F491679
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1208 | 633 | 1012 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100000302|Ga0068860_10000030223 |
| Length | 425 |
| Sequence | MLCEPAVCYLTCVNCLNLRLVWLRQVNRSGAARLRNDYSPIWKRNKVLASEPLLTATPAGDLLELRPAGSWTAANVVTLETLTAAIVPELDRAGNVRLDMTGVSXXXXLGAWLLEKLSRRAATAGHRAETIGAAANYAGLIEELHQVNRRNPRAAPARNPLLVKLDVVGRAAAGTAEDVTIFMQMLGSLFLALVGVLRRPRSLRVTSLVYQLYKVGWQAIPIMVLITFLIGAIIAQQGFFHFRKFGADSYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEIDALSTMGLDPVEVLILPRIIALVFALPILSFIGSMAALYGGALVAQFYGDMGPAIYLARLHEAVSVTSFEVGIIKAPFMALAIGIVACSEGLRVKGSAESLGRQTTTSVVKSIFLVIVLDGLFAIFFASIGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 19 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 20 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 21 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 22 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 25 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 26 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 27 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 28 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 29 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 30 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 31 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 34 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 35 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 36 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 37 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 38 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 39 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 40 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 41 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 42 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 43 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 44 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 45 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 46 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 47 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 48 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 49 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 50 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 51 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 52 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 53 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 54 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 55 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 56 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 57 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 58 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 59 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 60 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 61 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 62 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 63 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 64 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 65 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 66 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 67 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 68 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 69 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 70 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 71 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 72 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 73 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 74 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 75 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 76 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 77 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 78 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 79 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 80 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 81 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 82 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 83 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 84 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 85 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 86 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 87 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 88 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 89 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 90 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 91 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 92 | 2904699407 | |||
| 93 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 94 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 95 | 2906610324 | |||
| 96 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 97 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 98 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 99 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 100 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 101 | 2922368715 | |||
| 102 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 103 | 2922425934 | |||
| 104 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 105 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 106 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 107 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 108 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 109 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 110 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 111 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 112 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 113 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 114 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 115 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 116 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 117 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 118 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 119 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 120 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 121 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 122 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 123 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 124 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 125 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 126 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 127 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 128 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 129 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 130 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 131 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 132 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 133 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 134 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 135 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 136 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 137 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 138 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 139 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 140 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 141 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 142 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 143 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 144 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 145 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 146 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 147 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 148 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 149 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 150 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 151 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 152 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 153 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 154 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 155 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 156 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 157 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 158 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 159 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 160 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 161 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 162 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 163 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 164 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 165 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 166 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 167 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 168 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 169 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 170 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 171 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 173 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 176 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 178 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 180 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 189 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 192 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 194 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 196 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 199 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 203 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 204 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 206 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 208 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 215 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 216 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 218 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 219 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 220 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 222 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 223 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 224 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 225 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 226 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 227 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 228 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 229 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 230 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 231 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 232 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 233 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 234 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 235 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 236 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 237 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 238 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 239 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 240 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 241 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 242 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 243 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 244 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 245 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 246 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 247 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 248 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 249 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 250 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 251 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 252 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 253 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 255 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 256 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 257 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 258 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 259 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 295 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 297 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 356 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 357 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 358 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 363 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 367 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 368 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 369 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 370 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 371 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 372 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 373 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 374 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 375 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 376 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 377 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 378 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 379 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 380 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 381 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 382 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 383 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 384 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 385 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 386 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 387 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 388 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 389 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 390 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 391 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 392 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 393 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 394 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 395 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 396 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 397 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 398 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 399 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 400 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 401 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 402 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 403 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 404 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 405 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 406 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 407 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 408 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 409 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 410 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 411 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 412 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 413 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 414 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 415 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 416 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 417 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 418 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 419 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 420 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 421 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 422 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 423 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 424 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 425 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 426 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 427 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 428 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 429 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 430 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 431 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 432 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 433 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 434 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 435 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 436 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 437 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 438 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 439 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 440 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 441 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 442 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 443 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 444 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 445 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 502 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 503 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 504 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 505 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 506 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 507 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 508 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 509 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 510 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 511 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 512 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 513 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 514 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 515 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 516 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 517 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 518 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 519 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 520 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 521 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 522 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 523 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 524 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 525 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 526 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 527 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 531 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 533 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 544 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 558 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 560 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 561 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 562 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 563 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 564 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 565 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 566 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 567 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 568 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 569 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 570 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 571 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 572 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 576 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 577 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 578 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 579 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 580 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 581 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 582 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 583 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 584 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 585 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 586 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 587 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 588 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 589 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 590 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 591 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 592 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 593 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 594 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 595 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 596 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 597 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 598 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 599 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 600 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 601 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 602 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 603 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 604 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 605 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 606 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 607 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 608 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 609 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 610 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 611 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 612 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 613 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 614 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 615 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 616 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 617 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 618 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 619 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 620 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 621 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 622 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 623 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 624 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 625 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 626 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 627 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 628 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 629 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 630 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 631 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 632 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 633 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.97 |
| Metatranscriptomes | 0.08 |
| Isolates | 15.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.09 |
| Nodule | 11.67 |
| Rhizoplane | 5.22 |
| Rhizosphere | 63.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000110 | 3300003215 | Bacteria | 93591 |
| 2 | JGI25153J46596_10000263 | 3300003215 | Bacteria | 41900 |
| 3 | JGI25153J46596_10000645 | 3300003215 | Bacteria | 21275 |
| 4 | JGI25153J46596_10004577 | 3300003215 | Bacteria | 7418 |
| 5 | JGI25160J50197_1000523 | 3300003354 | Bacteria | 22402 |
| 6 | JGI25160J50197_1005211 | 3300003354 | Bacteria | 5452 |
| 7 | Ga0055539_1006587 | 3300003752 | Bacteria | 1484 |
| 8 | Ga0055543_1002843 | 3300004625 | Bacteria | 5459 |
| 9 | Ga0065165_1004569 | 3300005262 | Bacteria | 8453 |
| 10 | Ga0065165_1004928 | 3300005262 | Bacteria | 7870 |
| 11 | Ga0065165_1009267 | 3300005262 | Bacteria | 4443 |
| 12 | Ga0070670_100001907 | 3300005331 | Bacteria | 17064 |
| 13 | Ga0068869_100004028 | 3300005334 | Bacteria | 9092 |
| 14 | Ga0070680_100048253 | 3300005336 | Bacteria | 3469 |
| 15 | Ga0070680_100054060 | 3300005336 | Bacteria | 3278 |
| 16 | Ga0070682_100002059 | 3300005337 | Bacteria | 11215 |
| 17 | Ga0068868_100004146 | 3300005338 | Bacteria | 10130 |
| 18 | Ga0068868_100080657 | 3300005338 | Bacteria | 2608 |
| 19 | Ga0070660_100001946 | 3300005339 | Bacteria | 14247 |
| 20 | Ga0070660_100011425 | 3300005339 | Bacteria | 6308 |
| 21 | Ga0070660_100013552 | 3300005339 | Bacteria | 5852 |
| 22 | Ga0070660_100152300 | 3300005339 | Bacteria | 1860 |
| 23 | Ga0070689_100002684 | 3300005340 | Bacteria | 11665 |
| 24 | Ga0070689_100018682 | 3300005340 | Bacteria | 5112 |
| 25 | Ga0070691_10002422 | 3300005341 | Bacteria | 8277 |
| 26 | Ga0070687_100049505 | 3300005343 | Bacteria | 2166 |
| 27 | Ga0070661_100001146 | 3300005344 | Bacteria | 18648 |
| 28 | Ga0070692_10000134 | 3300005345 | Bacteria | 17740 |
| 29 | Ga0070668_100004348 | 3300005347 | Bacteria | 10507 |
| 30 | Ga0070668_100006572 | 3300005347 | Bacteria | 8611 |
| 31 | Ga0070668_100008886 | 3300005347 | Bacteria | 7461 |
| 32 | Ga0070669_100000574 | 3300005353 | Bacteria | 27273 |
| 33 | Ga0070675_100016690 | 3300005354 | Bacteria | 5827 |
| 34 | Ga0070671_100032813 | 3300005355 | Bacteria | 4292 |
| 35 | Ga0070671_100072280 | 3300005355 | Bacteria | 2880 |
| 36 | Ga0070674_100019523 | 3300005356 | Bacteria | 4306 |
| 37 | Ga0070674_100147148 | 3300005356 | Bacteria | 1774 |
| 38 | Ga0070673_100002610 | 3300005364 | Bacteria | 11013 |
| 39 | Ga0070688_100000238 | 3300005365 | Bacteria | 29006 |
| 40 | Ga0070659_100008590 | 3300005366 | Bacteria | 7468 |
| 41 | Ga0070667_100005240 | 3300005367 | Bacteria | 10839 |
| 42 | Ga0070667_100110990 | 3300005367 | Bacteria | 2378 |
| 43 | Ga0070667_100133228 | 3300005367 | Bacteria | 2170 |
| 44 | Ga0070709_10000553 | 3300005434 | Bacteria | 21892 |
| 45 | Ga0070709_10008113 | 3300005434 | Bacteria | 5763 |
| 46 | Ga0070709_10056012 | 3300005434 | Bacteria | 2491 |
| 47 | Ga0070714_100018688 | 3300005435 | Bacteria | 5637 |
| 48 | Ga0070714_100032673 | 3300005435 | Bacteria | 4345 |
| 49 | Ga0070714_100125085 | 3300005435 | Bacteria | 2291 |
| 50 | Ga0070713_100006321 | 3300005436 | Bacteria | 8206 |
| 51 | Ga0070713_100051675 | 3300005436 | Bacteria | 3400 |
| 52 | Ga0070713_100270223 | 3300005436 | Bacteria | 1557 |
| 53 | Ga0070710_10003271 | 3300005437 | Bacteria | 7681 |
| 54 | Ga0070701_10000806 | 3300005438 | Bacteria | 11187 |
| 55 | Ga0070711_100001115 | 3300005439 | Bacteria | 14359 |
| 56 | Ga0070711_100020122 | 3300005439 | Bacteria | 4295 |
| 57 | Ga0070711_100027000 | 3300005439 | Bacteria | 3766 |
| 58 | Ga0070705_100157858 | 3300005440 | Bacteria | 1513 |
| 59 | Ga0070700_100000601 | 3300005441 | Bacteria | 17957 |
| 60 | Ga0070663_100005162 | 3300005455 | Bacteria | 7732 |
| 61 | Ga0070663_100007733 | 3300005455 | Bacteria | 6564 |
| 62 | Ga0070663_100046018 | 3300005455 | Bacteria | 3085 |
| 63 | Ga0070678_100000163 | 3300005456 | Bacteria | 28192 |
| 64 | Ga0070678_100073070 | 3300005456 | Bacteria | 2573 |
| 65 | Ga0070662_100024658 | 3300005457 | Bacteria | 4146 |
| 66 | Ga0070681_10040314 | 3300005458 | Bacteria | 4679 |
| 67 | Ga0070681_10048886 | 3300005458 | Bacteria | 4225 |
| 68 | Ga0070681_10248182 | 3300005458 | Bacteria | 1693 |
| 69 | Ga0068867_100071933 | 3300005459 | Bacteria | 2588 |
| 70 | Ga0070698_100122003 | 3300005471 | Bacteria | 2565 |
| 71 | Ga0070679_100017687 | 3300005530 | Bacteria | 6901 |
| 72 | Ga0070679_100083526 | 3300005530 | Bacteria | 3182 |
| 73 | Ga0070679_100232338 | 3300005530 | Bacteria | 1803 |
| 74 | Ga0070697_100001048 | 3300005536 | Bacteria | 20883 |
| 75 | Ga0070697_100106706 | 3300005536 | Bacteria | 2330 |
| 76 | Ga0068853_100001401 | 3300005539 | Bacteria | 17397 |
| 77 | Ga0068853_100008598 | 3300005539 | Bacteria | 8208 |
| 78 | Ga0070672_100017891 | 3300005543 | Bacteria | 5110 |
| 79 | Ga0070686_100150714 | 3300005544 | Bacteria | 1628 |
| 80 | Ga0070695_100005052 | 3300005545 | Bacteria | 7777 |
| 81 | Ga0070695_100007331 | 3300005545 | Bacteria | 6539 |
| 82 | Ga0070696_100000980 | 3300005546 | Bacteria | 18512 |
| 83 | Ga0070696_100007479 | 3300005546 | Bacteria | 7307 |
| 84 | Ga0070693_100000352 | 3300005547 | Bacteria | 20882 |
| 85 | Ga0070693_100002177 | 3300005547 | Bacteria | 8981 |
| 86 | Ga0070665_100066528 | 3300005548 | Bacteria | 3615 |
| 87 | Ga0070665_100074481 | 3300005548 | Bacteria | 3401 |
| 88 | Ga0070704_100005431 | 3300005549 | Bacteria | 7424 |
| 89 | Ga0068855_100015779 | 3300005563 | Bacteria | 9088 |
| 90 | Ga0068855_100031649 | 3300005563 | Bacteria | 6317 |
| 91 | Ga0070664_100017767 | 3300005564 | Bacteria | 5843 |
| 92 | Ga0068857_100021342 | 3300005577 | Bacteria | 5700 |
| 93 | Ga0068854_100001035 | 3300005578 | Bacteria | 16677 |
| 94 | Ga0068856_100043502 | 3300005614 | Bacteria | 4419 |
| 95 | Ga0070702_100000144 | 3300005615 | Bacteria | 22195 |
| 96 | Ga0068852_100159186 | 3300005616 | Bacteria | 2107 |
| 97 | Ga0068852_100325192 | 3300005616 | Bacteria | 1494 |
| 98 | Ga0068859_100044410 | 3300005617 | Bacteria | 4465 |
| 99 | Ga0068859_100110965 | 3300005617 | Bacteria | 2805 |
| 100 | Ga0068864_100011530 | 3300005618 | Bacteria | 7303 |
| 101 | Ga0068864_100102363 | 3300005618 | Bacteria | 2541 |
| 102 | Ga0068866_10001363 | 3300005718 | Bacteria | 10576 |
| 103 | Ga0068861_100099229 | 3300005719 | Bacteria | 2313 |
| 104 | Ga0068863_100038781 | 3300005841 | Bacteria | 4532 |
| 105 | Ga0068863_100194093 | 3300005841 | Bacteria | 1952 |
| 106 | Ga0068858_100003338 | 3300005842 | Bacteria | 15989 |
| 107 | Ga0068858_100050100 | 3300005842 | Bacteria | 3865 |
| 108 | Ga0068858_100119126 | 3300005842 | Bacteria | 2468 |
| 109 | Ga0068858_100134898 | 3300005842 | Bacteria | 2316 |
| 110 | Ga0068858_100140259 | 3300005842 | Bacteria | 2269 |
| 111 | Ga0068860_100000302 | 3300005843 | Bacteria | 68581 |
| 112 | Ga0068860_100034267 | 3300005843 | Bacteria | 4869 |
| 113 | Ga0068860_100045641 | 3300005843 | Bacteria | 4179 |
| 114 | Ga0068860_100179979 | 3300005843 | Bacteria | 2043 |
| 115 | Ga0068862_100001405 | 3300005844 | Bacteria | 22295 |
| 116 | Ga0068862_100009937 | 3300005844 | Bacteria | 7860 |
| 117 | Ga0081455_10000877 | 3300005937 | Bacteria | 38899 |
| 118 | Ga0081455_10040525 | 3300005937 | Bacteria | 4105 |
| 119 | Ga0081455_10116256 | 3300005937 | Bacteria | 2116 |
| 120 | Ga0081540_1015193 | 3300005983 | Bacteria | 4885 |
| 121 | Ga0075365_10004351 | 3300006038 | Bacteria | 7486 |
| 122 | Ga0075365_10015666 | 3300006038 | Bacteria | 4592 |
| 123 | Ga0075368_10000403 | 3300006042 | Bacteria | 12665 |
| 124 | Ga0075368_10003164 | 3300006042 | Bacteria | 5470 |
| 125 | Ga0075368_10026345 | 3300006042 | Bacteria | 2236 |
| 126 | Ga0075363_100000700 | 3300006048 | Bacteria | 11342 |
| 127 | Ga0075363_100009217 | 3300006048 | Bacteria | 4636 |
| 128 | Ga0075363_100110511 | 3300006048 | Bacteria | 1527 |
| 129 | Ga0075364_10007739 | 3300006051 | Bacteria | 6398 |
| 130 | Ga0075364_10007956 | 3300006051 | Bacteria | 6316 |
| 131 | Ga0075364_10019969 | 3300006051 | Bacteria | 4211 |
| 132 | Ga0075364_10045735 | 3300006051 | Bacteria | 2848 |
| 133 | Ga0070715_10002699 | 3300006163 | Bacteria | 5501 |
| 134 | Ga0070716_100002822 | 3300006173 | Bacteria | 8087 |
| 135 | Ga0070712_100000650 | 3300006175 | Bacteria | 20430 |
| 136 | Ga0070712_100004063 | 3300006175 | Bacteria | 8985 |
| 137 | Ga0070712_100049647 | 3300006175 | Bacteria | 2915 |
| 138 | Ga0075362_10007931 | 3300006177 | Bacteria | 4042 |
| 139 | Ga0075367_10000859 | 3300006178 | Bacteria | 12127 |
| 140 | Ga0075367_10002352 | 3300006178 | Bacteria | 8600 |
| 141 | Ga0075367_10019333 | 3300006178 | Bacteria | 3776 |
| 142 | Ga0075369_10006864 | 3300006186 | Bacteria | 4322 |
| 143 | Ga0075369_10013177 | 3300006186 | Bacteria | 3275 |
| 144 | Ga0075366_10003963 | 3300006195 | Bacteria | 7904 |
| 145 | Ga0075366_10043269 | 3300006195 | Bacteria | 2667 |
| 146 | Ga0075366_10118954 | 3300006195 | Bacteria | 1591 |
| 147 | Ga0075370_10026001 | 3300006353 | Bacteria | 3240 |
| 148 | Ga0075370_10067999 | 3300006353 | Bacteria | 2034 |
| 149 | Ga0075370_10082159 | 3300006353 | Bacteria | 1852 |
| 150 | Ga0075370_10083928 | 3300006353 | Bacteria | 1833 |
| 151 | Ga0068871_100116263 | 3300006358 | Bacteria | 2255 |
| 152 | Ga0075428_100020141 | 3300006844 | Bacteria | 7388 |
| 153 | Ga0075428_100030217 | 3300006844 | Bacteria | 5992 |
| 154 | Ga0075430_100098093 | 3300006846 | Bacteria | 2448 |
| 155 | Ga0075431_100015972 | 3300006847 | Bacteria | 7617 |
| 156 | Ga0075431_100252258 | 3300006847 | Bacteria | 1792 |
| 157 | Ga0075433_10009947 | 3300006852 | Bacteria | 7621 |
| 158 | Ga0075433_10363190 | 3300006852 | Bacteria | 1279 |
| 159 | Ga0075434_100003258 | 3300006871 | Bacteria | 14508 |
| 160 | Ga0075434_100053572 | 3300006871 | Bacteria | 4008 |
| 161 | Ga0075434_100061214 | 3300006871 | Bacteria | 3745 |
| 162 | Ga0075434_100176524 | 3300006871 | Bacteria | 2156 |
| 163 | Ga0075429_100029516 | 3300006880 | Bacteria | 4762 |
| 164 | Ga0068865_100000403 | 3300006881 | Bacteria | 24052 |
| 165 | Ga0068865_100024210 | 3300006881 | Bacteria | 3981 |
| 166 | Ga0075436_100007723 | 3300006914 | Bacteria | 7350 |
| 167 | Ga0075436_100024382 | 3300006914 | Bacteria | 4158 |
| 168 | Ga0097620_100044410 | 3300006931 | Bacteria | 4465 |
| 169 | Ga0097620_100110965 | 3300006931 | Bacteria | 2805 |
| 170 | Ga0099825_1034761 | 3300006941 | Bacteria | 1850 |
| 171 | Ga0099823_1022744 | 3300006944 | Bacteria | 5787 |
| 172 | Ga0075435_100015085 | 3300007076 | Bacteria | 5801 |
| 173 | Ga0075435_100209742 | 3300007076 | Bacteria | 1652 |
| 174 | Ga0099794_10010689 | 3300007265 | Bacteria | 3904 |
| 175 | Ga0099795_10079882 | 3300007788 | Bacteria | 1249 |
| 176 | Ga0105250_10004961 | 3300009092 | Bacteria | 6036 |
| 177 | Ga0105240_10004412 | 3300009093 | Bacteria | 21461 |
| 178 | Ga0105240_10024435 | 3300009093 | Bacteria | 7961 |
| 179 | Ga0105240_10038789 | 3300009093 | Bacteria | 6107 |
| 180 | Ga0105240_10060004 | 3300009093 | Bacteria | 4743 |
| 181 | Ga0111539_10004280 | 3300009094 | Bacteria | 18684 |
| 182 | Ga0105245_10001576 | 3300009098 | Bacteria | 20702 |
| 183 | Ga0105245_10059144 | 3300009098 | Bacteria | 3450 |
| 184 | Ga0105245_10084344 | 3300009098 | Bacteria | 2910 |
| 185 | Ga0105245_10248838 | 3300009098 | Bacteria | 1726 |
| 186 | Ga0105247_10005404 | 3300009101 | Bacteria | 8050 |
| 187 | Ga0105247_10006815 | 3300009101 | Bacteria | 7042 |
| 188 | Ga0105247_10009887 | 3300009101 | Bacteria | 5779 |
| 189 | Ga0114129_10211876 | 3300009147 | Bacteria | 2619 |
| 190 | Ga0105243_10002082 | 3300009148 | Bacteria | 16941 |
| 191 | Ga0105243_10031664 | 3300009148 | Bacteria | 4078 |
| 192 | Ga0105243_10100640 | 3300009148 | Bacteria | 2398 |
| 193 | Ga0105241_10002293 | 3300009174 | Bacteria | 14379 |
| 194 | Ga0105241_10021664 | 3300009174 | Bacteria | 4754 |
| 195 | Ga0105241_10040310 | 3300009174 | Bacteria | 3525 |
| 196 | Ga0105241_10197872 | 3300009174 | Bacteria | 1677 |
| 197 | Ga0105241_10268409 | 3300009174 | Bacteria | 1453 |
| 198 | Ga0105242_10015101 | 3300009176 | Bacteria | 5993 |
| 199 | Ga0105248_10002287 | 3300009177 | Bacteria | 21211 |
| 200 | Ga0105248_10011606 | 3300009177 | Bacteria | 9705 |
| 201 | Ga0105248_10244685 | 3300009177 | Bacteria | 2019 |
| 202 | Ga0105237_10000892 | 3300009545 | Bacteria | 40254 |
| 203 | Ga0105237_10002097 | 3300009545 | Bacteria | 25173 |
| 204 | Ga0105237_10007140 | 3300009545 | Bacteria | 12275 |
| 205 | Ga0105237_10010596 | 3300009545 | Bacteria | 9792 |
| 206 | Ga0105237_10012219 | 3300009545 | Bacteria | 9054 |
| 207 | Ga0105237_10042290 | 3300009545 | Bacteria | 4595 |
| 208 | Ga0105237_10063501 | 3300009545 | Bacteria | 3690 |
| 209 | Ga0105237_10115079 | 3300009545 | Bacteria | 2683 |
| 210 | Ga0105237_10290804 | 3300009545 | Bacteria | 1637 |
| 211 | Ga0105238_10012485 | 3300009551 | Bacteria | 8569 |
| 212 | Ga0105238_10031155 | 3300009551 | Bacteria | 5429 |
| 213 | Ga0105238_10035315 | 3300009551 | Bacteria | 5083 |
| 214 | Ga0105238_10219532 | 3300009551 | Bacteria | 1877 |
| 215 | Ga0105249_10056401 | 3300009553 | Bacteria | 3596 |
| 216 | Ga0105249_10113853 | 3300009553 | Bacteria | 2560 |
| 217 | Ga0105239_10013543 | 3300010375 | Bacteria | 9054 |
| 218 | Ga0105239_10096608 | 3300010375 | Bacteria | 3264 |
| 219 | Ga0105239_10121877 | 3300010375 | Bacteria | 2897 |
| 220 | Ga0105246_10000623 | 3300011119 | Bacteria | 19751 |
| 221 | Ga0105246_10001035 | 3300011119 | Bacteria | 16002 |
| 222 | Ga0105246_10128700 | 3300011119 | Bacteria | 1888 |
| 223 | Ga0157373_10092832 | 3300013100 | Bacteria | 2126 |
| 224 | Ga0157371_10069270 | 3300013102 | Bacteria | 2498 |
| 225 | Ga0157370_10011827 | 3300013104 | Bacteria | 9107 |
| 226 | Ga0157370_10052376 | 3300013104 | Bacteria | 3897 |
| 227 | Ga0157370_10073433 | 3300013104 | Bacteria | 3227 |
| 228 | Ga0157370_10121827 | 3300013104 | Bacteria | 2435 |
| 229 | Ga0157369_10030988 | 3300013105 | Bacteria | 5894 |
| 230 | Ga0157369_10290424 | 3300013105 | Bacteria | 1702 |
| 231 | Ga0157374_10007939 | 3300013296 | Bacteria | 9063 |
| 232 | Ga0157374_10095531 | 3300013296 | Bacteria | 2842 |
| 233 | Ga0157374_10169549 | 3300013296 | Bacteria | 2129 |
| 234 | Ga0157374_10274394 | 3300013296 | Bacteria | 1663 |
| 235 | Ga0157378_10001216 | 3300013297 | Bacteria | 23323 |
| 236 | Ga0157378_10001958 | 3300013297 | Bacteria | 18458 |
| 237 | Ga0157378_10027506 | 3300013297 | Bacteria | 5018 |
| 238 | Ga0157378_10091909 | 3300013297 | Bacteria | 2760 |
| 239 | Ga0163162_10006254 | 3300013306 | Bacteria | 11543 |
| 240 | Ga0163162_10008329 | 3300013306 | Bacteria | 10113 |
| 241 | Ga0163162_10055157 | 3300013306 | Bacteria | 4000 |
| 242 | Ga0163162_10104803 | 3300013306 | Bacteria | 2922 |
| 243 | Ga0157372_10002164 | 3300013307 | Bacteria | 21380 |
| 244 | Ga0157375_10001815 | 3300013308 | Bacteria | 18305 |
| 245 | Ga0157375_10027175 | 3300013308 | Bacteria | 5345 |
| 246 | Ga0157375_10034100 | 3300013308 | Bacteria | 4845 |
| 247 | Ga0157375_10131427 | 3300013308 | Bacteria | 2623 |
| 248 | Ga0163163_10055204 | 3300014325 | Bacteria | 3926 |
| 249 | Ga0163163_10124317 | 3300014325 | Bacteria | 2616 |
| 250 | Ga0157377_10047803 | 3300014745 | Bacteria | 2398 |
| 251 | Ga0157379_10003521 | 3300014968 | Bacteria | 13257 |
| 252 | Ga0157379_10013168 | 3300014968 | Bacteria | 7241 |
| 253 | Ga0157379_10121772 | 3300014968 | Bacteria | 2347 |
| 254 | Ga0157376_10009118 | 3300014969 | Bacteria | 7193 |
| 255 | Ga0157376_10012349 | 3300014969 | Bacteria | 6336 |
| 256 | Ga0163161_10018218 | 3300017792 | Bacteria | 4923 |
| 257 | Ga0209563_107462 | 3300025230 | Bacteria | 1794 |
| 258 | Ga0209677_101165 | 3300025253 | Bacteria | 12146 |
| 259 | Ga0209148_1000224 | 3300025254 | Bacteria | 92967 |
| 260 | Ga0209233_1001790 | 3300025261 | Bacteria | 8280 |
| 261 | Ga0209455_1003552 | 3300025272 | Bacteria | 5457 |
| 262 | Ga0209673_1014407 | 3300025273 | Bacteria | 3059 |
| 263 | Ga0209564_1003463 | 3300025295 | Bacteria | 10758 |
| 264 | Ga0209564_1008956 | 3300025295 | Bacteria | 4848 |
| 265 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 266 | Ga0209758_1000087 | 3300025297 | Bacteria | 254384 |
| 267 | Ga0209758_1001103 | 3300025297 | Bacteria | 34890 |
| 268 | Ga0209758_1002205 | 3300025297 | Bacteria | 20325 |
| 269 | Ga0209758_1003246 | 3300025297 | Bacteria | 15078 |
| 270 | Ga0209758_1011329 | 3300025297 | Bacteria | 5182 |
| 271 | Ga0209256_1003035 | 3300025299 | Bacteria | 12390 |
| 272 | Ga0207426_1000160 | 3300025302 | Bacteria | 174540 |
| 273 | Ga0207426_1001010 | 3300025302 | Bacteria | 27314 |
| 274 | Ga0207426_1007290 | 3300025302 | Bacteria | 4649 |
| 275 | Ga0209257_1000795 | 3300025304 | Bacteria | 46064 |
| 276 | Ga0209257_1007831 | 3300025304 | Bacteria | 6318 |
| 277 | Ga0207696_1027246 | 3300025711 | Bacteria | 1762 |
| 278 | Ga0207642_10002423 | 3300025899 | Bacteria | 5814 |
| 279 | Ga0207710_10001768 | 3300025900 | Bacteria | 10433 |
| 280 | Ga0207710_10019392 | 3300025900 | Bacteria | 2902 |
| 281 | Ga0207688_10004014 | 3300025901 | Bacteria | 8014 |
| 282 | Ga0207688_10007134 | 3300025901 | Bacteria | 6076 |
| 283 | Ga0207688_10035621 | 3300025901 | Bacteria | 2758 |
| 284 | Ga0207647_10001768 | 3300025904 | Bacteria | 16586 |
| 285 | Ga0207647_10011677 | 3300025904 | Bacteria | 6147 |
| 286 | Ga0207647_10071218 | 3300025904 | Bacteria | 2098 |
| 287 | Ga0207647_10091650 | 3300025904 | Bacteria | 1812 |
| 288 | Ga0207699_10006211 | 3300025906 | Bacteria | 5765 |
| 289 | Ga0207699_10030688 | 3300025906 | Bacteria | 3010 |
| 290 | Ga0207699_10124118 | 3300025906 | Bacteria | 1674 |
| 291 | Ga0207643_10138238 | 3300025908 | Bacteria | 1454 |
| 292 | Ga0207705_10161688 | 3300025909 | Bacteria | 1682 |
| 293 | Ga0207654_10016479 | 3300025911 | Bacteria | 3849 |
| 294 | Ga0207654_10029119 | 3300025911 | Bacteria | 3018 |
| 295 | Ga0207654_10046809 | 3300025911 | Bacteria | 2468 |
| 296 | Ga0207707_10043505 | 3300025912 | Bacteria | 3918 |
| 297 | Ga0207707_10076955 | 3300025912 | Bacteria | 2912 |
| 298 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 299 | Ga0207671_10002337 | 3300025914 | Bacteria | 20455 |
| 300 | Ga0207671_10017059 | 3300025914 | Bacteria | 5614 |
| 301 | Ga0207671_10023189 | 3300025914 | Bacteria | 4682 |
| 302 | Ga0207671_10093015 | 3300025914 | Bacteria | 2274 |
| 303 | Ga0207671_10280619 | 3300025914 | Bacteria | 1314 |
| 304 | Ga0207693_10000326 | 3300025915 | Bacteria | 44051 |
| 305 | Ga0207693_10000328 | 3300025915 | Bacteria | 43917 |
| 306 | Ga0207693_10003223 | 3300025915 | Bacteria | 14005 |
| 307 | Ga0207663_10001926 | 3300025916 | Bacteria | 9833 |
| 308 | Ga0207663_10034720 | 3300025916 | Bacteria | 3019 |
| 309 | Ga0207663_10042314 | 3300025916 | Bacteria | 2782 |
| 310 | Ga0207663_10051661 | 3300025916 | Bacteria | 2561 |
| 311 | Ga0207660_10023384 | 3300025917 | Bacteria | 4173 |
| 312 | Ga0207660_10143180 | 3300025917 | Bacteria | 1829 |
| 313 | Ga0207662_10001133 | 3300025918 | Bacteria | 12560 |
| 314 | Ga0207657_10000664 | 3300025919 | Bacteria | 36576 |
| 315 | Ga0207657_10019384 | 3300025919 | Bacteria | 6462 |
| 316 | Ga0207657_10042217 | 3300025919 | Bacteria | 4025 |
| 317 | Ga0207649_10016920 | 3300025920 | Bacteria | 4124 |
| 318 | Ga0207652_10053329 | 3300025921 | Bacteria | 3473 |
| 319 | Ga0207652_10091229 | 3300025921 | Bacteria | 2679 |
| 320 | Ga0207652_10181534 | 3300025921 | Bacteria | 1891 |
| 321 | Ga0207681_10024471 | 3300025923 | Bacteria | 3876 |
| 322 | Ga0207694_10051174 | 3300025924 | Bacteria | 3201 |
| 323 | Ga0207694_10105080 | 3300025924 | Bacteria | 2241 |
| 324 | Ga0207650_10005610 | 3300025925 | Bacteria | 8572 |
| 325 | Ga0207650_10267418 | 3300025925 | Bacteria | 1389 |
| 326 | Ga0207687_10017153 | 3300025927 | Bacteria | 4761 |
| 327 | Ga0207687_10091861 | 3300025927 | Bacteria | 2215 |
| 328 | Ga0207700_10054769 | 3300025928 | Bacteria | 2996 |
| 329 | Ga0207700_10066396 | 3300025928 | Bacteria | 2757 |
| 330 | Ga0207700_10097609 | 3300025928 | Bacteria | 2335 |
| 331 | Ga0207700_10286350 | 3300025928 | Bacteria | 1419 |
| 332 | Ga0207664_10115378 | 3300025929 | Bacteria | 2239 |
| 333 | Ga0207644_10133956 | 3300025931 | Bacteria | 1900 |
| 334 | Ga0207690_10009470 | 3300025932 | Bacteria | 5785 |
| 335 | Ga0207706_10000247 | 3300025933 | Bacteria | 59079 |
| 336 | Ga0207706_10029015 | 3300025933 | Bacteria | 4940 |
| 337 | Ga0207706_10042883 | 3300025933 | Bacteria | 4009 |
| 338 | Ga0207686_10025507 | 3300025934 | Bacteria | 3438 |
| 339 | Ga0207709_10022604 | 3300025935 | Bacteria | 3568 |
| 340 | Ga0207709_10099170 | 3300025935 | Bacteria | 1922 |
| 341 | Ga0207709_10187831 | 3300025935 | Bacteria | 1465 |
| 342 | Ga0207670_10013061 | 3300025936 | Bacteria | 4884 |
| 343 | Ga0207670_10015701 | 3300025936 | Bacteria | 4531 |
| 344 | Ga0207669_10001810 | 3300025937 | Bacteria | 9051 |
| 345 | Ga0207669_10153555 | 3300025937 | Bacteria | 1616 |
| 346 | Ga0207704_10007211 | 3300025938 | Bacteria | 5236 |
| 347 | Ga0207704_10038375 | 3300025938 | Bacteria | 2778 |
| 348 | Ga0207704_10094641 | 3300025938 | Bacteria | 1973 |
| 349 | Ga0207665_10000262 | 3300025939 | Bacteria | 36575 |
| 350 | Ga0207665_10001364 | 3300025939 | Bacteria | 16457 |
| 351 | Ga0207691_10015768 | 3300025940 | Bacteria | 7183 |
| 352 | Ga0207711_10007899 | 3300025941 | Bacteria | 8899 |
| 353 | Ga0207711_10041075 | 3300025941 | Bacteria | 3938 |
| 354 | Ga0207711_10098011 | 3300025941 | Bacteria | 2590 |
| 355 | Ga0207711_10319764 | 3300025941 | Bacteria | 1434 |
| 356 | Ga0207689_10078975 | 3300025942 | Bacteria | 2704 |
| 357 | Ga0207679_10007266 | 3300025945 | Bacteria | 7018 |
| 358 | Ga0207679_10082748 | 3300025945 | Bacteria | 2458 |
| 359 | Ga0207667_10069346 | 3300025949 | Bacteria | 3669 |
| 360 | Ga0207667_10192844 | 3300025949 | Bacteria | 2090 |
| 361 | Ga0207712_10006105 | 3300025961 | Bacteria | 7603 |
| 362 | Ga0207668_10019130 | 3300025972 | Bacteria | 4324 |
| 363 | Ga0207668_10055299 | 3300025972 | Bacteria | 2758 |
| 364 | Ga0207668_10067366 | 3300025972 | Bacteria | 2541 |
| 365 | Ga0207640_10065360 | 3300025981 | Bacteria | 2427 |
| 366 | Ga0207658_10013439 | 3300025986 | Bacteria | 5592 |
| 367 | Ga0207677_10026700 | 3300026023 | Bacteria | 3626 |
| 368 | Ga0207703_10070342 | 3300026035 | Bacteria | 2888 |
| 369 | Ga0207639_10031931 | 3300026041 | Bacteria | 3873 |
| 370 | Ga0207639_10048933 | 3300026041 | Bacteria | 3202 |
| 371 | Ga0207639_10091893 | 3300026041 | Bacteria | 2431 |
| 372 | Ga0207678_10000247 | 3300026067 | Bacteria | 48621 |
| 373 | Ga0207678_10002469 | 3300026067 | Bacteria | 16796 |
| 374 | Ga0207678_10024463 | 3300026067 | Bacteria | 5274 |
| 375 | Ga0207678_10079215 | 3300026067 | Bacteria | 2813 |
| 376 | Ga0207678_10083637 | 3300026067 | Bacteria | 2730 |
| 377 | Ga0207708_10001039 | 3300026075 | Bacteria | 20776 |
| 378 | Ga0207708_10002105 | 3300026075 | Bacteria | 14659 |
| 379 | Ga0207702_10147255 | 3300026078 | Bacteria | 2138 |
| 380 | Ga0207641_10097710 | 3300026088 | Bacteria | 2581 |
| 381 | Ga0207641_10330503 | 3300026088 | Bacteria | 1448 |
| 382 | Ga0207648_10052487 | 3300026089 | Bacteria | 3565 |
| 383 | Ga0207648_10247999 | 3300026089 | Bacteria | 1587 |
| 384 | Ga0207676_10014267 | 3300026095 | Bacteria | 5713 |
| 385 | Ga0207674_10038386 | 3300026116 | Bacteria | 4971 |
| 386 | Ga0207675_100000047 | 3300026118 | Bacteria | 85113 |
| 387 | Ga0207675_100006675 | 3300026118 | Bacteria | 10919 |
| 388 | Ga0207675_100016268 | 3300026118 | Bacteria | 6945 |
| 389 | Ga0207675_100030122 | 3300026118 | Bacteria | 5053 |
| 390 | Ga0207675_100106034 | 3300026118 | Bacteria | 2649 |
| 391 | Ga0207683_10000542 | 3300026121 | Bacteria | 34972 |
| 392 | Ga0207683_10028640 | 3300026121 | Bacteria | 4818 |
| 393 | Ga0207698_10005599 | 3300026142 | Bacteria | 7774 |
| 394 | Ga0207698_10166236 | 3300026142 | Bacteria | 1936 |
| 395 | Ga0209389_1000137 | 3300027296 | Bacteria | 63287 |
| 396 | Ga0209489_114122 | 3300027361 | Bacteria | 5856 |
| 397 | Ga0209700_100046 | 3300027363 | Bacteria | 159296 |
| 398 | Ga0209179_1003276 | 3300027512 | Bacteria | 2312 |
| 399 | Ga0209966_1000879 | 3300027695 | Bacteria | 5790 |
| 400 | Ga0209966_1003243 | 3300027695 | Bacteria | 2734 |
| 401 | Ga0209998_10007039 | 3300027717 | Bacteria | 2332 |
| 402 | Ga0209813_10000354 | 3300027866 | Bacteria | 11736 |
| 403 | Ga0209813_10005018 | 3300027866 | Bacteria | 3196 |
| 404 | Ga0209813_10009392 | 3300027866 | Bacteria | 2501 |
| 405 | Ga0209813_10060166 | 3300027866 | Bacteria | 1211 |
| 406 | Ga0207428_10004311 | 3300027907 | Bacteria | 13585 |
| 407 | Ga0268266_10060595 | 3300028379 | Bacteria | 3263 |
| 408 | Ga0268266_10087880 | 3300028379 | Bacteria | 2720 |
| 409 | Ga0268265_10016031 | 3300028380 | Bacteria | 5142 |
| 410 | Ga0268265_10020474 | 3300028380 | Bacteria | 4616 |
| 411 | Ga0268265_10044534 | 3300028380 | Bacteria | 3305 |
| 412 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 413 | Ga0268264_10055482 | 3300028381 | Bacteria | 3310 |
| 414 | Ga0268264_10065128 | 3300028381 | Bacteria | 3069 |
| 415 | Ga0268264_10166218 | 3300028381 | Bacteria | 1992 |
| 416 | Ga0265337_1006298 | 3300028556 | Bacteria | 4597 |
| 417 | Ga0265326_10010919 | 3300028558 | Bacteria | 2688 |
| 418 | Ga0265319_1000642 | 3300028563 | Bacteria | 23018 |
| 419 | Ga0265334_10002301 | 3300028573 | Bacteria | 8979 |
| 420 | Ga0265334_10037179 | 3300028573 | Bacteria | 1920 |
| 421 | Ga0265318_10005252 | 3300028577 | Bacteria | 6099 |
| 422 | Ga0265323_10000169 | 3300028653 | Bacteria | 38978 |
| 423 | Ga0265322_10006247 | 3300028654 | Bacteria | 3506 |
| 424 | Ga0265336_10000663 | 3300028666 | Bacteria | 18699 |
| 425 | Ga0307517_10001951 | 3300028786 | Bacteria | 33688 |
| 426 | Ga0307515_10092425 | 3300028794 | Bacteria | 3766 |
| 427 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 428 | Ga0265324_10001030 | 3300029957 | Bacteria | 17126 |
| 429 | Ga0307511_10048094 | 3300030521 | Bacteria | 3476 |
| 430 | Ga0265330_10002148 | 3300031235 | Bacteria | 10875 |
| 431 | Ga0265330_10017984 | 3300031235 | Bacteria | 3249 |
| 432 | Ga0265325_10038067 | 3300031241 | Bacteria | 2540 |
| 433 | Ga0265340_10001233 | 3300031247 | Bacteria | 14653 |
| 434 | Ga0265339_10001813 | 3300031249 | Bacteria | 15668 |
| 435 | Ga0265339_10008846 | 3300031249 | Bacteria | 6375 |
| 436 | Ga0307509_10178491 | 3300031507 | Bacteria | 1993 |
| 437 | Ga0265313_10000356 | 3300031595 | Bacteria | 49871 |
| 438 | Ga0307508_10000058 | 3300031616 | Bacteria | 125293 |
| 439 | Ga0316579_10011336 | 3300031691 | Bacteria | 3788 |
| 440 | Ga0316579_10044153 | 3300031691 | Bacteria | 2075 |
| 441 | Ga0265314_10015665 | 3300031711 | Bacteria | 6009 |
| 442 | Ga0265314_10055336 | 3300031711 | Bacteria | 2740 |
| 443 | Ga0265342_10028933 | 3300031712 | Bacteria | 3444 |
| 444 | Ga0316576_10120963 | 3300031727 | Bacteria | 1965 |
| 445 | Ga0316578_10033393 | 3300031728 | Bacteria | 2947 |
| 446 | Ga0307516_10070540 | 3300031730 | Bacteria | 3357 |
| 447 | Ga0307405_10104864 | 3300031731 | Bacteria | 1903 |
| 448 | Ga0307410_10168960 | 3300031852 | Bacteria | 1646 |
| 449 | Ga0307406_10017401 | 3300031901 | Bacteria | 4184 |
| 450 | Ga0307409_100030066 | 3300031995 | Bacteria | 3897 |
| 451 | Ga0307415_100028697 | 3300032126 | Bacteria | 3544 |
| 452 | Ga0316583_10006386 | 3300032133 | Bacteria | 4232 |
| 453 | Ga0316585_10001817 | 3300032137 | Bacteria | 5706 |
| 454 | Ga0316580_10002912 | 3300032139 | Bacteria | 4795 |
| 455 | Ga0307510_10089703 | 3300033180 | Bacteria | 2925 |
| 456 | Ga0373930_0001132 | 3300034816 | Bacteria | 3880 |
| 457 | Ga0373958_0000104 | 3300034819 | Bacteria | 9094 |
| 458 | Ga0373959_0002185 | 3300034820 | Bacteria | 3118 |
| 459 | Ga0373928_0001256 | 3300035084 | Bacteria | 4988 |
| 460 | Ga0373929_0000075 | 3300035085 | Bacteria | 16379 |
| 461 | Ga0373949_0013321 | 3300035090 | Bacteria | 1821 |
| 462 | Ga0373951_0010253 | 3300035091 | Bacteria | 2103 |
| 463 | Ga0373923_0026898 | 3300035111 | Bacteria | 2291 |
| 464 | Ga0373932_0000399 | 3300035112 | Bacteria | 13364 |
| 465 | Ga0373936_0040420 | 3300035113 | Bacteria | 1868 |
| 466 | Ga0373941_0000103 | 3300035115 | Bacteria | 14264 |
| 467 | Ga0373941_0000649 | 3300035115 | Bacteria | 7041 |
| 468 | Ga0373945_0027424 | 3300035116 | Bacteria | 1990 |
| 469 | Ga0373945_0059101 | 3300035116 | Bacteria | 1427 |
| 470 | Ga0373954_0099175 | 3300035118 | Bacteria | 1404 |
| 471 | Ga0373946_0021979 | 3300035171 | Bacteria | 2479 |
| 472 | Ga0373955_0033569 | 3300035172 | Bacteria | 2704 |
| 473 | Ga0373942_0005219 | 3300035207 | Bacteria | 3008 |
| 474 | Ga0373931_0028547 | 3300035691 | Bacteria | 2857 |
| 475 | Ga0373935_0004983 | 3300035692 | Bacteria | 7813 |
| 476 | Ga0373935_0060761 | 3300035692 | Bacteria | 2418 |
| 477 | Ga0373935_0071435 | 3300035692 | Bacteria | 2239 |
| 478 | Ga0373927_0008479 | 3300035695 | Bacteria | 6916 |
| 479 | Ga0373927_0013969 | 3300035695 | Bacteria | 5325 |
| 480 | Ga0373927_0014897 | 3300035695 | Bacteria | 5143 |
| 481 | Ga0373927_0063358 | 3300035695 | Bacteria | 2391 |
| 482 | Ga0373933_0000202 | 3300035724 | Bacteria | 39481 |
| 483 | Ga0373947_0023677 | 3300035725 | Bacteria | 3574 |
| 484 | Ga0373947_0034433 | 3300035725 | Bacteria | 2995 |
| 485 | Ga0373947_0093691 | 3300035725 | Bacteria | 1877 |
| 486 | Ga0373947_0096428 | 3300035725 | Bacteria | 1852 |
| 487 | Ga0373947_0122576 | 3300035725 | Bacteria | 1653 |
| 488 | Ga0373937_0022999 | 3300036401 | Bacteria | 5606 |
| 489 | Ga0372808_000705 | 3300036459 | Bacteria | 2927 |
| 490 | Ga0316582_0083025 | 3300036647 | Bacteria | 2095 |
| 491 | Ga0316584_0032544 | 3300036712 | Bacteria | 3859 |
| 492 | Ga0373925_0014554 | 3300037068 | Bacteria | 5685 |
| 493 | Ga0373925_0017650 | 3300037068 | Bacteria | 5178 |
| 494 | Ga0373925_0105324 | 3300037068 | Bacteria | 2173 |
| 495 | Ga0373925_0207485 | 3300037068 | Bacteria | 1560 |
| 496 | Ga0373925_0292698 | 3300037068 | Bacteria | 1313 |
| 497 | Ga0395900_0048448 | 3300037418 | Bacteria | 4377 |
| 498 | Ga0395900_0218896 | 3300037418 | Bacteria | 1920 |
| 499 | Ga0395898_0030060 | 3300037466 | Bacteria | 5439 |
| 500 | Ga0395898_0075631 | 3300037466 | Bacteria | 3253 |
| 501 | Ga0395905_0004814 | 3300037471 | Bacteria | 13929 |
| 502 | Ga0436364_0400091 | 3300037853 | Bacteria | 2495 |
| 503 | Ga0395901_0042929 | 3300038443 | Bacteria | 4690 |
| 504 | Ga0395901_0223244 | 3300038443 | Bacteria | 1969 |
| 505 | Ga0395901_0274533 | 3300038443 | Bacteria | 1753 |
| 506 | Ga0395901_0276802 | 3300038443 | Bacteria | 1744 |
| 507 | Ga0400489_33869 | 3300039093 | Bacteria | 3885 |
| 508 | Ga0436361_0800382 | 3300039447 | Bacteria | 3828 |
| 509 | Ga0436363_0677719 | 3300039450 | Bacteria | 3742 |
| 510 | Ga0439453_0007254 | 3300041408 | Bacteria | 1753 |
| 511 | Ga0439450_019829 | 3300042008 | Bacteria | 1429 |
| 512 | Ga0439435_0015446 | 3300042436 | Bacteria | 1901 |
| 513 | Ga0451577_0019873 | 3300042876 | Bacteria | 6170 |
| 514 | Ga0466972_0006433 | 3300044658 | Bacteria | 5900 |
| 515 | Ga0466966_0000229 | 3300044684 | Bacteria | 37407 |
| 516 | Ga0466961_0000029 | 3300044693 | Bacteria | 86710 |
| 517 | Ga0453684_0055062 | 3300044712 | Bacteria | 5174 |
| 518 | Ga0466959_0000967 | 3300045049 | Bacteria | 17081 |
| 519 | Ga0451576_0019035 | 3300045051 | Bacteria | 7503 |
| 520 | Ga0495592_0111117 | 3300046454 | Bacteria | 1939 |
| 521 | Ga0495603_0005985 | 3300046455 | Bacteria | 7272 |
| 522 | Ga0495629_0000401 | 3300046459 | Bacteria | 36430 |
| 523 | Ga0495629_0014747 | 3300046459 | Bacteria | 5621 |
| 524 | Ga0495629_0020141 | 3300046459 | Bacteria | 4762 |
| 525 | Ga0495629_0046329 | 3300046459 | Bacteria | 3050 |
| 526 | Ga0495629_0123870 | 3300046459 | Bacteria | 1800 |
| 527 | Ga0495638_0004396 | 3300046460 | Bacteria | 10666 |
| 528 | Ga0495641_0011812 | 3300046461 | Bacteria | 4938 |
| 529 | Ga0495651_0012637 | 3300046462 | Bacteria | 6515 |
| 530 | Ga0495651_0027824 | 3300046462 | Bacteria | 4406 |
| 531 | Ga0495651_0133289 | 3300046462 | Bacteria | 1811 |
| 532 | Ga0495651_0139332 | 3300046462 | Bacteria | 1761 |
| 533 | Ga0495653_0108858 | 3300046463 | Bacteria | 1995 |
| 534 | Ga0495580_0025887 | 3300046472 | Bacteria | 4283 |
| 535 | Ga0495582_0025029 | 3300046473 | Bacteria | 3269 |
| 536 | Ga0495639_0002142 | 3300046475 | Bacteria | 8708 |
| 537 | Ga0495639_0028094 | 3300046475 | Bacteria | 2492 |
| 538 | Ga0495639_0035061 | 3300046475 | Bacteria | 2245 |
| 539 | Ga0495664_0097972 | 3300046477 | Bacteria | 1765 |
| 540 | Ga0495594_0002226 | 3300046499 | Bacteria | 10087 |
| 541 | Ga0495594_0004129 | 3300046499 | Bacteria | 7463 |
| 542 | Ga0495594_0011198 | 3300046499 | Bacteria | 4657 |
| 543 | Ga0495594_0080768 | 3300046499 | Bacteria | 1815 |
| 544 | Ga0495607_0022174 | 3300046501 | Bacteria | 3993 |
| 545 | Ga0495606_0053849 | 3300046507 | Bacteria | 2609 |
| 546 | Ga0495608_0118945 | 3300046511 | Bacteria | 1695 |
| 547 | Ga0495608_0212528 | 3300046511 | Bacteria | 1215 |
| 548 | Ga0495610_0021420 | 3300046512 | Bacteria | 3556 |
| 549 | Ga0495618_0085216 | 3300046514 | Bacteria | 2019 |
| 550 | Ga0495628_0026293 | 3300046516 | Bacteria | 4748 |
| 551 | Ga0495628_0075184 | 3300046516 | Bacteria | 2631 |
| 552 | Ga0495630_0024973 | 3300046517 | Bacteria | 4417 |
| 553 | Ga0495630_0035944 | 3300046517 | Bacteria | 3703 |
| 554 | Ga0495643_0041010 | 3300046522 | Bacteria | 2526 |
| 555 | Ga0495666_0030878 | 3300046526 | Bacteria | 2627 |
| 556 | Ga0495642_0016277 | 3300046528 | Bacteria | 2897 |
| 557 | Ga0495652_0047265 | 3300046529 | Bacteria | 3691 |
| 558 | Ga0495652_0093818 | 3300046529 | Bacteria | 2449 |
| 559 | Ga0495652_0097001 | 3300046529 | Bacteria | 2399 |
| 560 | Ga0495654_0053002 | 3300046530 | Bacteria | 1973 |
| 561 | Ga0495665_0002068 | 3300046531 | Bacteria | 10862 |
| 562 | Ga0495640_0015696 | 3300046533 | Bacteria | 5689 |
| 563 | Ga0495640_0019241 | 3300046533 | Bacteria | 5044 |
| 564 | Ga0495640_0053312 | 3300046533 | Bacteria | 2773 |
| 565 | Ga0495640_0150015 | 3300046533 | Bacteria | 1498 |
| 566 | Ga0495587_0039481 | 3300046536 | Bacteria | 2824 |
| 567 | Ga0495587_0110168 | 3300046536 | Bacteria | 1582 |
| 568 | Ga0495645_0020172 | 3300046543 | Bacteria | 4805 |
| 569 | Ga0495622_0011687 | 3300046557 | Bacteria | 4058 |
| 570 | Ga0495622_0014798 | 3300046557 | Bacteria | 3626 |
| 571 | Ga0495622_0075968 | 3300046557 | Bacteria | 1548 |
| 572 | Ga0495667_0013164 | 3300046559 | Bacteria | 5601 |
| 573 | Ga0495667_0050600 | 3300046559 | Bacteria | 2742 |
| 574 | Ga0495667_0122795 | 3300046559 | Bacteria | 1676 |
| 575 | Ga0495668_0005423 | 3300046616 | Bacteria | 8666 |
| 576 | Ga0495634_0010636 | 3300046642 | Bacteria | 6735 |
| 577 | Ga0495634_0125632 | 3300046642 | Bacteria | 1639 |
| 578 | Ga0495625_0124577 | 3300046660 | Bacteria | 1750 |
| 579 | Ga0495635_0005726 | 3300046663 | Bacteria | 8655 |
| 580 | Ga0495635_0014018 | 3300046663 | Bacteria | 5609 |
| 581 | Ga0495635_0034228 | 3300046663 | Bacteria | 3523 |
| 582 | Ga0495635_0166175 | 3300046663 | Bacteria | 1501 |
| 583 | Ga0495661_0052572 | 3300046665 | Bacteria | 2454 |
| 584 | Ga0495588_0036702 | 3300046674 | Bacteria | 2487 |
| 585 | Ga0495588_0046958 | 3300046674 | Bacteria | 2216 |
| 586 | Ga0495657_0096400 | 3300046675 | Bacteria | 1890 |
| 587 | Ga0495657_0121520 | 3300046675 | Bacteria | 1644 |
| 588 | Ga0495599_0003308 | 3300046678 | Bacteria | 9409 |
| 589 | Ga0495599_0220562 | 3300046678 | Bacteria | 1160 |
| 590 | Ga0495623_0025315 | 3300046679 | Bacteria | 3822 |
| 591 | Ga0495647_0005387 | 3300046681 | Bacteria | 4189 |
| 592 | Ga0495647_0018126 | 3300046681 | Bacteria | 2501 |
| 593 | Ga0495658_0000265 | 3300046683 | Bacteria | 29770 |
| 594 | Ga0495658_0003333 | 3300046683 | Bacteria | 7969 |
| 595 | Ga0495613_0008228 | 3300046689 | Bacteria | 7744 |
| 596 | Ga0495613_0034201 | 3300046689 | Bacteria | 3776 |
| 597 | Ga0495613_0060699 | 3300046689 | Bacteria | 2769 |
| 598 | Ga0495613_0064917 | 3300046689 | Bacteria | 2668 |
| 599 | Ga0495613_0176846 | 3300046689 | Bacteria | 1512 |
| 600 | Ga0495624_0039174 | 3300046690 | Bacteria | 3039 |
| 601 | Ga0495624_0053165 | 3300046690 | Bacteria | 2557 |
| 602 | Ga0495624_0115701 | 3300046690 | Bacteria | 1648 |
| 603 | Ga0495624_0138067 | 3300046690 | Bacteria | 1494 |
| 604 | Ga0495671_0018090 | 3300046692 | Bacteria | 3747 |
| 605 | Ga0495600_0028328 | 3300046809 | Bacteria | 3623 |
| 606 | Ga0495600_0041920 | 3300046809 | Bacteria | 2984 |
| 607 | Ga0495581_0025017 | 3300047315 | Bacteria | 3459 |
| 608 | Ga0495581_0032354 | 3300047315 | Bacteria | 3029 |
| 609 | Ga0495581_0053303 | 3300047315 | Bacteria | 2336 |
| 610 | Ga0495581_0080628 | 3300047315 | Bacteria | 1884 |
| 611 | Ga0495604_0021963 | 3300047317 | Bacteria | 5093 |
| 612 | Ga0495604_0050351 | 3300047317 | Bacteria | 3234 |
| 613 | Ga0495604_0053403 | 3300047317 | Bacteria | 3123 |
| 614 | Ga0495604_0157005 | 3300047317 | Bacteria | 1611 |
| 615 | Ga0495674_0013608 | 3300047319 | Bacteria | 7643 |
| 616 | Ga0495674_0014838 | 3300047319 | Bacteria | 7289 |
| 617 | Ga0495674_0030253 | 3300047319 | Bacteria | 4925 |
| 618 | Ga0495680_0015838 | 3300047322 | Bacteria | 6490 |
| 619 | Ga0495680_0030613 | 3300047322 | Bacteria | 4393 |
| 620 | Ga0495687_007206 | 3300047443 | Bacteria | 6609 |
| 621 | Ga0495675_0042693 | 3300047444 | Bacteria | 2888 |
| 622 | Ga0495673_0014114 | 3300047469 | Bacteria | 4164 |
| 623 | Ga0495684_0030860 | 3300047471 | Bacteria | 4114 |
| 624 | Ga0495684_0039229 | 3300047471 | Bacteria | 3630 |
| 625 | Ga0495686_0015739 | 3300047472 | Bacteria | 5152 |
| 626 | Ga0495593_0002908 | 3300047673 | Bacteria | 10322 |
| 627 | Ga0495593_0026795 | 3300047673 | Bacteria | 3179 |
| 628 | Ga0495593_0051458 | 3300047673 | Bacteria | 2179 |
| 629 | Ga0495593_0068108 | 3300047673 | Bacteria | 1852 |
| 630 | Ga0495602_0078694 | 3300048088 | Bacteria | 2784 |
| 631 | Ga0495602_0087820 | 3300048088 | Bacteria | 2590 |
| 632 | Ga0495602_0262838 | 3300048088 | Bacteria | 1279 |
| 633 | Ga0496100_0038440 | 3300048903 | Bacteria | 3032 |
| 634 | Ga0496101_0073266 | 3300048904 | Bacteria | 2515 |
| 635 | Ga0496101_0110399 | 3300048904 | Bacteria | 2069 |
| 636 | Ga0496101_0110593 | 3300048904 | Bacteria | 2068 |
| 637 | Ga0496102_0014005 | 3300048905 | Bacteria | 6964 |
| 638 | Ga0496102_0078941 | 3300048905 | Bacteria | 3030 |
| 639 | Ga0496102_0153625 | 3300048905 | Bacteria | 2163 |
| 640 | Ga0496103_0001223 | 3300048906 | Bacteria | 17609 |
| 641 | Ga0496103_0008856 | 3300048906 | Bacteria | 5968 |
| 642 | Ga0496103_0091266 | 3300048906 | Bacteria | 1922 |
| 643 | Ga0496103_0106903 | 3300048906 | Bacteria | 1775 |
| 644 | Ga0496103_0137325 | 3300048906 | Bacteria | 1563 |
| 645 | Ga0496104_0003761 | 3300048907 | Bacteria | 13118 |
| 646 | Ga0496104_0004958 | 3300048907 | Bacteria | 11618 |
| 647 | Ga0496104_0010970 | 3300048907 | Bacteria | 8107 |
| 648 | Ga0496104_0018250 | 3300048907 | Bacteria | 6399 |
| 649 | Ga0496104_0018351 | 3300048907 | Bacteria | 6383 |
| 650 | Ga0496104_0022383 | 3300048907 | Bacteria | 5805 |
| 651 | Ga0496104_0237680 | 3300048907 | Bacteria | 1734 |
| 652 | Ga0496104_0377465 | 3300048907 | Bacteria | 1330 |
| 653 | Ga0496105_0014746 | 3300048908 | Bacteria | 6221 |
| 654 | Ga0496105_0018352 | 3300048908 | Bacteria | 5619 |
| 655 | Ga0496105_0023234 | 3300048908 | Bacteria | 5027 |
| 656 | Ga0496105_0027661 | 3300048908 | Bacteria | 4635 |
| 657 | Ga0496105_0079001 | 3300048908 | Bacteria | 2717 |
| 658 | Ga0496106_0000863 | 3300048909 | Bacteria | 22031 |
| 659 | Ga0496106_0007382 | 3300048909 | Bacteria | 8124 |
| 660 | Ga0496106_0014060 | 3300048909 | Bacteria | 5914 |
| 661 | Ga0496106_0015871 | 3300048909 | Bacteria | 5572 |
| 662 | Ga0496106_0016670 | 3300048909 | Bacteria | 5435 |
| 663 | Ga0496106_0107712 | 3300048909 | Bacteria | 2167 |
| 664 | Ga0496107_0000335 | 3300048910 | Bacteria | 25483 |
| 665 | Ga0496107_0017009 | 3300048910 | Bacteria | 5113 |
| 666 | Ga0496107_0162898 | 3300048910 | Bacteria | 1653 |
| 667 | Ga0496108_0017621 | 3300048911 | Bacteria | 5844 |
| 668 | Ga0496108_0039412 | 3300048911 | Bacteria | 3938 |
| 669 | Ga0496109_0043189 | 3300048912 | Bacteria | 4086 |
| 670 | Ga0496109_0060277 | 3300048912 | Bacteria | 3467 |
| 671 | Ga0496109_0124445 | 3300048912 | Bacteria | 2403 |
| 672 | Ga0496110_0000794 | 3300048913 | Bacteria | 22051 |
| 673 | Ga0496110_0036244 | 3300048913 | Bacteria | 4283 |
| 674 | Ga0496110_0060791 | 3300048913 | Bacteria | 3333 |
| 675 | Ga0496110_0072731 | 3300048913 | Bacteria | 3051 |
| 676 | Ga0496110_0084491 | 3300048913 | Bacteria | 2833 |
| 677 | Ga0496110_0123992 | 3300048913 | Bacteria | 2330 |
| 678 | Ga0496110_0159976 | 3300048913 | Bacteria | 2041 |
| 679 | Ga0496110_0225549 | 3300048913 | Bacteria | 1704 |
| 680 | Ga0496112_0059616 | 3300048915 | Bacteria | 3761 |
| 681 | Ga0496112_0069376 | 3300048915 | Bacteria | 3482 |
| 682 | Ga0496112_0085763 | 3300048915 | Bacteria | 3115 |
| 683 | Ga0496113_0007570 | 3300048916 | Bacteria | 7003 |
| 684 | Ga0496113_0062644 | 3300048916 | Bacteria | 2809 |
| 685 | Ga0496113_0235333 | 3300048916 | Bacteria | 1461 |
| 686 | Ga0496113_0376308 | 3300048916 | Bacteria | 1140 |
| 687 | Ga0496114_0001714 | 3300048917 | Bacteria | 16643 |
| 688 | Ga0496114_0040299 | 3300048917 | Bacteria | 3866 |
| 689 | Ga0496114_0096993 | 3300048917 | Bacteria | 2511 |
| 690 | Ga0496114_0186514 | 3300048917 | Bacteria | 1813 |
| 691 | Ga0496115_0019333 | 3300048918 | Bacteria | 5240 |
| 692 | Ga0496115_0049271 | 3300048918 | Bacteria | 3371 |
| 693 | Ga0496115_0057816 | 3300048918 | Bacteria | 3120 |
| 694 | Ga0496115_0196083 | 3300048918 | Bacteria | 1669 |
| 695 | Ga0496117_0008333 | 3300048920 | Bacteria | 9863 |
| 696 | Ga0496117_0045821 | 3300048920 | Bacteria | 3153 |
| 697 | Ga0496117_0050906 | 3300048920 | Bacteria | 2933 |
| 698 | Ga0496117_0136853 | 3300048920 | Bacteria | 1474 |
| 699 | Ga0496118_0035633 | 3300048921 | Bacteria | 4037 |
| 700 | Ga0496118_0037179 | 3300048921 | Bacteria | 3923 |
| 701 | Ga0496118_0055750 | 3300048921 | Bacteria | 2978 |
| 702 | Ga0496119_0105777 | 3300048922 | Bacteria | 1571 |
| 703 | Ga0496120_0016663 | 3300048923 | Bacteria | 4796 |
| 704 | Ga0496121_0002396 | 3300048924 | Bacteria | 28735 |
| 705 | Ga0496121_0090293 | 3300048924 | Bacteria | 2395 |
| 706 | Ga0496122_0008649 | 3300048925 | Bacteria | 10923 |
| 707 | Ga0496122_0030293 | 3300048925 | Bacteria | 4539 |
| 708 | Ga0496123_0020212 | 3300048926 | Bacteria | 5215 |
| 709 | Ga0496124_0016923 | 3300048927 | Bacteria | 6908 |
| 710 | Ga0496124_0161086 | 3300048927 | Bacteria | 1749 |
| 711 | Ga0496125_0006206 | 3300048928 | Bacteria | 13017 |
| 712 | Ga0496125_0006386 | 3300048928 | Bacteria | 12773 |
| 713 | Ga0496125_0018774 | 3300048928 | Bacteria | 6553 |
| 714 | Ga0496125_0021935 | 3300048928 | Bacteria | 5939 |
| 715 | Ga0496125_0122488 | 3300048928 | Bacteria | 1851 |
| 716 | Ga0496126_0023524 | 3300048929 | Bacteria | 5969 |
| 717 | Ga0496126_0027687 | 3300048929 | Bacteria | 5409 |
| 718 | Ga0496126_0032003 | 3300048929 | Bacteria | 4961 |
| 719 | Ga0496126_0047633 | 3300048929 | Bacteria | 3924 |
| 720 | Ga0496126_0104040 | 3300048929 | Bacteria | 2480 |
| 721 | Ga0496126_0190719 | 3300048929 | Bacteria | 1736 |
| 722 | Ga0496126_0192436 | 3300048929 | Bacteria | 1727 |
| 723 | Ga0496126_0196413 | 3300048929 | Bacteria | 1706 |
| 724 | Ga0501031_0001866 | 3300049568 | Bacteria | 13252 |
| 725 | Ga0501031_0017282 | 3300049568 | Bacteria | 4687 |
| 726 | Ga0501031_0104102 | 3300049568 | Bacteria | 1852 |
| 727 | Ga0501032_0006976 | 3300049569 | Bacteria | 8281 |
| 728 | Ga0501032_0007040 | 3300049569 | Bacteria | 8249 |
| 729 | Ga0501032_0019190 | 3300049569 | Bacteria | 4784 |
| 730 | Ga0501032_0036536 | 3300049569 | Bacteria | 3352 |
| 731 | Ga0501032_0072302 | 3300049569 | Bacteria | 2298 |
| 732 | Ga0501032_0100665 | 3300049569 | Bacteria | 1915 |
| 733 | Ga0501032_0184403 | 3300049569 | Bacteria | 1365 |
| 734 | Ga0501033_0001605 | 3300049570 | Bacteria | 19872 |
| 735 | Ga0501033_0006414 | 3300049570 | Bacteria | 9212 |
| 736 | Ga0501033_0012999 | 3300049570 | Bacteria | 6348 |
| 737 | Ga0501033_0024710 | 3300049570 | Bacteria | 4530 |
| 738 | Ga0501033_0090027 | 3300049570 | Bacteria | 2245 |
| 739 | Ga0501033_0096577 | 3300049570 | Bacteria | 2159 |
| 740 | Ga0501033_0171302 | 3300049570 | Bacteria | 1559 |
| 741 | Ga0501033_0225548 | 3300049570 | Bacteria | 1332 |
| 742 | Ga0501033_0227053 | 3300049570 | Bacteria | 1327 |
| 743 | Ga0501034_0000499 | 3300049571 | Bacteria | 63629 |
| 744 | Ga0501034_0000561 | 3300049571 | Bacteria | 58872 |
| 745 | Ga0501034_0000832 | 3300049571 | Bacteria | 45898 |
| 746 | Ga0501034_0002893 | 3300049571 | Bacteria | 19964 |
| 747 | Ga0501034_0015498 | 3300049571 | Bacteria | 7831 |
| 748 | Ga0501034_0017391 | 3300049571 | Bacteria | 7375 |
| 749 | Ga0501034_0058850 | 3300049571 | Bacteria | 3860 |
| 750 | Ga0501034_0105050 | 3300049571 | Bacteria | 2817 |
| 751 | Ga0501034_0174087 | 3300049571 | Bacteria | 2118 |
| 752 | Ga0501034_0260331 | 3300049571 | Bacteria | 1677 |
| 753 | Ga0501034_0336364 | 3300049571 | Bacteria | 1440 |
| 754 | Ga0501036_0000503 | 3300049572 | Bacteria | 28006 |
| 755 | Ga0501036_0004196 | 3300049572 | Bacteria | 11615 |
| 756 | Ga0501036_0004539 | 3300049572 | Bacteria | 11206 |
| 757 | Ga0501036_0020356 | 3300049572 | Bacteria | 5573 |
| 758 | Ga0501036_0023203 | 3300049572 | Bacteria | 5224 |
| 759 | Ga0501036_0031563 | 3300049572 | Bacteria | 4476 |
| 760 | Ga0501036_0036678 | 3300049572 | Bacteria | 4149 |
| 761 | Ga0501036_0070697 | 3300049572 | Bacteria | 2951 |
| 762 | Ga0501036_0080185 | 3300049572 | Bacteria | 2759 |
| 763 | Ga0501036_0095058 | 3300049572 | Bacteria | 2519 |
| 764 | Ga0501036_0115323 | 3300049572 | Bacteria | 2269 |
| 765 | Ga0501036_0258636 | 3300049572 | Bacteria | 1458 |
| 766 | Ga0501037_0000595 | 3300049573 | Bacteria | 28225 |
| 767 | Ga0501037_0006217 | 3300049573 | Bacteria | 8731 |
| 768 | Ga0501037_0006574 | 3300049573 | Bacteria | 8508 |
| 769 | Ga0501037_0015628 | 3300049573 | Bacteria | 5587 |
| 770 | Ga0501037_0045570 | 3300049573 | Bacteria | 3219 |
| 771 | Ga0501037_0051522 | 3300049573 | Bacteria | 3010 |
| 772 | Ga0501037_0060251 | 3300049573 | Bacteria | 2768 |
| 773 | Ga0501038_0001751 | 3300049574 | Bacteria | 20170 |
| 774 | Ga0501038_0004702 | 3300049574 | Bacteria | 12701 |
| 775 | Ga0501038_0005164 | 3300049574 | Bacteria | 12140 |
| 776 | Ga0501038_0007397 | 3300049574 | Bacteria | 10128 |
| 777 | Ga0501038_0011040 | 3300049574 | Bacteria | 8247 |
| 778 | Ga0501038_0012326 | 3300049574 | Bacteria | 7810 |
| 779 | Ga0501038_0022542 | 3300049574 | Bacteria | 5640 |
| 780 | Ga0501038_0033990 | 3300049574 | Bacteria | 4485 |
| 781 | Ga0501038_0039123 | 3300049574 | Bacteria | 4149 |
| 782 | Ga0501038_0061540 | 3300049574 | Bacteria | 3210 |
| 783 | Ga0501038_0070972 | 3300049574 | Bacteria | 2955 |
| 784 | Ga0501038_0087664 | 3300049574 | Bacteria | 2614 |
| 785 | Ga0501038_0134451 | 3300049574 | Bacteria | 2027 |
| 786 | Ga0501039_0000143 | 3300049575 | Bacteria | 48809 |
| 787 | Ga0501039_0000498 | 3300049575 | Bacteria | 28499 |
| 788 | Ga0501039_0004324 | 3300049575 | Bacteria | 10710 |
| 789 | Ga0501039_0015580 | 3300049575 | Bacteria | 5817 |
| 790 | Ga0501039_0029417 | 3300049575 | Bacteria | 4231 |
| 791 | Ga0501039_0030447 | 3300049575 | Bacteria | 4162 |
| 792 | Ga0501039_0038083 | 3300049575 | Bacteria | 3714 |
| 793 | Ga0501039_0059313 | 3300049575 | Bacteria | 2964 |
| 794 | Ga0501039_0111401 | 3300049575 | Bacteria | 2139 |
| 795 | Ga0501039_0156921 | 3300049575 | Bacteria | 1788 |
| 796 | Ga0501040_0020607 | 3300049576 | Bacteria | 4395 |
| 797 | Ga0501040_0053192 | 3300049576 | Bacteria | 2772 |
| 798 | Ga0501040_0055248 | 3300049576 | Bacteria | 2723 |
| 799 | Ga0501041_0025769 | 3300049577 | Bacteria | 3535 |
| 800 | Ga0501041_0136074 | 3300049577 | Bacteria | 1531 |
| 801 | Ga0501042_0002901 | 3300049578 | Bacteria | 10643 |
| 802 | Ga0501042_0023178 | 3300049578 | Bacteria | 4341 |
| 803 | Ga0501042_0026691 | 3300049578 | Bacteria | 4057 |
| 804 | Ga0501042_0088730 | 3300049578 | Bacteria | 2219 |
| 805 | Ga0501043_0001482 | 3300049579 | Bacteria | 20529 |
| 806 | Ga0501043_0024995 | 3300049579 | Bacteria | 4686 |
| 807 | Ga0501043_0034734 | 3300049579 | Bacteria | 3965 |
| 808 | Ga0501043_0093962 | 3300049579 | Bacteria | 2357 |
| 809 | Ga0501043_0230787 | 3300049579 | Bacteria | 1429 |
| 810 | Ga0501043_0237019 | 3300049579 | Bacteria | 1408 |
| 811 | Ga0501046_0002131 | 3300049580 | Bacteria | 18703 |
| 812 | Ga0501046_0039428 | 3300049580 | Bacteria | 3782 |
| 813 | Ga0501046_0042875 | 3300049580 | Bacteria | 3605 |
| 814 | Ga0501047_0001136 | 3300049581 | Bacteria | 26421 |
| 815 | Ga0501047_0002024 | 3300049581 | Bacteria | 19400 |
| 816 | Ga0501047_0002192 | 3300049581 | Bacteria | 18696 |
| 817 | Ga0501047_0009485 | 3300049581 | Bacteria | 9197 |
| 818 | Ga0501047_0024519 | 3300049581 | Bacteria | 5788 |
| 819 | Ga0501047_0031991 | 3300049581 | Bacteria | 5076 |
| 820 | Ga0501047_0136472 | 3300049581 | Bacteria | 2333 |
| 821 | Ga0501047_0155191 | 3300049581 | Bacteria | 2163 |
| 822 | Ga0501047_0178874 | 3300049581 | Bacteria | 1988 |
| 823 | Ga0501047_0187256 | 3300049581 | Bacteria | 1934 |
| 824 | Ga0501047_0239434 | 3300049581 | Bacteria | 1666 |
| 825 | Ga0501048_0000774 | 3300049582 | Bacteria | 23431 |
| 826 | Ga0501048_0001447 | 3300049582 | Bacteria | 18018 |
| 827 | Ga0501048_0006795 | 3300049582 | Bacteria | 8689 |
| 828 | Ga0501048_0007164 | 3300049582 | Bacteria | 8471 |
| 829 | Ga0501048_0038256 | 3300049582 | Bacteria | 3443 |
| 830 | Ga0501048_0101465 | 3300049582 | Bacteria | 2030 |
| 831 | Ga0501067_0006079 | 3300049583 | Bacteria | 6692 |
| 832 | Ga0501067_0012216 | 3300049583 | Bacteria | 4759 |
| 833 | Ga0501068_0013601 | 3300049584 | Bacteria | 4634 |
| 834 | Ga0501069_0001439 | 3300049585 | Bacteria | 11677 |
| 835 | Ga0501069_0001866 | 3300049585 | Bacteria | 10534 |
| 836 | Ga0501070_0010475 | 3300049586 | Bacteria | 7840 |
| 837 | Ga0501070_0028755 | 3300049586 | Bacteria | 4660 |
| 838 | Ga0501070_0045861 | 3300049586 | Bacteria | 3635 |
| 839 | Ga0501070_0061458 | 3300049586 | Bacteria | 3112 |
| 840 | Ga0501070_0084417 | 3300049586 | Bacteria | 2629 |
| 841 | Ga0501071_0025822 | 3300049587 | Bacteria | 4117 |
| 842 | Ga0501071_0071361 | 3300049587 | Bacteria | 2531 |
| 843 | Ga0501072_0016230 | 3300049588 | Bacteria | 5712 |
| 844 | Ga0501072_0038118 | 3300049588 | Bacteria | 3772 |
| 845 | Ga0501072_0087873 | 3300049588 | Bacteria | 2466 |
| 846 | Ga0501072_0203728 | 3300049588 | Bacteria | 1578 |
| 847 | Ga0501073_0010927 | 3300049589 | Bacteria | 6640 |
| 848 | Ga0501073_0036985 | 3300049589 | Bacteria | 3467 |
| 849 | Ga0501073_0040917 | 3300049589 | Bacteria | 3276 |
| 850 | Ga0501073_0049989 | 3300049589 | Bacteria | 2931 |
| 851 | Ga0501073_0050132 | 3300049589 | Bacteria | 2926 |
| 852 | Ga0501073_0071338 | 3300049589 | Bacteria | 2420 |
| 853 | Ga0501073_0160688 | 3300049589 | Bacteria | 1556 |
| 854 | Ga0501074_0001676 | 3300049590 | Bacteria | 15071 |
| 855 | Ga0501074_0013443 | 3300049590 | Bacteria | 5951 |
| 856 | Ga0501074_0022115 | 3300049590 | Bacteria | 4620 |
| 857 | Ga0501074_0029779 | 3300049590 | Bacteria | 3955 |
| 858 | Ga0501074_0088678 | 3300049590 | Bacteria | 2215 |
| 859 | Ga0501075_0051757 | 3300049591 | Bacteria | 3088 |
| 860 | Ga0501076_0006597 | 3300049592 | Bacteria | 8417 |
| 861 | Ga0501076_0038923 | 3300049592 | Bacteria | 3732 |
| 862 | Ga0501076_0064500 | 3300049592 | Bacteria | 2919 |
| 863 | Ga0501076_0092799 | 3300049592 | Bacteria | 2429 |
| 864 | Ga0501077_0200369 | 3300049593 | Bacteria | 1268 |
| 865 | Ga0501079_0007700 | 3300049741 | Bacteria | 8152 |
| 866 | Ga0501079_0024164 | 3300049741 | Bacteria | 4664 |
| 867 | Ga0501079_0040814 | 3300049741 | Bacteria | 3581 |
| 868 | Ga0501079_0068913 | 3300049741 | Bacteria | 2730 |
| 869 | Ga0501079_0155810 | 3300049741 | Bacteria | 1781 |
| 870 | Ga0501080_0000159 | 3300049742 | Bacteria | 48535 |
| 871 | Ga0501080_0026563 | 3300049742 | Bacteria | 5379 |
| 872 | Ga0501080_0036625 | 3300049742 | Bacteria | 4580 |
| 873 | Ga0501080_0037947 | 3300049742 | Bacteria | 4499 |
| 874 | Ga0501080_0084953 | 3300049742 | Bacteria | 2941 |
| 875 | Ga0501080_0093866 | 3300049742 | Bacteria | 2786 |
| 876 | Ga0501080_0212966 | 3300049742 | Bacteria | 1770 |
| 877 | Ga0501080_0245428 | 3300049742 | Bacteria | 1633 |
| 878 | Ga0501081_0009677 | 3300049743 | Bacteria | 6284 |
| 879 | Ga0501081_0024556 | 3300049743 | Bacteria | 4047 |
| 880 | Ga0501081_0035597 | 3300049743 | Bacteria | 3389 |
| 881 | Ga0501081_0063804 | 3300049743 | Bacteria | 2557 |
| 882 | Ga0501081_0089569 | 3300049743 | Bacteria | 2162 |
| 883 | Ga0501081_0159094 | 3300049743 | Bacteria | 1627 |
| 884 | Ga0501083_0004507 | 3300049744 | Bacteria | 9838 |
| 885 | Ga0501083_0004950 | 3300049744 | Bacteria | 9438 |
| 886 | Ga0501083_0023504 | 3300049744 | Bacteria | 4273 |
| 887 | Ga0501083_0042685 | 3300049744 | Bacteria | 3073 |
| 888 | Ga0501083_0159484 | 3300049744 | Bacteria | 1476 |
| 889 | Ga0501035_0000838 | 3300049822 | Bacteria | 32854 |
| 890 | Ga0501035_0002087 | 3300049822 | Bacteria | 19885 |
| 891 | Ga0501035_0014314 | 3300049822 | Bacteria | 7322 |
| 892 | Ga0501035_0025165 | 3300049822 | Bacteria | 5456 |
| 893 | Ga0501035_0075849 | 3300049822 | Bacteria | 2974 |
| 894 | Ga0501035_0076523 | 3300049822 | Bacteria | 2959 |
| 895 | Ga0501035_0094684 | 3300049822 | Bacteria | 2626 |
| 896 | Ga0501035_0132711 | 3300049822 | Bacteria | 2170 |
| 897 | Ga0501035_0237567 | 3300049822 | Bacteria | 1551 |
| 898 | Ga0501035_0352824 | 3300049822 | Bacteria | 1230 |
| 899 | Ga0501044_0000115 | 3300049823 | Bacteria | 96999 |
| 900 | Ga0501044_0020560 | 3300049823 | Bacteria | 7046 |
| 901 | Ga0501044_0033827 | 3300049823 | Bacteria | 5367 |
| 902 | Ga0501044_0036679 | 3300049823 | Bacteria | 5127 |
| 903 | Ga0501044_0050013 | 3300049823 | Bacteria | 4314 |
| 904 | Ga0501044_0054046 | 3300049823 | Bacteria | 4129 |
| 905 | Ga0501044_0061755 | 3300049823 | Bacteria | 3832 |
| 906 | Ga0501044_0079233 | 3300049823 | Bacteria | 3329 |
| 907 | Ga0501044_0089548 | 3300049823 | Bacteria | 3106 |
| 908 | Ga0501044_0158828 | 3300049823 | Bacteria | 2239 |
| 909 | Ga0501044_0162402 | 3300049823 | Bacteria | 2209 |
| 910 | Ga0501044_0287733 | 3300049823 | Bacteria | 1575 |
| 911 | Ga0501045_0061250 | 3300049824 | Bacteria | 2761 |
| 912 | Ga0501045_0069803 | 3300049824 | Bacteria | 2584 |
| 913 | Ga0501045_0121727 | 3300049824 | Bacteria | 1937 |
| 914 | nmdc:mga03n38_13225_c1 | 3300050490 | Bacteria | 3128 |
| 915 | nmdc:mga03n38_14769_c1 | 3300050490 | Bacteria | 3002 |
| 916 | nmdc:mga03n38_1593_c1 | 3300050490 | Bacteria | 6611 |
| 917 | nmdc:mga03n38_29357_c1 | 3300050490 | Bacteria | 2301 |
| 918 | nmdc:mga00v17_2560_c1 | 3300050491 | Bacteria | 9330 |
| 919 | nmdc:mga00v17_66987_c1 | 3300050491 | Bacteria | 2218 |
| 920 | nmdc:mga0yw44_10870_c1 | 3300050492 | Bacteria | 4667 |
| 921 | nmdc:mga0yw44_12467_c1 | 3300050492 | Bacteria | 4433 |
| 922 | nmdc:mga0yw44_133331_c1 | 3300050492 | Bacteria | 1610 |
| 923 | nmdc:mga0yw44_41490_c1 | 3300050492 | Bacteria | 2740 |
| 924 | nmdc:mga0yw44_86897_c1 | 3300050492 | Bacteria | 1970 |
| 925 | nmdc:mga0k408_14266_c1 | 3300050493 | Bacteria | 4374 |
| 926 | nmdc:mga0k408_3070_c1 | 3300050493 | Bacteria | 8847 |
| 927 | nmdc:mga0k408_36016_c1 | 3300050493 | Bacteria | 2839 |
| 928 | nmdc:mga06z11_1068_c1 | 3300050494 | Bacteria | 9967 |
| 929 | nmdc:mga06z11_12914_c1 | 3300050494 | Bacteria | 3648 |
| 930 | nmdc:mga06z11_25213_c1 | 3300050494 | Bacteria | 2815 |
| 931 | nmdc:mga04h51_2923_c1 | 3300050495 | Bacteria | 4104 |
| 932 | nmdc:mga04h51_5240_c1 | 3300050495 | Bacteria | 3293 |
| 933 | nmdc:mga04h51_866_c1 | 3300050495 | Bacteria | 6980 |
| 934 | nmdc:mga07m45_34836_c1 | 3300050496 | Bacteria | 2799 |
| 935 | nmdc:mga07m45_8522_c1 | 3300050496 | Bacteria | 5276 |
| 936 | nmdc:mga07m45_8765_c1 | 3300050496 | Bacteria | 5213 |
| 937 | nmdc:mga06r32_48360_c2 | 3300050510 | Bacteria | 2780 |
| 938 | nmdc:mga06r32_91075_c1 | 3300050510 | Bacteria | 2980 |
| 939 | nmdc:mga0n895_150287_c1 | 3300050512 | Bacteria | 2359 |
| 940 | nmdc:mga0n895_46413_c1 | 3300050512 | Bacteria | 4244 |
| 941 | nmdc:mga0n895_5025_c1 | 3300050512 | Bacteria | 10973 |
| 942 | nmdc:mga0rr50_15118_c1 | 3300050513 | Bacteria | 5087 |
| 943 | nmdc:mga0rr50_264222_c1 | 3300050513 | Bacteria | 1432 |
| 944 | nmdc:mga0sz30_12419_c1 | 3300050516 | Bacteria | 3315 |
| 945 | nmdc:mga0sz30_74437_c1 | 3300050516 | Bacteria | 1465 |
| 946 | Ga0500610_0107331 | 3300053079 | Bacteria | 1439 |
| 947 | Ga0500635_0010324 | 3300053080 | Bacteria | 2618 |
| 948 | Ga0495655_0000469 | 3300053083 | Bacteria | 6772 |
| 949 | Ga0495595_0011588 | 3300053084 | Bacteria | 3690 |
| 950 | Ga0495619_0000164 | 3300053085 | Bacteria | 48672 |
| 951 | Ga0495619_0087869 | 3300053085 | Bacteria | 2102 |
| 952 | Ga0495619_0090762 | 3300053085 | Bacteria | 2068 |
| 953 | Ga0495619_0119361 | 3300053085 | Bacteria | 1807 |
| 954 | Ga0500581_018442 | 3300053089 | Bacteria | 3513 |
| 955 | Ga0500647_0004322 | 3300053091 | Bacteria | 5702 |
| 956 | Ga0500651_0030072 | 3300053093 | Bacteria | 3416 |
| 957 | Ga0500566_0000400 | 3300053094 | Bacteria | 24130 |
| 958 | Ga0500566_0110585 | 3300053094 | Bacteria | 1494 |
| 959 | Ga0500566_0122852 | 3300053094 | Bacteria | 1398 |
| 960 | Ga0500640_022647 | 3300053095 | Bacteria | 2716 |
| 961 | Ga0500650_0000315 | 3300053098 | Bacteria | 11676 |
| 962 | Ga0500555_024278 | 3300053103 | Bacteria | 1738 |
| 963 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 964 | Ga0500556_0000110 | 3300053104 | Bacteria | 73102 |
| 965 | Ga0500569_000629 | 3300053109 | Bacteria | 6006 |
| 966 | Ga0500572_000121 | 3300053111 | Bacteria | 26132 |
| 967 | Ga0500592_001867 | 3300053116 | Bacteria | 3392 |
| 968 | Ga0500595_000749 | 3300053119 | Bacteria | 19100 |
| 969 | Ga0500595_023560 | 3300053119 | Bacteria | 2162 |
| 970 | Ga0500595_027390 | 3300053119 | Bacteria | 1952 |
| 971 | Ga0500608_003152 | 3300053122 | Bacteria | 6126 |
| 972 | Ga0500614_003296 | 3300053123 | Bacteria | 3493 |
| 973 | Ga0500642_0000006 | 3300053130 | Bacteria | 350064 |
| 974 | Ga0500652_003613 | 3300053131 | Bacteria | 4698 |
| 975 | Ga0500658_0060631 | 3300053134 | Bacteria | 1571 |
| 976 | Ga0500658_0092215 | 3300053134 | Bacteria | 1311 |
| 977 | Ga0500559_0001424 | 3300053136 | Bacteria | 13570 |
| 978 | Ga0500559_0016013 | 3300053136 | Bacteria | 3166 |
| 979 | Ga0500568_0001277 | 3300053139 | Bacteria | 16583 |
| 980 | Ga0500568_0008272 | 3300053139 | Bacteria | 5030 |
| 981 | Ga0500577_0020328 | 3300053142 | Bacteria | 2170 |
| 982 | Ga0500588_0026039 | 3300053146 | Bacteria | 1632 |
| 983 | Ga0500590_089270 | 3300053148 | Bacteria | 1500 |
| 984 | Ga0500604_0005735 | 3300053151 | Bacteria | 3280 |
| 985 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 986 | Ga0500616_0005928 | 3300053153 | Bacteria | 8162 |
| 987 | Ga0500616_0010404 | 3300053153 | Bacteria | 5568 |
| 988 | Ga0500616_0012199 | 3300053153 | Bacteria | 5035 |
| 989 | Ga0500622_0001022 | 3300053156 | Bacteria | 23514 |
| 990 | Ga0500627_0094752 | 3300053158 | Bacteria | 1337 |
| 991 | Ga0500630_001045 | 3300053159 | Bacteria | 12946 |
| 992 | Ga0500638_031156 | 3300053162 | Bacteria | 2571 |
| 993 | Ga0500639_000219 | 3300053163 | Bacteria | 28391 |
| 994 | Ga0500636_0069407 | 3300053177 | Bacteria | 2045 |
| 995 | Ga0500636_0072414 | 3300053177 | Bacteria | 1997 |
| 996 | Ga0500636_0080342 | 3300053177 | Bacteria | 1879 |
| 997 | Ga0500637_0055030 | 3300053178 | Bacteria | 2271 |
| 998 | Ga0500645_047784 | 3300053730 | Bacteria | 1254 |
| 999 | Ga0500596_000227 | 3300053735 | Bacteria | 9566 |
| 1000 | Ga0500596_009050 | 3300053735 | Bacteria | 1566 |
| 1001 | Ga0501084_0018742 | 3300054114 | Bacteria | 5763 |
| 1002 | Ga0501084_0026608 | 3300054114 | Bacteria | 4828 |
| 1003 | Ga0501084_0034868 | 3300054114 | Bacteria | 4208 |
| 1004 | Ga0501084_0042101 | 3300054114 | Bacteria | 3820 |
| 1005 | Ga0501084_0065025 | 3300054114 | Bacteria | 3052 |
| 1006 | Ga0501084_0083485 | 3300054114 | Bacteria | 2681 |
| 1007 | Ga0501082_0008587 | 3300060353 | Bacteria | 8812 |
| 1008 | Ga0501082_0062434 | 3300060353 | Bacteria | 3207 |
| 1009 | Ga0501082_0190076 | 3300060353 | Bacteria | 1786 |
| 1010 | Ga0530510_0083480 | 3300061734 | Bacteria | 2326 |
| 1011 | Ga0530510_0167184 | 3300061734 | Bacteria | 1628 |
| 1012 | Ga0530510_0216087 | 3300061734 | Bacteria | 1424 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053146 | Ga0500588_0026039 | Ga0500588_0026039_15_995 | 264 |
| 2 | 3300053134 | Ga0500658_0060631 | Ga0500658_0060631_54_1034 | 265 |
| 3 | 3300037068 | Ga0373925_0207485 | Ga0373925_0207485_58_1077 | 276 |
| 4 | 3300009177 | Ga0105248_10244685 | Ga0105248_102446853 | 277 |
| 5 | 3300035118 | Ga0373954_0099175 | Ga0373954_0099175_29_1009 | 280 |
| 6 | 3300007788 | Ga0099795_10079882 | Ga0099795_100798821 | 283 |
| 7 | 3300027512 | Ga0209179_1003276 | Ga0209179_10032763 | 283 |
| 8 | 3300047315 | Ga0495581_0032354 | Ga0495581_0032354_920_1873 | 283 |
| 9 | 3300005616 | Ga0068852_100325192 | Ga0068852_1003251922 | 286 |
| 10 | 3300048916 | Ga0496113_0235333 | Ga0496113_0235333_10_939 | 288 |
| 11 | 3300046499 | Ga0495594_0080768 | Ga0495594_0080768_226_1194 | 293 |
| 12 | 3300049570 | Ga0501033_0001605 | Ga0501033_0001605_8297_9283 | 293 |
| 13 | 3300049571 | Ga0501034_0000832 | Ga0501034_0000832_36044_37030 | 293 |
| 14 | 3300049572 | Ga0501036_0000503 | Ga0501036_0000503_17788_18774 | 293 |
| 15 | 3300049574 | Ga0501038_0004702 | Ga0501038_0004702_5568_6554 | 293 |
| 16 | 3300049575 | Ga0501039_0000143 | Ga0501039_0000143_9888_10874 | 293 |
| 17 | 3300049581 | Ga0501047_0002192 | Ga0501047_0002192_12142_13128 | 293 |
| 18 | 3300054114 | Ga0501084_0042101 | Ga0501084_0042101_614_1600 | 293 |
| 19 | 3300049571 | Ga0501034_0336364 | Ga0501034_0336364_23_1003 | 297 |
| 20 | 3300048918 | Ga0496115_0057816 | Ga0496115_0057816_2105_3094 | 298 |
| 21 | 3300048088 | Ga0495602_0262838 | Ga0495602_0262838_186_1166 | 299 |
| 22 | 3300048913 | Ga0496110_0123992 | Ga0496110_0123992_135_1115 | 299 |
| 23 | 3300049570 | Ga0501033_0090027 | Ga0501033_0090027_92_1069 | 302 |
| 24 | 3300009093 | Ga0105240_10024435 | Ga0105240_100244354 | 303 |
| 25 | 3300009174 | Ga0105241_10268409 | Ga0105241_102684092 | 303 |
| 26 | 3300048920 | Ga0496117_0136853 | Ga0496117_0136853_367_1413 | 303 |
| 27 | 3300039450 | Ga0436363_0677719 | Ga0436363_0677719_25_1047 | 304 |
| 28 | 3300046460 | Ga0495638_0004396 | Ga0495638_0004396_9352_10473 | 304 |
| 29 | 3300046522 | Ga0495643_0041010 | Ga0495643_0041010_489_1610 | 304 |
| 30 | 3300046665 | Ga0495661_0052572 | Ga0495661_0052572_1080_2201 | 304 |
| 31 | 3300047472 | Ga0495686_0015739 | Ga0495686_0015739_1019_2140 | 304 |
| 32 | 3300048925 | Ga0496122_0008649 | Ga0496122_0008649_2223_3344 | 304 |
| 33 | 3300048926 | Ga0496123_0020212 | Ga0496123_0020212_2354_3475 | 304 |
| 34 | 3300048929 | Ga0496126_0104040 | Ga0496126_0104040_723_1844 | 304 |
| 35 | 3300050492 | nmdc:mga0yw44_10870_c1 | nmdc:mga0yw44_10870_c1_1388_2509 | 304 |
| 36 | 3300053093 | Ga0500651_0030072 | Ga0500651_0030072_1531_2652 | 304 |
| 37 | 3300053109 | Ga0500569_000629 | Ga0500569_000629_1190_2311 | 304 |
| 38 | 3300046507 | Ga0495606_0053849 | Ga0495606_0053849_1180_2301 | 305 |
| 39 | 3300046512 | Ga0495610_0021420 | Ga0495610_0021420_116_1237 | 305 |
| 40 | 3300048921 | Ga0496118_0037179 | Ga0496118_0037179_906_2039 | 305 |
| 41 | 3300053116 | Ga0500592_001867 | Ga0500592_001867_611_1732 | 305 |
| 42 | 3300053730 | Ga0500645_047784 | Ga0500645_047784_16_1137 | 305 |
| 43 | 3300006038 | Ga0075365_10015666 | Ga0075365_100156663 | 308 |
| 44 | 3300046660 | Ga0495625_0124577 | Ga0495625_0124577_448_1581 | 308 |
| 45 | iso_pu_bacteria | 2524023228 | 2524541184 | 308 |
| 46 | 3300005937 | Ga0081455_10040525 | Ga0081455_100405256 | 309 |
| 47 | 3300048929 | Ga0496126_0047633 | Ga0496126_0047633_1841_2974 | 309 |
| 48 | 3300053098 | Ga0500650_0000315 | Ga0500650_0000315_5116_6249 | 309 |
| 49 | 3300053130 | Ga0500642_0000006 | Ga0500642_0000006_288467_289600 | 309 |
| 50 | 3300053139 | Ga0500568_0001277 | Ga0500568_0001277_1539_2672 | 309 |
| 51 | 3300053151 | Ga0500604_0005735 | Ga0500604_0005735_1173_2306 | 309 |
| 52 | 3300035111 | Ga0373923_0026898 | Ga0373923_0026898_1065_2159 | 311 |
| 53 | 3300035116 | Ga0373945_0059101 | Ga0373945_0059101_368_1399 | 311 |
| 54 | 3300035692 | Ga0373935_0004983 | Ga0373935_0004983_2932_4026 | 311 |
| 55 | 3300035695 | Ga0373927_0008479 | Ga0373927_0008479_2117_3211 | 311 |
| 56 | 3300035725 | Ga0373947_0034433 | Ga0373947_0034433_377_1471 | 311 |
| 57 | 3300037068 | Ga0373925_0014554 | Ga0373925_0014554_352_1446 | 311 |
| 58 | 3300046461 | Ga0495641_0011812 | Ga0495641_0011812_179_1273 | 311 |
| 59 | 3300046472 | Ga0495580_0025887 | Ga0495580_0025887_2375_3469 | 311 |
| 60 | 3300046475 | Ga0495639_0002142 | Ga0495639_0002142_4425_5519 | 311 |
| 61 | 3300046499 | Ga0495594_0002226 | Ga0495594_0002226_6119_7213 | 311 |
| 62 | 3300046516 | Ga0495628_0075184 | Ga0495628_0075184_1432_2526 | 311 |
| 63 | 3300046517 | Ga0495630_0035944 | Ga0495630_0035944_377_1471 | 311 |
| 64 | 3300046531 | Ga0495665_0002068 | Ga0495665_0002068_1958_3052 | 311 |
| 65 | 3300046533 | Ga0495640_0015696 | Ga0495640_0015696_795_1889 | 311 |
| 66 | 3300046557 | Ga0495622_0011687 | Ga0495622_0011687_1849_2943 | 311 |
| 67 | 3300046642 | Ga0495634_0010636 | Ga0495634_0010636_1374_2468 | 311 |
| 68 | 3300046663 | Ga0495635_0005726 | Ga0495635_0005726_1699_2793 | 311 |
| 69 | 3300046674 | Ga0495588_0046958 | Ga0495588_0046958_568_1662 | 311 |
| 70 | 3300046675 | Ga0495657_0096400 | Ga0495657_0096400_265_1359 | 311 |
| 71 | 3300046681 | Ga0495647_0005387 | Ga0495647_0005387_260_1354 | 311 |
| 72 | 3300046683 | Ga0495658_0003333 | Ga0495658_0003333_4489_5583 | 311 |
| 73 | 3300046689 | Ga0495613_0008228 | Ga0495613_0008228_3093_4187 | 311 |
| 74 | 3300046690 | Ga0495624_0039174 | Ga0495624_0039174_300_1394 | 311 |
| 75 | 3300047315 | Ga0495581_0025017 | Ga0495581_0025017_569_1663 | 311 |
| 76 | 3300047319 | Ga0495674_0013608 | Ga0495674_0013608_2223_3317 | 311 |
| 77 | 3300047673 | Ga0495593_0002908 | Ga0495593_0002908_3711_4805 | 311 |
| 78 | 3300053103 | Ga0500555_024278 | Ga0500555_024278_354_1583 | 311 |
| 79 | 3300053177 | Ga0500636_0069407 | Ga0500636_0069407_638_1774 | 311 |
| 80 | 3300005338 | Ga0068868_100080657 | Ga0068868_1000806572 | 312 |
| 81 | 3300005367 | Ga0070667_100133228 | Ga0070667_1001332282 | 312 |
| 82 | 3300005843 | Ga0068860_100179979 | Ga0068860_1001799791 | 312 |
| 83 | 3300009551 | Ga0105238_10031155 | Ga0105238_100311555 | 312 |
| 84 | 3300025924 | Ga0207694_10051174 | Ga0207694_100511745 | 312 |
| 85 | 3300025941 | Ga0207711_10098011 | Ga0207711_100980111 | 312 |
| 86 | 3300026095 | Ga0207676_10014267 | Ga0207676_100142674 | 312 |
| 87 | 3300048909 | Ga0496106_0016670 | Ga0496106_0016670_4096_5232 | 312 |
| 88 | 3300048913 | Ga0496110_0084491 | Ga0496110_0084491_465_1601 | 312 |
| 89 | 3300005334 | Ga0068869_100004028 | Ga0068869_1000040287 | 313 |
| 90 | 3300005347 | Ga0070668_100008886 | Ga0070668_1000088868 | 313 |
| 91 | 3300005355 | Ga0070671_100032813 | Ga0070671_1000328134 | 313 |
| 92 | 3300005455 | Ga0070663_100005162 | Ga0070663_1000051621 | 313 |
| 93 | 3300005456 | Ga0070678_100073070 | Ga0070678_1000730703 | 313 |
| 94 | 3300005457 | Ga0070662_100024658 | Ga0070662_1000246584 | 313 |
| 95 | 3300005548 | Ga0070665_100074481 | Ga0070665_1000744813 | 313 |
| 96 | 3300005563 | Ga0068855_100031649 | Ga0068855_1000316497 | 313 |
| 97 | 3300005614 | Ga0068856_100043502 | Ga0068856_1000435021 | 313 |
| 98 | 3300005617 | Ga0068859_100110965 | Ga0068859_1001109652 | 313 |
| 99 | 3300005618 | Ga0068864_100011530 | Ga0068864_1000115306 | 313 |
| 100 | 3300005841 | Ga0068863_100194093 | Ga0068863_1001940932 | 313 |
| 101 | 3300005842 | Ga0068858_100050100 | Ga0068858_1000501002 | 313 |
| 102 | 3300006042 | Ga0075368_10003164 | Ga0075368_100031643 | 313 |
| 103 | 3300006051 | Ga0075364_10019969 | Ga0075364_100199693 | 313 |
| 104 | 3300006178 | Ga0075367_10019333 | Ga0075367_100193333 | 313 |
| 105 | 3300006195 | Ga0075366_10003963 | Ga0075366_100039638 | 313 |
| 106 | 3300006353 | Ga0075370_10082159 | Ga0075370_100821592 | 313 |
| 107 | 3300006871 | Ga0075434_100061214 | Ga0075434_1000612143 | 313 |
| 108 | 3300006931 | Ga0097620_100110965 | Ga0097620_1001109652 | 313 |
| 109 | 3300009098 | Ga0105245_10059144 | Ga0105245_100591442 | 313 |
| 110 | 3300009177 | Ga0105248_10011606 | Ga0105248_100116064 | 313 |
| 111 | 3300009551 | Ga0105238_10035315 | Ga0105238_100353155 | 313 |
| 112 | 3300011119 | Ga0105246_10001035 | Ga0105246_100010359 | 313 |
| 113 | 3300013308 | Ga0157375_10027175 | Ga0157375_100271752 | 313 |
| 114 | 3300014325 | Ga0163163_10124317 | Ga0163163_101243172 | 313 |
| 115 | 3300025901 | Ga0207688_10035621 | Ga0207688_100356212 | 313 |
| 116 | 3300025925 | Ga0207650_10267418 | Ga0207650_102674182 | 313 |
| 117 | 3300025933 | Ga0207706_10029015 | Ga0207706_100290153 | 313 |
| 118 | 3300025945 | Ga0207679_10082748 | Ga0207679_100827481 | 313 |
| 119 | 3300025949 | Ga0207667_10069346 | Ga0207667_100693464 | 313 |
| 120 | 3300026067 | Ga0207678_10024463 | Ga0207678_100244632 | 313 |
| 121 | 3300026078 | Ga0207702_10147255 | Ga0207702_101472553 | 313 |
| 122 | 3300026121 | Ga0207683_10028640 | Ga0207683_100286404 | 313 |
| 123 | 3300027866 | Ga0209813_10009392 | Ga0209813_100093921 | 313 |
| 124 | 3300048911 | Ga0496108_0017621 | Ga0496108_0017621_2502_3638 | 313 |
| 125 | 3300048912 | Ga0496109_0124445 | Ga0496109_0124445_1055_2191 | 313 |
| 126 | 3300048915 | Ga0496112_0085763 | Ga0496112_0085763_1201_2337 | 313 |
| 127 | 3300048928 | Ga0496125_0122488 | Ga0496125_0122488_558_1694 | 313 |
| 128 | 3300050491 | nmdc:mga00v17_66987_c1 | nmdc:mga00v17_66987_c1_126_1262 | 313 |
| 129 | 3300050493 | nmdc:mga0k408_3070_c1 | nmdc:mga0k408_3070_c1_3307_4443 | 313 |
| 130 | 3300050495 | nmdc:mga04h51_5240_c1 | nmdc:mga04h51_5240_c1_1269_2405 | 313 |
| 131 | 3300050496 | nmdc:mga07m45_8522_c1 | nmdc:mga07m45_8522_c1_894_2030 | 313 |
| 132 | 3300050512 | nmdc:mga0n895_150287_c1 | nmdc:mga0n895_150287_c1_838_1974 | 313 |
| 133 | 3300005842 | Ga0068858_100119126 | Ga0068858_1001191263 | 314 |
| 134 | 3300006881 | Ga0068865_100024210 | Ga0068865_1000242103 | 314 |
| 135 | 3300009098 | Ga0105245_10248838 | Ga0105245_102488382 | 314 |
| 136 | 3300009551 | Ga0105238_10012485 | Ga0105238_100124854 | 314 |
| 137 | 3300013306 | Ga0163162_10006254 | Ga0163162_1000625418 | 314 |
| 138 | 3300017792 | Ga0163161_10018218 | Ga0163161_100182186 | 314 |
| 139 | 3300025935 | Ga0207709_10187831 | Ga0207709_101878311 | 314 |
| 140 | 3300025938 | Ga0207704_10007211 | Ga0207704_100072116 | 314 |
| 141 | 3300026035 | Ga0207703_10070342 | Ga0207703_100703423 | 314 |
| 142 | 3300026118 | Ga0207675_100030122 | Ga0207675_1000301225 | 314 |
| 143 | 3300028380 | Ga0268265_10044534 | Ga0268265_100445343 | 314 |
| 144 | 3300048927 | Ga0496124_0016923 | Ga0496124_0016923_4768_5928 | 314 |
| 145 | 3300048928 | Ga0496125_0021935 | Ga0496125_0021935_1282_2442 | 314 |
| 146 | 3300046528 | Ga0495642_0016277 | Ga0495642_0016277_1548_2684 | 315 |
| 147 | 3300025941 | Ga0207711_10319764 | Ga0207711_103197641 | 316 |
| 148 | 3300031852 | Ga0307410_10168960 | Ga0307410_101689602 | 316 |
| 149 | 3300046692 | Ga0495671_0018090 | Ga0495671_0018090_273_1394 | 316 |
| 150 | 3300049577 | Ga0501041_0136074 | Ga0501041_0136074_452_1504 | 316 |
| 151 | 3300003215 | JGI25153J46596_10000645 | JGI25153J46596_100006455 | 317 |
| 152 | 3300009545 | Ga0105237_10063501 | Ga0105237_100635014 | 317 |
| 153 | 3300025297 | Ga0209758_1002205 | Ga0209758_10022055 | 317 |
| 154 | 3300035724 | Ga0373933_0000202 | Ga0373933_0000202_28874_30016 | 317 |
| 155 | 3300005356 | Ga0070674_100147148 | Ga0070674_1001471481 | 318 |
| 156 | 3300005434 | Ga0070709_10056012 | Ga0070709_100560122 | 318 |
| 157 | 3300005436 | Ga0070713_100006321 | Ga0070713_1000063212 | 318 |
| 158 | 3300005439 | Ga0070711_100027000 | Ga0070711_1000270004 | 318 |
| 159 | 3300005458 | Ga0070681_10040314 | Ga0070681_100403142 | 318 |
| 160 | 3300013104 | Ga0157370_10011827 | Ga0157370_100118278 | 318 |
| 161 | 3300025906 | Ga0207699_10124118 | Ga0207699_101241182 | 318 |
| 162 | 3300025915 | Ga0207693_10003223 | Ga0207693_100032232 | 318 |
| 163 | 3300025916 | Ga0207663_10042314 | Ga0207663_100423142 | 318 |
| 164 | 3300039093 | Ga0400489_33869 | Ga0400489_33869_575_1696 | 318 |
| 165 | 3300048929 | Ga0496126_0190719 | Ga0496126_0190719_69_1163 | 318 |
| 166 | 3300046526 | Ga0495666_0030878 | Ga0495666_0030878_885_2003 | 319 |
| 167 | 3300048906 | Ga0496103_0106903 | Ga0496103_0106903_314_1501 | 319 |
| 168 | 3300048907 | Ga0496104_0003761 | Ga0496104_0003761_6944_8131 | 319 |
| 169 | 3300048909 | Ga0496106_0015871 | Ga0496106_0015871_1003_2190 | 319 |
| 170 | 3300048913 | Ga0496110_0159976 | Ga0496110_0159976_332_1519 | 319 |
| 171 | 3300048918 | Ga0496115_0049271 | Ga0496115_0049271_322_1509 | 319 |
| 172 | 3300003752 | Ga0055539_1006587 | Ga0055539_10065872 | 320 |
| 173 | 3300013104 | Ga0157370_10052376 | Ga0157370_100523763 | 320 |
| 174 | 3300025253 | Ga0209677_101165 | Ga0209677_1011659 | 320 |
| 175 | 3300026067 | Ga0207678_10083637 | Ga0207678_100836373 | 320 |
| 176 | 3300046501 | Ga0495607_0022174 | Ga0495607_0022174_459_1592 | 320 |
| 177 | 3300046530 | Ga0495654_0053002 | Ga0495654_0053002_121_1254 | 320 |
| 178 | 3300048923 | Ga0496120_0016663 | Ga0496120_0016663_1593_2726 | 320 |
| 179 | 3300048928 | Ga0496125_0006386 | Ga0496125_0006386_5623_6756 | 320 |
| 180 | 3300053089 | Ga0500581_018442 | Ga0500581_018442_515_1648 | 320 |
| 181 | 3300053104 | Ga0500556_0000030 | Ga0500556_0000030_90691_91824 | 320 |
| 182 | 3300053131 | Ga0500652_003613 | Ga0500652_003613_1268_2401 | 320 |
| 183 | 3300053134 | Ga0500658_0092215 | Ga0500658_0092215_36_1169 | 320 |
| 184 | 3300053142 | Ga0500577_0020328 | Ga0500577_0020328_870_2003 | 320 |
| 185 | 3300053156 | Ga0500622_0001022 | Ga0500622_0001022_15561_16694 | 320 |
| 186 | 3300053158 | Ga0500627_0094752 | Ga0500627_0094752_88_1221 | 320 |
| 187 | 3300048916 | Ga0496113_0376308 | Ga0496113_0376308_13_1119 | 321 |
| 188 | 3300053085 | Ga0495619_0087869 | Ga0495619_0087869_284_1378 | 321 |
| 189 | 3300053153 | Ga0500616_0012199 | Ga0500616_0012199_3643_4770 | 321 |
| 190 | iso_pu_bacteria | 2935785616 | 2935792085 | 321 |
| 191 | iso_pu_bacteria | 2935793552 | 2935798074 | 321 |
| 192 | 3300013297 | Ga0157378_10001958 | Ga0157378_1000195816 | 322 |
| 193 | 3300031616 | Ga0307508_10000058 | Ga0307508_1000005818 | 324 |
| 194 | 3300035692 | Ga0373935_0071435 | Ga0373935_0071435_243_1292 | 324 |
| 195 | 3300035695 | Ga0373927_0063358 | Ga0373927_0063358_1205_2254 | 324 |
| 196 | 3300037068 | Ga0373925_0105324 | Ga0373925_0105324_950_1999 | 324 |
| 197 | 3300046557 | Ga0495622_0014798 | Ga0495622_0014798_1838_2887 | 324 |
| 198 | 3300048918 | Ga0496115_0196083 | Ga0496115_0196083_138_1250 | 324 |
| 199 | 3300049568 | Ga0501031_0017282 | Ga0501031_0017282_3485_4624 | 324 |
| 200 | 3300049572 | Ga0501036_0070697 | Ga0501036_0070697_291_1430 | 324 |
| 201 | 3300049574 | Ga0501038_0061540 | Ga0501038_0061540_1051_2190 | 324 |
| 202 | 3300049574 | Ga0501038_0070972 | Ga0501038_0070972_1155_2309 | 324 |
| 203 | 3300049575 | Ga0501039_0029417 | Ga0501039_0029417_966_2105 | 324 |
| 204 | 3300049576 | Ga0501040_0053192 | Ga0501040_0053192_67_1206 | 324 |
| 205 | 3300049578 | Ga0501042_0023178 | Ga0501042_0023178_239_1378 | 324 |
| 206 | 3300049580 | Ga0501046_0039428 | Ga0501046_0039428_1675_2814 | 324 |
| 207 | 3300049582 | Ga0501048_0038256 | Ga0501048_0038256_1825_2964 | 324 |
| 208 | 3300049587 | Ga0501071_0025822 | Ga0501071_0025822_2915_4054 | 324 |
| 209 | 3300049588 | Ga0501072_0087873 | Ga0501072_0087873_492_1631 | 324 |
| 210 | 3300049590 | Ga0501074_0022115 | Ga0501074_0022115_537_1676 | 324 |
| 211 | 3300049591 | Ga0501075_0051757 | Ga0501075_0051757_1532_2671 | 324 |
| 212 | 3300049742 | Ga0501080_0093866 | Ga0501080_0093866_1048_2187 | 324 |
| 213 | 3300049743 | Ga0501081_0024556 | Ga0501081_0024556_462_1601 | 324 |
| 214 | 3300053080 | Ga0500635_0010324 | Ga0500635_0010324_809_1858 | 324 |
| 215 | 3300053094 | Ga0500566_0110585 | Ga0500566_0110585_128_1177 | 324 |
| 216 | 3300053178 | Ga0500637_0055030 | Ga0500637_0055030_248_1297 | 324 |
| 217 | 3300054114 | Ga0501084_0026608 | Ga0501084_0026608_2723_3862 | 324 |
| 218 | 3300060353 | Ga0501082_0062434 | Ga0501082_0062434_372_1511 | 324 |
| 219 | 3300061734 | Ga0530510_0216087 | Ga0530510_0216087_171_1310 | 324 |
| 220 | 3300005937 | Ga0081455_10000877 | Ga0081455_1000087716 | 325 |
| 221 | 3300006852 | Ga0075433_10363190 | Ga0075433_103631901 | 325 |
| 222 | 3300006871 | Ga0075434_100003258 | Ga0075434_10000325811 | 325 |
| 223 | 3300028786 | Ga0307517_10001951 | Ga0307517_1000195122 | 325 |
| 224 | 3300028794 | Ga0307515_10092425 | Ga0307515_100924253 | 325 |
| 225 | 3300031507 | Ga0307509_10178491 | Ga0307509_101784911 | 325 |
| 226 | 3300035171 | Ga0373946_0021979 | Ga0373946_0021979_1138_2274 | 325 |
| 227 | 3300035725 | Ga0373947_0096428 | Ga0373947_0096428_706_1758 | 325 |
| 228 | 3300048913 | Ga0496110_0036244 | Ga0496110_0036244_780_1916 | 325 |
| 229 | 3300049569 | Ga0501032_0072302 | Ga0501032_0072302_488_1573 | 325 |
| 230 | 3300049570 | Ga0501033_0096577 | Ga0501033_0096577_932_2017 | 325 |
| 231 | 3300049572 | Ga0501036_0023203 | Ga0501036_0023203_1545_2630 | 325 |
| 232 | 3300049573 | Ga0501037_0060251 | Ga0501037_0060251_369_1454 | 325 |
| 233 | 3300049574 | Ga0501038_0005164 | Ga0501038_0005164_347_1432 | 325 |
| 234 | 3300049575 | Ga0501039_0038083 | Ga0501039_0038083_1829_2914 | 325 |
| 235 | 3300049581 | Ga0501047_0136472 | Ga0501047_0136472_553_1638 | 325 |
| 236 | 3300049742 | Ga0501080_0084953 | Ga0501080_0084953_1596_2681 | 325 |
| 237 | 3300049823 | Ga0501044_0033827 | Ga0501044_0033827_469_1554 | 325 |
| 238 | 3300050512 | nmdc:mga0n895_5025_c1 | nmdc:mga0n895_5025_c1_4679_5791 | 325 |
| 239 | 3300009101 | Ga0105247_10006815 | Ga0105247_100068157 | 326 |
| 240 | 3300025900 | Ga0207710_10019392 | Ga0207710_100193924 | 326 |
| 241 | 3300028556 | Ga0265337_1006298 | Ga0265337_10062984 | 326 |
| 242 | 3300028558 | Ga0265326_10010919 | Ga0265326_100109193 | 326 |
| 243 | 3300028563 | Ga0265319_1000642 | Ga0265319_10006428 | 326 |
| 244 | 3300028573 | Ga0265334_10002301 | Ga0265334_100023012 | 326 |
| 245 | 3300028577 | Ga0265318_10005252 | Ga0265318_100052524 | 326 |
| 246 | 3300028653 | Ga0265323_10000169 | Ga0265323_1000016917 | 326 |
| 247 | 3300028654 | Ga0265322_10006247 | Ga0265322_100062473 | 326 |
| 248 | 3300028666 | Ga0265336_10000663 | Ga0265336_1000066315 | 326 |
| 249 | 3300028800 | Ga0265338_10000013 | Ga0265338_1000001363 | 326 |
| 250 | 3300029957 | Ga0265324_10001030 | Ga0265324_1000103015 | 326 |
| 251 | iso_pu_bacteria | 2906610324 | 2906613347 | 326 |
| 252 | 3300007265 | Ga0099794_10010689 | Ga0099794_100106891 | 327 |
| 253 | 3300035692 | Ga0373935_0060761 | Ga0373935_0060761_1180_2238 | 327 |
| 254 | 3300046559 | Ga0495667_0122795 | Ga0495667_0122795_17_1102 | 327 |
| 255 | 3300046809 | Ga0495600_0041920 | Ga0495600_0041920_1011_2096 | 327 |
| 256 | 3300049581 | Ga0501047_0009485 | Ga0501047_0009485_6542_7624 | 327 |
| 257 | 3300049582 | Ga0501048_0101465 | Ga0501048_0101465_11_1069 | 327 |
| 258 | 3300049742 | Ga0501080_0212966 | Ga0501080_0212966_460_1542 | 327 |
| 259 | 3300049822 | Ga0501035_0094684 | Ga0501035_0094684_581_1639 | 327 |
| 260 | 3300049823 | Ga0501044_0158828 | Ga0501044_0158828_795_1877 | 327 |
| 261 | 3300005435 | Ga0070714_100125085 | Ga0070714_1001250853 | 328 |
| 262 | 3300009101 | Ga0105247_10005404 | Ga0105247_100054045 | 328 |
| 263 | 3300025908 | Ga0207643_10138238 | Ga0207643_101382381 | 328 |
| 264 | 3300026023 | Ga0207677_10026700 | Ga0207677_100267001 | 328 |
| 265 | 3300031241 | Ga0265325_10038067 | Ga0265325_100380673 | 328 |
| 266 | 3300049571 | Ga0501034_0058850 | Ga0501034_0058850_275_1408 | 328 |
| 267 | 3300049581 | Ga0501047_0239434 | Ga0501047_0239434_467_1600 | 328 |
| 268 | 3300005339 | Ga0070660_100152300 | Ga0070660_1001523002 | 329 |
| 269 | 3300005440 | Ga0070705_100157858 | Ga0070705_1001578582 | 329 |
| 270 | 3300005618 | Ga0068864_100102363 | Ga0068864_1001023632 | 329 |
| 271 | 3300009545 | Ga0105237_10115079 | Ga0105237_101150791 | 329 |
| 272 | 3300009553 | Ga0105249_10113853 | Ga0105249_101138532 | 329 |
| 273 | 3300010375 | Ga0105239_10121877 | Ga0105239_101218773 | 329 |
| 274 | 3300011119 | Ga0105246_10128700 | Ga0105246_101287002 | 329 |
| 275 | 3300013296 | Ga0157374_10169549 | Ga0157374_101695492 | 329 |
| 276 | 3300013306 | Ga0163162_10104803 | Ga0163162_101048032 | 329 |
| 277 | 3300013308 | Ga0157375_10131427 | Ga0157375_101314272 | 329 |
| 278 | 3300014325 | Ga0163163_10055204 | Ga0163163_100552043 | 329 |
| 279 | 3300014968 | Ga0157379_10013168 | Ga0157379_100131682 | 329 |
| 280 | 3300028381 | Ga0268264_10166218 | Ga0268264_101662182 | 329 |
| 281 | 3300035695 | Ga0373927_0013969 | Ga0373927_0013969_1078_2172 | 329 |
| 282 | 3300048905 | Ga0496102_0014005 | Ga0496102_0014005_5522_6655 | 329 |
| 283 | 3300048906 | Ga0496103_0091266 | Ga0496103_0091266_479_1612 | 329 |
| 284 | 3300048907 | Ga0496104_0018351 | Ga0496104_0018351_3876_5009 | 329 |
| 285 | 3300048908 | Ga0496105_0079001 | Ga0496105_0079001_988_2121 | 329 |
| 286 | 3300048909 | Ga0496106_0007382 | Ga0496106_0007382_2073_3206 | 329 |
| 287 | 3300048910 | Ga0496107_0162898 | Ga0496107_0162898_182_1315 | 329 |
| 288 | 3300048912 | Ga0496109_0043189 | Ga0496109_0043189_2222_3355 | 329 |
| 289 | 3300048913 | Ga0496110_0072731 | Ga0496110_0072731_217_1350 | 329 |
| 290 | 3300048915 | Ga0496112_0059616 | Ga0496112_0059616_2359_3492 | 329 |
| 291 | 3300048916 | Ga0496113_0062644 | Ga0496113_0062644_431_1564 | 329 |
| 292 | 3300053079 | Ga0500610_0107331 | Ga0500610_0107331_180_1316 | 329 |
| 293 | 3300005339 | Ga0070660_100011425 | Ga0070660_1000114256 | 330 |
| 294 | 3300025919 | Ga0207657_10042217 | Ga0207657_100422173 | 330 |
| 295 | 3300031711 | Ga0265314_10015665 | Ga0265314_100156654 | 330 |
| 296 | 3300036459 | Ga0372808_000705 | Ga0372808_000705_1699_2844 | 330 |
| 297 | 3300037068 | Ga0373925_0292698 | Ga0373925_0292698_205_1299 | 330 |
| 298 | 3300047469 | Ga0495673_0014114 | Ga0495673_0014114_161_1297 | 330 |
| 299 | 3300048915 | Ga0496112_0069376 | Ga0496112_0069376_1021_2115 | 330 |
| 300 | 3300049743 | Ga0501081_0089569 | Ga0501081_0089569_10_1131 | 330 |
| 301 | 3300005336 | Ga0070680_100048253 | Ga0070680_1000482532 | 331 |
| 302 | 3300005530 | Ga0070679_100083526 | Ga0070679_1000835261 | 331 |
| 303 | 3300005719 | Ga0068861_100099229 | Ga0068861_1000992292 | 331 |
| 304 | 3300009093 | Ga0105240_10004412 | Ga0105240_100044122 | 331 |
| 305 | 3300009098 | Ga0105245_10084344 | Ga0105245_100843444 | 331 |
| 306 | 3300009174 | Ga0105241_10002293 | Ga0105241_1000229310 | 331 |
| 307 | 3300025911 | Ga0207654_10016479 | Ga0207654_100164794 | 331 |
| 308 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029481 | 331 |
| 309 | 3300025914 | Ga0207671_10002337 | Ga0207671_100023376 | 331 |
| 310 | 3300025921 | Ga0207652_10181534 | Ga0207652_101815342 | 331 |
| 311 | 3300025927 | Ga0207687_10091861 | Ga0207687_100918613 | 331 |
| 312 | 3300026118 | Ga0207675_100106034 | Ga0207675_1001060343 | 331 |
| 313 | 3300049570 | Ga0501033_0006414 | Ga0501033_0006414_5490_6626 | 331 |
| 314 | 3300049571 | Ga0501034_0002893 | Ga0501034_0002893_17151_18287 | 331 |
| 315 | 3300049572 | Ga0501036_0004196 | Ga0501036_0004196_7018_8154 | 331 |
| 316 | 3300049573 | Ga0501037_0045570 | Ga0501037_0045570_2069_3205 | 331 |
| 317 | 3300049574 | Ga0501038_0012326 | Ga0501038_0012326_1593_2729 | 331 |
| 318 | 3300049575 | Ga0501039_0030447 | Ga0501039_0030447_153_1289 | 331 |
| 319 | 3300049579 | Ga0501043_0024995 | Ga0501043_0024995_3294_4430 | 331 |
| 320 | 3300049581 | Ga0501047_0024519 | Ga0501047_0024519_1267_2403 | 331 |
| 321 | 3300049582 | Ga0501048_0007164 | Ga0501048_0007164_2595_3731 | 331 |
| 322 | 3300049585 | Ga0501069_0001866 | Ga0501069_0001866_6560_7696 | 331 |
| 323 | 3300049589 | Ga0501073_0010927 | Ga0501073_0010927_3016_4152 | 331 |
| 324 | 3300049590 | Ga0501074_0013443 | Ga0501074_0013443_4693_5829 | 331 |
| 325 | 3300049742 | Ga0501080_0026563 | Ga0501080_0026563_2687_3823 | 331 |
| 326 | 3300049744 | Ga0501083_0159484 | Ga0501083_0159484_148_1284 | 331 |
| 327 | 3300049822 | Ga0501035_0002087 | Ga0501035_0002087_16003_17139 | 331 |
| 328 | 3300049823 | Ga0501044_0036679 | Ga0501044_0036679_549_1685 | 331 |
| 329 | 3300006186 | Ga0075369_10013177 | Ga0075369_100131773 | 332 |
| 330 | 3300009174 | Ga0105241_10040310 | Ga0105241_100403102 | 333 |
| 331 | 3300013296 | Ga0157374_10007939 | Ga0157374_100079398 | 333 |
| 332 | 3300028381 | Ga0268264_10055482 | Ga0268264_100554823 | 333 |
| 333 | 3300044684 | Ga0466966_0000229 | Ga0466966_0000229_11898_13040 | 333 |
| 334 | 3300044693 | Ga0466961_0000029 | Ga0466961_0000029_35008_36150 | 333 |
| 335 | 3300045049 | Ga0466959_0000967 | Ga0466959_0000967_14896_16038 | 333 |
| 336 | 3300049570 | Ga0501033_0171302 | Ga0501033_0171302_245_1348 | 333 |
| 337 | 3300049823 | Ga0501044_0079233 | Ga0501044_0079233_1156_2259 | 333 |
| 338 | iso_pu_bacteria | 8006984368 | 8006989057 | 333 |
| 339 | 3300006844 | Ga0075428_100030217 | Ga0075428_1000302174 | 334 |
| 340 | 3300006847 | Ga0075431_100252258 | Ga0075431_1002522582 | 334 |
| 341 | 3300041408 | Ga0439453_0007254 | Ga0439453_0007254_84_1202 | 334 |
| 342 | 3300042436 | Ga0439435_0015446 | Ga0439435_0015446_669_1787 | 334 |
| 343 | 3300048929 | Ga0496126_0192436 | Ga0496126_0192436_436_1557 | 334 |
| 344 | 3300049568 | Ga0501031_0104102 | Ga0501031_0104102_41_1174 | 334 |
| 345 | 3300049572 | Ga0501036_0095058 | Ga0501036_0095058_997_2130 | 334 |
| 346 | 3300049576 | Ga0501040_0020607 | Ga0501040_0020607_132_1265 | 334 |
| 347 | 3300049578 | Ga0501042_0088730 | Ga0501042_0088730_473_1606 | 334 |
| 348 | 3300049588 | Ga0501072_0016230 | Ga0501072_0016230_3427_4560 | 334 |
| 349 | 3300049592 | Ga0501076_0064500 | Ga0501076_0064500_1525_2658 | 334 |
| 350 | 3300050510 | nmdc:mga06r32_48360_c2 | nmdc:mga06r32_48360_c2_1476_2558 | 334 |
| 351 | 3300053083 | Ga0495655_0000469 | Ga0495655_0000469_1664_2797 | 334 |
| 352 | 3300054114 | Ga0501084_0083485 | Ga0501084_0083485_835_1968 | 334 |
| 353 | 3300061734 | Ga0530510_0083480 | Ga0530510_0083480_870_2003 | 334 |
| 354 | 3300005340 | Ga0070689_100018682 | Ga0070689_1000186822 | 335 |
| 355 | 3300005367 | Ga0070667_100110990 | Ga0070667_1001109902 | 335 |
| 356 | 3300005459 | Ga0068867_100071933 | Ga0068867_1000719332 | 335 |
| 357 | 3300005842 | Ga0068858_100140259 | Ga0068858_1001402592 | 335 |
| 358 | 3300009101 | Ga0105247_10009887 | Ga0105247_100098878 | 335 |
| 359 | 3300009545 | Ga0105237_10000892 | Ga0105237_1000089239 | 335 |
| 360 | 3300013297 | Ga0157378_10027506 | Ga0157378_100275064 | 335 |
| 361 | 3300013308 | Ga0157375_10001815 | Ga0157375_100018156 | 335 |
| 362 | 3300014968 | Ga0157379_10121772 | Ga0157379_101217721 | 335 |
| 363 | 3300014969 | Ga0157376_10012349 | Ga0157376_100123495 | 335 |
| 364 | 3300025916 | Ga0207663_10051661 | Ga0207663_100516612 | 335 |
| 365 | 3300025941 | Ga0207711_10041075 | Ga0207711_100410752 | 335 |
| 366 | 3300026089 | Ga0207648_10052487 | Ga0207648_100524872 | 335 |
| 367 | 3300028379 | Ga0268266_10060595 | Ga0268266_100605951 | 335 |
| 368 | 3300048904 | Ga0496101_0110399 | Ga0496101_0110399_110_1243 | 335 |
| 369 | 3300048905 | Ga0496102_0078941 | Ga0496102_0078941_365_1498 | 335 |
| 370 | 3300048907 | Ga0496104_0010970 | Ga0496104_0010970_1404_2537 | 335 |
| 371 | 3300048908 | Ga0496105_0014746 | Ga0496105_0014746_566_1699 | 335 |
| 372 | 3300048909 | Ga0496106_0000863 | Ga0496106_0000863_5302_6435 | 335 |
| 373 | 3300048910 | Ga0496107_0000335 | Ga0496107_0000335_17363_18496 | 335 |
| 374 | 3300048917 | Ga0496114_0001714 | Ga0496114_0001714_11152_12285 | 335 |
| 375 | 3300048918 | Ga0496115_0019333 | Ga0496115_0019333_3992_5125 | 335 |
| 376 | 3300005331 | Ga0070670_100001907 | Ga0070670_10000190715 | 336 |
| 377 | 3300005336 | Ga0070680_100054060 | Ga0070680_1000540603 | 336 |
| 378 | 3300005337 | Ga0070682_100002059 | Ga0070682_1000020592 | 336 |
| 379 | 3300005338 | Ga0068868_100004146 | Ga0068868_1000041468 | 336 |
| 380 | 3300005339 | Ga0070660_100001946 | Ga0070660_10000194610 | 336 |
| 381 | 3300005340 | Ga0070689_100002684 | Ga0070689_10000268411 | 336 |
| 382 | 3300005341 | Ga0070691_10002422 | Ga0070691_100024225 | 336 |
| 383 | 3300005344 | Ga0070661_100001146 | Ga0070661_1000011463 | 336 |
| 384 | 3300005345 | Ga0070692_10000134 | Ga0070692_100001347 | 336 |
| 385 | 3300005353 | Ga0070669_100000574 | Ga0070669_10000057419 | 336 |
| 386 | 3300005355 | Ga0070671_100072280 | Ga0070671_1000722803 | 336 |
| 387 | 3300005356 | Ga0070674_100019523 | Ga0070674_1000195232 | 336 |
| 388 | 3300005364 | Ga0070673_100002610 | Ga0070673_10000261010 | 336 |
| 389 | 3300005365 | Ga0070688_100000238 | Ga0070688_10000023810 | 336 |
| 390 | 3300005366 | Ga0070659_100008590 | Ga0070659_1000085906 | 336 |
| 391 | 3300005434 | Ga0070709_10000553 | Ga0070709_1000055324 | 336 |
| 392 | 3300005436 | Ga0070713_100051675 | Ga0070713_1000516753 | 336 |
| 393 | 3300005439 | Ga0070711_100001115 | Ga0070711_10000111510 | 336 |
| 394 | 3300005441 | Ga0070700_100000601 | Ga0070700_10000060115 | 336 |
| 395 | 3300005455 | Ga0070663_100046018 | Ga0070663_1000460182 | 336 |
| 396 | 3300005456 | Ga0070678_100000163 | Ga0070678_10000016311 | 336 |
| 397 | 3300005458 | Ga0070681_10248182 | Ga0070681_102481822 | 336 |
| 398 | 3300005539 | Ga0068853_100001401 | Ga0068853_10000140111 | 336 |
| 399 | 3300005543 | Ga0070672_100017891 | Ga0070672_1000178912 | 336 |
| 400 | 3300005544 | Ga0070686_100150714 | Ga0070686_1001507141 | 336 |
| 401 | 3300005545 | Ga0070695_100005052 | Ga0070695_1000050523 | 336 |
| 402 | 3300005546 | Ga0070696_100000980 | Ga0070696_10000098011 | 336 |
| 403 | 3300005547 | Ga0070693_100000352 | Ga0070693_10000035224 | 336 |
| 404 | 3300005548 | Ga0070665_100066528 | Ga0070665_1000665283 | 336 |
| 405 | 3300005549 | Ga0070704_100005431 | Ga0070704_1000054311 | 336 |
| 406 | 3300005563 | Ga0068855_100015779 | Ga0068855_1000157792 | 336 |
| 407 | 3300005564 | Ga0070664_100017767 | Ga0070664_1000177676 | 336 |
| 408 | 3300005577 | Ga0068857_100021342 | Ga0068857_1000213423 | 336 |
| 409 | 3300005578 | Ga0068854_100001035 | Ga0068854_1000010352 | 336 |
| 410 | 3300005615 | Ga0070702_100000144 | Ga0070702_1000001448 | 336 |
| 411 | 3300005616 | Ga0068852_100159186 | Ga0068852_1001591862 | 336 |
| 412 | 3300005617 | Ga0068859_100044410 | Ga0068859_1000444104 | 336 |
| 413 | 3300005718 | Ga0068866_10001363 | Ga0068866_100013636 | 336 |
| 414 | 3300005841 | Ga0068863_100038781 | Ga0068863_1000387814 | 336 |
| 415 | 3300005842 | Ga0068858_100003338 | Ga0068858_1000033382 | 336 |
| 416 | 3300005844 | Ga0068862_100001405 | Ga0068862_10000140510 | 336 |
| 417 | 3300006048 | Ga0075363_100110511 | Ga0075363_1001105111 | 336 |
| 418 | 3300006173 | Ga0070716_100002822 | Ga0070716_1000028223 | 336 |
| 419 | 3300006175 | Ga0070712_100000650 | Ga0070712_10000065021 | 336 |
| 420 | 3300006931 | Ga0097620_100044410 | Ga0097620_1000444104 | 336 |
| 421 | 3300009093 | Ga0105240_10060004 | Ga0105240_100600046 | 336 |
| 422 | 3300009148 | Ga0105243_10002082 | Ga0105243_1000208210 | 336 |
| 423 | 3300009176 | Ga0105242_10015101 | Ga0105242_100151018 | 336 |
| 424 | 3300009545 | Ga0105237_10010596 | Ga0105237_1001059611 | 336 |
| 425 | 3300009553 | Ga0105249_10056401 | Ga0105249_100564013 | 336 |
| 426 | 3300011119 | Ga0105246_10000623 | Ga0105246_1000062311 | 336 |
| 427 | 3300013102 | Ga0157371_10069270 | Ga0157371_100692703 | 336 |
| 428 | 3300013104 | Ga0157370_10073433 | Ga0157370_100734333 | 336 |
| 429 | 3300013306 | Ga0163162_10008329 | Ga0163162_1000832910 | 336 |
| 430 | 3300013308 | Ga0157375_10034100 | Ga0157375_100341006 | 336 |
| 431 | 3300025711 | Ga0207696_1027246 | Ga0207696_10272462 | 336 |
| 432 | 3300025899 | Ga0207642_10002423 | Ga0207642_100024233 | 336 |
| 433 | 3300025900 | Ga0207710_10001768 | Ga0207710_100017683 | 336 |
| 434 | 3300025901 | Ga0207688_10004014 | Ga0207688_1000401410 | 336 |
| 435 | 3300025906 | Ga0207699_10006211 | Ga0207699_100062116 | 336 |
| 436 | 3300025909 | Ga0207705_10161688 | Ga0207705_101616882 | 336 |
| 437 | 3300025914 | Ga0207671_10017059 | Ga0207671_100170593 | 336 |
| 438 | 3300025915 | Ga0207693_10000328 | Ga0207693_1000032811 | 336 |
| 439 | 3300025916 | Ga0207663_10001926 | Ga0207663_100019269 | 336 |
| 440 | 3300025917 | Ga0207660_10143180 | Ga0207660_101431802 | 336 |
| 441 | 3300025918 | Ga0207662_10001133 | Ga0207662_100011336 | 336 |
| 442 | 3300025919 | Ga0207657_10000664 | Ga0207657_1000066429 | 336 |
| 443 | 3300025920 | Ga0207649_10016920 | Ga0207649_100169203 | 336 |
| 444 | 3300025921 | Ga0207652_10091229 | Ga0207652_100912292 | 336 |
| 445 | 3300025923 | Ga0207681_10024471 | Ga0207681_100244713 | 336 |
| 446 | 3300025925 | Ga0207650_10005610 | Ga0207650_100056108 | 336 |
| 447 | 3300025928 | Ga0207700_10066396 | Ga0207700_100663963 | 336 |
| 448 | 3300025931 | Ga0207644_10133956 | Ga0207644_101339562 | 336 |
| 449 | 3300025932 | Ga0207690_10009470 | Ga0207690_100094706 | 336 |
| 450 | 3300025933 | Ga0207706_10000247 | Ga0207706_1000024728 | 336 |
| 451 | 3300025934 | Ga0207686_10025507 | Ga0207686_100255073 | 336 |
| 452 | 3300025936 | Ga0207670_10013061 | Ga0207670_100130614 | 336 |
| 453 | 3300025937 | Ga0207669_10001810 | Ga0207669_100018105 | 336 |
| 454 | 3300025938 | Ga0207704_10094641 | Ga0207704_100946412 | 336 |
| 455 | 3300025939 | Ga0207665_10000262 | Ga0207665_1000026224 | 336 |
| 456 | 3300025940 | Ga0207691_10015768 | Ga0207691_100157682 | 336 |
| 457 | 3300025941 | Ga0207711_10007899 | Ga0207711_100078993 | 336 |
| 458 | 3300025945 | Ga0207679_10007266 | Ga0207679_100072666 | 336 |
| 459 | 3300025949 | Ga0207667_10192844 | Ga0207667_101928442 | 336 |
| 460 | 3300025961 | Ga0207712_10006105 | Ga0207712_100061056 | 336 |
| 461 | 3300025972 | Ga0207668_10067366 | Ga0207668_100673662 | 336 |
| 462 | 3300025981 | Ga0207640_10065360 | Ga0207640_100653603 | 336 |
| 463 | 3300025986 | Ga0207658_10013439 | Ga0207658_100134393 | 336 |
| 464 | 3300026041 | Ga0207639_10031931 | Ga0207639_100319313 | 336 |
| 465 | 3300026067 | Ga0207678_10000247 | Ga0207678_1000024729 | 336 |
| 466 | 3300026075 | Ga0207708_10001039 | Ga0207708_1000103916 | 336 |
| 467 | 3300026088 | Ga0207641_10097710 | Ga0207641_100977102 | 336 |
| 468 | 3300026116 | Ga0207674_10038386 | Ga0207674_100383863 | 336 |
| 469 | 3300026118 | Ga0207675_100000047 | Ga0207675_10000004766 | 336 |
| 470 | 3300026121 | Ga0207683_10000542 | Ga0207683_1000054210 | 336 |
| 471 | 3300026142 | Ga0207698_10005599 | Ga0207698_100055998 | 336 |
| 472 | 3300028379 | Ga0268266_10087880 | Ga0268266_100878803 | 336 |
| 473 | 3300028380 | Ga0268265_10016031 | Ga0268265_100160316 | 336 |
| 474 | 3300028381 | Ga0268264_10065128 | Ga0268264_100651282 | 336 |
| 475 | 3300046536 | Ga0495587_0110168 | Ga0495587_0110168_102_1229 | 336 |
| 476 | 3300047317 | Ga0495604_0157005 | Ga0495604_0157005_455_1582 | 336 |
| 477 | 3300048903 | Ga0496100_0038440 | Ga0496100_0038440_1312_2445 | 336 |
| 478 | 3300048904 | Ga0496101_0073266 | Ga0496101_0073266_137_1270 | 336 |
| 479 | 3300048906 | Ga0496103_0008856 | Ga0496103_0008856_1216_2349 | 336 |
| 480 | 3300048907 | Ga0496104_0018250 | Ga0496104_0018250_4051_5184 | 336 |
| 481 | 3300048908 | Ga0496105_0023234 | Ga0496105_0023234_464_1597 | 336 |
| 482 | 3300048912 | Ga0496109_0060277 | Ga0496109_0060277_265_1398 | 336 |
| 483 | 3300048917 | Ga0496114_0040299 | Ga0496114_0040299_2597_3730 | 336 |
| 484 | 3300050491 | nmdc:mga00v17_2560_c1 | nmdc:mga00v17_2560_c1_60_1175 | 336 |
| 485 | 3300050492 | nmdc:mga0yw44_12467_c1 | nmdc:mga0yw44_12467_c1_52_1167 | 336 |
| 486 | 3300050492 | nmdc:mga0yw44_133331_c1 | nmdc:mga0yw44_133331_c1_299_1384 | 336 |
| 487 | 3300050493 | nmdc:mga0k408_14266_c1 | nmdc:mga0k408_14266_c1_2157_3242 | 336 |
| 488 | 3300053119 | Ga0500595_023560 | Ga0500595_023560_758_1843 | 336 |
| 489 | 3300010375 | Ga0105239_10096608 | Ga0105239_100966083 | 337 |
| 490 | 3300035172 | Ga0373955_0033569 | Ga0373955_0033569_34_1167 | 337 |
| 491 | 3300053085 | Ga0495619_0090762 | Ga0495619_0090762_543_1670 | 337 |
| 492 | 3300053119 | Ga0500595_000749 | Ga0500595_000749_12036_13157 | 337 |
| 493 | 3300048925 | Ga0496122_0030293 | Ga0496122_0030293_2808_3905 | 338 |
| 494 | 3300048929 | Ga0496126_0023524 | Ga0496126_0023524_2241_3338 | 338 |
| 495 | 3300049568 | Ga0501031_0001866 | Ga0501031_0001866_3243_4361 | 338 |
| 496 | 3300049573 | Ga0501037_0000595 | Ga0501037_0000595_9971_11089 | 338 |
| 497 | 3300049574 | Ga0501038_0022542 | Ga0501038_0022542_464_1582 | 338 |
| 498 | 3300049575 | Ga0501039_0015580 | Ga0501039_0015580_2475_3593 | 338 |
| 499 | 3300049578 | Ga0501042_0002901 | Ga0501042_0002901_5572_6690 | 338 |
| 500 | 3300049579 | Ga0501043_0237019 | Ga0501043_0237019_39_1175 | 338 |
| 501 | 3300049580 | Ga0501046_0002131 | Ga0501046_0002131_6276_7394 | 338 |
| 502 | 3300049589 | Ga0501073_0071338 | Ga0501073_0071338_1199_2344 | 338 |
| 503 | 3300049742 | Ga0501080_0037947 | Ga0501080_0037947_1393_2529 | 338 |
| 504 | 3300049822 | Ga0501035_0000838 | Ga0501035_0000838_8288_9406 | 338 |
| 505 | 3300049822 | Ga0501035_0352824 | Ga0501035_0352824_11_1156 | 338 |
| 506 | 3300053177 | Ga0500636_0072414 | Ga0500636_0072414_450_1571 | 338 |
| 507 | 3300005343 | Ga0070687_100049505 | Ga0070687_1000495052 | 339 |
| 508 | 3300046454 | Ga0495592_0111117 | Ga0495592_0111117_702_1796 | 339 |
| 509 | 3300046459 | Ga0495629_0014747 | Ga0495629_0014747_3497_4591 | 339 |
| 510 | 3300046459 | Ga0495629_0046329 | Ga0495629_0046329_48_1142 | 339 |
| 511 | 3300046462 | Ga0495651_0133289 | Ga0495651_0133289_592_1686 | 339 |
| 512 | 3300046511 | Ga0495608_0212528 | Ga0495608_0212528_16_1110 | 339 |
| 513 | 3300046514 | Ga0495618_0085216 | Ga0495618_0085216_53_1147 | 339 |
| 514 | 3300046516 | Ga0495628_0026293 | Ga0495628_0026293_715_1809 | 339 |
| 515 | 3300046529 | Ga0495652_0093818 | Ga0495652_0093818_634_1728 | 339 |
| 516 | 3300046533 | Ga0495640_0150015 | Ga0495640_0150015_327_1421 | 339 |
| 517 | 3300046536 | Ga0495587_0039481 | Ga0495587_0039481_1099_2193 | 339 |
| 518 | 3300046543 | Ga0495645_0020172 | Ga0495645_0020172_3213_4307 | 339 |
| 519 | 3300046559 | Ga0495667_0050600 | Ga0495667_0050600_1038_2132 | 339 |
| 520 | 3300046663 | Ga0495635_0166175 | Ga0495635_0166175_46_1140 | 339 |
| 521 | 3300046675 | Ga0495657_0121520 | Ga0495657_0121520_100_1194 | 339 |
| 522 | 3300046678 | Ga0495599_0220562 | Ga0495599_0220562_49_1143 | 339 |
| 523 | 3300046679 | Ga0495623_0025315 | Ga0495623_0025315_1817_2911 | 339 |
| 524 | 3300047319 | Ga0495674_0030253 | Ga0495674_0030253_1250_2344 | 339 |
| 525 | 3300047471 | Ga0495684_0030860 | Ga0495684_0030860_2774_3868 | 339 |
| 526 | 3300048088 | Ga0495602_0087820 | Ga0495602_0087820_1158_2252 | 339 |
| 527 | 3300048906 | Ga0496103_0137325 | Ga0496103_0137325_405_1532 | 339 |
| 528 | 3300049569 | Ga0501032_0019190 | Ga0501032_0019190_3227_4363 | 339 |
| 529 | 3300049570 | Ga0501033_0012999 | Ga0501033_0012999_4334_5470 | 339 |
| 530 | 3300049571 | Ga0501034_0015498 | Ga0501034_0015498_2362_3498 | 339 |
| 531 | 3300049572 | Ga0501036_0031563 | Ga0501036_0031563_40_1176 | 339 |
| 532 | 3300049573 | Ga0501037_0006574 | Ga0501037_0006574_3428_4564 | 339 |
| 533 | 3300049574 | Ga0501038_0001751 | Ga0501038_0001751_17160_18296 | 339 |
| 534 | 3300049575 | Ga0501039_0004324 | Ga0501039_0004324_5000_6136 | 339 |
| 535 | 3300049579 | Ga0501043_0034734 | Ga0501043_0034734_1951_3087 | 339 |
| 536 | 3300049580 | Ga0501046_0042875 | Ga0501046_0042875_449_1585 | 339 |
| 537 | 3300049582 | Ga0501048_0006795 | Ga0501048_0006795_6326_7462 | 339 |
| 538 | 3300049583 | Ga0501067_0012216 | Ga0501067_0012216_3149_4285 | 339 |
| 539 | 3300049585 | Ga0501069_0001439 | Ga0501069_0001439_2119_3255 | 339 |
| 540 | 3300049588 | Ga0501072_0038118 | Ga0501072_0038118_180_1316 | 339 |
| 541 | 3300049589 | Ga0501073_0160688 | Ga0501073_0160688_275_1411 | 339 |
| 542 | 3300049590 | Ga0501074_0001676 | Ga0501074_0001676_8936_10072 | 339 |
| 543 | 3300049742 | Ga0501080_0245428 | Ga0501080_0245428_448_1584 | 339 |
| 544 | 3300049744 | Ga0501083_0042685 | Ga0501083_0042685_470_1606 | 339 |
| 545 | 3300049822 | Ga0501035_0025165 | Ga0501035_0025165_760_1896 | 339 |
| 546 | 3300049823 | Ga0501044_0054046 | Ga0501044_0054046_2427_3563 | 339 |
| 547 | 3300005347 | Ga0070668_100004348 | Ga0070668_1000043485 | 340 |
| 548 | 3300005354 | Ga0070675_100016690 | Ga0070675_1000166906 | 340 |
| 549 | 3300005367 | Ga0070667_100005240 | Ga0070667_10000524011 | 340 |
| 550 | 3300005435 | Ga0070714_100018688 | Ga0070714_1000186886 | 340 |
| 551 | 3300005438 | Ga0070701_10000806 | Ga0070701_1000080611 | 340 |
| 552 | 3300005530 | Ga0070679_100017687 | Ga0070679_1000176873 | 340 |
| 553 | 3300005536 | Ga0070697_100001048 | Ga0070697_10000104810 | 340 |
| 554 | 3300006175 | Ga0070712_100049647 | Ga0070712_1000496472 | 340 |
| 555 | 3300006186 | Ga0075369_10006864 | Ga0075369_100068642 | 340 |
| 556 | 3300006844 | Ga0075428_100020141 | Ga0075428_1000201415 | 340 |
| 557 | 3300006846 | Ga0075430_100098093 | Ga0075430_1000980932 | 340 |
| 558 | 3300006847 | Ga0075431_100015972 | Ga0075431_1000159723 | 340 |
| 559 | 3300006852 | Ga0075433_10009947 | Ga0075433_100099473 | 340 |
| 560 | 3300006871 | Ga0075434_100053572 | Ga0075434_1000535722 | 340 |
| 561 | 3300006871 | Ga0075434_100176524 | Ga0075434_1001765242 | 340 |
| 562 | 3300006880 | Ga0075429_100029516 | Ga0075429_1000295165 | 340 |
| 563 | 3300006881 | Ga0068865_100000403 | Ga0068865_10000040327 | 340 |
| 564 | 3300006914 | Ga0075436_100007723 | Ga0075436_1000077239 | 340 |
| 565 | 3300007076 | Ga0075435_100209742 | Ga0075435_1002097422 | 340 |
| 566 | 3300009098 | Ga0105245_10001576 | Ga0105245_1000157616 | 340 |
| 567 | 3300009147 | Ga0114129_10211876 | Ga0114129_102118762 | 340 |
| 568 | 3300009177 | Ga0105248_10002287 | Ga0105248_1000228717 | 340 |
| 569 | 3300013105 | Ga0157369_10030988 | Ga0157369_100309883 | 340 |
| 570 | 3300013297 | Ga0157378_10001216 | Ga0157378_1000121628 | 340 |
| 571 | 3300013307 | Ga0157372_10002164 | Ga0157372_1000216418 | 340 |
| 572 | 3300014745 | Ga0157377_10047803 | Ga0157377_100478033 | 340 |
| 573 | 3300014968 | Ga0157379_10003521 | Ga0157379_100035216 | 340 |
| 574 | 3300014969 | Ga0157376_10009118 | Ga0157376_100091186 | 340 |
| 575 | 3300025927 | Ga0207687_10017153 | Ga0207687_100171535 | 340 |
| 576 | 3300025929 | Ga0207664_10115378 | Ga0207664_101153783 | 340 |
| 577 | 3300031235 | Ga0265330_10017984 | Ga0265330_100179843 | 340 |
| 578 | 3300031247 | Ga0265340_10001233 | Ga0265340_100012338 | 340 |
| 579 | 3300031249 | Ga0265339_10001813 | Ga0265339_1000181312 | 340 |
| 580 | 3300031595 | Ga0265313_10000356 | Ga0265313_1000035614 | 340 |
| 581 | 3300031712 | Ga0265342_10028933 | Ga0265342_100289333 | 340 |
| 582 | 3300035695 | Ga0373927_0014897 | Ga0373927_0014897_1204_2331 | 340 |
| 583 | 3300035725 | Ga0373947_0023677 | Ga0373947_0023677_2223_3350 | 340 |
| 584 | 3300037418 | Ga0395900_0048448 | Ga0395900_0048448_2948_4081 | 340 |
| 585 | 3300037471 | Ga0395905_0004814 | Ga0395905_0004814_5002_6135 | 340 |
| 586 | 3300038443 | Ga0395901_0042929 | Ga0395901_0042929_2050_3183 | 340 |
| 587 | 3300046459 | Ga0495629_0000401 | Ga0495629_0000401_11142_12269 | 340 |
| 588 | 3300046475 | Ga0495639_0035061 | Ga0495639_0035061_816_1943 | 340 |
| 589 | 3300046499 | Ga0495594_0011198 | Ga0495594_0011198_115_1242 | 340 |
| 590 | 3300046683 | Ga0495658_0000265 | Ga0495658_0000265_18524_19651 | 340 |
| 591 | 3300046689 | Ga0495613_0176846 | Ga0495613_0176846_206_1333 | 340 |
| 592 | 3300047322 | Ga0495680_0030613 | Ga0495680_0030613_2141_3268 | 340 |
| 593 | 3300047673 | Ga0495593_0051458 | Ga0495593_0051458_225_1352 | 340 |
| 594 | 3300048907 | Ga0496104_0377465 | Ga0496104_0377465_110_1237 | 340 |
| 595 | 3300050510 | nmdc:mga06r32_91075_c1 | nmdc:mga06r32_91075_c1_838_1971 | 340 |
| 596 | 3300050512 | nmdc:mga0n895_46413_c1 | nmdc:mga0n895_46413_c1_1587_2723 | 340 |
| 597 | 3300050513 | nmdc:mga0rr50_264222_c1 | nmdc:mga0rr50_264222_c1_234_1370 | 340 |
| 598 | 3300053085 | Ga0495619_0000164 | Ga0495619_0000164_9131_10258 | 340 |
| 599 | 3300006914 | Ga0075436_100024382 | Ga0075436_1000243822 | 341 |
| 600 | 3300009092 | Ga0105250_10004961 | Ga0105250_100049613 | 341 |
| 601 | 3300013296 | Ga0157374_10095531 | Ga0157374_100955312 | 341 |
| 602 | 3300049569 | Ga0501032_0007040 | Ga0501032_0007040_2226_3347 | 341 |
| 603 | 3300049571 | Ga0501034_0000561 | Ga0501034_0000561_24304_25425 | 341 |
| 604 | 3300049575 | Ga0501039_0000498 | Ga0501039_0000498_9114_10235 | 341 |
| 605 | 3300049581 | Ga0501047_0001136 | Ga0501047_0001136_3170_4291 | 341 |
| 606 | 3300049586 | Ga0501070_0045861 | Ga0501070_0045861_1898_3019 | 341 |
| 607 | 3300049742 | Ga0501080_0000159 | Ga0501080_0000159_26775_27896 | 341 |
| 608 | 3300049822 | Ga0501035_0132711 | Ga0501035_0132711_719_1840 | 341 |
| 609 | 3300049823 | Ga0501044_0000115 | Ga0501044_0000115_542_1663 | 341 |
| 610 | 3300049824 | Ga0501045_0061250 | Ga0501045_0061250_1071_2255 | 341 |
| 611 | 3300050513 | nmdc:mga0rr50_15118_c1 | nmdc:mga0rr50_15118_c1_2779_3906 | 341 |
| 612 | iso_pu_bacteria | 2513237096 | 2513660680 | 341 |
| 613 | iso_pu_bacteria | 2513237137 | 2513858335 | 341 |
| 614 | iso_pu_bacteria | 2513237145 | 2513915710 | 341 |
| 615 | iso_pu_bacteria | 2513237145 | 2513922473 | 341 |
| 616 | iso_pu_bacteria | 2517572143 | 2517887477 | 341 |
| 617 | iso_pu_bacteria | 2517572143 | 2517896052 | 341 |
| 618 | iso_pu_bacteria | 2517572143 | 2517896056 | 341 |
| 619 | iso_pu_bacteria | 2667528175 | 2671119003 | 341 |
| 620 | iso_pu_bacteria | 2908739725 | 2908747195 | 341 |
| 621 | iso_pu_bacteria | 2922425934 | 2922432301 | 341 |
| 622 | iso_pu_bacteria | 3005474847 | 3005479003 | 341 |
| 623 | iso_pu_bacteria | 8006933436 | 8006938793 | 341 |
| 624 | iso_pu_bacteria | 8006973647 | 8006973821 | 341 |
| 625 | iso_pu_bacteria | 8006973647 | 8006975253 | 341 |
| 626 | iso_pu_bacteria | 8019555841 | 8019563909 | 341 |
| 627 | 3300006038 | Ga0075365_10004351 | Ga0075365_100043519 | 342 |
| 628 | 3300006048 | Ga0075363_100009217 | Ga0075363_1000092173 | 342 |
| 629 | 3300006178 | Ga0075367_10002352 | Ga0075367_100023522 | 342 |
| 630 | 3300027866 | Ga0209813_10005018 | Ga0209813_100050183 | 342 |
| 631 | 3300044658 | Ga0466972_0006433 | Ga0466972_0006433_960_2096 | 342 |
| 632 | 3300046475 | Ga0495639_0028094 | Ga0495639_0028094_956_2083 | 342 |
| 633 | 3300049581 | Ga0501047_0155191 | Ga0501047_0155191_1038_2141 | 342 |
| 634 | 3300050490 | nmdc:mga03n38_14769_c1 | nmdc:mga03n38_14769_c1_1091_2308 | 342 |
| 635 | 3300053084 | Ga0495595_0011588 | Ga0495595_0011588_296_1423 | 342 |
| 636 | 3300053085 | Ga0495619_0119361 | Ga0495619_0119361_355_1482 | 342 |
| 637 | 3300053094 | Ga0500566_0122852 | Ga0500566_0122852_143_1270 | 342 |
| 638 | 3300026088 | Ga0207641_10330503 | Ga0207641_103305031 | 343 |
| 639 | 3300035725 | Ga0373947_0093691 | Ga0373947_0093691_639_1766 | 343 |
| 640 | 3300037068 | Ga0373925_0017650 | Ga0373925_0017650_1326_2453 | 343 |
| 641 | 3300046455 | Ga0495603_0005985 | Ga0495603_0005985_4481_5608 | 343 |
| 642 | 3300046459 | Ga0495629_0123870 | Ga0495629_0123870_66_1193 | 343 |
| 643 | 3300046462 | Ga0495651_0139332 | Ga0495651_0139332_542_1669 | 343 |
| 644 | 3300046463 | Ga0495653_0108858 | Ga0495653_0108858_364_1491 | 343 |
| 645 | 3300046473 | Ga0495582_0025029 | Ga0495582_0025029_1395_2522 | 343 |
| 646 | 3300046499 | Ga0495594_0004129 | Ga0495594_0004129_1312_2439 | 343 |
| 647 | 3300046517 | Ga0495630_0024973 | Ga0495630_0024973_442_1569 | 343 |
| 648 | 3300046529 | Ga0495652_0047265 | Ga0495652_0047265_1926_3053 | 343 |
| 649 | 3300046557 | Ga0495622_0075968 | Ga0495622_0075968_239_1366 | 343 |
| 650 | 3300046642 | Ga0495634_0125632 | Ga0495634_0125632_32_1159 | 343 |
| 651 | 3300046663 | Ga0495635_0034228 | Ga0495635_0034228_1462_2589 | 343 |
| 652 | 3300046674 | Ga0495588_0036702 | Ga0495588_0036702_112_1239 | 343 |
| 653 | 3300046681 | Ga0495647_0018126 | Ga0495647_0018126_1317_2444 | 343 |
| 654 | 3300046689 | Ga0495613_0060699 | Ga0495613_0060699_612_1739 | 343 |
| 655 | 3300046689 | Ga0495613_0064917 | Ga0495613_0064917_1112_2239 | 343 |
| 656 | 3300046690 | Ga0495624_0053165 | Ga0495624_0053165_1324_2451 | 343 |
| 657 | 3300046809 | Ga0495600_0028328 | Ga0495600_0028328_1016_2143 | 343 |
| 658 | 3300047315 | Ga0495581_0053303 | Ga0495581_0053303_1191_2318 | 343 |
| 659 | 3300047317 | Ga0495604_0053403 | Ga0495604_0053403_1666_2793 | 343 |
| 660 | 3300047319 | Ga0495674_0014838 | Ga0495674_0014838_5199_6326 | 343 |
| 661 | 3300047322 | Ga0495680_0015838 | Ga0495680_0015838_4869_5996 | 343 |
| 662 | 3300047471 | Ga0495684_0039229 | Ga0495684_0039229_1290_2417 | 343 |
| 663 | 3300047673 | Ga0495593_0068108 | Ga0495593_0068108_31_1161 | 343 |
| 664 | 3300048927 | Ga0496124_0161086 | Ga0496124_0161086_445_1581 | 343 |
| 665 | 3300049581 | Ga0501047_0178874 | Ga0501047_0178874_324_1535 | 343 |
| 666 | 3300049823 | Ga0501044_0089548 | Ga0501044_0089548_993_2126 | 343 |
| 667 | 3300006051 | Ga0075364_10045735 | Ga0075364_100457352 | 344 |
| 668 | 3300006195 | Ga0075366_10043269 | Ga0075366_100432694 | 344 |
| 669 | 3300006353 | Ga0075370_10026001 | Ga0075370_100260013 | 344 |
| 670 | 3300025933 | Ga0207706_10042883 | Ga0207706_100428832 | 344 |
| 671 | 3300038443 | Ga0395901_0276802 | Ga0395901_0276802_308_1459 | 344 |
| 672 | 3300046462 | Ga0495651_0027824 | Ga0495651_0027824_814_1950 | 344 |
| 673 | 3300048911 | Ga0496108_0039412 | Ga0496108_0039412_1580_2713 | 344 |
| 674 | 3300048920 | Ga0496117_0045821 | Ga0496117_0045821_218_1363 | 344 |
| 675 | 3300048921 | Ga0496118_0035633 | Ga0496118_0035633_1710_2846 | 344 |
| 676 | 3300048924 | Ga0496121_0002396 | Ga0496121_0002396_24518_25663 | 344 |
| 677 | 3300049575 | Ga0501039_0156921 | Ga0501039_0156921_204_1334 | 344 |
| 678 | 3300049588 | Ga0501072_0203728 | Ga0501072_0203728_110_1213 | 344 |
| 679 | 3300049592 | Ga0501076_0092799 | Ga0501076_0092799_1195_2325 | 344 |
| 680 | 3300049741 | Ga0501079_0155810 | Ga0501079_0155810_301_1434 | 344 |
| 681 | 3300049742 | Ga0501080_0036625 | Ga0501080_0036625_1805_2908 | 344 |
| 682 | 3300049743 | Ga0501081_0063804 | Ga0501081_0063804_1195_2325 | 344 |
| 683 | 3300049822 | Ga0501035_0237567 | Ga0501035_0237567_87_1217 | 344 |
| 684 | 3300049824 | Ga0501045_0069803 | Ga0501045_0069803_1186_2316 | 344 |
| 685 | 3300050490 | nmdc:mga03n38_13225_c1 | nmdc:mga03n38_13225_c1_1431_2582 | 344 |
| 686 | 3300053153 | Ga0500616_0010404 | Ga0500616_0010404_940_2076 | 344 |
| 687 | iso_pu_bacteria | 2904699407 | 2904707874 | 344 |
| 688 | 3300031711 | Ga0265314_10055336 | Ga0265314_100553363 | 345 |
| 689 | 3300037418 | Ga0395900_0218896 | Ga0395900_0218896_92_1234 | 345 |
| 690 | 3300037466 | Ga0395898_0075631 | Ga0395898_0075631_1453_2595 | 345 |
| 691 | 3300038443 | Ga0395901_0274533 | Ga0395901_0274533_578_1720 | 345 |
| 692 | 3300049592 | Ga0501076_0006597 | Ga0501076_0006597_5666_6778 | 345 |
| 693 | 3300049741 | Ga0501079_0007700 | Ga0501079_0007700_3344_4456 | 345 |
| 694 | 3300049743 | Ga0501081_0009677 | Ga0501081_0009677_4488_5600 | 345 |
| 695 | 3300054114 | Ga0501084_0018742 | Ga0501084_0018742_3429_4541 | 345 |
| 696 | iso_pu_bacteria | 2513237098 | 2513677461 | 345 |
| 697 | iso_pu_bacteria | 2524023210 | 2524466221 | 345 |
| 698 | iso_pu_bacteria | 2885383462 | 2885388158 | 345 |
| 699 | iso_pu_bacteria | 2903768456 | 2903776650 | 345 |
| 700 | iso_pu_bacteria | 8006933436 | 8006935285 | 345 |
| 701 | 3300005436 | Ga0070713_100270223 | Ga0070713_1002702232 | 346 |
| 702 | 3300005471 | Ga0070698_100122003 | Ga0070698_1001220032 | 346 |
| 703 | 3300005536 | Ga0070697_100106706 | Ga0070697_1001067063 | 346 |
| 704 | 3300006944 | Ga0099823_1022744 | Ga0099823_10227445 | 346 |
| 705 | 3300025261 | Ga0209233_1001790 | Ga0209233_10017902 | 346 |
| 706 | 3300025928 | Ga0207700_10054769 | Ga0207700_100547692 | 346 |
| 707 | 3300027296 | Ga0209389_1000137 | Ga0209389_100013730 | 346 |
| 708 | 3300027361 | Ga0209489_114122 | Ga0209489_1141222 | 346 |
| 709 | 3300027363 | Ga0209700_100046 | Ga0209700_10004692 | 346 |
| 710 | 3300005339 | Ga0070660_100013552 | Ga0070660_1000135521 | 347 |
| 711 | 3300005455 | Ga0070663_100007733 | Ga0070663_1000077338 | 347 |
| 712 | 3300005545 | Ga0070695_100007331 | Ga0070695_1000073317 | 347 |
| 713 | 3300005546 | Ga0070696_100007479 | Ga0070696_1000074793 | 347 |
| 714 | 3300006941 | Ga0099825_1034761 | Ga0099825_10347612 | 347 |
| 715 | 3300009148 | Ga0105243_10100640 | Ga0105243_101006402 | 347 |
| 716 | 3300009174 | Ga0105241_10197872 | Ga0105241_101978722 | 347 |
| 717 | 3300009545 | Ga0105237_10012219 | Ga0105237_100122195 | 347 |
| 718 | 3300009551 | Ga0105238_10219532 | Ga0105238_102195322 | 347 |
| 719 | 3300013105 | Ga0157369_10290424 | Ga0157369_102904241 | 347 |
| 720 | 3300013296 | Ga0157374_10274394 | Ga0157374_102743942 | 347 |
| 721 | 3300013297 | Ga0157378_10091909 | Ga0157378_100919092 | 347 |
| 722 | 3300035115 | Ga0373941_0000649 | Ga0373941_0000649_3970_5088 | 347 |
| 723 | 3300046477 | Ga0495664_0097972 | Ga0495664_0097972_450_1586 | 347 |
| 724 | 3300048905 | Ga0496102_0153625 | Ga0496102_0153625_835_1956 | 347 |
| 725 | 3300048906 | Ga0496103_0001223 | Ga0496103_0001223_8010_9131 | 347 |
| 726 | 3300048907 | Ga0496104_0004958 | Ga0496104_0004958_1741_2862 | 347 |
| 727 | 3300048908 | Ga0496105_0027661 | Ga0496105_0027661_949_2070 | 347 |
| 728 | 3300048909 | Ga0496106_0014060 | Ga0496106_0014060_4451_5572 | 347 |
| 729 | 3300048913 | Ga0496110_0000794 | Ga0496110_0000794_13886_15007 | 347 |
| 730 | 3300048916 | Ga0496113_0007570 | Ga0496113_0007570_3008_4129 | 347 |
| 731 | 3300048917 | Ga0496114_0096993 | Ga0496114_0096993_729_1850 | 347 |
| 732 | 3300049569 | Ga0501032_0036536 | Ga0501032_0036536_1492_2610 | 347 |
| 733 | 3300049569 | Ga0501032_0184403 | Ga0501032_0184403_190_1308 | 347 |
| 734 | 3300049570 | Ga0501033_0225548 | Ga0501033_0225548_114_1232 | 347 |
| 735 | 3300049570 | Ga0501033_0227053 | Ga0501033_0227053_194_1312 | 347 |
| 736 | 3300049571 | Ga0501034_0017391 | Ga0501034_0017391_5854_6972 | 347 |
| 737 | 3300049571 | Ga0501034_0174087 | Ga0501034_0174087_90_1208 | 347 |
| 738 | 3300049571 | Ga0501034_0260331 | Ga0501034_0260331_264_1382 | 347 |
| 739 | 3300049572 | Ga0501036_0004539 | Ga0501036_0004539_4537_5655 | 347 |
| 740 | 3300049572 | Ga0501036_0080185 | Ga0501036_0080185_451_1569 | 347 |
| 741 | 3300049572 | Ga0501036_0115323 | Ga0501036_0115323_607_1725 | 347 |
| 742 | 3300049572 | Ga0501036_0258636 | Ga0501036_0258636_45_1163 | 347 |
| 743 | 3300049573 | Ga0501037_0015628 | Ga0501037_0015628_780_1898 | 347 |
| 744 | 3300049573 | Ga0501037_0051522 | Ga0501037_0051522_1146_2264 | 347 |
| 745 | 3300049574 | Ga0501038_0007397 | Ga0501038_0007397_1669_2787 | 347 |
| 746 | 3300049574 | Ga0501038_0033990 | Ga0501038_0033990_793_1911 | 347 |
| 747 | 3300049574 | Ga0501038_0039123 | Ga0501038_0039123_1883_3001 | 347 |
| 748 | 3300049575 | Ga0501039_0111401 | Ga0501039_0111401_210_1328 | 347 |
| 749 | 3300049576 | Ga0501040_0055248 | Ga0501040_0055248_1262_2380 | 347 |
| 750 | 3300049578 | Ga0501042_0026691 | Ga0501042_0026691_1256_2374 | 347 |
| 751 | 3300049579 | Ga0501043_0001482 | Ga0501043_0001482_16030_17148 | 347 |
| 752 | 3300049579 | Ga0501043_0093962 | Ga0501043_0093962_528_1646 | 347 |
| 753 | 3300049579 | Ga0501043_0230787 | Ga0501043_0230787_209_1327 | 347 |
| 754 | 3300049581 | Ga0501047_0002024 | Ga0501047_0002024_3884_5002 | 347 |
| 755 | 3300049581 | Ga0501047_0187256 | Ga0501047_0187256_554_1672 | 347 |
| 756 | 3300049582 | Ga0501048_0000774 | Ga0501048_0000774_3385_4503 | 347 |
| 757 | 3300049582 | Ga0501048_0001447 | Ga0501048_0001447_6009_7127 | 347 |
| 758 | 3300049583 | Ga0501067_0006079 | Ga0501067_0006079_2008_3126 | 347 |
| 759 | 3300049584 | Ga0501068_0013601 | Ga0501068_0013601_1537_2655 | 347 |
| 760 | 3300049586 | Ga0501070_0010475 | Ga0501070_0010475_3115_4233 | 347 |
| 761 | 3300049586 | Ga0501070_0084417 | Ga0501070_0084417_322_1440 | 347 |
| 762 | 3300049589 | Ga0501073_0036985 | Ga0501073_0036985_358_1476 | 347 |
| 763 | 3300049589 | Ga0501073_0040917 | Ga0501073_0040917_92_1210 | 347 |
| 764 | 3300049590 | Ga0501074_0088678 | Ga0501074_0088678_984_2102 | 347 |
| 765 | 3300049593 | Ga0501077_0200369 | Ga0501077_0200369_17_1135 | 347 |
| 766 | 3300049741 | Ga0501079_0040814 | Ga0501079_0040814_1540_2658 | 347 |
| 767 | 3300049741 | Ga0501079_0068913 | Ga0501079_0068913_64_1182 | 347 |
| 768 | 3300049744 | Ga0501083_0004950 | Ga0501083_0004950_3359_4477 | 347 |
| 769 | 3300049744 | Ga0501083_0023504 | Ga0501083_0023504_1140_2258 | 347 |
| 770 | 3300049822 | Ga0501035_0076523 | Ga0501035_0076523_450_1568 | 347 |
| 771 | 3300049823 | Ga0501044_0020560 | Ga0501044_0020560_3353_4471 | 347 |
| 772 | 3300049823 | Ga0501044_0050013 | Ga0501044_0050013_2842_3960 | 347 |
| 773 | 3300049823 | Ga0501044_0162402 | Ga0501044_0162402_130_1248 | 347 |
| 774 | 3300049823 | Ga0501044_0287733 | Ga0501044_0287733_248_1366 | 347 |
| 775 | 3300025254 | Ga0209148_1000224 | Ga0209148_10002246 | 348 |
| 776 | 3300025272 | Ga0209455_1003552 | Ga0209455_10035523 | 348 |
| 777 | 3300031731 | Ga0307405_10104864 | Ga0307405_101048641 | 348 |
| 778 | 3300031901 | Ga0307406_10017401 | Ga0307406_100174012 | 348 |
| 779 | 3300031995 | Ga0307409_100030066 | Ga0307409_1000300662 | 348 |
| 780 | 3300032126 | Ga0307415_100028697 | Ga0307415_1000286973 | 348 |
| 781 | 3300048929 | Ga0496126_0027687 | Ga0496126_0027687_3741_4862 | 348 |
| 782 | iso_pu_bacteria | 2643221547 | 2643755221 | 348 |
| 783 | iso_pu_bacteria | 2857524615 | 2857525290 | 348 |
| 784 | iso_pu_bacteria | 2919073203 | 2919075019 | 348 |
| 785 | iso_pu_bacteria | 2929615660 | 2929616679 | 348 |
| 786 | iso_pu_bacteria | 2929624759 | 2929625423 | 348 |
| 787 | iso_pu_bacteria | 2933577622 | 2933578038 | 348 |
| 788 | iso_pu_bacteria | 8055742211 | 8055748325 | 348 |
| 789 | 3300049586 | Ga0501070_0061458 | Ga0501070_0061458_1757_2920 | 349 |
| 790 | 3300049590 | Ga0501074_0029779 | Ga0501074_0029779_1465_2628 | 349 |
| 791 | 3300049744 | Ga0501083_0004507 | Ga0501083_0004507_6712_7875 | 349 |
| 792 | 3300054114 | Ga0501084_0065025 | Ga0501084_0065025_58_1221 | 349 |
| 793 | iso_pu_bacteria | 2507262055 | 2507510583 | 349 |
| 794 | iso_pu_bacteria | 2508501009 | 2508544385 | 349 |
| 795 | iso_pu_bacteria | 2508501128 | 2509148575 | 349 |
| 796 | iso_pu_bacteria | 2511231028 | 2511396312 | 349 |
| 797 | iso_pu_bacteria | 2513237095 | 2513650773 | 349 |
| 798 | iso_pu_bacteria | 2513237101 | 2513691561 | 349 |
| 799 | iso_pu_bacteria | 2513237102 | 2513705520 | 349 |
| 800 | iso_pu_bacteria | 2513237139 | 2513877739 | 349 |
| 801 | iso_pu_bacteria | 2513237161 | 2514015069 | 349 |
| 802 | iso_pu_bacteria | 2515154112 | 2515628640 | 349 |
| 803 | iso_pu_bacteria | 2517093001 | 2517105541 | 349 |
| 804 | iso_pu_bacteria | 2524023205 | 2524436984 | 349 |
| 805 | iso_pu_bacteria | 2528768022 | 2528852308 | 349 |
| 806 | iso_pu_bacteria | 2617270735 | 2617350001 | 349 |
| 807 | iso_pu_bacteria | 2643221651 | 2644289195 | 349 |
| 808 | iso_pu_bacteria | 2721755755 | 2723845454 | 349 |
| 809 | iso_pu_bacteria | 2744054633 | 2745076186 | 349 |
| 810 | iso_pu_bacteria | 2791355196 | 2793063348 | 349 |
| 811 | iso_pu_bacteria | 2802429603 | 2805917132 | 349 |
| 812 | iso_pu_bacteria | 2816332527 | 2818243577 | 349 |
| 813 | iso_pu_bacteria | 2824600985 | 2824603896 | 349 |
| 814 | iso_pu_bacteria | 2824609381 | 2824612537 | 349 |
| 815 | iso_pu_bacteria | 2824617872 | 2824621712 | 349 |
| 816 | iso_pu_bacteria | 2824626560 | 2824630819 | 349 |
| 817 | iso_pu_bacteria | 2824635225 | 2824637450 | 349 |
| 818 | iso_pu_bacteria | 2824644064 | 2824646301 | 349 |
| 819 | iso_pu_bacteria | 2824653114 | 2824655632 | 349 |
| 820 | iso_pu_bacteria | 2824661429 | 2824662418 | 349 |
| 821 | iso_pu_bacteria | 2824671348 | 2824675880 | 349 |
| 822 | iso_pu_bacteria | 2824679649 | 2824680062 | 349 |
| 823 | iso_pu_bacteria | 2824687955 | 2824692002 | 349 |
| 824 | iso_pu_bacteria | 2824696289 | 2824696604 | 349 |
| 825 | iso_pu_bacteria | 2824704595 | 2824705716 | 349 |
| 826 | iso_pu_bacteria | 2824714736 | 2824720000 | 349 |
| 827 | iso_pu_bacteria | 2824723954 | 2824726739 | 349 |
| 828 | iso_pu_bacteria | 2824732956 | 2824733693 | 349 |
| 829 | iso_pu_bacteria | 2824746037 | 2824747949 | 349 |
| 830 | iso_pu_bacteria | 2824753945 | 2824756398 | 349 |
| 831 | iso_pu_bacteria | 2824763712 | 2824764083 | 349 |
| 832 | iso_pu_bacteria | 2824773399 | 2824776759 | 349 |
| 833 | iso_pu_bacteria | 2838122688 | 2838125416 | 349 |
| 834 | iso_pu_bacteria | 2841941048 | 2841941924 | 349 |
| 835 | iso_pu_bacteria | 2841949485 | 2841951358 | 349 |
| 836 | iso_pu_bacteria | 2841957949 | 2841958960 | 349 |
| 837 | iso_pu_bacteria | 2841966195 | 2841968643 | 349 |
| 838 | iso_pu_bacteria | 2841974524 | 2841976156 | 349 |
| 839 | iso_pu_bacteria | 2841983080 | 2841987521 | 349 |
| 840 | iso_pu_bacteria | 2842038055 | 2842045107 | 349 |
| 841 | iso_pu_bacteria | 2842045827 | 2842049232 | 349 |
| 842 | iso_pu_bacteria | 2844315083 | 2844317343 | 349 |
| 843 | iso_pu_bacteria | 2847930680 | 2847934050 | 349 |
| 844 | iso_pu_bacteria | 2847939898 | 2847944707 | 349 |
| 845 | iso_pu_bacteria | 2849076700 | 2849081065 | 349 |
| 846 | iso_pu_bacteria | 2874590934 | 2874594772 | 349 |
| 847 | iso_pu_bacteria | 2874604998 | 2874607645 | 349 |
| 848 | iso_pu_bacteria | 2874612657 | 2874612921 | 349 |
| 849 | iso_pu_bacteria | 2874620515 | 2874628466 | 349 |
| 850 | iso_pu_bacteria | 2874628541 | 2874634751 | 349 |
| 851 | iso_pu_bacteria | 2874645413 | 2874646867 | 349 |
| 852 | iso_pu_bacteria | 2876761206 | 2876769414 | 349 |
| 853 | iso_pu_bacteria | 2876771140 | 2876774386 | 349 |
| 854 | iso_pu_bacteria | 2876818435 | 2876822824 | 349 |
| 855 | iso_pu_bacteria | 2879074833 | 2879078540 | 349 |
| 856 | iso_pu_bacteria | 2879083081 | 2879086861 | 349 |
| 857 | iso_pu_bacteria | 2879099564 | 2879109778 | 349 |
| 858 | iso_pu_bacteria | 2879127579 | 2879129870 | 349 |
| 859 | iso_pu_bacteria | 2879142872 | 2879146195 | 349 |
| 860 | iso_pu_bacteria | 2881364244 | 2881369176 | 349 |
| 861 | iso_pu_bacteria | 2885366525 | 2885367438 | 349 |
| 862 | iso_pu_bacteria | 2885409591 | 2885414885 | 349 |
| 863 | iso_pu_bacteria | 2888378607 | 2888382030 | 349 |
| 864 | iso_pu_bacteria | 2888388044 | 2888388620 | 349 |
| 865 | iso_pu_bacteria | 2888419890 | 2888422647 | 349 |
| 866 | iso_pu_bacteria | 2889033259 | 2889038905 | 349 |
| 867 | iso_pu_bacteria | 2903727486 | 2903733271 | 349 |
| 868 | iso_pu_bacteria | 2904666416 | 2904667254 | 349 |
| 869 | iso_pu_bacteria | 2904711408 | 2904720334 | 349 |
| 870 | iso_pu_bacteria | 2906602504 | 2906606237 | 349 |
| 871 | iso_pu_bacteria | 2906626472 | 2906634074 | 349 |
| 872 | iso_pu_bacteria | 2906643746 | 2906647556 | 349 |
| 873 | iso_pu_bacteria | 2908775508 | 2908778287 | 349 |
| 874 | iso_pu_bacteria | 2922368715 | 2922371979 | 349 |
| 875 | iso_pu_bacteria | 2922393267 | 2922399277 | 349 |
| 876 | iso_pu_bacteria | 2932784394 | 2932793127 | 349 |
| 877 | iso_pu_bacteria | 2932809354 | 2932814567 | 349 |
| 878 | iso_pu_bacteria | 2932818245 | 2932824632 | 349 |
| 879 | iso_pu_bacteria | 2932828146 | 2932836586 | 349 |
| 880 | iso_pu_bacteria | 2935608549 | 2935610684 | 349 |
| 881 | iso_pu_bacteria | 2935616580 | 2935623320 | 349 |
| 882 | iso_pu_bacteria | 2935638405 | 2935646682 | 349 |
| 883 | iso_pu_bacteria | 2935648319 | 2935652454 | 349 |
| 884 | iso_pu_bacteria | 2935656913 | 2935661036 | 349 |
| 885 | iso_pu_bacteria | 2935665750 | 2935672648 | 349 |
| 886 | iso_pu_bacteria | 2935675223 | 2935682521 | 349 |
| 887 | iso_pu_bacteria | 2935684952 | 2935691725 | 349 |
| 888 | iso_pu_bacteria | 2935694250 | 2935699594 | 349 |
| 889 | iso_pu_bacteria | 2935694250 | 2935702744 | 349 |
| 890 | iso_pu_bacteria | 2935703347 | 2935707831 | 349 |
| 891 | iso_pu_bacteria | 2935713505 | 2935719559 | 349 |
| 892 | iso_pu_bacteria | 2935722832 | 2935728839 | 349 |
| 893 | iso_pu_bacteria | 2935732158 | 2935737919 | 349 |
| 894 | iso_pu_bacteria | 2935741537 | 2935747294 | 349 |
| 895 | iso_pu_bacteria | 2935750917 | 2935757905 | 349 |
| 896 | iso_pu_bacteria | 2935760218 | 2935761698 | 349 |
| 897 | iso_pu_bacteria | 2935769743 | 2935776221 | 349 |
| 898 | iso_pu_bacteria | 2935777560 | 2935784916 | 349 |
| 899 | iso_pu_bacteria | 2935801545 | 2935810104 | 349 |
| 900 | iso_pu_bacteria | 2935810662 | 2935819010 | 349 |
| 901 | iso_pu_bacteria | 2935819856 | 2935820181 | 349 |
| 902 | iso_pu_bacteria | 2935827899 | 2935835949 | 349 |
| 903 | iso_pu_bacteria | 2935837841 | 2935844927 | 349 |
| 904 | iso_pu_bacteria | 2935847175 | 2935849808 | 349 |
| 905 | iso_pu_bacteria | 2935855204 | 2935861680 | 349 |
| 906 | iso_pu_bacteria | 2935864058 | 2935870719 | 349 |
| 907 | iso_pu_bacteria | 2935873716 | 2935881408 | 349 |
| 908 | iso_pu_bacteria | 2935908558 | 2935914502 | 349 |
| 909 | iso_pu_bacteria | 2935916978 | 2935919052 | 349 |
| 910 | iso_pu_bacteria | 2935926038 | 2935932117 | 349 |
| 911 | iso_pu_bacteria | 2935934488 | 2935940715 | 349 |
| 912 | iso_pu_bacteria | 2935942939 | 2935948698 | 349 |
| 913 | iso_pu_bacteria | 2935951376 | 2935957195 | 349 |
| 914 | iso_pu_bacteria | 2935967501 | 2935973833 | 349 |
| 915 | iso_pu_bacteria | 2935975950 | 2935979700 | 349 |
| 916 | iso_pu_bacteria | 2935984226 | 2935988928 | 349 |
| 917 | iso_pu_bacteria | 2935992306 | 2936000410 | 349 |
| 918 | iso_pu_bacteria | 2936002035 | 2936005427 | 349 |
| 919 | iso_pu_bacteria | 2936011229 | 2936015093 | 349 |
| 920 | iso_pu_bacteria | 2936019824 | 2936023238 | 349 |
| 921 | iso_pu_bacteria | 2936028420 | 2936032309 | 349 |
| 922 | iso_pu_bacteria | 2936037263 | 2936041966 | 349 |
| 923 | iso_pu_bacteria | 2936046547 | 2936050170 | 349 |
| 924 | iso_pu_bacteria | 2936055302 | 2936061122 | 349 |
| 925 | iso_pu_bacteria | 2940556831 | 2940564183 | 349 |
| 926 | iso_pu_bacteria | 2941531003 | 2941537150 | 349 |
| 927 | iso_pu_bacteria | 2941538514 | 2941546734 | 349 |
| 928 | iso_pu_bacteria | 3005483717 | 3005486341 | 349 |
| 929 | iso_pu_bacteria | 3005506211 | 3005512167 | 349 |
| 930 | iso_pu_bacteria | 3005594810 | 3005597041 | 349 |
| 931 | iso_pu_bacteria | 3005718088 | 3005720472 | 349 |
| 932 | iso_pu_bacteria | 8006933436 | 8006943685 | 349 |
| 933 | iso_pu_bacteria | 8006973647 | 8006983936 | 349 |
| 934 | iso_pu_bacteria | 8016511872 | 8016515696 | 349 |
| 935 | iso_pu_bacteria | 8016583857 | 8016590090 | 349 |
| 936 | iso_pu_bacteria | 8016622563 | 8016630743 | 349 |
| 937 | iso_pu_bacteria | 8017057580 | 8017060802 | 349 |
| 938 | iso_pu_bacteria | 8019538911 | 8019542226 | 349 |
| 939 | iso_pu_bacteria | 8019547302 | 8019547393 | 349 |
| 940 | iso_pu_bacteria | 8019576017 | 8019580326 | 349 |
| 941 | iso_pu_bacteria | 8019586578 | 8019588046 | 349 |
| 942 | iso_pu_bacteria | 8019608314 | 8019615238 | 349 |
| 943 | iso_pu_bacteria | 8019619141 | 8019626040 | 349 |
| 944 | iso_pu_bacteria | 8019629233 | 8019636444 | 349 |
| 945 | iso_pu_bacteria | 8019638758 | 8019643189 | 349 |
| 946 | iso_pu_bacteria | 8019648815 | 8019656025 | 349 |
| 947 | iso_pu_bacteria | 8019659431 | 8019664222 | 349 |
| 948 | iso_pu_bacteria | 8019668869 | 8019673810 | 349 |
| 949 | iso_pu_bacteria | 8019678201 | 8019682299 | 349 |
| 950 | iso_pu_bacteria | 8019687851 | 8019688003 | 349 |
| 951 | iso_pu_bacteria | 8056967851 | 8056971946 | 349 |
| 952 | 3300005937 | Ga0081455_10116256 | Ga0081455_101162563 | 350 |
| 953 | 3300009094 | Ga0111539_10004280 | Ga0111539_100042805 | 350 |
| 954 | 3300009148 | Ga0105243_10031664 | Ga0105243_100316643 | 350 |
| 955 | 3300009545 | Ga0105237_10042290 | Ga0105237_100422904 | 350 |
| 956 | 3300013100 | Ga0157373_10092832 | Ga0157373_100928322 | 350 |
| 957 | 3300013306 | Ga0163162_10055157 | Ga0163162_100551573 | 350 |
| 958 | 3300025901 | Ga0207688_10007134 | Ga0207688_100071346 | 350 |
| 959 | 3300025904 | Ga0207647_10001768 | Ga0207647_100017686 | 350 |
| 960 | 3300025914 | Ga0207671_10280619 | Ga0207671_102806191 | 350 |
| 961 | 3300025935 | Ga0207709_10022604 | Ga0207709_100226042 | 350 |
| 962 | 3300025936 | Ga0207670_10015701 | Ga0207670_100157014 | 350 |
| 963 | 3300025938 | Ga0207704_10038375 | Ga0207704_100383752 | 350 |
| 964 | 3300025942 | Ga0207689_10078975 | Ga0207689_100789752 | 350 |
| 965 | 3300025972 | Ga0207668_10019130 | Ga0207668_100191305 | 350 |
| 966 | 3300026041 | Ga0207639_10048933 | Ga0207639_100489333 | 350 |
| 967 | 3300026075 | Ga0207708_10002105 | Ga0207708_100021055 | 350 |
| 968 | 3300026089 | Ga0207648_10247999 | Ga0207648_102479992 | 350 |
| 969 | 3300026118 | Ga0207675_100006675 | Ga0207675_1000066755 | 350 |
| 970 | 3300026142 | Ga0207698_10166236 | Ga0207698_101662362 | 350 |
| 971 | 3300027695 | Ga0209966_1000879 | Ga0209966_10008798 | 350 |
| 972 | 3300027695 | Ga0209966_1003243 | Ga0209966_10032432 | 350 |
| 973 | 3300027717 | Ga0209998_10007039 | Ga0209998_100070392 | 350 |
| 974 | 3300027907 | Ga0207428_10004311 | Ga0207428_100043114 | 350 |
| 975 | 3300033180 | Ga0307510_10089703 | Ga0307510_100897032 | 350 |
| 976 | 3300034816 | Ga0373930_0001132 | Ga0373930_0001132_1835_2962 | 350 |
| 977 | 3300034819 | Ga0373958_0000104 | Ga0373958_0000104_3985_5112 | 350 |
| 978 | 3300034820 | Ga0373959_0002185 | Ga0373959_0002185_1546_2673 | 350 |
| 979 | 3300035084 | Ga0373928_0001256 | Ga0373928_0001256_1374_2501 | 350 |
| 980 | 3300035085 | Ga0373929_0000075 | Ga0373929_0000075_2996_4123 | 350 |
| 981 | 3300035090 | Ga0373949_0013321 | Ga0373949_0013321_317_1444 | 350 |
| 982 | 3300035091 | Ga0373951_0010253 | Ga0373951_0010253_875_2002 | 350 |
| 983 | 3300035112 | Ga0373932_0000399 | Ga0373932_0000399_12092_13219 | 350 |
| 984 | 3300035113 | Ga0373936_0040420 | Ga0373936_0040420_486_1613 | 350 |
| 985 | 3300035115 | Ga0373941_0000103 | Ga0373941_0000103_12209_13336 | 350 |
| 986 | 3300035116 | Ga0373945_0027424 | Ga0373945_0027424_656_1783 | 350 |
| 987 | 3300035207 | Ga0373942_0005219 | Ga0373942_0005219_140_1267 | 350 |
| 988 | 3300035691 | Ga0373931_0028547 | Ga0373931_0028547_851_1978 | 350 |
| 989 | 3300035725 | Ga0373947_0122576 | Ga0373947_0122576_489_1634 | 350 |
| 990 | 3300042008 | Ga0439450_019829 | Ga0439450_019829_73_1200 | 350 |
| 991 | 3300042876 | Ga0451577_0019873 | Ga0451577_0019873_2633_3760 | 350 |
| 992 | 3300044712 | Ga0453684_0055062 | Ga0453684_0055062_3780_4907 | 350 |
| 993 | 3300045051 | Ga0451576_0019035 | Ga0451576_0019035_2948_4075 | 350 |
| 994 | 3300047673 | Ga0495593_0026795 | Ga0495593_0026795_101_1237 | 350 |
| 995 | 3300048910 | Ga0496107_0017009 | Ga0496107_0017009_1218_2345 | 350 |
| 996 | 3300048913 | Ga0496110_0060791 | Ga0496110_0060791_814_1941 | 350 |
| 997 | 3300048913 | Ga0496110_0225549 | Ga0496110_0225549_249_1376 | 350 |
| 998 | 3300060353 | Ga0501082_0008587 | Ga0501082_0008587_5430_6557 | 350 |
| 999 | 3300007076 | Ga0075435_100015085 | Ga0075435_1000150855 | 351 |
| 1000 | 3300031691 | Ga0316579_10011336 | Ga0316579_100113363 | 351 |
| 1001 | 3300048907 | Ga0496104_0237680 | Ga0496104_0237680_258_1385 | 351 |
| 1002 | 3300048929 | Ga0496126_0032003 | Ga0496126_0032003_612_1748 | 351 |
| 1003 | 3300053104 | Ga0500556_0000110 | Ga0500556_0000110_40321_41451 | 351 |
| 1004 | 3300053139 | Ga0500568_0008272 | Ga0500568_0008272_676_1812 | 351 |
| 1005 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_249825_250955 | 351 |
| 1006 | 3300053153 | Ga0500616_0005928 | Ga0500616_0005928_4509_5678 | 351 |
| 1007 | iso_pu_bacteria | 2513237104 | 2513715881 | 351 |
| 1008 | 3300003215 | JGI25153J46596_10004577 | JGI25153J46596_100045776 | 352 |
| 1009 | 3300005347 | Ga0070668_100006572 | Ga0070668_1000065724 | 352 |
| 1010 | 3300005539 | Ga0068853_100008598 | Ga0068853_1000085984 | 352 |
| 1011 | 3300005547 | Ga0070693_100002177 | Ga0070693_1000021777 | 352 |
| 1012 | 3300005842 | Ga0068858_100134898 | Ga0068858_1001348982 | 352 |
| 1013 | 3300005843 | Ga0068860_100034267 | Ga0068860_1000342673 | 352 |
| 1014 | 3300005843 | Ga0068860_100045641 | Ga0068860_1000456414 | 352 |
| 1015 | 3300005844 | Ga0068862_100009937 | Ga0068862_1000099373 | 352 |
| 1016 | 3300006042 | Ga0075368_10000403 | Ga0075368_1000040314 | 352 |
| 1017 | 3300006048 | Ga0075363_100000700 | Ga0075363_1000007009 | 352 |
| 1018 | 3300006178 | Ga0075367_10000859 | Ga0075367_1000085911 | 352 |
| 1019 | 3300006353 | Ga0075370_10067999 | Ga0075370_100679991 | 352 |
| 1020 | 3300025273 | Ga0209673_1014407 | Ga0209673_10144072 | 352 |
| 1021 | 3300025295 | Ga0209564_1008956 | Ga0209564_10089564 | 352 |
| 1022 | 3300025297 | Ga0209758_1001103 | Ga0209758_100110316 | 352 |
| 1023 | 3300025904 | Ga0207647_10071218 | Ga0207647_100712182 | 352 |
| 1024 | 3300025912 | Ga0207707_10076955 | Ga0207707_100769552 | 352 |
| 1025 | 3300025917 | Ga0207660_10023384 | Ga0207660_100233844 | 352 |
| 1026 | 3300025919 | Ga0207657_10019384 | Ga0207657_100193844 | 352 |
| 1027 | 3300025924 | Ga0207694_10105080 | Ga0207694_101050802 | 352 |
| 1028 | 3300025935 | Ga0207709_10099170 | Ga0207709_100991703 | 352 |
| 1029 | 3300025937 | Ga0207669_10153555 | Ga0207669_101535551 | 352 |
| 1030 | 3300025972 | Ga0207668_10055299 | Ga0207668_100552993 | 352 |
| 1031 | 3300026041 | Ga0207639_10091893 | Ga0207639_100918933 | 352 |
| 1032 | 3300026067 | Ga0207678_10002469 | Ga0207678_1000246913 | 352 |
| 1033 | 3300026118 | Ga0207675_100016268 | Ga0207675_1000162688 | 352 |
| 1034 | 3300027866 | Ga0209813_10000354 | Ga0209813_1000035411 | 352 |
| 1035 | 3300028380 | Ga0268265_10020474 | Ga0268265_100204743 | 352 |
| 1036 | 3300031691 | Ga0316579_10044153 | Ga0316579_100441532 | 352 |
| 1037 | 3300031727 | Ga0316576_10120963 | Ga0316576_101209631 | 352 |
| 1038 | 3300031728 | Ga0316578_10033393 | Ga0316578_100333933 | 352 |
| 1039 | 3300032133 | Ga0316583_10006386 | Ga0316583_100063861 | 352 |
| 1040 | 3300032137 | Ga0316585_10001817 | Ga0316585_100018174 | 352 |
| 1041 | 3300032139 | Ga0316580_10002912 | Ga0316580_100029124 | 352 |
| 1042 | 3300036401 | Ga0373937_0022999 | Ga0373937_0022999_2075_3208 | 352 |
| 1043 | 3300036647 | Ga0316582_0083025 | Ga0316582_0083025_183_1331 | 352 |
| 1044 | 3300036712 | Ga0316584_0032544 | Ga0316584_0032544_2111_3259 | 352 |
| 1045 | 3300039447 | Ga0436361_0800382 | Ga0436361_0800382_974_2107 | 352 |
| 1046 | 3300046459 | Ga0495629_0020141 | Ga0495629_0020141_2493_3635 | 352 |
| 1047 | 3300046462 | Ga0495651_0012637 | Ga0495651_0012637_2909_4051 | 352 |
| 1048 | 3300046511 | Ga0495608_0118945 | Ga0495608_0118945_324_1466 | 352 |
| 1049 | 3300046529 | Ga0495652_0097001 | Ga0495652_0097001_256_1398 | 352 |
| 1050 | 3300046533 | Ga0495640_0053312 | Ga0495640_0053312_198_1340 | 352 |
| 1051 | 3300046663 | Ga0495635_0014018 | Ga0495635_0014018_159_1301 | 352 |
| 1052 | 3300046690 | Ga0495624_0115701 | Ga0495624_0115701_244_1386 | 352 |
| 1053 | 3300047315 | Ga0495581_0080628 | Ga0495581_0080628_227_1369 | 352 |
| 1054 | 3300047317 | Ga0495604_0050351 | Ga0495604_0050351_1301_2443 | 352 |
| 1055 | 3300048088 | Ga0495602_0078694 | Ga0495602_0078694_209_1351 | 352 |
| 1056 | 3300048907 | Ga0496104_0022383 | Ga0496104_0022383_2960_4102 | 352 |
| 1057 | 3300048908 | Ga0496105_0018352 | Ga0496105_0018352_1902_3044 | 352 |
| 1058 | 3300048917 | Ga0496114_0186514 | Ga0496114_0186514_546_1688 | 352 |
| 1059 | 3300048922 | Ga0496119_0105777 | Ga0496119_0105777_32_1174 | 352 |
| 1060 | 3300049569 | Ga0501032_0100665 | Ga0501032_0100665_246_1379 | 352 |
| 1061 | 3300049572 | Ga0501036_0036678 | Ga0501036_0036678_1404_2537 | 352 |
| 1062 | 3300049574 | Ga0501038_0087664 | Ga0501038_0087664_1333_2466 | 352 |
| 1063 | 3300049575 | Ga0501039_0059313 | Ga0501039_0059313_858_1991 | 352 |
| 1064 | 3300049577 | Ga0501041_0025769 | Ga0501041_0025769_338_1471 | 352 |
| 1065 | 3300049587 | Ga0501071_0071361 | Ga0501071_0071361_541_1674 | 352 |
| 1066 | 3300049589 | Ga0501073_0049989 | Ga0501073_0049989_536_1672 | 352 |
| 1067 | 3300049592 | Ga0501076_0038923 | Ga0501076_0038923_426_1559 | 352 |
| 1068 | 3300049741 | Ga0501079_0024164 | Ga0501079_0024164_922_2055 | 352 |
| 1069 | 3300049743 | Ga0501081_0035597 | Ga0501081_0035597_748_1881 | 352 |
| 1070 | 3300049824 | Ga0501045_0121727 | Ga0501045_0121727_315_1448 | 352 |
| 1071 | 3300050490 | nmdc:mga03n38_1593_c1 | nmdc:mga03n38_1593_c1_4682_5818 | 352 |
| 1072 | 3300050492 | nmdc:mga0yw44_86897_c1 | nmdc:mga0yw44_86897_c1_167_1303 | 352 |
| 1073 | 3300050494 | nmdc:mga06z11_1068_c1 | nmdc:mga06z11_1068_c1_2404_3540 | 352 |
| 1074 | 3300050495 | nmdc:mga04h51_866_c1 | nmdc:mga04h51_866_c1_509_1645 | 352 |
| 1075 | 3300053177 | Ga0500636_0080342 | Ga0500636_0080342_212_1354 | 352 |
| 1076 | 3300054114 | Ga0501084_0034868 | Ga0501084_0034868_2767_3900 | 352 |
| 1077 | 3300060353 | Ga0501082_0190076 | Ga0501082_0190076_496_1632 | 352 |
| 1078 | 3300061734 | Ga0530510_0167184 | Ga0530510_0167184_139_1272 | 352 |
| 1079 | iso_pu_bacteria | 2513237141 | 2513888416 | 352 |
| 1080 | 3300003215 | JGI25153J46596_10000110 | JGI25153J46596_1000011022 | 353 |
| 1081 | 3300003215 | JGI25153J46596_10000263 | JGI25153J46596_1000026316 | 353 |
| 1082 | 3300003354 | JGI25160J50197_1000523 | JGI25160J50197_100052319 | 353 |
| 1083 | 3300003354 | JGI25160J50197_1005211 | JGI25160J50197_10052115 | 353 |
| 1084 | 3300004625 | Ga0055543_1002843 | Ga0055543_10028434 | 353 |
| 1085 | 3300005262 | Ga0065165_1004569 | Ga0065165_10045694 | 353 |
| 1086 | 3300005262 | Ga0065165_1004928 | Ga0065165_10049282 | 353 |
| 1087 | 3300005262 | Ga0065165_1009267 | Ga0065165_10092674 | 353 |
| 1088 | 3300005434 | Ga0070709_10008113 | Ga0070709_100081132 | 353 |
| 1089 | 3300005435 | Ga0070714_100032673 | Ga0070714_1000326732 | 353 |
| 1090 | 3300005437 | Ga0070710_10003271 | Ga0070710_100032717 | 353 |
| 1091 | 3300005439 | Ga0070711_100020122 | Ga0070711_1000201223 | 353 |
| 1092 | 3300005458 | Ga0070681_10048886 | Ga0070681_100488862 | 353 |
| 1093 | 3300005530 | Ga0070679_100232338 | Ga0070679_1002323381 | 353 |
| 1094 | 3300005843 | Ga0068860_100000302 | Ga0068860_10000030223 | 353 |
| 1095 | 3300005983 | Ga0081540_1015193 | Ga0081540_10151935 | 353 |
| 1096 | 3300006042 | Ga0075368_10026345 | Ga0075368_100263453 | 353 |
| 1097 | 3300006051 | Ga0075364_10007739 | Ga0075364_100077396 | 353 |
| 1098 | 3300006051 | Ga0075364_10007956 | Ga0075364_100079563 | 353 |
| 1099 | 3300006163 | Ga0070715_10002699 | Ga0070715_100026992 | 353 |
| 1100 | 3300006175 | Ga0070712_100004063 | Ga0070712_1000040638 | 353 |
| 1101 | 3300006177 | Ga0075362_10007931 | Ga0075362_100079313 | 353 |
| 1102 | 3300006195 | Ga0075366_10118954 | Ga0075366_101189542 | 353 |
| 1103 | 3300006353 | Ga0075370_10083928 | Ga0075370_100839283 | 353 |
| 1104 | 3300006358 | Ga0068871_100116263 | Ga0068871_1001162632 | 353 |
| 1105 | 3300009093 | Ga0105240_10038789 | Ga0105240_100387892 | 353 |
| 1106 | 3300009174 | Ga0105241_10021664 | Ga0105241_100216643 | 353 |
| 1107 | 3300009545 | Ga0105237_10002097 | Ga0105237_1000209716 | 353 |
| 1108 | 3300009545 | Ga0105237_10007140 | Ga0105237_1000714010 | 353 |
| 1109 | 3300009545 | Ga0105237_10290804 | Ga0105237_102908041 | 353 |
| 1110 | 3300010375 | Ga0105239_10013543 | Ga0105239_100135433 | 353 |
| 1111 | 3300013104 | Ga0157370_10121827 | Ga0157370_101218271 | 353 |
| 1112 | 3300025230 | Ga0209563_107462 | Ga0209563_1074622 | 353 |
| 1113 | 3300025295 | Ga0209564_1003463 | Ga0209564_10034639 | 353 |
| 1114 | 3300025297 | Ga0209758_1000075 | Ga0209758_1000075102 | 353 |
| 1115 | 3300025297 | Ga0209758_1000087 | Ga0209758_1000087174 | 353 |
| 1116 | 3300025297 | Ga0209758_1003246 | Ga0209758_100324610 | 353 |
| 1117 | 3300025297 | Ga0209758_1011329 | Ga0209758_10113294 | 353 |
| 1118 | 3300025299 | Ga0209256_1003035 | Ga0209256_10030352 | 353 |
| 1119 | 3300025302 | Ga0207426_1000160 | Ga0207426_100016026 | 353 |
| 1120 | 3300025302 | Ga0207426_1001010 | Ga0207426_100101014 | 353 |
| 1121 | 3300025302 | Ga0207426_1007290 | Ga0207426_10072904 | 353 |
| 1122 | 3300025304 | Ga0209257_1000795 | Ga0209257_10007956 | 353 |
| 1123 | 3300025304 | Ga0209257_1007831 | Ga0209257_10078314 | 353 |
| 1124 | 3300025904 | Ga0207647_10011677 | Ga0207647_100116774 | 353 |
| 1125 | 3300025904 | Ga0207647_10091650 | Ga0207647_100916502 | 353 |
| 1126 | 3300025906 | Ga0207699_10030688 | Ga0207699_100306882 | 353 |
| 1127 | 3300025911 | Ga0207654_10029119 | Ga0207654_100291193 | 353 |
| 1128 | 3300025911 | Ga0207654_10046809 | Ga0207654_100468093 | 353 |
| 1129 | 3300025912 | Ga0207707_10043505 | Ga0207707_100435052 | 353 |
| 1130 | 3300025914 | Ga0207671_10023189 | Ga0207671_100231894 | 353 |
| 1131 | 3300025914 | Ga0207671_10093015 | Ga0207671_100930152 | 353 |
| 1132 | 3300025915 | Ga0207693_10000326 | Ga0207693_1000032617 | 353 |
| 1133 | 3300025916 | Ga0207663_10034720 | Ga0207663_100347202 | 353 |
| 1134 | 3300025921 | Ga0207652_10053329 | Ga0207652_100533293 | 353 |
| 1135 | 3300025928 | Ga0207700_10097609 | Ga0207700_100976092 | 353 |
| 1136 | 3300025928 | Ga0207700_10286350 | Ga0207700_102863501 | 353 |
| 1137 | 3300025939 | Ga0207665_10001364 | Ga0207665_100013642 | 353 |
| 1138 | 3300026067 | Ga0207678_10079215 | Ga0207678_100792153 | 353 |
| 1139 | 3300027866 | Ga0209813_10060166 | Ga0209813_100601661 | 353 |
| 1140 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020125 | 353 |
| 1141 | 3300028573 | Ga0265334_10037179 | Ga0265334_100371792 | 353 |
| 1142 | 3300030521 | Ga0307511_10048094 | Ga0307511_100480943 | 353 |
| 1143 | 3300031235 | Ga0265330_10002148 | Ga0265330_100021489 | 353 |
| 1144 | 3300031249 | Ga0265339_10008846 | Ga0265339_100088465 | 353 |
| 1145 | 3300031730 | Ga0307516_10070540 | Ga0307516_100705403 | 353 |
| 1146 | 3300037466 | Ga0395898_0030060 | Ga0395898_0030060_106_1242 | 353 |
| 1147 | 3300037853 | Ga0436364_0400091 | Ga0436364_0400091_231_1367 | 353 |
| 1148 | 3300038443 | Ga0395901_0223244 | Ga0395901_0223244_669_1805 | 353 |
| 1149 | 3300046533 | Ga0495640_0019241 | Ga0495640_0019241_460_1596 | 353 |
| 1150 | 3300046559 | Ga0495667_0013164 | Ga0495667_0013164_2884_4020 | 353 |
| 1151 | 3300046616 | Ga0495668_0005423 | Ga0495668_0005423_2329_3465 | 353 |
| 1152 | 3300046678 | Ga0495599_0003308 | Ga0495599_0003308_30_1166 | 353 |
| 1153 | 3300046689 | Ga0495613_0034201 | Ga0495613_0034201_2580_3716 | 353 |
| 1154 | 3300046690 | Ga0495624_0138067 | Ga0495624_0138067_335_1471 | 353 |
| 1155 | 3300047317 | Ga0495604_0021963 | Ga0495604_0021963_643_1779 | 353 |
| 1156 | 3300047443 | Ga0495687_007206 | Ga0495687_007206_573_1709 | 353 |
| 1157 | 3300047444 | Ga0495675_0042693 | Ga0495675_0042693_870_2006 | 353 |
| 1158 | 3300048904 | Ga0496101_0110593 | Ga0496101_0110593_891_2027 | 353 |
| 1159 | 3300048909 | Ga0496106_0107712 | Ga0496106_0107712_973_2109 | 353 |
| 1160 | 3300048920 | Ga0496117_0008333 | Ga0496117_0008333_6054_7190 | 353 |
| 1161 | 3300048920 | Ga0496117_0050906 | Ga0496117_0050906_965_2101 | 353 |
| 1162 | 3300048921 | Ga0496118_0055750 | Ga0496118_0055750_877_2013 | 353 |
| 1163 | 3300048924 | Ga0496121_0090293 | Ga0496121_0090293_205_1341 | 353 |
| 1164 | 3300048928 | Ga0496125_0006206 | Ga0496125_0006206_11341_12477 | 353 |
| 1165 | 3300048928 | Ga0496125_0018774 | Ga0496125_0018774_19_1155 | 353 |
| 1166 | 3300048929 | Ga0496126_0196413 | Ga0496126_0196413_218_1354 | 353 |
| 1167 | 3300049569 | Ga0501032_0006976 | Ga0501032_0006976_6726_7862 | 353 |
| 1168 | 3300049570 | Ga0501033_0024710 | Ga0501033_0024710_2106_3242 | 353 |
| 1169 | 3300049571 | Ga0501034_0000499 | Ga0501034_0000499_48413_49549 | 353 |
| 1170 | 3300049571 | Ga0501034_0105050 | Ga0501034_0105050_416_1552 | 353 |
| 1171 | 3300049572 | Ga0501036_0020356 | Ga0501036_0020356_3313_4449 | 353 |
| 1172 | 3300049573 | Ga0501037_0006217 | Ga0501037_0006217_741_1877 | 353 |
| 1173 | 3300049574 | Ga0501038_0011040 | Ga0501038_0011040_6596_7732 | 353 |
| 1174 | 3300049574 | Ga0501038_0134451 | Ga0501038_0134451_164_1309 | 353 |
| 1175 | 3300049581 | Ga0501047_0031991 | Ga0501047_0031991_439_1575 | 353 |
| 1176 | 3300049586 | Ga0501070_0028755 | Ga0501070_0028755_2258_3394 | 353 |
| 1177 | 3300049589 | Ga0501073_0050132 | Ga0501073_0050132_1400_2587 | 353 |
| 1178 | 3300049743 | Ga0501081_0159094 | Ga0501081_0159094_391_1578 | 353 |
| 1179 | 3300049822 | Ga0501035_0014314 | Ga0501035_0014314_79_1215 | 353 |
| 1180 | 3300049822 | Ga0501035_0075849 | Ga0501035_0075849_240_1385 | 353 |
| 1181 | 3300049823 | Ga0501044_0061755 | Ga0501044_0061755_36_1172 | 353 |
| 1182 | 3300050490 | nmdc:mga03n38_29357_c1 | nmdc:mga03n38_29357_c1_257_1393 | 353 |
| 1183 | 3300050492 | nmdc:mga0yw44_41490_c1 | nmdc:mga0yw44_41490_c1_1201_2337 | 353 |
| 1184 | 3300050493 | nmdc:mga0k408_36016_c1 | nmdc:mga0k408_36016_c1_827_1963 | 353 |
| 1185 | 3300050494 | nmdc:mga06z11_12914_c1 | nmdc:mga06z11_12914_c1_2167_3303 | 353 |
| 1186 | 3300050494 | nmdc:mga06z11_25213_c1 | nmdc:mga06z11_25213_c1_1303_2439 | 353 |
| 1187 | 3300050495 | nmdc:mga04h51_2923_c1 | nmdc:mga04h51_2923_c1_1045_2181 | 353 |
| 1188 | 3300050496 | nmdc:mga07m45_34836_c1 | nmdc:mga07m45_34836_c1_1496_2632 | 353 |
| 1189 | 3300050496 | nmdc:mga07m45_8765_c1 | nmdc:mga07m45_8765_c1_2634_3782 | 353 |
| 1190 | 3300050516 | nmdc:mga0sz30_12419_c1 | nmdc:mga0sz30_12419_c1_1344_2480 | 353 |
| 1191 | 3300050516 | nmdc:mga0sz30_74437_c1 | nmdc:mga0sz30_74437_c1_95_1231 | 353 |
| 1192 | 3300053091 | Ga0500647_0004322 | Ga0500647_0004322_728_1864 | 353 |
| 1193 | 3300053094 | Ga0500566_0000400 | Ga0500566_0000400_16370_17506 | 353 |
| 1194 | 3300053095 | Ga0500640_022647 | Ga0500640_022647_239_1375 | 353 |
| 1195 | 3300053111 | Ga0500572_000121 | Ga0500572_000121_16359_17495 | 353 |
| 1196 | 3300053119 | Ga0500595_027390 | Ga0500595_027390_57_1202 | 353 |
| 1197 | 3300053122 | Ga0500608_003152 | Ga0500608_003152_3437_4573 | 353 |
| 1198 | 3300053123 | Ga0500614_003296 | Ga0500614_003296_1542_2678 | 353 |
| 1199 | 3300053136 | Ga0500559_0001424 | Ga0500559_0001424_6964_8100 | 353 |
| 1200 | 3300053136 | Ga0500559_0016013 | Ga0500559_0016013_53_1189 | 353 |
| 1201 | 3300053148 | Ga0500590_089270 | Ga0500590_089270_316_1452 | 353 |
| 1202 | 3300053159 | Ga0500630_001045 | Ga0500630_001045_4710_5846 | 353 |
| 1203 | 3300053162 | Ga0500638_031156 | Ga0500638_031156_181_1317 | 353 |
| 1204 | 3300053163 | Ga0500639_000219 | Ga0500639_000219_10910_12046 | 353 |
| 1205 | 3300053735 | Ga0500596_000227 | Ga0500596_000227_4655_5791 | 353 |
| 1206 | 3300053735 | Ga0500596_009050 | Ga0500596_009050_353_1489 | 353 |
| 1207 | iso_pu_bacteria | 2617270741 | 2617378680 | 353 |
| 1208 | iso_pu_bacteria | 3005587118 | 3005593638 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fef-assembly1.cif.gz_J | structure of mce1 transporter from mycobacterium smegmatis (map0) | 0.8318 | 105 | 344 |
| 7ch9-assembly1.cif.gz_H | cryo-em structure of p.aeruginosa mlafebd | 0.8205 | 90 | 347 |
| 6z5u-assembly1.cif.gz_B | cryo-em structure of the a. baumannii mlabdef complex bound to appnhp | 0.8205 | 93 | 345 |
| 7ch8-assembly1.cif.gz_H | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.8165 | 90 | 347 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.8148 | 91 | 344 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1N8G8_45_205_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3741 | 149 | 337 | 1.10.1760.20 |
| af_P76352_330_491_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3703 | 151 | 337 | 1.20.1250.20 |
| af_O44196_80_262_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.3682 | 138 | 343 | 1.10.357.20 |
| af_I1N8G8_45_205_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.368 | 149 | 337 | 1.10.1760.20 |
| af_Q4DPE2_262_423_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3597 | 150 | 345 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A517WXU6-F1-model_v4 | ABC transport permease subunit MlaE | 0.8834 | 93 | 351 |
GO:0005548
GO:0043190 |
| AF-A0A1V5MI47-F1-model_v4 | Putative phospholipid ABC transporter permease protein MlaE | 0.8808 | 93 | 349 |
GO:0005548
GO:0043190 |
| AF-A0A2E6NRK7-F1-model_v4 | ABC transporter permease | 0.8805 | 105 | 351 |
GO:0005548
GO:0043190 |
| AF-A0A519BNM1-F1-model_v4 | ABC transporter permease | 0.8803 | 89 | 345 |
GO:0005548
GO:0043190 |
| AF-A0A1J5PGI3-F1-model_v4 | Putative phospholipid ABC transporter permease protein MlaE | 0.879 | 107 | 353 |
GO:0005548
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar