969532 | 194 |
| 849 | 3300005339 | Ga0070660_100366651 | Ga0070660_1003666511 | 194 |
| 850 | 3300005340 | Ga0070689_100420274 | Ga0070689_1004202742 | 194 |
| 851 | 3300005355 | Ga0070671_100116480 | Ga0070671_1001164801 | 194 |
| 852 | 3300005434 | Ga0070709_10062101 | Ga0070709_100621012 | 194 |
| 853 | 3300005435 | Ga0070714_100027307 | Ga0070714_1000273075 | 194 |
| 854 | 3300005436 | Ga0070713_100080503 | Ga0070713_1000805034 | 194 |
| 855 | 3300005455 | Ga0070663_100030326 | Ga0070663_1000303264 | 194 |
| 856 | 3300005455 | Ga0070663_100180131 | Ga0070663_1001801312 | 194 |
| 857 | 3300005456 | Ga0070678_100651572 | Ga0070678_1006515721 | 194 |
| 858 | 3300005457 | Ga0070662_100119590 | Ga0070662_1001195901 | 194 |
| 859 | 3300005458 | Ga0070681_10331122 | Ga0070681_103311221 | 194 |
| 860 | 3300005471 | Ga0070698_100061232 | Ga0070698_1000612324 | 194 |
| 861 | 3300005530 | Ga0070679_100118161 | Ga0070679_1001181611 | 194 |
| 862 | 3300005535 | Ga0070684_100002732 | Ga0070684_10000273213 | 194 |
| 863 | 3300005535 | Ga0070684_100035349 | Ga0070684_1000353492 | 194 |
| 864 | 3300005539 | Ga0068853_100024770 | Ga0068853_1000247703 | 194 |
| 865 | 3300005539 | Ga0068853_100100270 | Ga0068853_1001002704 | 194 |
| 866 | 3300005539 | Ga0068853_101045875 | Ga0068853_1010458751 | 194 |
| 867 | 3300005548 | Ga0070665_100006911 | Ga0070665_1000069114 | 194 |
| 868 | 3300005578 | Ga0068854_100194811 | Ga0068854_1001948113 | 194 |
| 869 | 3300005616 | Ga0068852_100200070 | Ga0068852_1002000703 | 194 |
| 870 | 3300005842 | Ga0068858_100538518 | Ga0068858_1005385182 | 194 |
| 871 | 3300005937 | Ga0081455_10006750 | Ga0081455_1000675015 | 194 |
| 872 | 3300005937 | Ga0081455_10062291 | Ga0081455_100622912 | 194 |
| 873 | 3300005983 | Ga0081540_1003811 | Ga0081540_100381113 | 194 |
| 874 | 3300005983 | Ga0081540_1007099 | Ga0081540_100709910 | 194 |
| 875 | 3300005983 | Ga0081540_1007462 | Ga0081540_10074625 | 194 |
| 876 | 3300005983 | Ga0081540_1013188 | Ga0081540_10131883 | 194 |
| 877 | 3300005983 | Ga0081540_1016372 | Ga0081540_10163722 | 194 |
| 878 | 3300005983 | Ga0081540_1029699 | Ga0081540_10296993 | 194 |
| 879 | 3300005985 | Ga0081539_10001182 | Ga0081539_1000118227 | 194 |
| 880 | 3300005985 | Ga0081539_10022473 | Ga0081539_100224734 | 194 |
| 881 | 3300006028 | Ga0070717_10019596 | Ga0070717_100195965 | 194 |
| 882 | 3300006038 | Ga0075365_10329353 | Ga0075365_103293532 | 194 |
| 883 | 3300006051 | Ga0075364_10117045 | Ga0075364_101170451 | 194 |
| 884 | 3300006175 | Ga0070712_100738384 | Ga0070712_1007383841 | 194 |
| 885 | 3300006186 | Ga0075369_10114072 | Ga0075369_101140721 | 194 |
| 886 | 3300006195 | Ga0075366_10029236 | Ga0075366_100292362 | 194 |
| 887 | 3300006353 | Ga0075370_10015394 | Ga0075370_100153944 | 194 |
| 888 | 3300006353 | Ga0075370_10027830 | Ga0075370_100278302 | 194 |
| 889 | 3300006358 | Ga0068871_100266722 | Ga0068871_1002667222 | 194 |
| 890 | 3300006941 | Ga0099825_1025526 | Ga0099825_10255263 | 194 |
| 891 | 3300006941 | Ga0099825_1027160 | Ga0099825_10271603 | 194 |
| 892 | 3300006942 | Ga0099824_1006625 | Ga0099824_100662514 | 194 |
| 893 | 3300006942 | Ga0099824_1015178 | Ga0099824_10151783 | 194 |
| 894 | 3300006943 | Ga0099822_1003046 | Ga0099822_100304623 | 194 |
| 895 | 3300006944 | Ga0099823_1022654 | Ga0099823_10226546 | 194 |
| 896 | 3300009101 | Ga0105247_10020411 | Ga0105247_100204114 | 194 |
| 897 | 3300009101 | Ga0105247_10418772 | Ga0105247_104187722 | 194 |
| 898 | 3300009147 | Ga0114129_10491130 | Ga0114129_104911302 | 194 |
| 899 | 3300009545 | Ga0105237_10188668 | Ga0105237_101886682 | 194 |
| 900 | 3300009545 | Ga0105237_10265806 | Ga0105237_102658063 | 194 |
| 901 | 3300009551 | Ga0105238_10608766 | Ga0105238_106087662 | 194 |
| 902 | 3300009553 | Ga0105249_10284382 | Ga0105249_102843822 | 194 |
| 903 | 3300010375 | Ga0105239_10088222 | Ga0105239_100882221 | 194 |
| 904 | 3300010375 | Ga0105239_10412923 | Ga0105239_104129232 | 194 |
| 905 | 3300011119 | Ga0105246_11040625 | Ga0105246_110406251 | 194 |
| 906 | 3300012488 | Ga0157343_1010179 | Ga0157343_10101791 | 194 |
| 907 | 3300013104 | Ga0157370_10723833 | Ga0157370_107238332 | 194 |
| 908 | 3300013105 | Ga0157369_10010164 | Ga0157369_100101641 | 194 |
| 909 | 3300013105 | Ga0157369_10248477 | Ga0157369_102484774 | 194 |
| 910 | 3300013296 | Ga0157374_10047448 | Ga0157374_100474483 | 194 |
| 911 | 3300013306 | Ga0163162_11031758 | Ga0163162_110317581 | 194 |
| 912 | 3300013306 | Ga0163162_11374083 | Ga0163162_113740832 | 194 |
| 913 | 3300013308 | Ga0157375_10073559 | Ga0157375_100735594 | 194 |
| 914 | 3300014325 | Ga0163163_10033065 | Ga0163163_100330652 | 194 |
| 915 | 3300014745 | Ga0157377_10135122 | Ga0157377_101351221 | 194 |
| 916 | 3300021320 | Ga0214544_1000163 | Ga0214544_100016324 | 194 |
| 917 | 3300021327 | Ga0214543_1043876 | Ga0214543_10438761 | 194 |
| 918 | 3300021358 | Ga0213873_10037378 | Ga0213873_100373782 | 194 |
| 919 | 3300021361 | Ga0213872_10044316 | Ga0213872_100443163 | 194 |
| 920 | 3300021377 | Ga0213874_10024497 | Ga0213874_100244972 | 194 |
| 921 | 3300021377 | Ga0213874_10067548 | Ga0213874_100675481 | 194 |
| 922 | 3300021377 | Ga0213874_10126299 | Ga0213874_101262992 | 194 |
| 923 | 3300025230 | Ga0209563_101608 | Ga0209563_1016086 | 194 |
| 924 | 3300025253 | Ga0209677_111207 | Ga0209677_1112072 | 194 |
| 925 | 3300025261 | Ga0209233_1002828 | Ga0209233_10028283 | 194 |
| 926 | 3300025295 | Ga0209564_1000532 | Ga0209564_10005324 | 194 |
| 927 | 3300025297 | Ga0209758_1000938 | Ga0209758_10009385 | 194 |
| 928 | 3300025297 | Ga0209758_1009535 | Ga0209758_10095356 | 194 |
| 929 | 3300025297 | Ga0209758_1009772 | Ga0209758_10097728 | 194 |
| 930 | 3300025302 | Ga0207426_1002293 | Ga0207426_10022939 | 194 |
| 931 | 3300025900 | Ga0207710_10151631 | Ga0207710_101516312 | 194 |
| 932 | 3300025906 | Ga0207699_10034307 | Ga0207699_100343074 | 194 |
| 933 | 3300025909 | Ga0207705_10153732 | Ga0207705_101537322 | 194 |
| 934 | 3300025910 | Ga0207684_10303315 | Ga0207684_103033151 | 194 |
| 935 | 3300025912 | Ga0207707_10006974 | Ga0207707_100069743 | 194 |
| 936 | 3300025913 | Ga0207695_10476172 | Ga0207695_104761721 | 194 |
| 937 | 3300025915 | Ga0207693_10187764 | Ga0207693_101877641 | 194 |
| 938 | 3300025917 | Ga0207660_10374813 | Ga0207660_103748131 | 194 |
| 939 | 3300025919 | Ga0207657_10117281 | Ga0207657_101172811 | 194 |
| 940 | 3300025921 | Ga0207652_10010388 | Ga0207652_100103881 | 194 |
| 941 | 3300025922 | Ga0207646_10854170 | Ga0207646_108541701 | 194 |
| 942 | 3300025924 | Ga0207694_10293812 | Ga0207694_102938121 | 194 |
| 943 | 3300025924 | Ga0207694_10876994 | Ga0207694_108769941 | 194 |
| 944 | 3300025928 | Ga0207700_10039961 | Ga0207700_100399613 | 194 |
| 945 | 3300025928 | Ga0207700_10043510 | Ga0207700_100435101 | 194 |
| 946 | 3300025928 | Ga0207700_10662511 | Ga0207700_106625112 | 194 |
| 947 | 3300025929 | Ga0207664_10024402 | Ga0207664_100244024 | 194 |
| 948 | 3300025929 | Ga0207664_11027879 | Ga0207664_110278791 | 194 |
| 949 | 3300025932 | Ga0207690_10130306 | Ga0207690_101303062 | 194 |
| 950 | 3300025932 | Ga0207690_10173140 | Ga0207690_101731401 | 194 |
| 951 | 3300025933 | Ga0207706_10208702 | Ga0207706_102087021 | 194 |
| 952 | 3300025936 | Ga0207670_10329772 | Ga0207670_103297722 | 194 |
| 953 | 3300025944 | Ga0207661_10003335 | Ga0207661_1000333510 | 194 |
| 954 | 3300025944 | Ga0207661_10064261 | Ga0207661_100642611 | 194 |
| 955 | 3300025945 | Ga0207679_10379129 | Ga0207679_103791291 | 194 |
| 956 | 3300025949 | Ga0207667_10224824 | Ga0207667_102248242 | 194 |
| 957 | 3300025949 | Ga0207667_10600425 | Ga0207667_106004252 | 194 |
| 958 | 3300025972 | Ga0207668_10026980 | Ga0207668_100269804 | 194 |
| 959 | 3300026035 | Ga0207703_10471257 | Ga0207703_104712572 | 194 |
| 960 | 3300026041 | Ga0207639_10342341 | Ga0207639_103423412 | 194 |
| 961 | 3300026067 | Ga0207678_10032634 | Ga0207678_100326347 | 194 |
| 962 | 3300026067 | Ga0207678_10057246 | Ga0207678_100572463 | 194 |
| 963 | 3300026067 | Ga0207678_10279546 | Ga0207678_102795461 | 194 |
| 964 | 3300026067 | Ga0207678_10675784 | Ga0207678_106757841 | 194 |
| 965 | 3300026067 | Ga0207678_10966962 | Ga0207678_109669621 | 194 |
| 966 | 3300026089 | Ga0207648_10221584 | Ga0207648_102215843 | 194 |
| 967 | 3300026121 | Ga0207683_10975556 | Ga0207683_109755561 | 194 |
| 968 | 3300026142 | Ga0207698_10221475 | Ga0207698_102214752 | 194 |
| 969 | 3300027296 | Ga0209389_1000019 | Ga0209389_100001915 | 194 |
| 970 | 3300027296 | Ga0209389_1000880 | Ga0209389_100088019 | 194 |
| 971 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007356 | 194 |
| 972 | 3300027357 | Ga0209589_1000897 | Ga0209589_100089719 | 194 |
| 973 | 3300027361 | Ga0209489_100008 | Ga0209489_100008356 | 194 |
| 974 | 3300027361 | Ga0209489_100033 | Ga0209489_10003315 | 194 |
| 975 | 3300027361 | Ga0209489_100110 | Ga0209489_10011087 | 194 |
| 976 | 3300027363 | Ga0209700_100009 | Ga0209700_100009356 | 194 |
| 977 | 3300027363 | Ga0209700_100012 | Ga0209700_100012352 | 194 |
| 978 | 3300028379 | Ga0268266_10656684 | Ga0268266_106566842 | 194 |
| 979 | 3300028794 | Ga0307515_10118872 | Ga0307515_101188722 | 194 |
| 980 | 3300031235 | Ga0265330_10027960 | Ga0265330_100279605 | 194 |
| 981 | 3300031247 | Ga0265340_10105297 | Ga0265340_101052971 | 194 |
| 982 | 3300031249 | Ga0265339_10008955 | Ga0265339_100089555 | 194 |
| 983 | 3300031250 | Ga0265331_10140398 | Ga0265331_101403982 | 194 |
| 984 | 3300031616 | Ga0307508_10452287 | Ga0307508_104522871 | 194 |
| 985 | 3300031711 | Ga0265314_10036736 | Ga0265314_100367363 | 194 |
| 986 | 3300031712 | Ga0265342_10022364 | Ga0265342_100223642 | 194 |
| 987 | 3300033180 | Ga0307510_10138019 | Ga0307510_101380191 | 194 |
| 988 | 3300035086 | Ga0373934_0021442 | Ga0373934_0021442_1582_2196 | 194 |
| 989 | 3300035118 | Ga0373954_0026019 | Ga0373954_0026019_1076_1690 | 194 |
| 990 | 3300035119 | Ga0373956_0023981 | Ga0373956_0023981_479_1093 | 194 |
| 991 | 3300035172 | Ga0373955_0056849 | Ga0373955_0056849_315_929 | 194 |
| 992 | 3300035410 | Ga0373924_0065013 | Ga0373924_0065013_336_950 | 194 |
| 993 | 3300035410 | Ga0373924_0075561 | Ga0373924_0075561_185_802 | 194 |
| 994 | 3300035692 | Ga0373935_0083518 | Ga0373935_0083518_1038_1652 | 194 |
| 995 | 3300035695 | Ga0373927_0060534 | Ga0373927_0060534_1290_1907 | 194 |
| 996 | 3300035724 | Ga0373933_0000127 | Ga0373933_0000127_17143_17760 | 194 |
| 997 | 3300035724 | Ga0373933_0240895 | Ga0373933_0240895_130_747 | 194 |
| 998 | 3300035724 | Ga0373933_0265210 | Ga0373933_0265210_361_975 | 194 |
| 999 | 3300036401 | Ga0373937_0027265 | Ga0373937_0027265_2701_3318 | 194 |
| 1000 | 3300036401 | Ga0373937_0089249 | Ga0373937_0089249_373_987 | 194 |
| 1001 | 3300036401 | Ga0373937_0669900 | Ga0373937_0669900_193_807 | 194 |
| 1002 | 3300037418 | Ga0395900_0023448 | Ga0395900_0023448_3275_3895 | 194 |
| 1003 | 3300037471 | Ga0395905_0081904 | Ga0395905_0081904_157_777 | 194 |
| 1004 | 3300037471 | Ga0395905_0831561 | Ga0395905_0831561_187_807 | 194 |
| 1005 | 3300038443 | Ga0395901_0102114 | Ga0395901_0102114_1479_2099 | 194 |
| 1006 | 3300039437 | Ga0436365_0368752 | Ga0436365_0368752_1129_1746 | 194 |
| 1007 | 3300039437 | Ga0436365_0547166 | Ga0436365_0547166_645_1259 | 194 |
| 1008 | 3300039438 | Ga0436360_1334781 | Ga0436360_1334781_244_861 | 194 |
| 1009 | 3300039447 | Ga0436361_0862252 | Ga0436361_0862252_284_901 | 194 |
| 1010 | 3300039450 | Ga0436363_0756020 | Ga0436363_0756020_185_805 | 194 |
| 1011 | 3300039450 | Ga0436363_0779713 | Ga0436363_0779713_2262_2876 | 194 |
| 1012 | 3300039450 | Ga0436363_1042782 | Ga0436363_1042782_2219_2851 | 194 |
| 1013 | 3300039453 | Ga0436362_0134504 | Ga0436362_0134504_1229_1846 | 194 |
| 1014 | 3300041451 | Ga0451791_1147245 | Ga0451791_1147245_11_631 | 194 |
| 1015 | 3300041460 | Ga0451802_1371745 | Ga0451802_1371745_230_850 | 194 |
| 1016 | 3300044656 | Ga0466969_0027941 | Ga0466969_0027941_810_1427 | 194 |
| 1017 | 3300044656 | Ga0466969_0215109 | Ga0466969_0215109_215_829 | 194 |
| 1018 | 3300044683 | Ga0466965_0099238 | Ga0466965_0099238_747_1367 | 194 |
| 1019 | 3300044684 | Ga0466966_0000632 | Ga0466966_0000632_16300_16917 | 194 |
| 1020 | 3300044684 | Ga0466966_0057282 | Ga0466966_0057282_331_945 | 194 |
| 1021 | 3300044684 | Ga0466966_0084103 | Ga0466966_0084103_86_703 | 194 |
| 1022 | 3300044693 | Ga0466961_0000897 | Ga0466961_0000897_16419_17036 | 194 |
| 1023 | 3300044694 | Ga0466963_0370225 | Ga0466963_0370225_130_750 | 194 |
| 1024 | 3300044842 | Ga0466957_0139098 | Ga0466957_0139098_125_742 | 194 |
| 1025 | 3300044901 | Ga0466960_0020623 | Ga0466960_0020623_282_902 | 194 |
| 1026 | 3300045049 | Ga0466959_0004435 | Ga0466959_0004435_1751_2368 | 194 |
| 1027 | 3300045049 | Ga0466959_0035818 | Ga0466959_0035818_309_923 | 194 |
| 1028 | 3300045049 | Ga0466959_0298228 | Ga0466959_0298228_355_972 | 194 |
| 1029 | 3300045976 | Ga0466967_0135506 | Ga0466967_0135506_1012_1632 | 194 |
| 1030 | 3300046454 | Ga0495592_0140292 | Ga0495592_0140292_108_728 | 194 |
| 1031 | 3300046455 | Ga0495603_0097065 | Ga0495603_0097065_935_1555 | 194 |
| 1032 | 3300046460 | Ga0495638_0023867 | Ga0495638_0023867_2837_3457 | 194 |
| 1033 | 3300046460 | Ga0495638_0030772 | Ga0495638_0030772_2583_3200 | 194 |
| 1034 | 3300046460 | Ga0495638_0091842 | Ga0495638_0091842_962_1579 | 194 |
| 1035 | 3300046462 | Ga0495651_0022721 | Ga0495651_0022721_352_972 | 194 |
| 1036 | 3300046462 | Ga0495651_0043109 | Ga0495651_0043109_705_1319 | 194 |
| 1037 | 3300046462 | Ga0495651_0090764 | Ga0495651_0090764_739_1353 | 194 |
| 1038 | 3300046463 | Ga0495653_0088004 | Ga0495653_0088004_1255_1875 | 194 |
| 1039 | 3300046471 | Ga0495650_0110195 | Ga0495650_0110195_236_856 | 194 |
| 1040 | 3300046472 | Ga0495580_0627811 | Ga0495580_0627811_45_662 | 194 |
| 1041 | 3300046474 | Ga0495605_0109212 | Ga0495605_0109212_311_931 | 194 |
| 1042 | 3300046477 | Ga0495664_0043121 | Ga0495664_0043121_1809_2423 | 194 |
| 1043 | 3300046477 | Ga0495664_0043518 | Ga0495664_0043518_980_1600 | 194 |
| 1044 | 3300046477 | Ga0495664_0091342 | Ga0495664_0091342_643_1263 | 194 |
| 1045 | 3300046511 | Ga0495608_0097641 | Ga0495608_0097641_403_1023 | 194 |
| 1046 | 3300046512 | Ga0495610_0120719 | Ga0495610_0120719_80_697 | 194 |
| 1047 | 3300046513 | Ga0495616_0186379 | Ga0495616_0186379_279_896 | 194 |
| 1048 | 3300046514 | Ga0495618_0173006 | Ga0495618_0173006_179_793 | 194 |
| 1049 | 3300046515 | Ga0495620_0056120 | Ga0495620_0056120_707_1327 | 194 |
| 1050 | 3300046516 | Ga0495628_0018136 | Ga0495628_0018136_1918_2532 | 194 |
| 1051 | 3300046516 | Ga0495628_0375163 | Ga0495628_0375163_50_670 | 194 |
| 1052 | 3300046517 | Ga0495630_0186812 | Ga0495630_0186812_889_1503 | 194 |
| 1053 | 3300046518 | Ga0495631_0173670 | Ga0495631_0173670_192_809 | 194 |
| 1054 | 3300046522 | Ga0495643_0244724 | Ga0495643_0244724_184_801 | 194 |
| 1055 | 3300046523 | Ga0495644_0163388 | Ga0495644_0163388_190_810 | 194 |
| 1056 | 3300046524 | Ga0495648_0008154 | Ga0495648_0008154_1676_2293 | 194 |
| 1057 | 3300046524 | Ga0495648_0035226 | Ga0495648_0035226_793_1413 | 194 |
| 1058 | 3300046524 | Ga0495648_0101946 | Ga0495648_0101946_428_1048 | 194 |
| 1059 | 3300046524 | Ga0495648_0146599 | Ga0495648_0146599_367_984 | 194 |
| 1060 | 3300046524 | Ga0495648_0323115 | Ga0495648_0323115_23_643 | 194 |
| 1061 | 3300046526 | Ga0495666_0211888 | Ga0495666_0211888_72_689 | 194 |
| 1062 | 3300046529 | Ga0495652_0004702 | Ga0495652_0004702_9873_10493 | 194 |
| 1063 | 3300046529 | Ga0495652_0126608 | Ga0495652_0126608_591_1205 | 194 |
| 1064 | 3300046530 | Ga0495654_0020872 | Ga0495654_0020872_842_1459 | 194 |
| 1065 | 3300046533 | Ga0495640_0206161 | Ga0495640_0206161_321_935 | 194 |
| 1066 | 3300046536 | Ga0495587_0031425 | Ga0495587_0031425_1865_2485 | 194 |
| 1067 | 3300046536 | Ga0495587_0058205 | Ga0495587_0058205_78_692 | 194 |
| 1068 | 3300046543 | Ga0495645_0061947 | Ga0495645_0061947_58_672 | 194 |
| 1069 | 3300046543 | Ga0495645_0069362 | Ga0495645_0069362_156_776 | 194 |
| 1070 | 3300046543 | Ga0495645_0096018 | Ga0495645_0096018_1185_1805 | 194 |
| 1071 | 3300046557 | Ga0495622_0025030 | Ga0495622_0025030_548_1168 | 194 |
| 1072 | 3300046557 | Ga0495622_0031167 | Ga0495622_0031167_125_742 | 194 |
| 1073 | 3300046559 | Ga0495667_0075923 | Ga0495667_0075923_1276_1890 | 194 |
| 1074 | 3300046559 | Ga0495667_0141940 | Ga0495667_0141940_722_1342 | 194 |
| 1075 | 3300046616 | Ga0495668_0140594 | Ga0495668_0140594_521_1141 | 194 |
| 1076 | 3300046660 | Ga0495625_0138384 | Ga0495625_0138384_817_1437 | 194 |
| 1077 | 3300046665 | Ga0495661_0142722 | Ga0495661_0142722_661_1281 | 194 |
| 1078 | 3300046665 | Ga0495661_0321456 | Ga0495661_0321456_36_656 | 194 |
| 1079 | 3300046674 | Ga0495588_0024575 | Ga0495588_0024575_1244_1864 | 194 |
| 1080 | 3300046675 | Ga0495657_0010925 | Ga0495657_0010925_1950_2570 | 194 |
| 1081 | 3300046678 | Ga0495599_0008515 | Ga0495599_0008515_1708_2328 | 194 |
| 1082 | 3300046678 | Ga0495599_0222184 | Ga0495599_0222184_503_1123 | 194 |
| 1083 | 3300046679 | Ga0495623_0054800 | Ga0495623_0054800_1132_1752 | 194 |
| 1084 | 3300046679 | Ga0495623_0250544 | Ga0495623_0250544_285_899 | 194 |
| 1085 | 3300046680 | Ga0495646_0019570 | Ga0495646_0019570_1211_1825 | 194 |
| 1086 | 3300046680 | Ga0495646_0064544 | Ga0495646_0064544_941_1561 | 194 |
| 1087 | 3300046683 | Ga0495658_0472031 | Ga0495658_0472031_158_778 | 194 |
| 1088 | 3300046689 | Ga0495613_0039815 | Ga0495613_0039815_2167_2787 | 194 |
| 1089 | 3300046691 | Ga0495670_0008140 | Ga0495670_0008140_782_1399 | 194 |
| 1090 | 3300046694 | Ga0495649_0143514 | Ga0495649_0143514_148_768 | 194 |
| 1091 | 3300046794 | Ga0495589_0164040 | Ga0495589_0164040_429_1046 | 194 |
| 1092 | 3300046809 | Ga0495600_0090783 | Ga0495600_0090783_828_1448 | 194 |
| 1093 | 3300047315 | Ga0495581_0270178 | Ga0495581_0270178_23_640 | 194 |
| 1094 | 3300047317 | Ga0495604_0076979 | Ga0495604_0076979_1608_2228 | 194 |
| 1095 | 3300047317 | Ga0495604_0077995 | Ga0495604_0077995_662_1276 | 194 |
| 1096 | 3300047319 | Ga0495674_0045519 | Ga0495674_0045519_1884_2498 | 194 |
| 1097 | 3300047319 | Ga0495674_0083343 | Ga0495674_0083343_1242_1862 | 194 |
| 1098 | 3300047319 | Ga0495674_0447778 | Ga0495674_0447778_68_685 | 194 |
| 1099 | 3300047322 | Ga0495680_0001058 | Ga0495680_0001058_22993_23613 | 194 |
| 1100 | 3300047322 | Ga0495680_0075816 | Ga0495680_0075816_341_955 | 194 |
| 1101 | 3300047444 | Ga0495675_0045612 | Ga0495675_0045612_903_1517 | 194 |
| 1102 | 3300047471 | Ga0495684_0089430 | Ga0495684_0089430_108_728 | 194 |
| 1103 | 3300047471 | Ga0495684_0097252 | Ga0495684_0097252_160_774 | 194 |
| 1104 | 3300047471 | Ga0495684_0518169 | Ga0495684_0518169_28_642 | 194 |
| 1105 | 3300047472 | Ga0495686_0027319 | Ga0495686_0027319_975_1592 | 194 |
| 1106 | 3300047472 | Ga0495686_0117128 | Ga0495686_0117128_415_1101 | 194 |
| 1107 | 3300047472 | Ga0495686_0252232 | Ga0495686_0252232_321_941 | 194 |
| 1108 | 3300048088 | Ga0495602_0033384 | Ga0495602_0033384_2652_3272 | 194 |
| 1109 | 3300048088 | Ga0495602_0073454 | Ga0495602_0073454_1059_1673 | 194 |
| 1110 | 3300048091 | Ga0495626_0234328 | Ga0495626_0234328_17_637 | 194 |
| 1111 | 3300048903 | Ga0496100_0567242 | Ga0496100_0567242_95_712 | 194 |
| 1112 | 3300048904 | Ga0496101_0593743 | Ga0496101_0593743_173_793 | 194 |
| 1113 | 3300048905 | Ga0496102_0128519 | Ga0496102_0128519_12_632 | 194 |
| 1114 | 3300048905 | Ga0496102_0243168 | Ga0496102_0243168_856_1470 | 194 |
| 1115 | 3300048906 | Ga0496103_0189649 | Ga0496103_0189649_323_943 | 194 |
| 1116 | 3300048906 | Ga0496103_0355448 | Ga0496103_0355448_195_809 | 194 |
| 1117 | 3300048907 | Ga0496104_0023058 | Ga0496104_0023058_5040_5654 | 194 |
| 1118 | 3300048907 | Ga0496104_0058026 | Ga0496104_0058026_1296_1916 | 194 |
| 1119 | 3300048908 | Ga0496105_0003256 | Ga0496105_0003256_1058_1678 | 194 |
| 1120 | 3300048908 | Ga0496105_0100928 | Ga0496105_0100928_527_1144 | 194 |
| 1121 | 3300048909 | Ga0496106_0021369 | Ga0496106_0021369_3021_3635 | 194 |
| 1122 | 3300048910 | Ga0496107_0068714 | Ga0496107_0068714_630_1250 | 194 |
| 1123 | 3300048912 | Ga0496109_0230326 | Ga0496109_0230326_561_1181 | 194 |
| 1124 | 3300048912 | Ga0496109_0362814 | Ga0496109_0362814_450_1064 | 194 |
| 1125 | 3300048913 | Ga0496110_0041874 | Ga0496110_0041874_1099_1713 | 194 |
| 1126 | 3300048915 | Ga0496112_0108545 | Ga0496112_0108545_2015_2629 | 194 |
| 1127 | 3300048915 | Ga0496112_0173926 | Ga0496112_0173926_167_784 | 194 |
| 1128 | 3300048919 | Ga0496116_0002646 | Ga0496116_0002646_14725_15408 | 194 |
| 1129 | 3300048919 | Ga0496116_0039136 | Ga0496116_0039136_2079_2699 | 194 |
| 1130 | 3300048919 | Ga0496116_0112190 | Ga0496116_0112190_32_652 | 194 |
| 1131 | 3300048920 | Ga0496117_0084805 | Ga0496117_0084805_838_1455 | 194 |
| 1132 | 3300048920 | Ga0496117_0181706 | Ga0496117_0181706_445_1065 | 194 |
| 1133 | 3300048921 | Ga0496118_0044149 | Ga0496118_0044149_822_1439 | 194 |
| 1134 | 3300048922 | Ga0496119_0043790 | Ga0496119_0043790_1252_1872 | 194 |
| 1135 | 3300048923 | Ga0496120_0096386 | Ga0496120_0096386_321_938 | 194 |
| 1136 | 3300048924 | Ga0496121_0008599 | Ga0496121_0008599_9061_9678 | 194 |
| 1137 | 3300048924 | Ga0496121_0076460 | Ga0496121_0076460_161_781 | 194 |
| 1138 | 3300048924 | Ga0496121_0210360 | Ga0496121_0210360_118_738 | 194 |
| 1139 | 3300048925 | Ga0496122_0056702 | Ga0496122_0056702_1347_1979 | 194 |
| 1140 | 3300048925 | Ga0496122_0142229 | Ga0496122_0142229_494_1111 | 194 |
| 1141 | 3300048926 | Ga0496123_0027721 | Ga0496123_0027721_1468_2085 | 194 |
| 1142 | 3300048926 | Ga0496123_0088597 | Ga0496123_0088597_938_1555 | 194 |
| 1143 | 3300048927 | Ga0496124_0094473 | Ga0496124_0094473_1266_1883 | 194 |
| 1144 | 3300048927 | Ga0496124_0311498 | Ga0496124_0311498_147_764 | 194 |
| 1145 | 3300048928 | Ga0496125_0008788 | Ga0496125_0008788_595_1212 | 194 |
| 1146 | 3300048929 | Ga0496126_0003769 | Ga0496126_0003769_17996_18613 | 194 |
| 1147 | 3300048929 | Ga0496126_0012961 | Ga0496126_0012961_3465_4082 | 194 |
| 1148 | 3300048929 | Ga0496126_0027303 | Ga0496126_0027303_4344_4961 | 194 |
| 1149 | 3300048929 | Ga0496126_0061654 | Ga0496126_0061654_503_1123 | 194 |
| 1150 | 3300048929 | Ga0496126_0078583 | Ga0496126_0078583_1170_1790 | 194 |
| 1151 | 3300048929 | Ga0496126_0259269 | Ga0496126_0259269_103_720 | 194 |
| 1152 | 3300048929 | Ga0496126_0402242 | Ga0496126_0402242_23_637 | 194 |
| 1153 | 3300049580 | Ga0501046_0039535 | Ga0501046_0039535_2921_3541 | 194 |
| 1154 | 3300049589 | Ga0501073_0260568 | Ga0501073_0260568_341_961 | 194 |
| 1155 | 3300049742 | Ga0501080_0242339 | Ga0501080_0242339_379_999 | 194 |
| 1156 | 3300050491 | nmdc:mga00v17_42220_c1 | nmdc:mga00v17_42220_c1_2098_2730 | 194 |
| 1157 | 3300050492 | nmdc:mga0yw44_242129_c1 | nmdc:mga0yw44_242129_c1_146_766 | 194 |
| 1158 | 3300050493 | nmdc:mga0k408_171755_c1 | nmdc:mga0k408_171755_c1_373_993 | 194 |
| 1159 | 3300050496 | nmdc:mga07m45_200702_c1 | nmdc:mga07m45_200702_c1_84_704 | 194 |
| 1160 | 3300050507 | nmdc:mga05p37_387592_c1 | nmdc:mga05p37_387592_c1_304_921 | 194 |
| 1161 | 3300050516 | nmdc:mga0sz30_188296_c1 | nmdc:mga0sz30_188296_c1_116_817 | 194 |
| 1162 | 3300053077 | Ga0495601_0034790 | Ga0495601_0034790_1567_2181 | 194 |
| 1163 | 3300053077 | Ga0495601_0049041 | Ga0495601_0049041_396_1016 | 194 |
| 1164 | 3300053077 | Ga0495601_0210260 | Ga0495601_0210260_250_870 | 194 |
| 1165 | 3300053078 | Ga0495612_0052290 | Ga0495612_0052290_298_912 | 194 |
| 1166 | 3300053078 | Ga0495612_0073744 | Ga0495612_0073744_34_654 | 194 |
| 1167 | 3300053084 | Ga0495595_0025394 | Ga0495595_0025394_1713_2327 | 194 |
| 1168 | 3300053085 | Ga0495619_0023185 | Ga0495619_0023185_1815_2429 | 194 |
| 1169 | 3300053085 | Ga0495619_0509436 | Ga0495619_0509436_196_816 | 194 |
| 1170 | 3300053086 | Ga0500578_0035459 | Ga0500578_0035459_1293_1913 | 194 |
| 1171 | 3300053086 | Ga0500578_0056796 | Ga0500578_0056796_1305_1925 | 194 |
| 1172 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_138615_139235 | 194 |
| 1173 | 3300053087 | Ga0500643_025224 | Ga0500643_025224_635_1255 | 194 |
| 1174 | 3300053093 | Ga0500651_0164309 | Ga0500651_0164309_283_900 | 194 |
| 1175 | 3300053094 | Ga0500566_0000329 | Ga0500566_0000329_5001_5618 | 194 |
| 1176 | 3300053096 | Ga0500641_0021761 | Ga0500641_0021761_286_906 | 194 |
| 1177 | 3300053098 | Ga0500650_0000589 | Ga0500650_0000589_6469_7086 | 194 |
| 1178 | 3300053104 | Ga0500556_0000238 | Ga0500556_0000238_37185_37802 | 194 |
| 1179 | 3300053108 | Ga0500562_010221 | Ga0500562_010221_184_804 | 194 |
| 1180 | 3300053111 | Ga0500572_031194 | Ga0500572_031194_833_1453 | 194 |
| 1181 | 3300053116 | Ga0500592_000637 | Ga0500592_000637_2598_3215 | 194 |
| 1182 | 3300053118 | Ga0500594_0027947 | Ga0500594_0027947_242_859 | 194 |
| 1183 | 3300053121 | Ga0500607_027031 | Ga0500607_027031_1074_1694 | 194 |
| 1184 | 3300053122 | Ga0500608_095611 | Ga0500608_095611_569_1186 | 194 |
| 1185 | 3300053130 | Ga0500642_0000108 | Ga0500642_0000108_17839_18456 | 194 |
| 1186 | 3300053130 | Ga0500642_0049086 | Ga0500642_0049086_991_1611 | 194 |
| 1187 | 3300053131 | Ga0500652_002951 | Ga0500652_002951_782_1399 | 194 |
| 1188 | 3300053134 | Ga0500658_0042410 | Ga0500658_0042410_204_821 | 194 |
| 1189 | 3300053134 | Ga0500658_0057738 | Ga0500658_0057738_561_1181 | 194 |
| 1190 | 3300053136 | Ga0500559_0000839 | Ga0500559_0000839_16779_17396 | 194 |
| 1191 | 3300053136 | Ga0500559_0006971 | Ga0500559_0006971_396_1016 | 194 |
| 1192 | 3300053138 | Ga0500564_024677 | Ga0500564_024677_56_676 | 194 |
| 1193 | 3300053139 | Ga0500568_0011393 | Ga0500568_0011393_542_1162 | 194 |
| 1194 | 3300053139 | Ga0500568_0018904 | Ga0500568_0018904_758_1411 | 194 |
| 1195 | 3300053145 | Ga0500586_001118 | Ga0500586_001118_4192_4809 | 194 |
| 1196 | 3300053146 | Ga0500588_0076625 | Ga0500588_0076625_41_661 | 194 |
| 1197 | 3300053148 | Ga0500590_059453 | Ga0500590_059453_480_1097 | 194 |
| 1198 | 3300053151 | Ga0500604_0004045 | Ga0500604_0004045_2578_3195 | 194 |
| 1199 | 3300053151 | Ga0500604_0054951 | Ga0500604_0054951_249_869 | 194 |
| 1200 | 3300053153 | Ga0500616_0000197 | Ga0500616_0000197_16625_17242 | 194 |
| 1201 | 3300053154 | Ga0500619_020679 | Ga0500619_020679_235_855 | 194 |
| 1202 | 3300053156 | Ga0500622_0002972 | Ga0500622_0002972_8603_9220 | 194 |
| 1203 | 3300053156 | Ga0500622_0060366 | Ga0500622_0060366_1275_1895 | 194 |
| 1204 | 3300053158 | Ga0500627_0049036 | Ga0500627_0049036_730_1350 | 194 |
| 1205 | 3300053177 | Ga0500636_0000390 | Ga0500636_0000390_20169_20789 | 194 |
| 1206 | 3300053177 | Ga0500636_0002715 | Ga0500636_0002715_137_754 | 194 |
| 1207 | 3300053724 | Ga0500570_119848 | Ga0500570_119848_113_730 | 194 |
| 1208 | 3300053730 | Ga0500645_035466 | Ga0500645_035466_121_738 | 194 |
| 1209 | 3300053736 | Ga0500599_003770 | Ga0500599_003770_788_1408 | 194 |
| 1210 | 3300055283 | Ga0500661_046636 | Ga0500661_046636_41_661 | 194 |
| 1211 | iso_pu_bacteria | 2602042107 | 2603857549 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8jtc-assembly1.cif.gz_A | human vmat2 complex with reserpine | 0.4116 | 18 | 192 |
| 8evu-assembly1.cif.gz_E | cryo em structure of vibrio cholerae nqr | 0.4013 | 3 | 191 |
| 6rw3-assembly2.cif.gz_B | the molecular basis for sugar import in malaria parasites. | 0.4009 | 1 | 187 |
| 6rw3-assembly4.cif.gz_D | the molecular basis for sugar import in malaria parasites. | 0.3997 | 1 | 193 |
| 8f6h-assembly1.cif.gz_B | cryo-em structure of a zinc-loaded asymmetrical tmd d70a mutant of the yiip-fab complex | 0.3992 | 9 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2R4J1_1_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6871 | 4 | 193 | 1.20.1250.20 |
| af_Q2R4J1_1_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6751 | 4 | 193 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6284 | 10 | 189 | 1.20.1250.20 |
| af_Q2FZP3_16_220_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5929 | 10 | 189 | 1.20.1250.20 |
| af_C6TIG3_1_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5123 | 5 | 189 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y1R4X4-F1-model_v4 | Lysine transporter LysE | 0.9369 | 1 | 193 |
GO:0005886
GO:0015171 |
| AF-A0A1Y1R4X4-F1-model_v4 | Lysine transporter LysE | 0.9323 | 1 | 193 |
GO:0005886
GO:0015171 |
| AF-A0A4V3DBE2-F1-model_v4 | Threonine/homoserine/homoserine lactone efflux protein | 0.9267 | 2 | 193 |
GO:0005886
GO:0015171 |
| AF-A0A2A4CU03-F1-model_v4 | Lysine transporter LysE | 0.9239 | 3 | 193 |
GO:0005886
GO:0015171 |
| AF-A0A2D8YMG6-F1-model_v4 | deleted | 0.9224 | 2 | 193 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar