F491679

General Info

Members Datasets Scaffolds Average Seq Length
1208 633 1012 361

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000302|Ga0068860_10000030223
Length 425
Sequence MLCEPAVCYLTCVNCLNLRLVWLRQVNRSGAARLRNDYSPIWKRNKVLASEPLLTATPAGDLLELRPAGSWTAANVVTLETLTAAIVPELDRAGNVRLDMTGVSXXXXLGAWLLEKLSRRAATAGHRAETIGAAANYAGLIEELHQVNRRNPRAAPARNPLLVKLDVVGRAAAGTAEDVTIFMQMLGSLFLALVGVLRRPRSLRVTSLVYQLYKVGWQAIPIMVLITFLIGAIIAQQGFFHFRKFGADSYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEIDALSTMGLDPVEVLILPRIIALVFALPILSFIGSMAALYGGALVAQFYGDMGPAIYLARLHEAVSVTSFEVGIIKAPFMALAIGIVACSEGLRVKGSAESLGRQTTTSVVKSIFLVIVLDGLFAIFFASIGM

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
19 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
20 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
26 2643221651 Afipia sp. Root123D2 Isolate Unclassified
27 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
28 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
29 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
30 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
34 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
35 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
38 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
39 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
40 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
41 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
42 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
43 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
44 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
45 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
46 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
49 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
50 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
51 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
52 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
55 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
56 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
57 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
58 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
59 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
60 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
61 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
62 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
63 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
64 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
65 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
66 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
67 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
68 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
69 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
70 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
71 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
72 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
73 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
74 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
75 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
76 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
77 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
78 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
79 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
80 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
81 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
82 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
83 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
84 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
85 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
86 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
87 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
88 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
89 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
90 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
91 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
92 2904699407
93 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
94 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
95 2906610324
96 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
97 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
98 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
99 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
100 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
101 2922368715
102 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
103 2922425934
104 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
105 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
106 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
107 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
108 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
109 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
110 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
111 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
112 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
113 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
114 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
115 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
116 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
117 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
118 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
119 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
120 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
121 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
122 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
123 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
124 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
125 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
126 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
127 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
128 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
129 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
130 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
131 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
132 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
133 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
134 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
135 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
136 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
137 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
138 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
139 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
140 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
141 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
142 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
143 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
144 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
145 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
146 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
147 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
148 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
149 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
150 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
151 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
152 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
153 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
154 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
155 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
156 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
157 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
158 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
159 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
160 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
161 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
162 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
163 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
164 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
165 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
166 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
169 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
170 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
171 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
172 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
173 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
174 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
175 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
176 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
177 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
178 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
179 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
180 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
181 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
182 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
183 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
184 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
185 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
186 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
187 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
188 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
189 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
190 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
191 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
192 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
193 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
194 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
195 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
196 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
197 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
198 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
199 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
200 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
201 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
202 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
203 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
204 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
205 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
206 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
207 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
208 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
209 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
210 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
211 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
212 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
213 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
214 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
215 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
216 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
217 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
218 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
219 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
220 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
221 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
222 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
223 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
224 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
225 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
226 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
227 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
228 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
229 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
230 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
231 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
232 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
233 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
234 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
235 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
236 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
237 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
238 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
239 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
240 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
243 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
244 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
245 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
246 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
247 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
248 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
249 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
250 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
251 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
252 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
253 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
255 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
256 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
257 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
258 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
259 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
260 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
261 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
262 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
263 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
264 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
265 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
266 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
267 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
268 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
269 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
270 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
271 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
272 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
273 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
274 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
275 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
276 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
277 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
278 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
279 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
280 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
281 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
282 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
283 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
284 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
285 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
286 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
287 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
288 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
292 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
295 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
296 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
297 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
298 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
356 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
357 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
358 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
362 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
363 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
367 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
368 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
369 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
370 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
371 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
372 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
373 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
374 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
377 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
378 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
379 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
380 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
381 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
382 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
383 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
384 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
385 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
386 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
387 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
388 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
389 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
390 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
391 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
392 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
393 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
394 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
395 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
396 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
397 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
398 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
399 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
400 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
401 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
402 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
403 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
404 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
405 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
406 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
407 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
408 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
409 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
410 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
411 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
412 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
413 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
414 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
415 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
416 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
417 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
418 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
419 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
420 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
421 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
422 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
423 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
424 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
425 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
426 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
427 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
428 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
429 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
430 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
431 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
432 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
433 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
434 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
435 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
436 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
437 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
438 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
439 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
440 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
441 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
442 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
443 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
444 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
445 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
446 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
447 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
448 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
449 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
450 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
451 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
452 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
453 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
454 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
455 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
456 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
457 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
458 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
459 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
460 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
461 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
462 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
463 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
464 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
465 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
466 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
467 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
468 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
469 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
470 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
471 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
472 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
473 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
474 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
475 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
476 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
477 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
478 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
479 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
480 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
481 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
482 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
483 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
484 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
485 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
486 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
487 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
488 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
489 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
490 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
491 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
492 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
493 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
494 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
495 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
496 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
497 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
498 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
499 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
500 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
501 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
502 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
503 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
504 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
505 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
506 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
507 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
508 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
509 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
510 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
511 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
512 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
513 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
514 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
515 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
516 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
517 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
518 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
519 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
520 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
521 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
522 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
523 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
524 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
525 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
526 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
529 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
530 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
531 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
533 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
534 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
537 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
539 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
541 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
542 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
543 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
544 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
545 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
546 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
547 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
548 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
549 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
550 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
551 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
552 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
553 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
554 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
555 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
556 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
559 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
560 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
561 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
562 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
563 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
564 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
565 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
566 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
567 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
568 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
569 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
570 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
571 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
572 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
573 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
574 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
575 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
576 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
577 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
578 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
579 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
580 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
581 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
582 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
583 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
584 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
585 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
586 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
587 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
588 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
589 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
590 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
591 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
592 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
593 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
594 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
595 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
596 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
597 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
598 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
599 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
600 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
601 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
602 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
603 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
604 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
605 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
606 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
607 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
608 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
609 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
610 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
611 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
612 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
613 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
614 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
615 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
616 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
617 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
618 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
619 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
620 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
621 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
622 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
623 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
624 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
625 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
626 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
627 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
628 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
629 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
630 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
631 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
632 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
633 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.97
Metatranscriptomes 0.08
Isolates 15.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 11.67
Rhizoplane 5.22
Rhizosphere 63.91
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000110 3300003215 Bacteria 93591
2 JGI25153J46596_10000263 3300003215 Bacteria 41900
3 JGI25153J46596_10000645 3300003215 Bacteria 21275
4 JGI25153J46596_10004577 3300003215 Bacteria 7418
5 JGI25160J50197_1000523 3300003354 Bacteria 22402
6 JGI25160J50197_1005211 3300003354 Bacteria 5452
7 Ga0055539_1006587 3300003752 Bacteria 1484
8 Ga0055543_1002843 3300004625 Bacteria 5459
9 Ga0065165_1004569 3300005262 Bacteria 8453
10 Ga0065165_1004928 3300005262 Bacteria 7870
11 Ga0065165_1009267 3300005262 Bacteria 4443
12 Ga0070670_100001907 3300005331 Bacteria 17064
13 Ga0068869_100004028 3300005334 Bacteria 9092
14 Ga0070680_100048253 3300005336 Bacteria 3469
15 Ga0070680_100054060 3300005336 Bacteria 3278
16 Ga0070682_100002059 3300005337 Bacteria 11215
17 Ga0068868_100004146 3300005338 Bacteria 10130
18 Ga0068868_100080657 3300005338 Bacteria 2608
19 Ga0070660_100001946 3300005339 Bacteria 14247
20 Ga0070660_100011425 3300005339 Bacteria 6308
21 Ga0070660_100013552 3300005339 Bacteria 5852
22 Ga0070660_100152300 3300005339 Bacteria 1860
23 Ga0070689_100002684 3300005340 Bacteria 11665
24 Ga0070689_100018682 3300005340 Bacteria 5112
25 Ga0070691_10002422 3300005341 Bacteria 8277
26 Ga0070687_100049505 3300005343 Bacteria 2166
27 Ga0070661_100001146 3300005344 Bacteria 18648
28 Ga0070692_10000134 3300005345 Bacteria 17740
29 Ga0070668_100004348 3300005347 Bacteria 10507
30 Ga0070668_100006572 3300005347 Bacteria 8611
31 Ga0070668_100008886 3300005347 Bacteria 7461
32 Ga0070669_100000574 3300005353 Bacteria 27273
33 Ga0070675_100016690 3300005354 Bacteria 5827
34 Ga0070671_100032813 3300005355 Bacteria 4292
35 Ga0070671_100072280 3300005355 Bacteria 2880
36 Ga0070674_100019523 3300005356 Bacteria 4306
37 Ga0070674_100147148 3300005356 Bacteria 1774
38 Ga0070673_100002610 3300005364 Bacteria 11013
39 Ga0070688_100000238 3300005365 Bacteria 29006
40 Ga0070659_100008590 3300005366 Bacteria 7468
41 Ga0070667_100005240 3300005367 Bacteria 10839
42 Ga0070667_100110990 3300005367 Bacteria 2378
43 Ga0070667_100133228 3300005367 Bacteria 2170
44 Ga0070709_10000553 3300005434 Bacteria 21892
45 Ga0070709_10008113 3300005434 Bacteria 5763
46 Ga0070709_10056012 3300005434 Bacteria 2491
47 Ga0070714_100018688 3300005435 Bacteria 5637
48 Ga0070714_100032673 3300005435 Bacteria 4345
49 Ga0070714_100125085 3300005435 Bacteria 2291
50 Ga0070713_100006321 3300005436 Bacteria 8206
51 Ga0070713_100051675 3300005436 Bacteria 3400
52 Ga0070713_100270223 3300005436 Bacteria 1557
53 Ga0070710_10003271 3300005437 Bacteria 7681
54 Ga0070701_10000806 3300005438 Bacteria 11187
55 Ga0070711_100001115 3300005439 Bacteria 14359
56 Ga0070711_100020122 3300005439 Bacteria 4295
57 Ga0070711_100027000 3300005439 Bacteria 3766
58 Ga0070705_100157858 3300005440 Bacteria 1513
59 Ga0070700_100000601 3300005441 Bacteria 17957
60 Ga0070663_100005162 3300005455 Bacteria 7732
61 Ga0070663_100007733 3300005455 Bacteria 6564
62 Ga0070663_100046018 3300005455 Bacteria 3085
63 Ga0070678_100000163 3300005456 Bacteria 28192
64 Ga0070678_100073070 3300005456 Bacteria 2573
65 Ga0070662_100024658 3300005457 Bacteria 4146
66 Ga0070681_10040314 3300005458 Bacteria 4679
67 Ga0070681_10048886 3300005458 Bacteria 4225
68 Ga0070681_10248182 3300005458 Bacteria 1693
69 Ga0068867_100071933 3300005459 Bacteria 2588
70 Ga0070698_100122003 3300005471 Bacteria 2565
71 Ga0070679_100017687 3300005530 Bacteria 6901
72 Ga0070679_100083526 3300005530 Bacteria 3182
73 Ga0070679_100232338 3300005530 Bacteria 1803
74 Ga0070697_100001048 3300005536 Bacteria 20883
75 Ga0070697_100106706 3300005536 Bacteria 2330
76 Ga0068853_100001401 3300005539 Bacteria 17397
77 Ga0068853_100008598 3300005539 Bacteria 8208
78 Ga0070672_100017891 3300005543 Bacteria 5110
79 Ga0070686_100150714 3300005544 Bacteria 1628
80 Ga0070695_100005052 3300005545 Bacteria 7777
81 Ga0070695_100007331 3300005545 Bacteria 6539
82 Ga0070696_100000980 3300005546 Bacteria 18512
83 Ga0070696_100007479 3300005546 Bacteria 7307
84 Ga0070693_100000352 3300005547 Bacteria 20882
85 Ga0070693_100002177 3300005547 Bacteria 8981
86 Ga0070665_100066528 3300005548 Bacteria 3615
87 Ga0070665_100074481 3300005548 Bacteria 3401
88 Ga0070704_100005431 3300005549 Bacteria 7424
89 Ga0068855_100015779 3300005563 Bacteria 9088
90 Ga0068855_100031649 3300005563 Bacteria 6317
91 Ga0070664_100017767 3300005564 Bacteria 5843
92 Ga0068857_100021342 3300005577 Bacteria 5700
93 Ga0068854_100001035 3300005578 Bacteria 16677
94 Ga0068856_100043502 3300005614 Bacteria 4419
95 Ga0070702_100000144 3300005615 Bacteria 22195
96 Ga0068852_100159186 3300005616 Bacteria 2107
97 Ga0068852_100325192 3300005616 Bacteria 1494
98 Ga0068859_100044410 3300005617 Bacteria 4465
99 Ga0068859_100110965 3300005617 Bacteria 2805
100 Ga0068864_100011530 3300005618 Bacteria 7303
101 Ga0068864_100102363 3300005618 Bacteria 2541
102 Ga0068866_10001363 3300005718 Bacteria 10576
103 Ga0068861_100099229 3300005719 Bacteria 2313
104 Ga0068863_100038781 3300005841 Bacteria 4532
105 Ga0068863_100194093 3300005841 Bacteria 1952
106 Ga0068858_100003338 3300005842 Bacteria 15989
107 Ga0068858_100050100 3300005842 Bacteria 3865
108 Ga0068858_100119126 3300005842 Bacteria 2468
109 Ga0068858_100134898 3300005842 Bacteria 2316
110 Ga0068858_100140259 3300005842 Bacteria 2269
111 Ga0068860_100000302 3300005843 Bacteria 68581
112 Ga0068860_100034267 3300005843 Bacteria 4869
113 Ga0068860_100045641 3300005843 Bacteria 4179
114 Ga0068860_100179979 3300005843 Bacteria 2043
115 Ga0068862_100001405 3300005844 Bacteria 22295
116 Ga0068862_100009937 3300005844 Bacteria 7860
117 Ga0081455_10000877 3300005937 Bacteria 38899
118 Ga0081455_10040525 3300005937 Bacteria 4105
119 Ga0081455_10116256 3300005937 Bacteria 2116
120 Ga0081540_1015193 3300005983 Bacteria 4885
121 Ga0075365_10004351 3300006038 Bacteria 7486
122 Ga0075365_10015666 3300006038 Bacteria 4592
123 Ga0075368_10000403 3300006042 Bacteria 12665
124 Ga0075368_10003164 3300006042 Bacteria 5470
125 Ga0075368_10026345 3300006042 Bacteria 2236
126 Ga0075363_100000700 3300006048 Bacteria 11342
127 Ga0075363_100009217 3300006048 Bacteria 4636
128 Ga0075363_100110511 3300006048 Bacteria 1527
129 Ga0075364_10007739 3300006051 Bacteria 6398
130 Ga0075364_10007956 3300006051 Bacteria 6316
131 Ga0075364_10019969 3300006051 Bacteria 4211
132 Ga0075364_10045735 3300006051 Bacteria 2848
133 Ga0070715_10002699 3300006163 Bacteria 5501
134 Ga0070716_100002822 3300006173 Bacteria 8087
135 Ga0070712_100000650 3300006175 Bacteria 20430
136 Ga0070712_100004063 3300006175 Bacteria 8985
137 Ga0070712_100049647 3300006175 Bacteria 2915
138 Ga0075362_10007931 3300006177 Bacteria 4042
139 Ga0075367_10000859 3300006178 Bacteria 12127
140 Ga0075367_10002352 3300006178 Bacteria 8600
141 Ga0075367_10019333 3300006178 Bacteria 3776
142 Ga0075369_10006864 3300006186 Bacteria 4322
143 Ga0075369_10013177 3300006186 Bacteria 3275
144 Ga0075366_10003963 3300006195 Bacteria 7904
145 Ga0075366_10043269 3300006195 Bacteria 2667
146 Ga0075366_10118954 3300006195 Bacteria 1591
147 Ga0075370_10026001 3300006353 Bacteria 3240
148 Ga0075370_10067999 3300006353 Bacteria 2034
149 Ga0075370_10082159 3300006353 Bacteria 1852
150 Ga0075370_10083928 3300006353 Bacteria 1833
151 Ga0068871_100116263 3300006358 Bacteria 2255
152 Ga0075428_100020141 3300006844 Bacteria 7388
153 Ga0075428_100030217 3300006844 Bacteria 5992
154 Ga0075430_100098093 3300006846 Bacteria 2448
155 Ga0075431_100015972 3300006847 Bacteria 7617
156 Ga0075431_100252258 3300006847 Bacteria 1792
157 Ga0075433_10009947 3300006852 Bacteria 7621
158 Ga0075433_10363190 3300006852 Bacteria 1279
159 Ga0075434_100003258 3300006871 Bacteria 14508
160 Ga0075434_100053572 3300006871 Bacteria 4008
161 Ga0075434_100061214 3300006871 Bacteria 3745
162 Ga0075434_100176524 3300006871 Bacteria 2156
163 Ga0075429_100029516 3300006880 Bacteria 4762
164 Ga0068865_100000403 3300006881 Bacteria 24052
165 Ga0068865_100024210 3300006881 Bacteria 3981
166 Ga0075436_100007723 3300006914 Bacteria 7350
167 Ga0075436_100024382 3300006914 Bacteria 4158
168 Ga0097620_100044410 3300006931 Bacteria 4465
169 Ga0097620_100110965 3300006931 Bacteria 2805
170 Ga0099825_1034761 3300006941 Bacteria 1850
171 Ga0099823_1022744 3300006944 Bacteria 5787
172 Ga0075435_100015085 3300007076 Bacteria 5801
173 Ga0075435_100209742 3300007076 Bacteria 1652
174 Ga0099794_10010689 3300007265 Bacteria 3904
175 Ga0099795_10079882 3300007788 Bacteria 1249
176 Ga0105250_10004961 3300009092 Bacteria 6036
177 Ga0105240_10004412 3300009093 Bacteria 21461
178 Ga0105240_10024435 3300009093 Bacteria 7961
179 Ga0105240_10038789 3300009093 Bacteria 6107
180 Ga0105240_10060004 3300009093 Bacteria 4743
181 Ga0111539_10004280 3300009094 Bacteria 18684
182 Ga0105245_10001576 3300009098 Bacteria 20702
183 Ga0105245_10059144 3300009098 Bacteria 3450
184 Ga0105245_10084344 3300009098 Bacteria 2910
185 Ga0105245_10248838 3300009098 Bacteria 1726
186 Ga0105247_10005404 3300009101 Bacteria 8050
187 Ga0105247_10006815 3300009101 Bacteria 7042
188 Ga0105247_10009887 3300009101 Bacteria 5779
189 Ga0114129_10211876 3300009147 Bacteria 2619
190 Ga0105243_10002082 3300009148 Bacteria 16941
191 Ga0105243_10031664 3300009148 Bacteria 4078
192 Ga0105243_10100640 3300009148 Bacteria 2398
193 Ga0105241_10002293 3300009174 Bacteria 14379
194 Ga0105241_10021664 3300009174 Bacteria 4754
195 Ga0105241_10040310 3300009174 Bacteria 3525
196 Ga0105241_10197872 3300009174 Bacteria 1677
197 Ga0105241_10268409 3300009174 Bacteria 1453
198 Ga0105242_10015101 3300009176 Bacteria 5993
199 Ga0105248_10002287 3300009177 Bacteria 21211
200 Ga0105248_10011606 3300009177 Bacteria 9705
201 Ga0105248_10244685 3300009177 Bacteria 2019
202 Ga0105237_10000892 3300009545 Bacteria 40254
203 Ga0105237_10002097 3300009545 Bacteria 25173
204 Ga0105237_10007140 3300009545 Bacteria 12275
205 Ga0105237_10010596 3300009545 Bacteria 9792
206 Ga0105237_10012219 3300009545 Bacteria 9054
207 Ga0105237_10042290 3300009545 Bacteria 4595
208 Ga0105237_10063501 3300009545 Bacteria 3690
209 Ga0105237_10115079 3300009545 Bacteria 2683
210 Ga0105237_10290804 3300009545 Bacteria 1637
211 Ga0105238_10012485 3300009551 Bacteria 8569
212 Ga0105238_10031155 3300009551 Bacteria 5429
213 Ga0105238_10035315 3300009551 Bacteria 5083
214 Ga0105238_10219532 3300009551 Bacteria 1877
215 Ga0105249_10056401 3300009553 Bacteria 3596
216 Ga0105249_10113853 3300009553 Bacteria 2560
217 Ga0105239_10013543 3300010375 Bacteria 9054
218 Ga0105239_10096608 3300010375 Bacteria 3264
219 Ga0105239_10121877 3300010375 Bacteria 2897
220 Ga0105246_10000623 3300011119 Bacteria 19751
221 Ga0105246_10001035 3300011119 Bacteria 16002
222 Ga0105246_10128700 3300011119 Bacteria 1888
223 Ga0157373_10092832 3300013100 Bacteria 2126
224 Ga0157371_10069270 3300013102 Bacteria 2498
225 Ga0157370_10011827 3300013104 Bacteria 9107
226 Ga0157370_10052376 3300013104 Bacteria 3897
227 Ga0157370_10073433 3300013104 Bacteria 3227
228 Ga0157370_10121827 3300013104 Bacteria 2435
229 Ga0157369_10030988 3300013105 Bacteria 5894
230 Ga0157369_10290424 3300013105 Bacteria 1702
231 Ga0157374_10007939 3300013296 Bacteria 9063
232 Ga0157374_10095531 3300013296 Bacteria 2842
233 Ga0157374_10169549 3300013296 Bacteria 2129
234 Ga0157374_10274394 3300013296 Bacteria 1663
235 Ga0157378_10001216 3300013297 Bacteria 23323
236 Ga0157378_10001958 3300013297 Bacteria 18458
237 Ga0157378_10027506 3300013297 Bacteria 5018
238 Ga0157378_10091909 3300013297 Bacteria 2760
239 Ga0163162_10006254 3300013306 Bacteria 11543
240 Ga0163162_10008329 3300013306 Bacteria 10113
241 Ga0163162_10055157 3300013306 Bacteria 4000
242 Ga0163162_10104803 3300013306 Bacteria 2922
243 Ga0157372_10002164 3300013307 Bacteria 21380
244 Ga0157375_10001815 3300013308 Bacteria 18305
245 Ga0157375_10027175 3300013308 Bacteria 5345
246 Ga0157375_10034100 3300013308 Bacteria 4845
247 Ga0157375_10131427 3300013308 Bacteria 2623
248 Ga0163163_10055204 3300014325 Bacteria 3926
249 Ga0163163_10124317 3300014325 Bacteria 2616
250 Ga0157377_10047803 3300014745 Bacteria 2398
251 Ga0157379_10003521 3300014968 Bacteria 13257
252 Ga0157379_10013168 3300014968 Bacteria 7241
253 Ga0157379_10121772 3300014968 Bacteria 2347
254 Ga0157376_10009118 3300014969 Bacteria 7193
255 Ga0157376_10012349 3300014969 Bacteria 6336
256 Ga0163161_10018218 3300017792 Bacteria 4923
257 Ga0209563_107462 3300025230 Bacteria 1794
258 Ga0209677_101165 3300025253 Bacteria 12146
259 Ga0209148_1000224 3300025254 Bacteria 92967
260 Ga0209233_1001790 3300025261 Bacteria 8280
261 Ga0209455_1003552 3300025272 Bacteria 5457
262 Ga0209673_1014407 3300025273 Bacteria 3059
263 Ga0209564_1003463 3300025295 Bacteria 10758
264 Ga0209564_1008956 3300025295 Bacteria 4848
265 Ga0209758_1000075 3300025297 Bacteria 271585
266 Ga0209758_1000087 3300025297 Bacteria 254384
267 Ga0209758_1001103 3300025297 Bacteria 34890
268 Ga0209758_1002205 3300025297 Bacteria 20325
269 Ga0209758_1003246 3300025297 Bacteria 15078
270 Ga0209758_1011329 3300025297 Bacteria 5182
271 Ga0209256_1003035 3300025299 Bacteria 12390
272 Ga0207426_1000160 3300025302 Bacteria 174540
273 Ga0207426_1001010 3300025302 Bacteria 27314
274 Ga0207426_1007290 3300025302 Bacteria 4649
275 Ga0209257_1000795 3300025304 Bacteria 46064
276 Ga0209257_1007831 3300025304 Bacteria 6318
277 Ga0207696_1027246 3300025711 Bacteria 1762
278 Ga0207642_10002423 3300025899 Bacteria 5814
279 Ga0207710_10001768 3300025900 Bacteria 10433
280 Ga0207710_10019392 3300025900 Bacteria 2902
281 Ga0207688_10004014 3300025901 Bacteria 8014
282 Ga0207688_10007134 3300025901 Bacteria 6076
283 Ga0207688_10035621 3300025901 Bacteria 2758
284 Ga0207647_10001768 3300025904 Bacteria 16586
285 Ga0207647_10011677 3300025904 Bacteria 6147
286 Ga0207647_10071218 3300025904 Bacteria 2098
287 Ga0207647_10091650 3300025904 Bacteria 1812
288 Ga0207699_10006211 3300025906 Bacteria 5765
289 Ga0207699_10030688 3300025906 Bacteria 3010
290 Ga0207699_10124118 3300025906 Bacteria 1674
291 Ga0207643_10138238 3300025908 Bacteria 1454
292 Ga0207705_10161688 3300025909 Bacteria 1682
293 Ga0207654_10016479 3300025911 Bacteria 3849
294 Ga0207654_10029119 3300025911 Bacteria 3018
295 Ga0207654_10046809 3300025911 Bacteria 2468
296 Ga0207707_10043505 3300025912 Bacteria 3918
297 Ga0207707_10076955 3300025912 Bacteria 2912
298 Ga0207695_10000029 3300025913 Bacteria 548364
299 Ga0207671_10002337 3300025914 Bacteria 20455
300 Ga0207671_10017059 3300025914 Bacteria 5614
301 Ga0207671_10023189 3300025914 Bacteria 4682
302 Ga0207671_10093015 3300025914 Bacteria 2274
303 Ga0207671_10280619 3300025914 Bacteria 1314
304 Ga0207693_10000326 3300025915 Bacteria 44051
305 Ga0207693_10000328 3300025915 Bacteria 43917
306 Ga0207693_10003223 3300025915 Bacteria 14005
307 Ga0207663_10001926 3300025916 Bacteria 9833
308 Ga0207663_10034720 3300025916 Bacteria 3019
309 Ga0207663_10042314 3300025916 Bacteria 2782
310 Ga0207663_10051661 3300025916 Bacteria 2561
311 Ga0207660_10023384 3300025917 Bacteria 4173
312 Ga0207660_10143180 3300025917 Bacteria 1829
313 Ga0207662_10001133 3300025918 Bacteria 12560
314 Ga0207657_10000664 3300025919 Bacteria 36576
315 Ga0207657_10019384 3300025919 Bacteria 6462
316 Ga0207657_10042217 3300025919 Bacteria 4025
317 Ga0207649_10016920 3300025920 Bacteria 4124
318 Ga0207652_10053329 3300025921 Bacteria 3473
319 Ga0207652_10091229 3300025921 Bacteria 2679
320 Ga0207652_10181534 3300025921 Bacteria 1891
321 Ga0207681_10024471 3300025923 Bacteria 3876
322 Ga0207694_10051174 3300025924 Bacteria 3201
323 Ga0207694_10105080 3300025924 Bacteria 2241
324 Ga0207650_10005610 3300025925 Bacteria 8572
325 Ga0207650_10267418 3300025925 Bacteria 1389
326 Ga0207687_10017153 3300025927 Bacteria 4761
327 Ga0207687_10091861 3300025927 Bacteria 2215
328 Ga0207700_10054769 3300025928 Bacteria 2996
329 Ga0207700_10066396 3300025928 Bacteria 2757
330 Ga0207700_10097609 3300025928 Bacteria 2335
331 Ga0207700_10286350 3300025928 Bacteria 1419
332 Ga0207664_10115378 3300025929 Bacteria 2239
333 Ga0207644_10133956 3300025931 Bacteria 1900
334 Ga0207690_10009470 3300025932 Bacteria 5785
335 Ga0207706_10000247 3300025933 Bacteria 59079
336 Ga0207706_10029015 3300025933 Bacteria 4940
337 Ga0207706_10042883 3300025933 Bacteria 4009
338 Ga0207686_10025507 3300025934 Bacteria 3438
339 Ga0207709_10022604 3300025935 Bacteria 3568
340 Ga0207709_10099170 3300025935 Bacteria 1922
341 Ga0207709_10187831 3300025935 Bacteria 1465
342 Ga0207670_10013061 3300025936 Bacteria 4884
343 Ga0207670_10015701 3300025936 Bacteria 4531
344 Ga0207669_10001810 3300025937 Bacteria 9051
345 Ga0207669_10153555 3300025937 Bacteria 1616
346 Ga0207704_10007211 3300025938 Bacteria 5236
347 Ga0207704_10038375 3300025938 Bacteria 2778
348 Ga0207704_10094641 3300025938 Bacteria 1973
349 Ga0207665_10000262 3300025939 Bacteria 36575
350 Ga0207665_10001364 3300025939 Bacteria 16457
351 Ga0207691_10015768 3300025940 Bacteria 7183
352 Ga0207711_10007899 3300025941 Bacteria 8899
353 Ga0207711_10041075 3300025941 Bacteria 3938
354 Ga0207711_10098011 3300025941 Bacteria 2590
355 Ga0207711_10319764 3300025941 Bacteria 1434
356 Ga0207689_10078975 3300025942 Bacteria 2704
357 Ga0207679_10007266 3300025945 Bacteria 7018
358 Ga0207679_10082748 3300025945 Bacteria 2458
359 Ga0207667_10069346 3300025949 Bacteria 3669
360 Ga0207667_10192844 3300025949 Bacteria 2090
361 Ga0207712_10006105 3300025961 Bacteria 7603
362 Ga0207668_10019130 3300025972 Bacteria 4324
363 Ga0207668_10055299 3300025972 Bacteria 2758
364 Ga0207668_10067366 3300025972 Bacteria 2541
365 Ga0207640_10065360 3300025981 Bacteria 2427
366 Ga0207658_10013439 3300025986 Bacteria 5592
367 Ga0207677_10026700 3300026023 Bacteria 3626
368 Ga0207703_10070342 3300026035 Bacteria 2888
369 Ga0207639_10031931 3300026041 Bacteria 3873
370 Ga0207639_10048933 3300026041 Bacteria 3202
371 Ga0207639_10091893 3300026041 Bacteria 2431
372 Ga0207678_10000247 3300026067 Bacteria 48621
373 Ga0207678_10002469 3300026067 Bacteria 16796
374 Ga0207678_10024463 3300026067 Bacteria 5274
375 Ga0207678_10079215 3300026067 Bacteria 2813
376 Ga0207678_10083637 3300026067 Bacteria 2730
377 Ga0207708_10001039 3300026075 Bacteria 20776
378 Ga0207708_10002105 3300026075 Bacteria 14659
379 Ga0207702_10147255 3300026078 Bacteria 2138
380 Ga0207641_10097710 3300026088 Bacteria 2581
381 Ga0207641_10330503 3300026088 Bacteria 1448
382 Ga0207648_10052487 3300026089 Bacteria 3565
383 Ga0207648_10247999 3300026089 Bacteria 1587
384 Ga0207676_10014267 3300026095 Bacteria 5713
385 Ga0207674_10038386 3300026116 Bacteria 4971
386 Ga0207675_100000047 3300026118 Bacteria 85113
387 Ga0207675_100006675 3300026118 Bacteria 10919
388 Ga0207675_100016268 3300026118 Bacteria 6945
389 Ga0207675_100030122 3300026118 Bacteria 5053
390 Ga0207675_100106034 3300026118 Bacteria 2649
391 Ga0207683_10000542 3300026121 Bacteria 34972
392 Ga0207683_10028640 3300026121 Bacteria 4818
393 Ga0207698_10005599 3300026142 Bacteria 7774
394 Ga0207698_10166236 3300026142 Bacteria 1936
395 Ga0209389_1000137 3300027296 Bacteria 63287
396 Ga0209489_114122 3300027361 Bacteria 5856
397 Ga0209700_100046 3300027363 Bacteria 159296
398 Ga0209179_1003276 3300027512 Bacteria 2312
399 Ga0209966_1000879 3300027695 Bacteria 5790
400 Ga0209966_1003243 3300027695 Bacteria 2734
401 Ga0209998_10007039 3300027717 Bacteria 2332
402 Ga0209813_10000354 3300027866 Bacteria 11736
403 Ga0209813_10005018 3300027866 Bacteria 3196
404 Ga0209813_10009392 3300027866 Bacteria 2501
405 Ga0209813_10060166 3300027866 Bacteria 1211
406 Ga0207428_10004311 3300027907 Bacteria 13585
407 Ga0268266_10060595 3300028379 Bacteria 3263
408 Ga0268266_10087880 3300028379 Bacteria 2720
409 Ga0268265_10016031 3300028380 Bacteria 5142
410 Ga0268265_10020474 3300028380 Bacteria 4616
411 Ga0268265_10044534 3300028380 Bacteria 3305
412 Ga0268264_10000020 3300028381 Bacteria 483593
413 Ga0268264_10055482 3300028381 Bacteria 3310
414 Ga0268264_10065128 3300028381 Bacteria 3069
415 Ga0268264_10166218 3300028381 Bacteria 1992
416 Ga0265337_1006298 3300028556 Bacteria 4597
417 Ga0265326_10010919 3300028558 Bacteria 2688
418 Ga0265319_1000642 3300028563 Bacteria 23018
419 Ga0265334_10002301 3300028573 Bacteria 8979
420 Ga0265334_10037179 3300028573 Bacteria 1920
421 Ga0265318_10005252 3300028577 Bacteria 6099
422 Ga0265323_10000169 3300028653 Bacteria 38978
423 Ga0265322_10006247 3300028654 Bacteria 3506
424 Ga0265336_10000663 3300028666 Bacteria 18699
425 Ga0307517_10001951 3300028786 Bacteria 33688
426 Ga0307515_10092425 3300028794 Bacteria 3766
427 Ga0265338_10000013 3300028800 Bacteria 379065
428 Ga0265324_10001030 3300029957 Bacteria 17126
429 Ga0307511_10048094 3300030521 Bacteria 3476
430 Ga0265330_10002148 3300031235 Bacteria 10875
431 Ga0265330_10017984 3300031235 Bacteria 3249
432 Ga0265325_10038067 3300031241 Bacteria 2540
433 Ga0265340_10001233 3300031247 Bacteria 14653
434 Ga0265339_10001813 3300031249 Bacteria 15668
435 Ga0265339_10008846 3300031249 Bacteria 6375
436 Ga0307509_10178491 3300031507 Bacteria 1993
437 Ga0265313_10000356 3300031595 Bacteria 49871
438 Ga0307508_10000058 3300031616 Bacteria 125293
439 Ga0316579_10011336 3300031691 Bacteria 3788
440 Ga0316579_10044153 3300031691 Bacteria 2075
441 Ga0265314_10015665 3300031711 Bacteria 6009
442 Ga0265314_10055336 3300031711 Bacteria 2740
443 Ga0265342_10028933 3300031712 Bacteria 3444
444 Ga0316576_10120963 3300031727 Bacteria 1965
445 Ga0316578_10033393 3300031728 Bacteria 2947
446 Ga0307516_10070540 3300031730 Bacteria 3357
447 Ga0307405_10104864 3300031731 Bacteria 1903
448 Ga0307410_10168960 3300031852 Bacteria 1646
449 Ga0307406_10017401 3300031901 Bacteria 4184
450 Ga0307409_100030066 3300031995 Bacteria 3897
451 Ga0307415_100028697 3300032126 Bacteria 3544
452 Ga0316583_10006386 3300032133 Bacteria 4232
453 Ga0316585_10001817 3300032137 Bacteria 5706
454 Ga0316580_10002912 3300032139 Bacteria 4795
455 Ga0307510_10089703 3300033180 Bacteria 2925
456 Ga0373930_0001132 3300034816 Bacteria 3880
457 Ga0373958_0000104 3300034819 Bacteria 9094
458 Ga0373959_0002185 3300034820 Bacteria 3118
459 Ga0373928_0001256 3300035084 Bacteria 4988
460 Ga0373929_0000075 3300035085 Bacteria 16379
461 Ga0373949_0013321 3300035090 Bacteria 1821
462 Ga0373951_0010253 3300035091 Bacteria 2103
463 Ga0373923_0026898 3300035111 Bacteria 2291
464 Ga0373932_0000399 3300035112 Bacteria 13364
465 Ga0373936_0040420 3300035113 Bacteria 1868
466 Ga0373941_0000103 3300035115 Bacteria 14264
467 Ga0373941_0000649 3300035115 Bacteria 7041
468 Ga0373945_0027424 3300035116 Bacteria 1990
469 Ga0373945_0059101 3300035116 Bacteria 1427
470 Ga0373954_0099175 3300035118 Bacteria 1404
471 Ga0373946_0021979 3300035171 Bacteria 2479
472 Ga0373955_0033569 3300035172 Bacteria 2704
473 Ga0373942_0005219 3300035207 Bacteria 3008
474 Ga0373931_0028547 3300035691 Bacteria 2857
475 Ga0373935_0004983 3300035692 Bacteria 7813
476 Ga0373935_0060761 3300035692 Bacteria 2418
477 Ga0373935_0071435 3300035692 Bacteria 2239
478 Ga0373927_0008479 3300035695 Bacteria 6916
479 Ga0373927_0013969 3300035695 Bacteria 5325
480 Ga0373927_0014897 3300035695 Bacteria 5143
481 Ga0373927_0063358 3300035695 Bacteria 2391
482 Ga0373933_0000202 3300035724 Bacteria 39481
483 Ga0373947_0023677 3300035725 Bacteria 3574
484 Ga0373947_0034433 3300035725 Bacteria 2995
485 Ga0373947_0093691 3300035725 Bacteria 1877
486 Ga0373947_0096428 3300035725 Bacteria 1852
487 Ga0373947_0122576 3300035725 Bacteria 1653
488 Ga0373937_0022999 3300036401 Bacteria 5606
489 Ga0372808_000705 3300036459 Bacteria 2927
490 Ga0316582_0083025 3300036647 Bacteria 2095
491 Ga0316584_0032544 3300036712 Bacteria 3859
492 Ga0373925_0014554 3300037068 Bacteria 5685
493 Ga0373925_0017650 3300037068 Bacteria 5178
494 Ga0373925_0105324 3300037068 Bacteria 2173
495 Ga0373925_0207485 3300037068 Bacteria 1560
496 Ga0373925_0292698 3300037068 Bacteria 1313
497 Ga0395900_0048448 3300037418 Bacteria 4377
498 Ga0395900_0218896 3300037418 Bacteria 1920
499 Ga0395898_0030060 3300037466 Bacteria 5439
500 Ga0395898_0075631 3300037466 Bacteria 3253
501 Ga0395905_0004814 3300037471 Bacteria 13929
502 Ga0436364_0400091 3300037853 Bacteria 2495
503 Ga0395901_0042929 3300038443 Bacteria 4690
504 Ga0395901_0223244 3300038443 Bacteria 1969
505 Ga0395901_0274533 3300038443 Bacteria 1753
506 Ga0395901_0276802 3300038443 Bacteria 1744
507 Ga0400489_33869 3300039093 Bacteria 3885
508 Ga0436361_0800382 3300039447 Bacteria 3828
509 Ga0436363_0677719 3300039450 Bacteria 3742
510 Ga0439453_0007254 3300041408 Bacteria 1753
511 Ga0439450_019829 3300042008 Bacteria 1429
512 Ga0439435_0015446 3300042436 Bacteria 1901
513 Ga0451577_0019873 3300042876 Bacteria 6170
514 Ga0466972_0006433 3300044658 Bacteria 5900
515 Ga0466966_0000229 3300044684 Bacteria 37407
516 Ga0466961_0000029 3300044693 Bacteria 86710
517 Ga0453684_0055062 3300044712 Bacteria 5174
518 Ga0466959_0000967 3300045049 Bacteria 17081
519 Ga0451576_0019035 3300045051 Bacteria 7503
520 Ga0495592_0111117 3300046454 Bacteria 1939
521 Ga0495603_0005985 3300046455 Bacteria 7272
522 Ga0495629_0000401 3300046459 Bacteria 36430
523 Ga0495629_0014747 3300046459 Bacteria 5621
524 Ga0495629_0020141 3300046459 Bacteria 4762
525 Ga0495629_0046329 3300046459 Bacteria 3050
526 Ga0495629_0123870 3300046459 Bacteria 1800
527 Ga0495638_0004396 3300046460 Bacteria 10666
528 Ga0495641_0011812 3300046461 Bacteria 4938
529 Ga0495651_0012637 3300046462 Bacteria 6515
530 Ga0495651_0027824 3300046462 Bacteria 4406
531 Ga0495651_0133289 3300046462 Bacteria 1811
532 Ga0495651_0139332 3300046462 Bacteria 1761
533 Ga0495653_0108858 3300046463 Bacteria 1995
534 Ga0495580_0025887 3300046472 Bacteria 4283
535 Ga0495582_0025029 3300046473 Bacteria 3269
536 Ga0495639_0002142 3300046475 Bacteria 8708
537 Ga0495639_0028094 3300046475 Bacteria 2492
538 Ga0495639_0035061 3300046475 Bacteria 2245
539 Ga0495664_0097972 3300046477 Bacteria 1765
540 Ga0495594_0002226 3300046499 Bacteria 10087
541 Ga0495594_0004129 3300046499 Bacteria 7463
542 Ga0495594_0011198 3300046499 Bacteria 4657
543 Ga0495594_0080768 3300046499 Bacteria 1815
544 Ga0495607_0022174 3300046501 Bacteria 3993
545 Ga0495606_0053849 3300046507 Bacteria 2609
546 Ga0495608_0118945 3300046511 Bacteria 1695
547 Ga0495608_0212528 3300046511 Bacteria 1215
548 Ga0495610_0021420 3300046512 Bacteria 3556
549 Ga0495618_0085216 3300046514 Bacteria 2019
550 Ga0495628_0026293 3300046516 Bacteria 4748
551 Ga0495628_0075184 3300046516 Bacteria 2631
552 Ga0495630_0024973 3300046517 Bacteria 4417
553 Ga0495630_0035944 3300046517 Bacteria 3703
554 Ga0495643_0041010 3300046522 Bacteria 2526
555 Ga0495666_0030878 3300046526 Bacteria 2627
556 Ga0495642_0016277 3300046528 Bacteria 2897
557 Ga0495652_0047265 3300046529 Bacteria 3691
558 Ga0495652_0093818 3300046529 Bacteria 2449
559 Ga0495652_0097001 3300046529 Bacteria 2399
560 Ga0495654_0053002 3300046530 Bacteria 1973
561 Ga0495665_0002068 3300046531 Bacteria 10862
562 Ga0495640_0015696 3300046533 Bacteria 5689
563 Ga0495640_0019241 3300046533 Bacteria 5044
564 Ga0495640_0053312 3300046533 Bacteria 2773
565 Ga0495640_0150015 3300046533 Bacteria 1498
566 Ga0495587_0039481 3300046536 Bacteria 2824
567 Ga0495587_0110168 3300046536 Bacteria 1582
568 Ga0495645_0020172 3300046543 Bacteria 4805
569 Ga0495622_0011687 3300046557 Bacteria 4058
570 Ga0495622_0014798 3300046557 Bacteria 3626
571 Ga0495622_0075968 3300046557 Bacteria 1548
572 Ga0495667_0013164 3300046559 Bacteria 5601
573 Ga0495667_0050600 3300046559 Bacteria 2742
574 Ga0495667_0122795 3300046559 Bacteria 1676
575 Ga0495668_0005423 3300046616 Bacteria 8666
576 Ga0495634_0010636 3300046642 Bacteria 6735
577 Ga0495634_0125632 3300046642 Bacteria 1639
578 Ga0495625_0124577 3300046660 Bacteria 1750
579 Ga0495635_0005726 3300046663 Bacteria 8655
580 Ga0495635_0014018 3300046663 Bacteria 5609
581 Ga0495635_0034228 3300046663 Bacteria 3523
582 Ga0495635_0166175 3300046663 Bacteria 1501
583 Ga0495661_0052572 3300046665 Bacteria 2454
584 Ga0495588_0036702 3300046674 Bacteria 2487
585 Ga0495588_0046958 3300046674 Bacteria 2216
586 Ga0495657_0096400 3300046675 Bacteria 1890
587 Ga0495657_0121520 3300046675 Bacteria 1644
588 Ga0495599_0003308 3300046678 Bacteria 9409
589 Ga0495599_0220562 3300046678 Bacteria 1160
590 Ga0495623_0025315 3300046679 Bacteria 3822
591 Ga0495647_0005387 3300046681 Bacteria 4189
592 Ga0495647_0018126 3300046681 Bacteria 2501
593 Ga0495658_0000265 3300046683 Bacteria 29770
594 Ga0495658_0003333 3300046683 Bacteria 7969
595 Ga0495613_0008228 3300046689 Bacteria 7744
596 Ga0495613_0034201 3300046689 Bacteria 3776
597 Ga0495613_0060699 3300046689 Bacteria 2769
598 Ga0495613_0064917 3300046689 Bacteria 2668
599 Ga0495613_0176846 3300046689 Bacteria 1512
600 Ga0495624_0039174 3300046690 Bacteria 3039
601 Ga0495624_0053165 3300046690 Bacteria 2557
602 Ga0495624_0115701 3300046690 Bacteria 1648
603 Ga0495624_0138067 3300046690 Bacteria 1494
604 Ga0495671_0018090 3300046692 Bacteria 3747
605 Ga0495600_0028328 3300046809 Bacteria 3623
606 Ga0495600_0041920 3300046809 Bacteria 2984
607 Ga0495581_0025017 3300047315 Bacteria 3459
608 Ga0495581_0032354 3300047315 Bacteria 3029
609 Ga0495581_0053303 3300047315 Bacteria 2336
610 Ga0495581_0080628 3300047315 Bacteria 1884
611 Ga0495604_0021963 3300047317 Bacteria 5093
612 Ga0495604_0050351 3300047317 Bacteria 3234
613 Ga0495604_0053403 3300047317 Bacteria 3123
614 Ga0495604_0157005 3300047317 Bacteria 1611
615 Ga0495674_0013608 3300047319 Bacteria 7643
616 Ga0495674_0014838 3300047319 Bacteria 7289
617 Ga0495674_0030253 3300047319 Bacteria 4925
618 Ga0495680_0015838 3300047322 Bacteria 6490
619 Ga0495680_0030613 3300047322 Bacteria 4393
620 Ga0495687_007206 3300047443 Bacteria 6609
621 Ga0495675_0042693 3300047444 Bacteria 2888
622 Ga0495673_0014114 3300047469 Bacteria 4164
623 Ga0495684_0030860 3300047471 Bacteria 4114
624 Ga0495684_0039229 3300047471 Bacteria 3630
625 Ga0495686_0015739 3300047472 Bacteria 5152
626 Ga0495593_0002908 3300047673 Bacteria 10322
627 Ga0495593_0026795 3300047673 Bacteria 3179
628 Ga0495593_0051458 3300047673 Bacteria 2179
629 Ga0495593_0068108 3300047673 Bacteria 1852
630 Ga0495602_0078694 3300048088 Bacteria 2784
631 Ga0495602_0087820 3300048088 Bacteria 2590
632 Ga0495602_0262838 3300048088 Bacteria 1279
633 Ga0496100_0038440 3300048903 Bacteria 3032
634 Ga0496101_0073266 3300048904 Bacteria 2515
635 Ga0496101_0110399 3300048904 Bacteria 2069
636 Ga0496101_0110593 3300048904 Bacteria 2068
637 Ga0496102_0014005 3300048905 Bacteria 6964
638 Ga0496102_0078941 3300048905 Bacteria 3030
639 Ga0496102_0153625 3300048905 Bacteria 2163
640 Ga0496103_0001223 3300048906 Bacteria 17609
641 Ga0496103_0008856 3300048906 Bacteria 5968
642 Ga0496103_0091266 3300048906 Bacteria 1922
643 Ga0496103_0106903 3300048906 Bacteria 1775
644 Ga0496103_0137325 3300048906 Bacteria 1563
645 Ga0496104_0003761 3300048907 Bacteria 13118
646 Ga0496104_0004958 3300048907 Bacteria 11618
647 Ga0496104_0010970 3300048907 Bacteria 8107
648 Ga0496104_0018250 3300048907 Bacteria 6399
649 Ga0496104_0018351 3300048907 Bacteria 6383
650 Ga0496104_0022383 3300048907 Bacteria 5805
651 Ga0496104_0237680 3300048907 Bacteria 1734
652 Ga0496104_0377465 3300048907 Bacteria 1330
653 Ga0496105_0014746 3300048908 Bacteria 6221
654 Ga0496105_0018352 3300048908 Bacteria 5619
655 Ga0496105_0023234 3300048908 Bacteria 5027
656 Ga0496105_0027661 3300048908 Bacteria 4635
657 Ga0496105_0079001 3300048908 Bacteria 2717
658 Ga0496106_0000863 3300048909 Bacteria 22031
659 Ga0496106_0007382 3300048909 Bacteria 8124
660 Ga0496106_0014060 3300048909 Bacteria 5914
661 Ga0496106_0015871 3300048909 Bacteria 5572
662 Ga0496106_0016670 3300048909 Bacteria 5435
663 Ga0496106_0107712 3300048909 Bacteria 2167
664 Ga0496107_0000335 3300048910 Bacteria 25483
665 Ga0496107_0017009 3300048910 Bacteria 5113
666 Ga0496107_0162898 3300048910 Bacteria 1653
667 Ga0496108_0017621 3300048911 Bacteria 5844
668 Ga0496108_0039412 3300048911 Bacteria 3938
669 Ga0496109_0043189 3300048912 Bacteria 4086
670 Ga0496109_0060277 3300048912 Bacteria 3467
671 Ga0496109_0124445 3300048912 Bacteria 2403
672 Ga0496110_0000794 3300048913 Bacteria 22051
673 Ga0496110_0036244 3300048913 Bacteria 4283
674 Ga0496110_0060791 3300048913 Bacteria 3333
675 Ga0496110_0072731 3300048913 Bacteria 3051
676 Ga0496110_0084491 3300048913 Bacteria 2833
677 Ga0496110_0123992 3300048913 Bacteria 2330
678 Ga0496110_0159976 3300048913 Bacteria 2041
679 Ga0496110_0225549 3300048913 Bacteria 1704
680 Ga0496112_0059616 3300048915 Bacteria 3761
681 Ga0496112_0069376 3300048915 Bacteria 3482
682 Ga0496112_0085763 3300048915 Bacteria 3115
683 Ga0496113_0007570 3300048916 Bacteria 7003
684 Ga0496113_0062644 3300048916 Bacteria 2809
685 Ga0496113_0235333 3300048916 Bacteria 1461
686 Ga0496113_0376308 3300048916 Bacteria 1140
687 Ga0496114_0001714 3300048917 Bacteria 16643
688 Ga0496114_0040299 3300048917 Bacteria 3866
689 Ga0496114_0096993 3300048917 Bacteria 2511
690 Ga0496114_0186514 3300048917 Bacteria 1813
691 Ga0496115_0019333 3300048918 Bacteria 5240
692 Ga0496115_0049271 3300048918 Bacteria 3371
693 Ga0496115_0057816 3300048918 Bacteria 3120
694 Ga0496115_0196083 3300048918 Bacteria 1669
695 Ga0496117_0008333 3300048920 Bacteria 9863
696 Ga0496117_0045821 3300048920 Bacteria 3153
697 Ga0496117_0050906 3300048920 Bacteria 2933
698 Ga0496117_0136853 3300048920 Bacteria 1474
699 Ga0496118_0035633 3300048921 Bacteria 4037
700 Ga0496118_0037179 3300048921 Bacteria 3923
701 Ga0496118_0055750 3300048921 Bacteria 2978
702 Ga0496119_0105777 3300048922 Bacteria 1571
703 Ga0496120_0016663 3300048923 Bacteria 4796
704 Ga0496121_0002396 3300048924 Bacteria 28735
705 Ga0496121_0090293 3300048924 Bacteria 2395
706 Ga0496122_0008649 3300048925 Bacteria 10923
707 Ga0496122_0030293 3300048925 Bacteria 4539
708 Ga0496123_0020212 3300048926 Bacteria 5215
709 Ga0496124_0016923 3300048927 Bacteria 6908
710 Ga0496124_0161086 3300048927 Bacteria 1749
711 Ga0496125_0006206 3300048928 Bacteria 13017
712 Ga0496125_0006386 3300048928 Bacteria 12773
713 Ga0496125_0018774 3300048928 Bacteria 6553
714 Ga0496125_0021935 3300048928 Bacteria 5939
715 Ga0496125_0122488 3300048928 Bacteria 1851
716 Ga0496126_0023524 3300048929 Bacteria 5969
717 Ga0496126_0027687 3300048929 Bacteria 5409
718 Ga0496126_0032003 3300048929 Bacteria 4961
719 Ga0496126_0047633 3300048929 Bacteria 3924
720 Ga0496126_0104040 3300048929 Bacteria 2480
721 Ga0496126_0190719 3300048929 Bacteria 1736
722 Ga0496126_0192436 3300048929 Bacteria 1727
723 Ga0496126_0196413 3300048929 Bacteria 1706
724 Ga0501031_0001866 3300049568 Bacteria 13252
725 Ga0501031_0017282 3300049568 Bacteria 4687
726 Ga0501031_0104102 3300049568 Bacteria 1852
727 Ga0501032_0006976 3300049569 Bacteria 8281
728 Ga0501032_0007040 3300049569 Bacteria 8249
729 Ga0501032_0019190 3300049569 Bacteria 4784
730 Ga0501032_0036536 3300049569 Bacteria 3352
731 Ga0501032_0072302 3300049569 Bacteria 2298
732 Ga0501032_0100665 3300049569 Bacteria 1915
733 Ga0501032_0184403 3300049569 Bacteria 1365
734 Ga0501033_0001605 3300049570 Bacteria 19872
735 Ga0501033_0006414 3300049570 Bacteria 9212
736 Ga0501033_0012999 3300049570 Bacteria 6348
737 Ga0501033_0024710 3300049570 Bacteria 4530
738 Ga0501033_0090027 3300049570 Bacteria 2245
739 Ga0501033_0096577 3300049570 Bacteria 2159
740 Ga0501033_0171302 3300049570 Bacteria 1559
741 Ga0501033_0225548 3300049570 Bacteria 1332
742 Ga0501033_0227053 3300049570 Bacteria 1327
743 Ga0501034_0000499 3300049571 Bacteria 63629
744 Ga0501034_0000561 3300049571 Bacteria 58872
745 Ga0501034_0000832 3300049571 Bacteria 45898
746 Ga0501034_0002893 3300049571 Bacteria 19964
747 Ga0501034_0015498 3300049571 Bacteria 7831
748 Ga0501034_0017391 3300049571 Bacteria 7375
749 Ga0501034_0058850 3300049571 Bacteria 3860
750 Ga0501034_0105050 3300049571 Bacteria 2817
751 Ga0501034_0174087 3300049571 Bacteria 2118
752 Ga0501034_0260331 3300049571 Bacteria 1677
753 Ga0501034_0336364 3300049571 Bacteria 1440
754 Ga0501036_0000503 3300049572 Bacteria 28006
755 Ga0501036_0004196 3300049572 Bacteria 11615
756 Ga0501036_0004539 3300049572 Bacteria 11206
757 Ga0501036_0020356 3300049572 Bacteria 5573
758 Ga0501036_0023203 3300049572 Bacteria 5224
759 Ga0501036_0031563 3300049572 Bacteria 4476
760 Ga0501036_0036678 3300049572 Bacteria 4149
761 Ga0501036_0070697 3300049572 Bacteria 2951
762 Ga0501036_0080185 3300049572 Bacteria 2759
763 Ga0501036_0095058 3300049572 Bacteria 2519
764 Ga0501036_0115323 3300049572 Bacteria 2269
765 Ga0501036_0258636 3300049572 Bacteria 1458
766 Ga0501037_0000595 3300049573 Bacteria 28225
767 Ga0501037_0006217 3300049573 Bacteria 8731
768 Ga0501037_0006574 3300049573 Bacteria 8508
769 Ga0501037_0015628 3300049573 Bacteria 5587
770 Ga0501037_0045570 3300049573 Bacteria 3219
771 Ga0501037_0051522 3300049573 Bacteria 3010
772 Ga0501037_0060251 3300049573 Bacteria 2768
773 Ga0501038_0001751 3300049574 Bacteria 20170
774 Ga0501038_0004702 3300049574 Bacteria 12701
775 Ga0501038_0005164 3300049574 Bacteria 12140
776 Ga0501038_0007397 3300049574 Bacteria 10128
777 Ga0501038_0011040 3300049574 Bacteria 8247
778 Ga0501038_0012326 3300049574 Bacteria 7810
779 Ga0501038_0022542 3300049574 Bacteria 5640
780 Ga0501038_0033990 3300049574 Bacteria 4485
781 Ga0501038_0039123 3300049574 Bacteria 4149
782 Ga0501038_0061540 3300049574 Bacteria 3210
783 Ga0501038_0070972 3300049574 Bacteria 2955
784 Ga0501038_0087664 3300049574 Bacteria 2614
785 Ga0501038_0134451 3300049574 Bacteria 2027
786 Ga0501039_0000143 3300049575 Bacteria 48809
787 Ga0501039_0000498 3300049575 Bacteria 28499
788 Ga0501039_0004324 3300049575 Bacteria 10710
789 Ga0501039_0015580 3300049575 Bacteria 5817
790 Ga0501039_0029417 3300049575 Bacteria 4231
791 Ga0501039_0030447 3300049575 Bacteria 4162
792 Ga0501039_0038083 3300049575 Bacteria 3714
793 Ga0501039_0059313 3300049575 Bacteria 2964
794 Ga0501039_0111401 3300049575 Bacteria 2139
795 Ga0501039_0156921 3300049575 Bacteria 1788
796 Ga0501040_0020607 3300049576 Bacteria 4395
797 Ga0501040_0053192 3300049576 Bacteria 2772
798 Ga0501040_0055248 3300049576 Bacteria 2723
799 Ga0501041_0025769 3300049577 Bacteria 3535
800 Ga0501041_0136074 3300049577 Bacteria 1531
801 Ga0501042_0002901 3300049578 Bacteria 10643
802 Ga0501042_0023178 3300049578 Bacteria 4341
803 Ga0501042_0026691 3300049578 Bacteria 4057
804 Ga0501042_0088730 3300049578 Bacteria 2219
805 Ga0501043_0001482 3300049579 Bacteria 20529
806 Ga0501043_0024995 3300049579 Bacteria 4686
807 Ga0501043_0034734 3300049579 Bacteria 3965
808 Ga0501043_0093962 3300049579 Bacteria 2357
809 Ga0501043_0230787 3300049579 Bacteria 1429
810 Ga0501043_0237019 3300049579 Bacteria 1408
811 Ga0501046_0002131 3300049580 Bacteria 18703
812 Ga0501046_0039428 3300049580 Bacteria 3782
813 Ga0501046_0042875 3300049580 Bacteria 3605
814 Ga0501047_0001136 3300049581 Bacteria 26421
815 Ga0501047_0002024 3300049581 Bacteria 19400
816 Ga0501047_0002192 3300049581 Bacteria 18696
817 Ga0501047_0009485 3300049581 Bacteria 9197
818 Ga0501047_0024519 3300049581 Bacteria 5788
819 Ga0501047_0031991 3300049581 Bacteria 5076
820 Ga0501047_0136472 3300049581 Bacteria 2333
821 Ga0501047_0155191 3300049581 Bacteria 2163
822 Ga0501047_0178874 3300049581 Bacteria 1988
823 Ga0501047_0187256 3300049581 Bacteria 1934
824 Ga0501047_0239434 3300049581 Bacteria 1666
825 Ga0501048_0000774 3300049582 Bacteria 23431
826 Ga0501048_0001447 3300049582 Bacteria 18018
827 Ga0501048_0006795 3300049582 Bacteria 8689
828 Ga0501048_0007164 3300049582 Bacteria 8471
829 Ga0501048_0038256 3300049582 Bacteria 3443
830 Ga0501048_0101465 3300049582 Bacteria 2030
831 Ga0501067_0006079 3300049583 Bacteria 6692
832 Ga0501067_0012216 3300049583 Bacteria 4759
833 Ga0501068_0013601 3300049584 Bacteria 4634
834 Ga0501069_0001439 3300049585 Bacteria 11677
835 Ga0501069_0001866 3300049585 Bacteria 10534
836 Ga0501070_0010475 3300049586 Bacteria 7840
837 Ga0501070_0028755 3300049586 Bacteria 4660
838 Ga0501070_0045861 3300049586 Bacteria 3635
839 Ga0501070_0061458 3300049586 Bacteria 3112
840 Ga0501070_0084417 3300049586 Bacteria 2629
841 Ga0501071_0025822 3300049587 Bacteria 4117
842 Ga0501071_0071361 3300049587 Bacteria 2531
843 Ga0501072_0016230 3300049588 Bacteria 5712
844 Ga0501072_0038118 3300049588 Bacteria 3772
845 Ga0501072_0087873 3300049588 Bacteria 2466
846 Ga0501072_0203728 3300049588 Bacteria 1578
847 Ga0501073_0010927 3300049589 Bacteria 6640
848 Ga0501073_0036985 3300049589 Bacteria 3467
849 Ga0501073_0040917 3300049589 Bacteria 3276
850 Ga0501073_0049989 3300049589 Bacteria 2931
851 Ga0501073_0050132 3300049589 Bacteria 2926
852 Ga0501073_0071338 3300049589 Bacteria 2420
853 Ga0501073_0160688 3300049589 Bacteria 1556
854 Ga0501074_0001676 3300049590 Bacteria 15071
855 Ga0501074_0013443 3300049590 Bacteria 5951
856 Ga0501074_0022115 3300049590 Bacteria 4620
857 Ga0501074_0029779 3300049590 Bacteria 3955
858 Ga0501074_0088678 3300049590 Bacteria 2215
859 Ga0501075_0051757 3300049591 Bacteria 3088
860 Ga0501076_0006597 3300049592 Bacteria 8417
861 Ga0501076_0038923 3300049592 Bacteria 3732
862 Ga0501076_0064500 3300049592 Bacteria 2919
863 Ga0501076_0092799 3300049592 Bacteria 2429
864 Ga0501077_0200369 3300049593 Bacteria 1268
865 Ga0501079_0007700 3300049741 Bacteria 8152
866 Ga0501079_0024164 3300049741 Bacteria 4664
867 Ga0501079_0040814 3300049741 Bacteria 3581
868 Ga0501079_0068913 3300049741 Bacteria 2730
869 Ga0501079_0155810 3300049741 Bacteria 1781
870 Ga0501080_0000159 3300049742 Bacteria 48535
871 Ga0501080_0026563 3300049742 Bacteria 5379
872 Ga0501080_0036625 3300049742 Bacteria 4580
873 Ga0501080_0037947 3300049742 Bacteria 4499
874 Ga0501080_0084953 3300049742 Bacteria 2941
875 Ga0501080_0093866 3300049742 Bacteria 2786
876 Ga0501080_0212966 3300049742 Bacteria 1770
877 Ga0501080_0245428 3300049742 Bacteria 1633
878 Ga0501081_0009677 3300049743 Bacteria 6284
879 Ga0501081_0024556 3300049743 Bacteria 4047
880 Ga0501081_0035597 3300049743 Bacteria 3389
881 Ga0501081_0063804 3300049743 Bacteria 2557
882 Ga0501081_0089569 3300049743 Bacteria 2162
883 Ga0501081_0159094 3300049743 Bacteria 1627
884 Ga0501083_0004507 3300049744 Bacteria 9838
885 Ga0501083_0004950 3300049744 Bacteria 9438
886 Ga0501083_0023504 3300049744 Bacteria 4273
887 Ga0501083_0042685 3300049744 Bacteria 3073
888 Ga0501083_0159484 3300049744 Bacteria 1476
889 Ga0501035_0000838 3300049822 Bacteria 32854
890 Ga0501035_0002087 3300049822 Bacteria 19885
891 Ga0501035_0014314 3300049822 Bacteria 7322
892 Ga0501035_0025165 3300049822 Bacteria 5456
893 Ga0501035_0075849 3300049822 Bacteria 2974
894 Ga0501035_0076523 3300049822 Bacteria 2959
895 Ga0501035_0094684 3300049822 Bacteria 2626
896 Ga0501035_0132711 3300049822 Bacteria 2170
897 Ga0501035_0237567 3300049822 Bacteria 1551
898 Ga0501035_0352824 3300049822 Bacteria 1230
899 Ga0501044_0000115 3300049823 Bacteria 96999
900 Ga0501044_0020560 3300049823 Bacteria 7046
901 Ga0501044_0033827 3300049823 Bacteria 5367
902 Ga0501044_0036679 3300049823 Bacteria 5127
903 Ga0501044_0050013 3300049823 Bacteria 4314
904 Ga0501044_0054046 3300049823 Bacteria 4129
905 Ga0501044_0061755 3300049823 Bacteria 3832
906 Ga0501044_0079233 3300049823 Bacteria 3329
907 Ga0501044_0089548 3300049823 Bacteria 3106
908 Ga0501044_0158828 3300049823 Bacteria 2239
909 Ga0501044_0162402 3300049823 Bacteria 2209
910 Ga0501044_0287733 3300049823 Bacteria 1575
911 Ga0501045_0061250 3300049824 Bacteria 2761
912 Ga0501045_0069803 3300049824 Bacteria 2584
913 Ga0501045_0121727 3300049824 Bacteria 1937
914 nmdc:mga03n38_13225_c1 3300050490 Bacteria 3128
915 nmdc:mga03n38_14769_c1 3300050490 Bacteria 3002
916 nmdc:mga03n38_1593_c1 3300050490 Bacteria 6611
917 nmdc:mga03n38_29357_c1 3300050490 Bacteria 2301
918 nmdc:mga00v17_2560_c1 3300050491 Bacteria 9330
919 nmdc:mga00v17_66987_c1 3300050491 Bacteria 2218
920 nmdc:mga0yw44_10870_c1 3300050492 Bacteria 4667
921 nmdc:mga0yw44_12467_c1 3300050492 Bacteria 4433
922 nmdc:mga0yw44_133331_c1 3300050492 Bacteria 1610
923 nmdc:mga0yw44_41490_c1 3300050492 Bacteria 2740
924 nmdc:mga0yw44_86897_c1 3300050492 Bacteria 1970
925 nmdc:mga0k408_14266_c1 3300050493 Bacteria 4374
926 nmdc:mga0k408_3070_c1 3300050493 Bacteria 8847
927 nmdc:mga0k408_36016_c1 3300050493 Bacteria 2839
928 nmdc:mga06z11_1068_c1 3300050494 Bacteria 9967
929 nmdc:mga06z11_12914_c1 3300050494 Bacteria 3648
930 nmdc:mga06z11_25213_c1 3300050494 Bacteria 2815
931 nmdc:mga04h51_2923_c1 3300050495 Bacteria 4104
932 nmdc:mga04h51_5240_c1 3300050495 Bacteria 3293
933 nmdc:mga04h51_866_c1 3300050495 Bacteria 6980
934 nmdc:mga07m45_34836_c1 3300050496 Bacteria 2799
935 nmdc:mga07m45_8522_c1 3300050496 Bacteria 5276
936 nmdc:mga07m45_8765_c1 3300050496 Bacteria 5213
937 nmdc:mga06r32_48360_c2 3300050510 Bacteria 2780
938 nmdc:mga06r32_91075_c1 3300050510 Bacteria 2980
939 nmdc:mga0n895_150287_c1 3300050512 Bacteria 2359
940 nmdc:mga0n895_46413_c1 3300050512 Bacteria 4244
941 nmdc:mga0n895_5025_c1 3300050512 Bacteria 10973
942 nmdc:mga0rr50_15118_c1 3300050513 Bacteria 5087
943 nmdc:mga0rr50_264222_c1 3300050513 Bacteria 1432
944 nmdc:mga0sz30_12419_c1 3300050516 Bacteria 3315
945 nmdc:mga0sz30_74437_c1 3300050516 Bacteria 1465
946 Ga0500610_0107331 3300053079 Bacteria 1439
947 Ga0500635_0010324 3300053080 Bacteria 2618
948 Ga0495655_0000469 3300053083 Bacteria 6772
949 Ga0495595_0011588 3300053084 Bacteria 3690
950 Ga0495619_0000164 3300053085 Bacteria 48672
951 Ga0495619_0087869 3300053085 Bacteria 2102
952 Ga0495619_0090762 3300053085 Bacteria 2068
953 Ga0495619_0119361 3300053085 Bacteria 1807
954 Ga0500581_018442 3300053089 Bacteria 3513
955 Ga0500647_0004322 3300053091 Bacteria 5702
956 Ga0500651_0030072 3300053093 Bacteria 3416
957 Ga0500566_0000400 3300053094 Bacteria 24130
958 Ga0500566_0110585 3300053094 Bacteria 1494
959 Ga0500566_0122852 3300053094 Bacteria 1398
960 Ga0500640_022647 3300053095 Bacteria 2716
961 Ga0500650_0000315 3300053098 Bacteria 11676
962 Ga0500555_024278 3300053103 Bacteria 1738
963 Ga0500556_0000030 3300053104 Bacteria 165098
964 Ga0500556_0000110 3300053104 Bacteria 73102
965 Ga0500569_000629 3300053109 Bacteria 6006
966 Ga0500572_000121 3300053111 Bacteria 26132
967 Ga0500592_001867 3300053116 Bacteria 3392
968 Ga0500595_000749 3300053119 Bacteria 19100
969 Ga0500595_023560 3300053119 Bacteria 2162
970 Ga0500595_027390 3300053119 Bacteria 1952
971 Ga0500608_003152 3300053122 Bacteria 6126
972 Ga0500614_003296 3300053123 Bacteria 3493
973 Ga0500642_0000006 3300053130 Bacteria 350064
974 Ga0500652_003613 3300053131 Bacteria 4698
975 Ga0500658_0060631 3300053134 Bacteria 1571
976 Ga0500658_0092215 3300053134 Bacteria 1311
977 Ga0500559_0001424 3300053136 Bacteria 13570
978 Ga0500559_0016013 3300053136 Bacteria 3166
979 Ga0500568_0001277 3300053139 Bacteria 16583
980 Ga0500568_0008272 3300053139 Bacteria 5030
981 Ga0500577_0020328 3300053142 Bacteria 2170
982 Ga0500588_0026039 3300053146 Bacteria 1632
983 Ga0500590_089270 3300053148 Bacteria 1500
984 Ga0500604_0005735 3300053151 Bacteria 3280
985 Ga0500616_0000006 3300053153 Bacteria 944738
986 Ga0500616_0005928 3300053153 Bacteria 8162
987 Ga0500616_0010404 3300053153 Bacteria 5568
988 Ga0500616_0012199 3300053153 Bacteria 5035
989 Ga0500622_0001022 3300053156 Bacteria 23514
990 Ga0500627_0094752 3300053158 Bacteria 1337
991 Ga0500630_001045 3300053159 Bacteria 12946
992 Ga0500638_031156 3300053162 Bacteria 2571
993 Ga0500639_000219 3300053163 Bacteria 28391
994 Ga0500636_0069407 3300053177 Bacteria 2045
995 Ga0500636_0072414 3300053177 Bacteria 1997
996 Ga0500636_0080342 3300053177 Bacteria 1879
997 Ga0500637_0055030 3300053178 Bacteria 2271
998 Ga0500645_047784 3300053730 Bacteria 1254
999 Ga0500596_000227 3300053735 Bacteria 9566
1000 Ga0500596_009050 3300053735 Bacteria 1566
1001 Ga0501084_0018742 3300054114 Bacteria 5763
1002 Ga0501084_0026608 3300054114 Bacteria 4828
1003 Ga0501084_0034868 3300054114 Bacteria 4208
1004 Ga0501084_0042101 3300054114 Bacteria 3820
1005 Ga0501084_0065025 3300054114 Bacteria 3052
1006 Ga0501084_0083485 3300054114 Bacteria 2681
1007 Ga0501082_0008587 3300060353 Bacteria 8812
1008 Ga0501082_0062434 3300060353 Bacteria 3207
1009 Ga0501082_0190076 3300060353 Bacteria 1786
1010 Ga0530510_0083480 3300061734 Bacteria 2326
1011 Ga0530510_0167184 3300061734 Bacteria 1628
1012 Ga0530510_0216087 3300061734 Bacteria 1424

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053146 Ga0500588_0026039 Ga0500588_0026039_15_995 264
2 3300053134 Ga0500658_0060631 Ga0500658_0060631_54_1034 265
3 3300037068 Ga0373925_0207485 Ga0373925_0207485_58_1077 276
4 3300009177 Ga0105248_10244685 Ga0105248_102446853 277
5 3300035118 Ga0373954_0099175 Ga0373954_0099175_29_1009 280
6 3300007788 Ga0099795_10079882 Ga0099795_100798821 283
7 3300027512 Ga0209179_1003276 Ga0209179_10032763 283
8 3300047315 Ga0495581_0032354 Ga0495581_0032354_920_1873 283
9 3300005616 Ga0068852_100325192 Ga0068852_1003251922 286
10 3300048916 Ga0496113_0235333 Ga0496113_0235333_10_939 288
11 3300046499 Ga0495594_0080768 Ga0495594_0080768_226_1194 293
12 3300049570 Ga0501033_0001605 Ga0501033_0001605_8297_9283 293
13 3300049571 Ga0501034_0000832 Ga0501034_0000832_36044_37030 293
14 3300049572 Ga0501036_0000503 Ga0501036_0000503_17788_18774 293
15 3300049574 Ga0501038_0004702 Ga0501038_0004702_5568_6554 293
16 3300049575 Ga0501039_0000143 Ga0501039_0000143_9888_10874 293
17 3300049581 Ga0501047_0002192 Ga0501047_0002192_12142_13128 293
18 3300054114 Ga0501084_0042101 Ga0501084_0042101_614_1600 293
19 3300049571 Ga0501034_0336364 Ga0501034_0336364_23_1003 297
20 3300048918 Ga0496115_0057816 Ga0496115_0057816_2105_3094 298
21 3300048088 Ga0495602_0262838 Ga0495602_0262838_186_1166 299
22 3300048913 Ga0496110_0123992 Ga0496110_0123992_135_1115 299
23 3300049570 Ga0501033_0090027 Ga0501033_0090027_92_1069 302
24 3300009093 Ga0105240_10024435 Ga0105240_100244354 303
25 3300009174 Ga0105241_10268409 Ga0105241_102684092 303
26 3300048920 Ga0496117_0136853 Ga0496117_0136853_367_1413 303
27 3300039450 Ga0436363_0677719 Ga0436363_0677719_25_1047 304
28 3300046460 Ga0495638_0004396 Ga0495638_0004396_9352_10473 304
29 3300046522 Ga0495643_0041010 Ga0495643_0041010_489_1610 304
30 3300046665 Ga0495661_0052572 Ga0495661_0052572_1080_2201 304
31 3300047472 Ga0495686_0015739 Ga0495686_0015739_1019_2140 304
32 3300048925 Ga0496122_0008649 Ga0496122_0008649_2223_3344 304
33 3300048926 Ga0496123_0020212 Ga0496123_0020212_2354_3475 304
34 3300048929 Ga0496126_0104040 Ga0496126_0104040_723_1844 304
35 3300050492 nmdc:mga0yw44_10870_c1 nmdc:mga0yw44_10870_c1_1388_2509 304
36 3300053093 Ga0500651_0030072 Ga0500651_0030072_1531_2652 304
37 3300053109 Ga0500569_000629 Ga0500569_000629_1190_2311 304
38 3300046507 Ga0495606_0053849 Ga0495606_0053849_1180_2301 305
39 3300046512 Ga0495610_0021420 Ga0495610_0021420_116_1237 305
40 3300048921 Ga0496118_0037179 Ga0496118_0037179_906_2039 305
41 3300053116 Ga0500592_001867 Ga0500592_001867_611_1732 305
42 3300053730 Ga0500645_047784 Ga0500645_047784_16_1137 305
43 3300006038 Ga0075365_10015666 Ga0075365_100156663 308
44 3300046660 Ga0495625_0124577 Ga0495625_0124577_448_1581 308
45 iso_pu_bacteria 2524023228 2524541184 308
46 3300005937 Ga0081455_10040525 Ga0081455_100405256 309
47 3300048929 Ga0496126_0047633 Ga0496126_0047633_1841_2974 309
48 3300053098 Ga0500650_0000315 Ga0500650_0000315_5116_6249 309
49 3300053130 Ga0500642_0000006 Ga0500642_0000006_288467_289600 309
50 3300053139 Ga0500568_0001277 Ga0500568_0001277_1539_2672 309
51 3300053151 Ga0500604_0005735 Ga0500604_0005735_1173_2306 309
52 3300035111 Ga0373923_0026898 Ga0373923_0026898_1065_2159 311
53 3300035116 Ga0373945_0059101 Ga0373945_0059101_368_1399 311
54 3300035692 Ga0373935_0004983 Ga0373935_0004983_2932_4026 311
55 3300035695 Ga0373927_0008479 Ga0373927_0008479_2117_3211 311
56 3300035725 Ga0373947_0034433 Ga0373947_0034433_377_1471 311
57 3300037068 Ga0373925_0014554 Ga0373925_0014554_352_1446 311
58 3300046461 Ga0495641_0011812 Ga0495641_0011812_179_1273 311
59 3300046472 Ga0495580_0025887 Ga0495580_0025887_2375_3469 311
60 3300046475 Ga0495639_0002142 Ga0495639_0002142_4425_5519 311
61 3300046499 Ga0495594_0002226 Ga0495594_0002226_6119_7213 311
62 3300046516 Ga0495628_0075184 Ga0495628_0075184_1432_2526 311
63 3300046517 Ga0495630_0035944 Ga0495630_0035944_377_1471 311
64 3300046531 Ga0495665_0002068 Ga0495665_0002068_1958_3052 311
65 3300046533 Ga0495640_0015696 Ga0495640_0015696_795_1889 311
66 3300046557 Ga0495622_0011687 Ga0495622_0011687_1849_2943 311
67 3300046642 Ga0495634_0010636 Ga0495634_0010636_1374_2468 311
68 3300046663 Ga0495635_0005726 Ga0495635_0005726_1699_2793 311
69 3300046674 Ga0495588_0046958 Ga0495588_0046958_568_1662 311
70 3300046675 Ga0495657_0096400 Ga0495657_0096400_265_1359 311
71 3300046681 Ga0495647_0005387 Ga0495647_0005387_260_1354 311
72 3300046683 Ga0495658_0003333 Ga0495658_0003333_4489_5583 311
73 3300046689 Ga0495613_0008228 Ga0495613_0008228_3093_4187 311
74 3300046690 Ga0495624_0039174 Ga0495624_0039174_300_1394 311
75 3300047315 Ga0495581_0025017 Ga0495581_0025017_569_1663 311
76 3300047319 Ga0495674_0013608 Ga0495674_0013608_2223_3317 311
77 3300047673 Ga0495593_0002908 Ga0495593_0002908_3711_4805 311
78 3300053103 Ga0500555_024278 Ga0500555_024278_354_1583 311
79 3300053177 Ga0500636_0069407 Ga0500636_0069407_638_1774 311
80 3300005338 Ga0068868_100080657 Ga0068868_1000806572 312
81 3300005367 Ga0070667_100133228 Ga0070667_1001332282 312
82 3300005843 Ga0068860_100179979 Ga0068860_1001799791 312
83 3300009551 Ga0105238_10031155 Ga0105238_100311555 312
84 3300025924 Ga0207694_10051174 Ga0207694_100511745 312
85 3300025941 Ga0207711_10098011 Ga0207711_100980111 312
86 3300026095 Ga0207676_10014267 Ga0207676_100142674 312
87 3300048909 Ga0496106_0016670 Ga0496106_0016670_4096_5232 312
88 3300048913 Ga0496110_0084491 Ga0496110_0084491_465_1601 312
89 3300005334 Ga0068869_100004028 Ga0068869_1000040287 313
90 3300005347 Ga0070668_100008886 Ga0070668_1000088868 313
91 3300005355 Ga0070671_100032813 Ga0070671_1000328134 313
92 3300005455 Ga0070663_100005162 Ga0070663_1000051621 313
93 3300005456 Ga0070678_100073070 Ga0070678_1000730703 313
94 3300005457 Ga0070662_100024658 Ga0070662_1000246584 313
95 3300005548 Ga0070665_100074481 Ga0070665_1000744813 313
96 3300005563 Ga0068855_100031649 Ga0068855_1000316497 313
97 3300005614 Ga0068856_100043502 Ga0068856_1000435021 313
98 3300005617 Ga0068859_100110965 Ga0068859_1001109652 313
99 3300005618 Ga0068864_100011530 Ga0068864_1000115306 313
100 3300005841 Ga0068863_100194093 Ga0068863_1001940932 313
101 3300005842 Ga0068858_100050100 Ga0068858_1000501002 313
102 3300006042 Ga0075368_10003164 Ga0075368_100031643 313
103 3300006051 Ga0075364_10019969 Ga0075364_100199693 313
104 3300006178 Ga0075367_10019333 Ga0075367_100193333 313
105 3300006195 Ga0075366_10003963 Ga0075366_100039638 313
106 3300006353 Ga0075370_10082159 Ga0075370_100821592 313
107 3300006871 Ga0075434_100061214 Ga0075434_1000612143 313
108 3300006931 Ga0097620_100110965 Ga0097620_1001109652 313
109 3300009098 Ga0105245_10059144 Ga0105245_100591442 313
110 3300009177 Ga0105248_10011606 Ga0105248_100116064 313
111 3300009551 Ga0105238_10035315 Ga0105238_100353155 313
112 3300011119 Ga0105246_10001035 Ga0105246_100010359 313
113 3300013308 Ga0157375_10027175 Ga0157375_100271752 313
114 3300014325 Ga0163163_10124317 Ga0163163_101243172 313
115 3300025901 Ga0207688_10035621 Ga0207688_100356212 313
116 3300025925 Ga0207650_10267418 Ga0207650_102674182 313
117 3300025933 Ga0207706_10029015 Ga0207706_100290153 313
118 3300025945 Ga0207679_10082748 Ga0207679_100827481 313
119 3300025949 Ga0207667_10069346 Ga0207667_100693464 313
120 3300026067 Ga0207678_10024463 Ga0207678_100244632 313
121 3300026078 Ga0207702_10147255 Ga0207702_101472553 313
122 3300026121 Ga0207683_10028640 Ga0207683_100286404 313
123 3300027866 Ga0209813_10009392 Ga0209813_100093921 313
124 3300048911 Ga0496108_0017621 Ga0496108_0017621_2502_3638 313
125 3300048912 Ga0496109_0124445 Ga0496109_0124445_1055_2191 313
126 3300048915 Ga0496112_0085763 Ga0496112_0085763_1201_2337 313
127 3300048928 Ga0496125_0122488 Ga0496125_0122488_558_1694 313
128 3300050491 nmdc:mga00v17_66987_c1 nmdc:mga00v17_66987_c1_126_1262 313
129 3300050493 nmdc:mga0k408_3070_c1 nmdc:mga0k408_3070_c1_3307_4443 313
130 3300050495 nmdc:mga04h51_5240_c1 nmdc:mga04h51_5240_c1_1269_2405 313
131 3300050496 nmdc:mga07m45_8522_c1 nmdc:mga07m45_8522_c1_894_2030 313
132 3300050512 nmdc:mga0n895_150287_c1 nmdc:mga0n895_150287_c1_838_1974 313
133 3300005842 Ga0068858_100119126 Ga0068858_1001191263 314
134 3300006881 Ga0068865_100024210 Ga0068865_1000242103 314
135 3300009098 Ga0105245_10248838 Ga0105245_102488382 314
136 3300009551 Ga0105238_10012485 Ga0105238_100124854 314
137 3300013306 Ga0163162_10006254 Ga0163162_1000625418 314
138 3300017792 Ga0163161_10018218 Ga0163161_100182186 314
139 3300025935 Ga0207709_10187831 Ga0207709_101878311 314
140 3300025938 Ga0207704_10007211 Ga0207704_100072116 314
141 3300026035 Ga0207703_10070342 Ga0207703_100703423 314
142 3300026118 Ga0207675_100030122 Ga0207675_1000301225 314
143 3300028380 Ga0268265_10044534 Ga0268265_100445343 314
144 3300048927 Ga0496124_0016923 Ga0496124_0016923_4768_5928 314
145 3300048928 Ga0496125_0021935 Ga0496125_0021935_1282_2442 314
146 3300046528 Ga0495642_0016277 Ga0495642_0016277_1548_2684 315
147 3300025941 Ga0207711_10319764 Ga0207711_103197641 316
148 3300031852 Ga0307410_10168960 Ga0307410_101689602 316
149 3300046692 Ga0495671_0018090 Ga0495671_0018090_273_1394 316
150 3300049577 Ga0501041_0136074 Ga0501041_0136074_452_1504 316
151 3300003215 JGI25153J46596_10000645 JGI25153J46596_100006455 317
152 3300009545 Ga0105237_10063501 Ga0105237_100635014 317
153 3300025297 Ga0209758_1002205 Ga0209758_10022055 317
154 3300035724 Ga0373933_0000202 Ga0373933_0000202_28874_30016 317
155 3300005356 Ga0070674_100147148 Ga0070674_1001471481 318
156 3300005434 Ga0070709_10056012 Ga0070709_100560122 318
157 3300005436 Ga0070713_100006321 Ga0070713_1000063212 318
158 3300005439 Ga0070711_100027000 Ga0070711_1000270004 318
159 3300005458 Ga0070681_10040314 Ga0070681_100403142 318
160 3300013104 Ga0157370_10011827 Ga0157370_100118278 318
161 3300025906 Ga0207699_10124118 Ga0207699_101241182 318
162 3300025915 Ga0207693_10003223 Ga0207693_100032232 318
163 3300025916 Ga0207663_10042314 Ga0207663_100423142 318
164 3300039093 Ga0400489_33869 Ga0400489_33869_575_1696 318
165 3300048929 Ga0496126_0190719 Ga0496126_0190719_69_1163 318
166 3300046526 Ga0495666_0030878 Ga0495666_0030878_885_2003 319
167 3300048906 Ga0496103_0106903 Ga0496103_0106903_314_1501 319
168 3300048907 Ga0496104_0003761 Ga0496104_0003761_6944_8131 319
169 3300048909 Ga0496106_0015871 Ga0496106_0015871_1003_2190 319
170 3300048913 Ga0496110_0159976 Ga0496110_0159976_332_1519 319
171 3300048918 Ga0496115_0049271 Ga0496115_0049271_322_1509 319
172 3300003752 Ga0055539_1006587 Ga0055539_10065872 320
173 3300013104 Ga0157370_10052376 Ga0157370_100523763 320
174 3300025253 Ga0209677_101165 Ga0209677_1011659 320
175 3300026067 Ga0207678_10083637 Ga0207678_100836373 320
176 3300046501 Ga0495607_0022174 Ga0495607_0022174_459_1592 320
177 3300046530 Ga0495654_0053002 Ga0495654_0053002_121_1254 320
178 3300048923 Ga0496120_0016663 Ga0496120_0016663_1593_2726 320
179 3300048928 Ga0496125_0006386 Ga0496125_0006386_5623_6756 320
180 3300053089 Ga0500581_018442 Ga0500581_018442_515_1648 320
181 3300053104 Ga0500556_0000030 Ga0500556_0000030_90691_91824 320
182 3300053131 Ga0500652_003613 Ga0500652_003613_1268_2401 320
183 3300053134 Ga0500658_0092215 Ga0500658_0092215_36_1169 320
184 3300053142 Ga0500577_0020328 Ga0500577_0020328_870_2003 320
185 3300053156 Ga0500622_0001022 Ga0500622_0001022_15561_16694 320
186 3300053158 Ga0500627_0094752 Ga0500627_0094752_88_1221 320
187 3300048916 Ga0496113_0376308 Ga0496113_0376308_13_1119 321
188 3300053085 Ga0495619_0087869 Ga0495619_0087869_284_1378 321
189 3300053153 Ga0500616_0012199 Ga0500616_0012199_3643_4770 321
190 iso_pu_bacteria 2935785616 2935792085 321
191 iso_pu_bacteria 2935793552 2935798074 321
192 3300013297 Ga0157378_10001958 Ga0157378_1000195816 322
193 3300031616 Ga0307508_10000058 Ga0307508_1000005818 324
194 3300035692 Ga0373935_0071435 Ga0373935_0071435_243_1292 324
195 3300035695 Ga0373927_0063358 Ga0373927_0063358_1205_2254 324
196 3300037068 Ga0373925_0105324 Ga0373925_0105324_950_1999 324
197 3300046557 Ga0495622_0014798 Ga0495622_0014798_1838_2887 324
198 3300048918 Ga0496115_0196083 Ga0496115_0196083_138_1250 324
199 3300049568 Ga0501031_0017282 Ga0501031_0017282_3485_4624 324
200 3300049572 Ga0501036_0070697 Ga0501036_0070697_291_1430 324
201 3300049574 Ga0501038_0061540 Ga0501038_0061540_1051_2190 324
202 3300049574 Ga0501038_0070972 Ga0501038_0070972_1155_2309 324
203 3300049575 Ga0501039_0029417 Ga0501039_0029417_966_2105 324
204 3300049576 Ga0501040_0053192 Ga0501040_0053192_67_1206 324
205 3300049578 Ga0501042_0023178 Ga0501042_0023178_239_1378 324
206 3300049580 Ga0501046_0039428 Ga0501046_0039428_1675_2814 324
207 3300049582 Ga0501048_0038256 Ga0501048_0038256_1825_2964 324
208 3300049587 Ga0501071_0025822 Ga0501071_0025822_2915_4054 324
209 3300049588 Ga0501072_0087873 Ga0501072_0087873_492_1631 324
210 3300049590 Ga0501074_0022115 Ga0501074_0022115_537_1676 324
211 3300049591 Ga0501075_0051757 Ga0501075_0051757_1532_2671 324
212 3300049742 Ga0501080_0093866 Ga0501080_0093866_1048_2187 324
213 3300049743 Ga0501081_0024556 Ga0501081_0024556_462_1601 324
214 3300053080 Ga0500635_0010324 Ga0500635_0010324_809_1858 324
215 3300053094 Ga0500566_0110585 Ga0500566_0110585_128_1177 324
216 3300053178 Ga0500637_0055030 Ga0500637_0055030_248_1297 324
217 3300054114 Ga0501084_0026608 Ga0501084_0026608_2723_3862 324
218 3300060353 Ga0501082_0062434 Ga0501082_0062434_372_1511 324
219 3300061734 Ga0530510_0216087 Ga0530510_0216087_171_1310 324
220 3300005937 Ga0081455_10000877 Ga0081455_1000087716 325
221 3300006852 Ga0075433_10363190 Ga0075433_103631901 325
222 3300006871 Ga0075434_100003258 Ga0075434_10000325811 325
223 3300028786 Ga0307517_10001951 Ga0307517_1000195122 325
224 3300028794 Ga0307515_10092425 Ga0307515_100924253 325
225 3300031507 Ga0307509_10178491 Ga0307509_101784911 325
226 3300035171 Ga0373946_0021979 Ga0373946_0021979_1138_2274 325
227 3300035725 Ga0373947_0096428 Ga0373947_0096428_706_1758 325
228 3300048913 Ga0496110_0036244 Ga0496110_0036244_780_1916 325
229 3300049569 Ga0501032_0072302 Ga0501032_0072302_488_1573 325
230 3300049570 Ga0501033_0096577 Ga0501033_0096577_932_2017 325
231 3300049572 Ga0501036_0023203 Ga0501036_0023203_1545_2630 325
232 3300049573 Ga0501037_0060251 Ga0501037_0060251_369_1454 325
233 3300049574 Ga0501038_0005164 Ga0501038_0005164_347_1432 325
234 3300049575 Ga0501039_0038083 Ga0501039_0038083_1829_2914 325
235 3300049581 Ga0501047_0136472 Ga0501047_0136472_553_1638 325
236 3300049742 Ga0501080_0084953 Ga0501080_0084953_1596_2681 325
237 3300049823 Ga0501044_0033827 Ga0501044_0033827_469_1554 325
238 3300050512 nmdc:mga0n895_5025_c1 nmdc:mga0n895_5025_c1_4679_5791 325
239 3300009101 Ga0105247_10006815 Ga0105247_100068157 326
240 3300025900 Ga0207710_10019392 Ga0207710_100193924 326
241 3300028556 Ga0265337_1006298 Ga0265337_10062984 326
242 3300028558 Ga0265326_10010919 Ga0265326_100109193 326
243 3300028563 Ga0265319_1000642 Ga0265319_10006428 326
244 3300028573 Ga0265334_10002301 Ga0265334_100023012 326
245 3300028577 Ga0265318_10005252 Ga0265318_100052524 326
246 3300028653 Ga0265323_10000169 Ga0265323_1000016917 326
247 3300028654 Ga0265322_10006247 Ga0265322_100062473 326
248 3300028666 Ga0265336_10000663 Ga0265336_1000066315 326
249 3300028800 Ga0265338_10000013 Ga0265338_1000001363 326
250 3300029957 Ga0265324_10001030 Ga0265324_1000103015 326
251 iso_pu_bacteria 2906610324 2906613347 326
252 3300007265 Ga0099794_10010689 Ga0099794_100106891 327
253 3300035692 Ga0373935_0060761 Ga0373935_0060761_1180_2238 327
254 3300046559 Ga0495667_0122795 Ga0495667_0122795_17_1102 327
255 3300046809 Ga0495600_0041920 Ga0495600_0041920_1011_2096 327
256 3300049581 Ga0501047_0009485 Ga0501047_0009485_6542_7624 327
257 3300049582 Ga0501048_0101465 Ga0501048_0101465_11_1069 327
258 3300049742 Ga0501080_0212966 Ga0501080_0212966_460_1542 327
259 3300049822 Ga0501035_0094684 Ga0501035_0094684_581_1639 327
260 3300049823 Ga0501044_0158828 Ga0501044_0158828_795_1877 327
261 3300005435 Ga0070714_100125085 Ga0070714_1001250853 328
262 3300009101 Ga0105247_10005404 Ga0105247_100054045 328
263 3300025908 Ga0207643_10138238 Ga0207643_101382381 328
264 3300026023 Ga0207677_10026700 Ga0207677_100267001 328
265 3300031241 Ga0265325_10038067 Ga0265325_100380673 328
266 3300049571 Ga0501034_0058850 Ga0501034_0058850_275_1408 328
267 3300049581 Ga0501047_0239434 Ga0501047_0239434_467_1600 328
268 3300005339 Ga0070660_100152300 Ga0070660_1001523002 329
269 3300005440 Ga0070705_100157858 Ga0070705_1001578582 329
270 3300005618 Ga0068864_100102363 Ga0068864_1001023632 329
271 3300009545 Ga0105237_10115079 Ga0105237_101150791 329
272 3300009553 Ga0105249_10113853 Ga0105249_101138532 329
273 3300010375 Ga0105239_10121877 Ga0105239_101218773 329
274 3300011119 Ga0105246_10128700 Ga0105246_101287002 329
275 3300013296 Ga0157374_10169549 Ga0157374_101695492 329
276 3300013306 Ga0163162_10104803 Ga0163162_101048032 329
277 3300013308 Ga0157375_10131427 Ga0157375_101314272 329
278 3300014325 Ga0163163_10055204 Ga0163163_100552043 329
279 3300014968 Ga0157379_10013168 Ga0157379_100131682 329
280 3300028381 Ga0268264_10166218 Ga0268264_101662182 329
281 3300035695 Ga0373927_0013969 Ga0373927_0013969_1078_2172 329
282 3300048905 Ga0496102_0014005 Ga0496102_0014005_5522_6655 329
283 3300048906 Ga0496103_0091266 Ga0496103_0091266_479_1612 329
284 3300048907 Ga0496104_0018351 Ga0496104_0018351_3876_5009 329
285 3300048908 Ga0496105_0079001 Ga0496105_0079001_988_2121 329
286 3300048909 Ga0496106_0007382 Ga0496106_0007382_2073_3206 329
287 3300048910 Ga0496107_0162898 Ga0496107_0162898_182_1315 329
288 3300048912 Ga0496109_0043189 Ga0496109_0043189_2222_3355 329
289 3300048913 Ga0496110_0072731 Ga0496110_0072731_217_1350 329
290 3300048915 Ga0496112_0059616 Ga0496112_0059616_2359_3492 329
291 3300048916 Ga0496113_0062644 Ga0496113_0062644_431_1564 329
292 3300053079 Ga0500610_0107331 Ga0500610_0107331_180_1316 329
293 3300005339 Ga0070660_100011425 Ga0070660_1000114256 330
294 3300025919 Ga0207657_10042217 Ga0207657_100422173 330
295 3300031711 Ga0265314_10015665 Ga0265314_100156654 330
296 3300036459 Ga0372808_000705 Ga0372808_000705_1699_2844 330
297 3300037068 Ga0373925_0292698 Ga0373925_0292698_205_1299 330
298 3300047469 Ga0495673_0014114 Ga0495673_0014114_161_1297 330
299 3300048915 Ga0496112_0069376 Ga0496112_0069376_1021_2115 330
300 3300049743 Ga0501081_0089569 Ga0501081_0089569_10_1131 330
301 3300005336 Ga0070680_100048253 Ga0070680_1000482532 331
302 3300005530 Ga0070679_100083526 Ga0070679_1000835261 331
303 3300005719 Ga0068861_100099229 Ga0068861_1000992292 331
304 3300009093 Ga0105240_10004412 Ga0105240_100044122 331
305 3300009098 Ga0105245_10084344 Ga0105245_100843444 331
306 3300009174 Ga0105241_10002293 Ga0105241_1000229310 331
307 3300025911 Ga0207654_10016479 Ga0207654_100164794 331
308 3300025913 Ga0207695_10000029 Ga0207695_10000029481 331
309 3300025914 Ga0207671_10002337 Ga0207671_100023376 331
310 3300025921 Ga0207652_10181534 Ga0207652_101815342 331
311 3300025927 Ga0207687_10091861 Ga0207687_100918613 331
312 3300026118 Ga0207675_100106034 Ga0207675_1001060343 331
313 3300049570 Ga0501033_0006414 Ga0501033_0006414_5490_6626 331
314 3300049571 Ga0501034_0002893 Ga0501034_0002893_17151_18287 331
315 3300049572 Ga0501036_0004196 Ga0501036_0004196_7018_8154 331
316 3300049573 Ga0501037_0045570 Ga0501037_0045570_2069_3205 331
317 3300049574 Ga0501038_0012326 Ga0501038_0012326_1593_2729 331
318 3300049575 Ga0501039_0030447 Ga0501039_0030447_153_1289 331
319 3300049579 Ga0501043_0024995 Ga0501043_0024995_3294_4430 331
320 3300049581 Ga0501047_0024519 Ga0501047_0024519_1267_2403 331
321 3300049582 Ga0501048_0007164 Ga0501048_0007164_2595_3731 331
322 3300049585 Ga0501069_0001866 Ga0501069_0001866_6560_7696 331
323 3300049589 Ga0501073_0010927 Ga0501073_0010927_3016_4152 331
324 3300049590 Ga0501074_0013443 Ga0501074_0013443_4693_5829 331
325 3300049742 Ga0501080_0026563 Ga0501080_0026563_2687_3823 331
326 3300049744 Ga0501083_0159484 Ga0501083_0159484_148_1284 331
327 3300049822 Ga0501035_0002087 Ga0501035_0002087_16003_17139 331
328 3300049823 Ga0501044_0036679 Ga0501044_0036679_549_1685 331
329 3300006186 Ga0075369_10013177 Ga0075369_100131773 332
330 3300009174 Ga0105241_10040310 Ga0105241_100403102 333
331 3300013296 Ga0157374_10007939 Ga0157374_100079398 333
332 3300028381 Ga0268264_10055482 Ga0268264_100554823 333
333 3300044684 Ga0466966_0000229 Ga0466966_0000229_11898_13040 333
334 3300044693 Ga0466961_0000029 Ga0466961_0000029_35008_36150 333
335 3300045049 Ga0466959_0000967 Ga0466959_0000967_14896_16038 333
336 3300049570 Ga0501033_0171302 Ga0501033_0171302_245_1348 333
337 3300049823 Ga0501044_0079233 Ga0501044_0079233_1156_2259 333
338 iso_pu_bacteria 8006984368 8006989057 333
339 3300006844 Ga0075428_100030217 Ga0075428_1000302174 334
340 3300006847 Ga0075431_100252258 Ga0075431_1002522582 334
341 3300041408 Ga0439453_0007254 Ga0439453_0007254_84_1202 334
342 3300042436 Ga0439435_0015446 Ga0439435_0015446_669_1787 334
343 3300048929 Ga0496126_0192436 Ga0496126_0192436_436_1557 334
344 3300049568 Ga0501031_0104102 Ga0501031_0104102_41_1174 334
345 3300049572 Ga0501036_0095058 Ga0501036_0095058_997_2130 334
346 3300049576 Ga0501040_0020607 Ga0501040_0020607_132_1265 334
347 3300049578 Ga0501042_0088730 Ga0501042_0088730_473_1606 334
348 3300049588 Ga0501072_0016230 Ga0501072_0016230_3427_4560 334
349 3300049592 Ga0501076_0064500 Ga0501076_0064500_1525_2658 334
350 3300050510 nmdc:mga06r32_48360_c2 nmdc:mga06r32_48360_c2_1476_2558 334
351 3300053083 Ga0495655_0000469 Ga0495655_0000469_1664_2797 334
352 3300054114 Ga0501084_0083485 Ga0501084_0083485_835_1968 334
353 3300061734 Ga0530510_0083480 Ga0530510_0083480_870_2003 334
354 3300005340 Ga0070689_100018682 Ga0070689_1000186822 335
355 3300005367 Ga0070667_100110990 Ga0070667_1001109902 335
356 3300005459 Ga0068867_100071933 Ga0068867_1000719332 335
357 3300005842 Ga0068858_100140259 Ga0068858_1001402592 335
358 3300009101 Ga0105247_10009887 Ga0105247_100098878 335
359 3300009545 Ga0105237_10000892 Ga0105237_1000089239 335
360 3300013297 Ga0157378_10027506 Ga0157378_100275064 335
361 3300013308 Ga0157375_10001815 Ga0157375_100018156 335
362 3300014968 Ga0157379_10121772 Ga0157379_101217721 335
363 3300014969 Ga0157376_10012349 Ga0157376_100123495 335
364 3300025916 Ga0207663_10051661 Ga0207663_100516612 335
365 3300025941 Ga0207711_10041075 Ga0207711_100410752 335
366 3300026089 Ga0207648_10052487 Ga0207648_100524872 335
367 3300028379 Ga0268266_10060595 Ga0268266_100605951 335
368 3300048904 Ga0496101_0110399 Ga0496101_0110399_110_1243 335
369 3300048905 Ga0496102_0078941 Ga0496102_0078941_365_1498 335
370 3300048907 Ga0496104_0010970 Ga0496104_0010970_1404_2537 335
371 3300048908 Ga0496105_0014746 Ga0496105_0014746_566_1699 335
372 3300048909 Ga0496106_0000863 Ga0496106_0000863_5302_6435 335
373 3300048910 Ga0496107_0000335 Ga0496107_0000335_17363_18496 335
374 3300048917 Ga0496114_0001714 Ga0496114_0001714_11152_12285 335
375 3300048918 Ga0496115_0019333 Ga0496115_0019333_3992_5125 335
376 3300005331 Ga0070670_100001907 Ga0070670_10000190715 336
377 3300005336 Ga0070680_100054060 Ga0070680_1000540603 336
378 3300005337 Ga0070682_100002059 Ga0070682_1000020592 336
379 3300005338 Ga0068868_100004146 Ga0068868_1000041468 336
380 3300005339 Ga0070660_100001946 Ga0070660_10000194610 336
381 3300005340 Ga0070689_100002684 Ga0070689_10000268411 336
382 3300005341 Ga0070691_10002422 Ga0070691_100024225 336
383 3300005344 Ga0070661_100001146 Ga0070661_1000011463 336
384 3300005345 Ga0070692_10000134 Ga0070692_100001347 336
385 3300005353 Ga0070669_100000574 Ga0070669_10000057419 336
386 3300005355 Ga0070671_100072280 Ga0070671_1000722803 336
387 3300005356 Ga0070674_100019523 Ga0070674_1000195232 336
388 3300005364 Ga0070673_100002610 Ga0070673_10000261010 336
389 3300005365 Ga0070688_100000238 Ga0070688_10000023810 336
390 3300005366 Ga0070659_100008590 Ga0070659_1000085906 336
391 3300005434 Ga0070709_10000553 Ga0070709_1000055324 336
392 3300005436 Ga0070713_100051675 Ga0070713_1000516753 336
393 3300005439 Ga0070711_100001115 Ga0070711_10000111510 336
394 3300005441 Ga0070700_100000601 Ga0070700_10000060115 336
395 3300005455 Ga0070663_100046018 Ga0070663_1000460182 336
396 3300005456 Ga0070678_100000163 Ga0070678_10000016311 336
397 3300005458 Ga0070681_10248182 Ga0070681_102481822 336
398 3300005539 Ga0068853_100001401 Ga0068853_10000140111 336
399 3300005543 Ga0070672_100017891 Ga0070672_1000178912 336
400 3300005544 Ga0070686_100150714 Ga0070686_1001507141 336
401 3300005545 Ga0070695_100005052 Ga0070695_1000050523 336
402 3300005546 Ga0070696_100000980 Ga0070696_10000098011 336
403 3300005547 Ga0070693_100000352 Ga0070693_10000035224 336
404 3300005548 Ga0070665_100066528 Ga0070665_1000665283 336
405 3300005549 Ga0070704_100005431 Ga0070704_1000054311 336
406 3300005563 Ga0068855_100015779 Ga0068855_1000157792 336
407 3300005564 Ga0070664_100017767 Ga0070664_1000177676 336
408 3300005577 Ga0068857_100021342 Ga0068857_1000213423 336
409 3300005578 Ga0068854_100001035 Ga0068854_1000010352 336
410 3300005615 Ga0070702_100000144 Ga0070702_1000001448 336
411 3300005616 Ga0068852_100159186 Ga0068852_1001591862 336
412 3300005617 Ga0068859_100044410 Ga0068859_1000444104 336
413 3300005718 Ga0068866_10001363 Ga0068866_100013636 336
414 3300005841 Ga0068863_100038781 Ga0068863_1000387814 336
415 3300005842 Ga0068858_100003338 Ga0068858_1000033382 336
416 3300005844 Ga0068862_100001405 Ga0068862_10000140510 336
417 3300006048 Ga0075363_100110511 Ga0075363_1001105111 336
418 3300006173 Ga0070716_100002822 Ga0070716_1000028223 336
419 3300006175 Ga0070712_100000650 Ga0070712_10000065021 336
420 3300006931 Ga0097620_100044410 Ga0097620_1000444104 336
421 3300009093 Ga0105240_10060004 Ga0105240_100600046 336
422 3300009148 Ga0105243_10002082 Ga0105243_1000208210 336
423 3300009176 Ga0105242_10015101 Ga0105242_100151018 336
424 3300009545 Ga0105237_10010596 Ga0105237_1001059611 336
425 3300009553 Ga0105249_10056401 Ga0105249_100564013 336
426 3300011119 Ga0105246_10000623 Ga0105246_1000062311 336
427 3300013102 Ga0157371_10069270 Ga0157371_100692703 336
428 3300013104 Ga0157370_10073433 Ga0157370_100734333 336
429 3300013306 Ga0163162_10008329 Ga0163162_1000832910 336
430 3300013308 Ga0157375_10034100 Ga0157375_100341006 336
431 3300025711 Ga0207696_1027246 Ga0207696_10272462 336
432 3300025899 Ga0207642_10002423 Ga0207642_100024233 336
433 3300025900 Ga0207710_10001768 Ga0207710_100017683 336
434 3300025901 Ga0207688_10004014 Ga0207688_1000401410 336
435 3300025906 Ga0207699_10006211 Ga0207699_100062116 336
436 3300025909 Ga0207705_10161688 Ga0207705_101616882 336
437 3300025914 Ga0207671_10017059 Ga0207671_100170593 336
438 3300025915 Ga0207693_10000328 Ga0207693_1000032811 336
439 3300025916 Ga0207663_10001926 Ga0207663_100019269 336
440 3300025917 Ga0207660_10143180 Ga0207660_101431802 336
441 3300025918 Ga0207662_10001133 Ga0207662_100011336 336
442 3300025919 Ga0207657_10000664 Ga0207657_1000066429 336
443 3300025920 Ga0207649_10016920 Ga0207649_100169203 336
444 3300025921 Ga0207652_10091229 Ga0207652_100912292 336
445 3300025923 Ga0207681_10024471 Ga0207681_100244713 336
446 3300025925 Ga0207650_10005610 Ga0207650_100056108 336
447 3300025928 Ga0207700_10066396 Ga0207700_100663963 336
448 3300025931 Ga0207644_10133956 Ga0207644_101339562 336
449 3300025932 Ga0207690_10009470 Ga0207690_100094706 336
450 3300025933 Ga0207706_10000247 Ga0207706_1000024728 336
451 3300025934 Ga0207686_10025507 Ga0207686_100255073 336
452 3300025936 Ga0207670_10013061 Ga0207670_100130614 336
453 3300025937 Ga0207669_10001810 Ga0207669_100018105 336
454 3300025938 Ga0207704_10094641 Ga0207704_100946412 336
455 3300025939 Ga0207665_10000262 Ga0207665_1000026224 336
456 3300025940 Ga0207691_10015768 Ga0207691_100157682 336
457 3300025941 Ga0207711_10007899 Ga0207711_100078993 336
458 3300025945 Ga0207679_10007266 Ga0207679_100072666 336
459 3300025949 Ga0207667_10192844 Ga0207667_101928442 336
460 3300025961 Ga0207712_10006105 Ga0207712_100061056 336
461 3300025972 Ga0207668_10067366 Ga0207668_100673662 336
462 3300025981 Ga0207640_10065360 Ga0207640_100653603 336
463 3300025986 Ga0207658_10013439 Ga0207658_100134393 336
464 3300026041 Ga0207639_10031931 Ga0207639_100319313 336
465 3300026067 Ga0207678_10000247 Ga0207678_1000024729 336
466 3300026075 Ga0207708_10001039 Ga0207708_1000103916 336
467 3300026088 Ga0207641_10097710 Ga0207641_100977102 336
468 3300026116 Ga0207674_10038386 Ga0207674_100383863 336
469 3300026118 Ga0207675_100000047 Ga0207675_10000004766 336
470 3300026121 Ga0207683_10000542 Ga0207683_1000054210 336
471 3300026142 Ga0207698_10005599 Ga0207698_100055998 336
472 3300028379 Ga0268266_10087880 Ga0268266_100878803 336
473 3300028380 Ga0268265_10016031 Ga0268265_100160316 336
474 3300028381 Ga0268264_10065128 Ga0268264_100651282 336
475 3300046536 Ga0495587_0110168 Ga0495587_0110168_102_1229 336
476 3300047317 Ga0495604_0157005 Ga0495604_0157005_455_1582 336
477 3300048903 Ga0496100_0038440 Ga0496100_0038440_1312_2445 336
478 3300048904 Ga0496101_0073266 Ga0496101_0073266_137_1270 336
479 3300048906 Ga0496103_0008856 Ga0496103_0008856_1216_2349 336
480 3300048907 Ga0496104_0018250 Ga0496104_0018250_4051_5184 336
481 3300048908 Ga0496105_0023234 Ga0496105_0023234_464_1597 336
482 3300048912 Ga0496109_0060277 Ga0496109_0060277_265_1398 336
483 3300048917 Ga0496114_0040299 Ga0496114_0040299_2597_3730 336
484 3300050491 nmdc:mga00v17_2560_c1 nmdc:mga00v17_2560_c1_60_1175 336
485 3300050492 nmdc:mga0yw44_12467_c1 nmdc:mga0yw44_12467_c1_52_1167 336
486 3300050492 nmdc:mga0yw44_133331_c1 nmdc:mga0yw44_133331_c1_299_1384 336
487 3300050493 nmdc:mga0k408_14266_c1 nmdc:mga0k408_14266_c1_2157_3242 336
488 3300053119 Ga0500595_023560 Ga0500595_023560_758_1843 336
489 3300010375 Ga0105239_10096608 Ga0105239_100966083 337
490 3300035172 Ga0373955_0033569 Ga0373955_0033569_34_1167 337
491 3300053085 Ga0495619_0090762 Ga0495619_0090762_543_1670 337
492 3300053119 Ga0500595_000749 Ga0500595_000749_12036_13157 337
493 3300048925 Ga0496122_0030293 Ga0496122_0030293_2808_3905 338
494 3300048929 Ga0496126_0023524 Ga0496126_0023524_2241_3338 338
495 3300049568 Ga0501031_0001866 Ga0501031_0001866_3243_4361 338
496 3300049573 Ga0501037_0000595 Ga0501037_0000595_9971_11089 338
497 3300049574 Ga0501038_0022542 Ga0501038_0022542_464_1582 338
498 3300049575 Ga0501039_0015580 Ga0501039_0015580_2475_3593 338
499 3300049578 Ga0501042_0002901 Ga0501042_0002901_5572_6690 338
500 3300049579 Ga0501043_0237019 Ga0501043_0237019_39_1175 338
501 3300049580 Ga0501046_0002131 Ga0501046_0002131_6276_7394 338
502 3300049589 Ga0501073_0071338 Ga0501073_0071338_1199_2344 338
503 3300049742 Ga0501080_0037947 Ga0501080_0037947_1393_2529 338
504 3300049822 Ga0501035_0000838 Ga0501035_0000838_8288_9406 338
505 3300049822 Ga0501035_0352824 Ga0501035_0352824_11_1156 338
506 3300053177 Ga0500636_0072414 Ga0500636_0072414_450_1571 338
507 3300005343 Ga0070687_100049505 Ga0070687_1000495052 339
508 3300046454 Ga0495592_0111117 Ga0495592_0111117_702_1796 339
509 3300046459 Ga0495629_0014747 Ga0495629_0014747_3497_4591 339
510 3300046459 Ga0495629_0046329 Ga0495629_0046329_48_1142 339
511 3300046462 Ga0495651_0133289 Ga0495651_0133289_592_1686 339
512 3300046511 Ga0495608_0212528 Ga0495608_0212528_16_1110 339
513 3300046514 Ga0495618_0085216 Ga0495618_0085216_53_1147 339
514 3300046516 Ga0495628_0026293 Ga0495628_0026293_715_1809 339
515 3300046529 Ga0495652_0093818 Ga0495652_0093818_634_1728 339
516 3300046533 Ga0495640_0150015 Ga0495640_0150015_327_1421 339
517 3300046536 Ga0495587_0039481 Ga0495587_0039481_1099_2193 339
518 3300046543 Ga0495645_0020172 Ga0495645_0020172_3213_4307 339
519 3300046559 Ga0495667_0050600 Ga0495667_0050600_1038_2132 339
520 3300046663 Ga0495635_0166175 Ga0495635_0166175_46_1140 339
521 3300046675 Ga0495657_0121520 Ga0495657_0121520_100_1194 339
522 3300046678 Ga0495599_0220562 Ga0495599_0220562_49_1143 339
523 3300046679 Ga0495623_0025315 Ga0495623_0025315_1817_2911 339
524 3300047319 Ga0495674_0030253 Ga0495674_0030253_1250_2344 339
525 3300047471 Ga0495684_0030860 Ga0495684_0030860_2774_3868 339
526 3300048088 Ga0495602_0087820 Ga0495602_0087820_1158_2252 339
527 3300048906 Ga0496103_0137325 Ga0496103_0137325_405_1532 339
528 3300049569 Ga0501032_0019190 Ga0501032_0019190_3227_4363 339
529 3300049570 Ga0501033_0012999 Ga0501033_0012999_4334_5470 339
530 3300049571 Ga0501034_0015498 Ga0501034_0015498_2362_3498 339
531 3300049572 Ga0501036_0031563 Ga0501036_0031563_40_1176 339
532 3300049573 Ga0501037_0006574 Ga0501037_0006574_3428_4564 339
533 3300049574 Ga0501038_0001751 Ga0501038_0001751_17160_18296 339
534 3300049575 Ga0501039_0004324 Ga0501039_0004324_5000_6136 339
535 3300049579 Ga0501043_0034734 Ga0501043_0034734_1951_3087 339
536 3300049580 Ga0501046_0042875 Ga0501046_0042875_449_1585 339
537 3300049582 Ga0501048_0006795 Ga0501048_0006795_6326_7462 339
538 3300049583 Ga0501067_0012216 Ga0501067_0012216_3149_4285 339
539 3300049585 Ga0501069_0001439 Ga0501069_0001439_2119_3255 339
540 3300049588 Ga0501072_0038118 Ga0501072_0038118_180_1316 339
541 3300049589 Ga0501073_0160688 Ga0501073_0160688_275_1411 339
542 3300049590 Ga0501074_0001676 Ga0501074_0001676_8936_10072 339
543 3300049742 Ga0501080_0245428 Ga0501080_0245428_448_1584 339
544 3300049744 Ga0501083_0042685 Ga0501083_0042685_470_1606 339
545 3300049822 Ga0501035_0025165 Ga0501035_0025165_760_1896 339
546 3300049823 Ga0501044_0054046 Ga0501044_0054046_2427_3563 339
547 3300005347 Ga0070668_100004348 Ga0070668_1000043485 340
548 3300005354 Ga0070675_100016690 Ga0070675_1000166906 340
549 3300005367 Ga0070667_100005240 Ga0070667_10000524011 340
550 3300005435 Ga0070714_100018688 Ga0070714_1000186886 340
551 3300005438 Ga0070701_10000806 Ga0070701_1000080611 340
552 3300005530 Ga0070679_100017687 Ga0070679_1000176873 340
553 3300005536 Ga0070697_100001048 Ga0070697_10000104810 340
554 3300006175 Ga0070712_100049647 Ga0070712_1000496472 340
555 3300006186 Ga0075369_10006864 Ga0075369_100068642 340
556 3300006844 Ga0075428_100020141 Ga0075428_1000201415 340
557 3300006846 Ga0075430_100098093 Ga0075430_1000980932 340
558 3300006847 Ga0075431_100015972 Ga0075431_1000159723 340
559 3300006852 Ga0075433_10009947 Ga0075433_100099473 340
560 3300006871 Ga0075434_100053572 Ga0075434_1000535722 340
561 3300006871 Ga0075434_100176524 Ga0075434_1001765242 340
562 3300006880 Ga0075429_100029516 Ga0075429_1000295165 340
563 3300006881 Ga0068865_100000403 Ga0068865_10000040327 340
564 3300006914 Ga0075436_100007723 Ga0075436_1000077239 340
565 3300007076 Ga0075435_100209742 Ga0075435_1002097422 340
566 3300009098 Ga0105245_10001576 Ga0105245_1000157616 340
567 3300009147 Ga0114129_10211876 Ga0114129_102118762 340
568 3300009177 Ga0105248_10002287 Ga0105248_1000228717 340
569 3300013105 Ga0157369_10030988 Ga0157369_100309883 340
570 3300013297 Ga0157378_10001216 Ga0157378_1000121628 340
571 3300013307 Ga0157372_10002164 Ga0157372_1000216418 340
572 3300014745 Ga0157377_10047803 Ga0157377_100478033 340
573 3300014968 Ga0157379_10003521 Ga0157379_100035216 340
574 3300014969 Ga0157376_10009118 Ga0157376_100091186 340
575 3300025927 Ga0207687_10017153 Ga0207687_100171535 340
576 3300025929 Ga0207664_10115378 Ga0207664_101153783 340
577 3300031235 Ga0265330_10017984 Ga0265330_100179843 340
578 3300031247 Ga0265340_10001233 Ga0265340_100012338 340
579 3300031249 Ga0265339_10001813 Ga0265339_1000181312 340
580 3300031595 Ga0265313_10000356 Ga0265313_1000035614 340
581 3300031712 Ga0265342_10028933 Ga0265342_100289333 340
582 3300035695 Ga0373927_0014897 Ga0373927_0014897_1204_2331 340
583 3300035725 Ga0373947_0023677 Ga0373947_0023677_2223_3350 340
584 3300037418 Ga0395900_0048448 Ga0395900_0048448_2948_4081 340
585 3300037471 Ga0395905_0004814 Ga0395905_0004814_5002_6135 340
586 3300038443 Ga0395901_0042929 Ga0395901_0042929_2050_3183 340
587 3300046459 Ga0495629_0000401 Ga0495629_0000401_11142_12269 340
588 3300046475 Ga0495639_0035061 Ga0495639_0035061_816_1943 340
589 3300046499 Ga0495594_0011198 Ga0495594_0011198_115_1242 340
590 3300046683 Ga0495658_0000265 Ga0495658_0000265_18524_19651 340
591 3300046689 Ga0495613_0176846 Ga0495613_0176846_206_1333 340
592 3300047322 Ga0495680_0030613 Ga0495680_0030613_2141_3268 340
593 3300047673 Ga0495593_0051458 Ga0495593_0051458_225_1352 340
594 3300048907 Ga0496104_0377465 Ga0496104_0377465_110_1237 340
595 3300050510 nmdc:mga06r32_91075_c1 nmdc:mga06r32_91075_c1_838_1971 340
596 3300050512 nmdc:mga0n895_46413_c1 nmdc:mga0n895_46413_c1_1587_2723 340
597 3300050513 nmdc:mga0rr50_264222_c1 nmdc:mga0rr50_264222_c1_234_1370 340
598 3300053085 Ga0495619_0000164 Ga0495619_0000164_9131_10258 340
599 3300006914 Ga0075436_100024382 Ga0075436_1000243822 341
600 3300009092 Ga0105250_10004961 Ga0105250_100049613 341
601 3300013296 Ga0157374_10095531 Ga0157374_100955312 341
602 3300049569 Ga0501032_0007040 Ga0501032_0007040_2226_3347 341
603 3300049571 Ga0501034_0000561 Ga0501034_0000561_24304_25425 341
604 3300049575 Ga0501039_0000498 Ga0501039_0000498_9114_10235 341
605 3300049581 Ga0501047_0001136 Ga0501047_0001136_3170_4291 341
606 3300049586 Ga0501070_0045861 Ga0501070_0045861_1898_3019 341
607 3300049742 Ga0501080_0000159 Ga0501080_0000159_26775_27896 341
608 3300049822 Ga0501035_0132711 Ga0501035_0132711_719_1840 341
609 3300049823 Ga0501044_0000115 Ga0501044_0000115_542_1663 341
610 3300049824 Ga0501045_0061250 Ga0501045_0061250_1071_2255 341
611 3300050513 nmdc:mga0rr50_15118_c1 nmdc:mga0rr50_15118_c1_2779_3906 341
612 iso_pu_bacteria 2513237096 2513660680 341
613 iso_pu_bacteria 2513237137 2513858335 341
614 iso_pu_bacteria 2513237145 2513915710 341
615 iso_pu_bacteria 2513237145 2513922473 341
616 iso_pu_bacteria 2517572143 2517887477 341
617 iso_pu_bacteria 2517572143 2517896052 341
618 iso_pu_bacteria 2517572143 2517896056 341
619 iso_pu_bacteria 2667528175 2671119003 341
620 iso_pu_bacteria 2908739725 2908747195 341
621 iso_pu_bacteria 2922425934 2922432301 341
622 iso_pu_bacteria 3005474847 3005479003 341
623 iso_pu_bacteria 8006933436 8006938793 341
624 iso_pu_bacteria 8006973647 8006973821 341
625 iso_pu_bacteria 8006973647 8006975253 341
626 iso_pu_bacteria 8019555841 8019563909 341
627 3300006038 Ga0075365_10004351 Ga0075365_100043519 342
628 3300006048 Ga0075363_100009217 Ga0075363_1000092173 342
629 3300006178 Ga0075367_10002352 Ga0075367_100023522 342
630 3300027866 Ga0209813_10005018 Ga0209813_100050183 342
631 3300044658 Ga0466972_0006433 Ga0466972_0006433_960_2096 342
632 3300046475 Ga0495639_0028094 Ga0495639_0028094_956_2083 342
633 3300049581 Ga0501047_0155191 Ga0501047_0155191_1038_2141 342
634 3300050490 nmdc:mga03n38_14769_c1 nmdc:mga03n38_14769_c1_1091_2308 342
635 3300053084 Ga0495595_0011588 Ga0495595_0011588_296_1423 342
636 3300053085 Ga0495619_0119361 Ga0495619_0119361_355_1482 342
637 3300053094 Ga0500566_0122852 Ga0500566_0122852_143_1270 342
638 3300026088 Ga0207641_10330503 Ga0207641_103305031 343
639 3300035725 Ga0373947_0093691 Ga0373947_0093691_639_1766 343
640 3300037068 Ga0373925_0017650 Ga0373925_0017650_1326_2453 343
641 3300046455 Ga0495603_0005985 Ga0495603_0005985_4481_5608 343
642 3300046459 Ga0495629_0123870 Ga0495629_0123870_66_1193 343
643 3300046462 Ga0495651_0139332 Ga0495651_0139332_542_1669 343
644 3300046463 Ga0495653_0108858 Ga0495653_0108858_364_1491 343
645 3300046473 Ga0495582_0025029 Ga0495582_0025029_1395_2522 343
646 3300046499 Ga0495594_0004129 Ga0495594_0004129_1312_2439 343
647 3300046517 Ga0495630_0024973 Ga0495630_0024973_442_1569 343
648 3300046529 Ga0495652_0047265 Ga0495652_0047265_1926_3053 343
649 3300046557 Ga0495622_0075968 Ga0495622_0075968_239_1366 343
650 3300046642 Ga0495634_0125632 Ga0495634_0125632_32_1159 343
651 3300046663 Ga0495635_0034228 Ga0495635_0034228_1462_2589 343
652 3300046674 Ga0495588_0036702 Ga0495588_0036702_112_1239 343
653 3300046681 Ga0495647_0018126 Ga0495647_0018126_1317_2444 343
654 3300046689 Ga0495613_0060699 Ga0495613_0060699_612_1739 343
655 3300046689 Ga0495613_0064917 Ga0495613_0064917_1112_2239 343
656 3300046690 Ga0495624_0053165 Ga0495624_0053165_1324_2451 343
657 3300046809 Ga0495600_0028328 Ga0495600_0028328_1016_2143 343
658 3300047315 Ga0495581_0053303 Ga0495581_0053303_1191_2318 343
659 3300047317 Ga0495604_0053403 Ga0495604_0053403_1666_2793 343
660 3300047319 Ga0495674_0014838 Ga0495674_0014838_5199_6326 343
661 3300047322 Ga0495680_0015838 Ga0495680_0015838_4869_5996 343
662 3300047471 Ga0495684_0039229 Ga0495684_0039229_1290_2417 343
663 3300047673 Ga0495593_0068108 Ga0495593_0068108_31_1161 343
664 3300048927 Ga0496124_0161086 Ga0496124_0161086_445_1581 343
665 3300049581 Ga0501047_0178874 Ga0501047_0178874_324_1535 343
666 3300049823 Ga0501044_0089548 Ga0501044_0089548_993_2126 343
667 3300006051 Ga0075364_10045735 Ga0075364_100457352 344
668 3300006195 Ga0075366_10043269 Ga0075366_100432694 344
669 3300006353 Ga0075370_10026001 Ga0075370_100260013 344
670 3300025933 Ga0207706_10042883 Ga0207706_100428832 344
671 3300038443 Ga0395901_0276802 Ga0395901_0276802_308_1459 344
672 3300046462 Ga0495651_0027824 Ga0495651_0027824_814_1950 344
673 3300048911 Ga0496108_0039412 Ga0496108_0039412_1580_2713 344
674 3300048920 Ga0496117_0045821 Ga0496117_0045821_218_1363 344
675 3300048921 Ga0496118_0035633 Ga0496118_0035633_1710_2846 344
676 3300048924 Ga0496121_0002396 Ga0496121_0002396_24518_25663 344
677 3300049575 Ga0501039_0156921 Ga0501039_0156921_204_1334 344
678 3300049588 Ga0501072_0203728 Ga0501072_0203728_110_1213 344
679 3300049592 Ga0501076_0092799 Ga0501076_0092799_1195_2325 344
680 3300049741 Ga0501079_0155810 Ga0501079_0155810_301_1434 344
681 3300049742 Ga0501080_0036625 Ga0501080_0036625_1805_2908 344
682 3300049743 Ga0501081_0063804 Ga0501081_0063804_1195_2325 344
683 3300049822 Ga0501035_0237567 Ga0501035_0237567_87_1217 344
684 3300049824 Ga0501045_0069803 Ga0501045_0069803_1186_2316 344
685 3300050490 nmdc:mga03n38_13225_c1 nmdc:mga03n38_13225_c1_1431_2582 344
686 3300053153 Ga0500616_0010404 Ga0500616_0010404_940_2076 344
687 iso_pu_bacteria 2904699407 2904707874 344
688 3300031711 Ga0265314_10055336 Ga0265314_100553363 345
689 3300037418 Ga0395900_0218896 Ga0395900_0218896_92_1234 345
690 3300037466 Ga0395898_0075631 Ga0395898_0075631_1453_2595 345
691 3300038443 Ga0395901_0274533 Ga0395901_0274533_578_1720 345
692 3300049592 Ga0501076_0006597 Ga0501076_0006597_5666_6778 345
693 3300049741 Ga0501079_0007700 Ga0501079_0007700_3344_4456 345
694 3300049743 Ga0501081_0009677 Ga0501081_0009677_4488_5600 345
695 3300054114 Ga0501084_0018742 Ga0501084_0018742_3429_4541 345
696 iso_pu_bacteria 2513237098 2513677461 345
697 iso_pu_bacteria 2524023210 2524466221 345
698 iso_pu_bacteria 2885383462 2885388158 345
699 iso_pu_bacteria 2903768456 2903776650 345
700 iso_pu_bacteria 8006933436 8006935285 345
701 3300005436 Ga0070713_100270223 Ga0070713_1002702232 346
702 3300005471 Ga0070698_100122003 Ga0070698_1001220032 346
703 3300005536 Ga0070697_100106706 Ga0070697_1001067063 346
704 3300006944 Ga0099823_1022744 Ga0099823_10227445 346
705 3300025261 Ga0209233_1001790 Ga0209233_10017902 346
706 3300025928 Ga0207700_10054769 Ga0207700_100547692 346
707 3300027296 Ga0209389_1000137 Ga0209389_100013730 346
708 3300027361 Ga0209489_114122 Ga0209489_1141222 346
709 3300027363 Ga0209700_100046 Ga0209700_10004692 346
710 3300005339 Ga0070660_100013552 Ga0070660_1000135521 347
711 3300005455 Ga0070663_100007733 Ga0070663_1000077338 347
712 3300005545 Ga0070695_100007331 Ga0070695_1000073317 347
713 3300005546 Ga0070696_100007479 Ga0070696_1000074793 347
714 3300006941 Ga0099825_1034761 Ga0099825_10347612 347
715 3300009148 Ga0105243_10100640 Ga0105243_101006402 347
716 3300009174 Ga0105241_10197872 Ga0105241_101978722 347
717 3300009545 Ga0105237_10012219 Ga0105237_100122195 347
718 3300009551 Ga0105238_10219532 Ga0105238_102195322 347
719 3300013105 Ga0157369_10290424 Ga0157369_102904241 347
720 3300013296 Ga0157374_10274394 Ga0157374_102743942 347
721 3300013297 Ga0157378_10091909 Ga0157378_100919092 347
722 3300035115 Ga0373941_0000649 Ga0373941_0000649_3970_5088 347
723 3300046477 Ga0495664_0097972 Ga0495664_0097972_450_1586 347
724 3300048905 Ga0496102_0153625 Ga0496102_0153625_835_1956 347
725 3300048906 Ga0496103_0001223 Ga0496103_0001223_8010_9131 347
726 3300048907 Ga0496104_0004958 Ga0496104_0004958_1741_2862 347
727 3300048908 Ga0496105_0027661 Ga0496105_0027661_949_2070 347
728 3300048909 Ga0496106_0014060 Ga0496106_0014060_4451_5572 347
729 3300048913 Ga0496110_0000794 Ga0496110_0000794_13886_15007 347
730 3300048916 Ga0496113_0007570 Ga0496113_0007570_3008_4129 347
731 3300048917 Ga0496114_0096993 Ga0496114_0096993_729_1850 347
732 3300049569 Ga0501032_0036536 Ga0501032_0036536_1492_2610 347
733 3300049569 Ga0501032_0184403 Ga0501032_0184403_190_1308 347
734 3300049570 Ga0501033_0225548 Ga0501033_0225548_114_1232 347
735 3300049570 Ga0501033_0227053 Ga0501033_0227053_194_1312 347
736 3300049571 Ga0501034_0017391 Ga0501034_0017391_5854_6972 347
737 3300049571 Ga0501034_0174087 Ga0501034_0174087_90_1208 347
738 3300049571 Ga0501034_0260331 Ga0501034_0260331_264_1382 347
739 3300049572 Ga0501036_0004539 Ga0501036_0004539_4537_5655 347
740 3300049572 Ga0501036_0080185 Ga0501036_0080185_451_1569 347
741 3300049572 Ga0501036_0115323 Ga0501036_0115323_607_1725 347
742 3300049572 Ga0501036_0258636 Ga0501036_0258636_45_1163 347
743 3300049573 Ga0501037_0015628 Ga0501037_0015628_780_1898 347
744 3300049573 Ga0501037_0051522 Ga0501037_0051522_1146_2264 347
745 3300049574 Ga0501038_0007397 Ga0501038_0007397_1669_2787 347
746 3300049574 Ga0501038_0033990 Ga0501038_0033990_793_1911 347
747 3300049574 Ga0501038_0039123 Ga0501038_0039123_1883_3001 347
748 3300049575 Ga0501039_0111401 Ga0501039_0111401_210_1328 347
749 3300049576 Ga0501040_0055248 Ga0501040_0055248_1262_2380 347
750 3300049578 Ga0501042_0026691 Ga0501042_0026691_1256_2374 347
751 3300049579 Ga0501043_0001482 Ga0501043_0001482_16030_17148 347
752 3300049579 Ga0501043_0093962 Ga0501043_0093962_528_1646 347
753 3300049579 Ga0501043_0230787 Ga0501043_0230787_209_1327 347
754 3300049581 Ga0501047_0002024 Ga0501047_0002024_3884_5002 347
755 3300049581 Ga0501047_0187256 Ga0501047_0187256_554_1672 347
756 3300049582 Ga0501048_0000774 Ga0501048_0000774_3385_4503 347
757 3300049582 Ga0501048_0001447 Ga0501048_0001447_6009_7127 347
758 3300049583 Ga0501067_0006079 Ga0501067_0006079_2008_3126 347
759 3300049584 Ga0501068_0013601 Ga0501068_0013601_1537_2655 347
760 3300049586 Ga0501070_0010475 Ga0501070_0010475_3115_4233 347
761 3300049586 Ga0501070_0084417 Ga0501070_0084417_322_1440 347
762 3300049589 Ga0501073_0036985 Ga0501073_0036985_358_1476 347
763 3300049589 Ga0501073_0040917 Ga0501073_0040917_92_1210 347
764 3300049590 Ga0501074_0088678 Ga0501074_0088678_984_2102 347
765 3300049593 Ga0501077_0200369 Ga0501077_0200369_17_1135 347
766 3300049741 Ga0501079_0040814 Ga0501079_0040814_1540_2658 347
767 3300049741 Ga0501079_0068913 Ga0501079_0068913_64_1182 347
768 3300049744 Ga0501083_0004950 Ga0501083_0004950_3359_4477 347
769 3300049744 Ga0501083_0023504 Ga0501083_0023504_1140_2258 347
770 3300049822 Ga0501035_0076523 Ga0501035_0076523_450_1568 347
771 3300049823 Ga0501044_0020560 Ga0501044_0020560_3353_4471 347
772 3300049823 Ga0501044_0050013 Ga0501044_0050013_2842_3960 347
773 3300049823 Ga0501044_0162402 Ga0501044_0162402_130_1248 347
774 3300049823 Ga0501044_0287733 Ga0501044_0287733_248_1366 347
775 3300025254 Ga0209148_1000224 Ga0209148_10002246 348
776 3300025272 Ga0209455_1003552 Ga0209455_10035523 348
777 3300031731 Ga0307405_10104864 Ga0307405_101048641 348
778 3300031901 Ga0307406_10017401 Ga0307406_100174012 348
779 3300031995 Ga0307409_100030066 Ga0307409_1000300662 348
780 3300032126 Ga0307415_100028697 Ga0307415_1000286973 348
781 3300048929 Ga0496126_0027687 Ga0496126_0027687_3741_4862 348
782 iso_pu_bacteria 2643221547 2643755221 348
783 iso_pu_bacteria 2857524615 2857525290 348
784 iso_pu_bacteria 2919073203 2919075019 348
785 iso_pu_bacteria 2929615660 2929616679 348
786 iso_pu_bacteria 2929624759 2929625423 348
787 iso_pu_bacteria 2933577622 2933578038 348
788 iso_pu_bacteria 8055742211 8055748325 348
789 3300049586 Ga0501070_0061458 Ga0501070_0061458_1757_2920 349
790 3300049590 Ga0501074_0029779 Ga0501074_0029779_1465_2628 349
791 3300049744 Ga0501083_0004507 Ga0501083_0004507_6712_7875 349
792 3300054114 Ga0501084_0065025 Ga0501084_0065025_58_1221 349
793 iso_pu_bacteria 2507262055 2507510583 349
794 iso_pu_bacteria 2508501009 2508544385 349
795 iso_pu_bacteria 2508501128 2509148575 349
796 iso_pu_bacteria 2511231028 2511396312 349
797 iso_pu_bacteria 2513237095 2513650773 349
798 iso_pu_bacteria 2513237101 2513691561 349
799 iso_pu_bacteria 2513237102 2513705520 349
800 iso_pu_bacteria 2513237139 2513877739 349
801 iso_pu_bacteria 2513237161 2514015069 349
802 iso_pu_bacteria 2515154112 2515628640 349
803 iso_pu_bacteria 2517093001 2517105541 349
804 iso_pu_bacteria 2524023205 2524436984 349
805 iso_pu_bacteria 2528768022 2528852308 349
806 iso_pu_bacteria 2617270735 2617350001 349
807 iso_pu_bacteria 2643221651 2644289195 349
808 iso_pu_bacteria 2721755755 2723845454 349
809 iso_pu_bacteria 2744054633 2745076186 349
810 iso_pu_bacteria 2791355196 2793063348 349
811 iso_pu_bacteria 2802429603 2805917132 349
812 iso_pu_bacteria 2816332527 2818243577 349
813 iso_pu_bacteria 2824600985 2824603896 349
814 iso_pu_bacteria 2824609381 2824612537 349
815 iso_pu_bacteria 2824617872 2824621712 349
816 iso_pu_bacteria 2824626560 2824630819 349
817 iso_pu_bacteria 2824635225 2824637450 349
818 iso_pu_bacteria 2824644064 2824646301 349
819 iso_pu_bacteria 2824653114 2824655632 349
820 iso_pu_bacteria 2824661429 2824662418 349
821 iso_pu_bacteria 2824671348 2824675880 349
822 iso_pu_bacteria 2824679649 2824680062 349
823 iso_pu_bacteria 2824687955 2824692002 349
824 iso_pu_bacteria 2824696289 2824696604 349
825 iso_pu_bacteria 2824704595 2824705716 349
826 iso_pu_bacteria 2824714736 2824720000 349
827 iso_pu_bacteria 2824723954 2824726739 349
828 iso_pu_bacteria 2824732956 2824733693 349
829 iso_pu_bacteria 2824746037 2824747949 349
830 iso_pu_bacteria 2824753945 2824756398 349
831 iso_pu_bacteria 2824763712 2824764083 349
832 iso_pu_bacteria 2824773399 2824776759 349
833 iso_pu_bacteria 2838122688 2838125416 349
834 iso_pu_bacteria 2841941048 2841941924 349
835 iso_pu_bacteria 2841949485 2841951358 349
836 iso_pu_bacteria 2841957949 2841958960 349
837 iso_pu_bacteria 2841966195 2841968643 349
838 iso_pu_bacteria 2841974524 2841976156 349
839 iso_pu_bacteria 2841983080 2841987521 349
840 iso_pu_bacteria 2842038055 2842045107 349
841 iso_pu_bacteria 2842045827 2842049232 349
842 iso_pu_bacteria 2844315083 2844317343 349
843 iso_pu_bacteria 2847930680 2847934050 349
844 iso_pu_bacteria 2847939898 2847944707 349
845 iso_pu_bacteria 2849076700 2849081065 349
846 iso_pu_bacteria 2874590934 2874594772 349
847 iso_pu_bacteria 2874604998 2874607645 349
848 iso_pu_bacteria 2874612657 2874612921 349
849 iso_pu_bacteria 2874620515 2874628466 349
850 iso_pu_bacteria 2874628541 2874634751 349
851 iso_pu_bacteria 2874645413 2874646867 349
852 iso_pu_bacteria 2876761206 2876769414 349
853 iso_pu_bacteria 2876771140 2876774386 349
854 iso_pu_bacteria 2876818435 2876822824 349
855 iso_pu_bacteria 2879074833 2879078540 349
856 iso_pu_bacteria 2879083081 2879086861 349
857 iso_pu_bacteria 2879099564 2879109778 349
858 iso_pu_bacteria 2879127579 2879129870 349
859 iso_pu_bacteria 2879142872 2879146195 349
860 iso_pu_bacteria 2881364244 2881369176 349
861 iso_pu_bacteria 2885366525 2885367438 349
862 iso_pu_bacteria 2885409591 2885414885 349
863 iso_pu_bacteria 2888378607 2888382030 349
864 iso_pu_bacteria 2888388044 2888388620 349
865 iso_pu_bacteria 2888419890 2888422647 349
866 iso_pu_bacteria 2889033259 2889038905 349
867 iso_pu_bacteria 2903727486 2903733271 349
868 iso_pu_bacteria 2904666416 2904667254 349
869 iso_pu_bacteria 2904711408 2904720334 349
870 iso_pu_bacteria 2906602504 2906606237 349
871 iso_pu_bacteria 2906626472 2906634074 349
872 iso_pu_bacteria 2906643746 2906647556 349
873 iso_pu_bacteria 2908775508 2908778287 349
874 iso_pu_bacteria 2922368715 2922371979 349
875 iso_pu_bacteria 2922393267 2922399277 349
876 iso_pu_bacteria 2932784394 2932793127 349
877 iso_pu_bacteria 2932809354 2932814567 349
878 iso_pu_bacteria 2932818245 2932824632 349
879 iso_pu_bacteria 2932828146 2932836586 349
880 iso_pu_bacteria 2935608549 2935610684 349
881 iso_pu_bacteria 2935616580 2935623320 349
882 iso_pu_bacteria 2935638405 2935646682 349
883 iso_pu_bacteria 2935648319 2935652454 349
884 iso_pu_bacteria 2935656913 2935661036 349
885 iso_pu_bacteria 2935665750 2935672648 349
886 iso_pu_bacteria 2935675223 2935682521 349
887 iso_pu_bacteria 2935684952 2935691725 349
888 iso_pu_bacteria 2935694250 2935699594 349
889 iso_pu_bacteria 2935694250 2935702744 349
890 iso_pu_bacteria 2935703347 2935707831 349
891 iso_pu_bacteria 2935713505 2935719559 349
892 iso_pu_bacteria 2935722832 2935728839 349
893 iso_pu_bacteria 2935732158 2935737919 349
894 iso_pu_bacteria 2935741537 2935747294 349
895 iso_pu_bacteria 2935750917 2935757905 349
896 iso_pu_bacteria 2935760218 2935761698 349
897 iso_pu_bacteria 2935769743 2935776221 349
898 iso_pu_bacteria 2935777560 2935784916 349
899 iso_pu_bacteria 2935801545 2935810104 349
900 iso_pu_bacteria 2935810662 2935819010 349
901 iso_pu_bacteria 2935819856 2935820181 349
902 iso_pu_bacteria 2935827899 2935835949 349
903 iso_pu_bacteria 2935837841 2935844927 349
904 iso_pu_bacteria 2935847175 2935849808 349
905 iso_pu_bacteria 2935855204 2935861680 349
906 iso_pu_bacteria 2935864058 2935870719 349
907 iso_pu_bacteria 2935873716 2935881408 349
908 iso_pu_bacteria 2935908558 2935914502 349
909 iso_pu_bacteria 2935916978 2935919052 349
910 iso_pu_bacteria 2935926038 2935932117 349
911 iso_pu_bacteria 2935934488 2935940715 349
912 iso_pu_bacteria 2935942939 2935948698 349
913 iso_pu_bacteria 2935951376 2935957195 349
914 iso_pu_bacteria 2935967501 2935973833 349
915 iso_pu_bacteria 2935975950 2935979700 349
916 iso_pu_bacteria 2935984226 2935988928 349
917 iso_pu_bacteria 2935992306 2936000410 349
918 iso_pu_bacteria 2936002035 2936005427 349
919 iso_pu_bacteria 2936011229 2936015093 349
920 iso_pu_bacteria 2936019824 2936023238 349
921 iso_pu_bacteria 2936028420 2936032309 349
922 iso_pu_bacteria 2936037263 2936041966 349
923 iso_pu_bacteria 2936046547 2936050170 349
924 iso_pu_bacteria 2936055302 2936061122 349
925 iso_pu_bacteria 2940556831 2940564183 349
926 iso_pu_bacteria 2941531003 2941537150 349
927 iso_pu_bacteria 2941538514 2941546734 349
928 iso_pu_bacteria 3005483717 3005486341 349
929 iso_pu_bacteria 3005506211 3005512167 349
930 iso_pu_bacteria 3005594810 3005597041 349
931 iso_pu_bacteria 3005718088 3005720472 349
932 iso_pu_bacteria 8006933436 8006943685 349
933 iso_pu_bacteria 8006973647 8006983936 349
934 iso_pu_bacteria 8016511872 8016515696 349
935 iso_pu_bacteria 8016583857 8016590090 349
936 iso_pu_bacteria 8016622563 8016630743 349
937 iso_pu_bacteria 8017057580 8017060802 349
938 iso_pu_bacteria 8019538911 8019542226 349
939 iso_pu_bacteria 8019547302 8019547393 349
940 iso_pu_bacteria 8019576017 8019580326 349
941 iso_pu_bacteria 8019586578 8019588046 349
942 iso_pu_bacteria 8019608314 8019615238 349
943 iso_pu_bacteria 8019619141 8019626040 349
944 iso_pu_bacteria 8019629233 8019636444 349
945 iso_pu_bacteria 8019638758 8019643189 349
946 iso_pu_bacteria 8019648815 8019656025 349
947 iso_pu_bacteria 8019659431 8019664222 349
948 iso_pu_bacteria 8019668869 8019673810 349
949 iso_pu_bacteria 8019678201 8019682299 349
950 iso_pu_bacteria 8019687851 8019688003 349
951 iso_pu_bacteria 8056967851 8056971946 349
952 3300005937 Ga0081455_10116256 Ga0081455_101162563 350
953 3300009094 Ga0111539_10004280 Ga0111539_100042805 350
954 3300009148 Ga0105243_10031664 Ga0105243_100316643 350
955 3300009545 Ga0105237_10042290 Ga0105237_100422904 350
956 3300013100 Ga0157373_10092832 Ga0157373_100928322 350
957 3300013306 Ga0163162_10055157 Ga0163162_100551573 350
958 3300025901 Ga0207688_10007134 Ga0207688_100071346 350
959 3300025904 Ga0207647_10001768 Ga0207647_100017686 350
960 3300025914 Ga0207671_10280619 Ga0207671_102806191 350
961 3300025935 Ga0207709_10022604 Ga0207709_100226042 350
962 3300025936 Ga0207670_10015701 Ga0207670_100157014 350
963 3300025938 Ga0207704_10038375 Ga0207704_100383752 350
964 3300025942 Ga0207689_10078975 Ga0207689_100789752 350
965 3300025972 Ga0207668_10019130 Ga0207668_100191305 350
966 3300026041 Ga0207639_10048933 Ga0207639_100489333 350
967 3300026075 Ga0207708_10002105 Ga0207708_100021055 350
968 3300026089 Ga0207648_10247999 Ga0207648_102479992 350
969 3300026118 Ga0207675_100006675 Ga0207675_1000066755 350
970 3300026142 Ga0207698_10166236 Ga0207698_101662362 350
971 3300027695 Ga0209966_1000879 Ga0209966_10008798 350
972 3300027695 Ga0209966_1003243 Ga0209966_10032432 350
973 3300027717 Ga0209998_10007039 Ga0209998_100070392 350
974 3300027907 Ga0207428_10004311 Ga0207428_100043114 350
975 3300033180 Ga0307510_10089703 Ga0307510_100897032 350
976 3300034816 Ga0373930_0001132 Ga0373930_0001132_1835_2962 350
977 3300034819 Ga0373958_0000104 Ga0373958_0000104_3985_5112 350
978 3300034820 Ga0373959_0002185 Ga0373959_0002185_1546_2673 350
979 3300035084 Ga0373928_0001256 Ga0373928_0001256_1374_2501 350
980 3300035085 Ga0373929_0000075 Ga0373929_0000075_2996_4123 350
981 3300035090 Ga0373949_0013321 Ga0373949_0013321_317_1444 350
982 3300035091 Ga0373951_0010253 Ga0373951_0010253_875_2002 350
983 3300035112 Ga0373932_0000399 Ga0373932_0000399_12092_13219 350
984 3300035113 Ga0373936_0040420 Ga0373936_0040420_486_1613 350
985 3300035115 Ga0373941_0000103 Ga0373941_0000103_12209_13336 350
986 3300035116 Ga0373945_0027424 Ga0373945_0027424_656_1783 350
987 3300035207 Ga0373942_0005219 Ga0373942_0005219_140_1267 350
988 3300035691 Ga0373931_0028547 Ga0373931_0028547_851_1978 350
989 3300035725 Ga0373947_0122576 Ga0373947_0122576_489_1634 350
990 3300042008 Ga0439450_019829 Ga0439450_019829_73_1200 350
991 3300042876 Ga0451577_0019873 Ga0451577_0019873_2633_3760 350
992 3300044712 Ga0453684_0055062 Ga0453684_0055062_3780_4907 350
993 3300045051 Ga0451576_0019035 Ga0451576_0019035_2948_4075 350
994 3300047673 Ga0495593_0026795 Ga0495593_0026795_101_1237 350
995 3300048910 Ga0496107_0017009 Ga0496107_0017009_1218_2345 350
996 3300048913 Ga0496110_0060791 Ga0496110_0060791_814_1941 350
997 3300048913 Ga0496110_0225549 Ga0496110_0225549_249_1376 350
998 3300060353 Ga0501082_0008587 Ga0501082_0008587_5430_6557 350
999 3300007076 Ga0075435_100015085 Ga0075435_1000150855 351
1000 3300031691 Ga0316579_10011336 Ga0316579_100113363 351
1001 3300048907 Ga0496104_0237680 Ga0496104_0237680_258_1385 351
1002 3300048929 Ga0496126_0032003 Ga0496126_0032003_612_1748 351
1003 3300053104 Ga0500556_0000110 Ga0500556_0000110_40321_41451 351
1004 3300053139 Ga0500568_0008272 Ga0500568_0008272_676_1812 351
1005 3300053153 Ga0500616_0000006 Ga0500616_0000006_249825_250955 351
1006 3300053153 Ga0500616_0005928 Ga0500616_0005928_4509_5678 351
1007 iso_pu_bacteria 2513237104 2513715881 351
1008 3300003215 JGI25153J46596_10004577 JGI25153J46596_100045776 352
1009 3300005347 Ga0070668_100006572 Ga0070668_1000065724 352
1010 3300005539 Ga0068853_100008598 Ga0068853_1000085984 352
1011 3300005547 Ga0070693_100002177 Ga0070693_1000021777 352
1012 3300005842 Ga0068858_100134898 Ga0068858_1001348982 352
1013 3300005843 Ga0068860_100034267 Ga0068860_1000342673 352
1014 3300005843 Ga0068860_100045641 Ga0068860_1000456414 352
1015 3300005844 Ga0068862_100009937 Ga0068862_1000099373 352
1016 3300006042 Ga0075368_10000403 Ga0075368_1000040314 352
1017 3300006048 Ga0075363_100000700 Ga0075363_1000007009 352
1018 3300006178 Ga0075367_10000859 Ga0075367_1000085911 352
1019 3300006353 Ga0075370_10067999 Ga0075370_100679991 352
1020 3300025273 Ga0209673_1014407 Ga0209673_10144072 352
1021 3300025295 Ga0209564_1008956 Ga0209564_10089564 352
1022 3300025297 Ga0209758_1001103 Ga0209758_100110316 352
1023 3300025904 Ga0207647_10071218 Ga0207647_100712182 352
1024 3300025912 Ga0207707_10076955 Ga0207707_100769552 352
1025 3300025917 Ga0207660_10023384 Ga0207660_100233844 352
1026 3300025919 Ga0207657_10019384 Ga0207657_100193844 352
1027 3300025924 Ga0207694_10105080 Ga0207694_101050802 352
1028 3300025935 Ga0207709_10099170 Ga0207709_100991703 352
1029 3300025937 Ga0207669_10153555 Ga0207669_101535551 352
1030 3300025972 Ga0207668_10055299 Ga0207668_100552993 352
1031 3300026041 Ga0207639_10091893 Ga0207639_100918933 352
1032 3300026067 Ga0207678_10002469 Ga0207678_1000246913 352
1033 3300026118 Ga0207675_100016268 Ga0207675_1000162688 352
1034 3300027866 Ga0209813_10000354 Ga0209813_1000035411 352
1035 3300028380 Ga0268265_10020474 Ga0268265_100204743 352
1036 3300031691 Ga0316579_10044153 Ga0316579_100441532 352
1037 3300031727 Ga0316576_10120963 Ga0316576_101209631 352
1038 3300031728 Ga0316578_10033393 Ga0316578_100333933 352
1039 3300032133 Ga0316583_10006386 Ga0316583_100063861 352
1040 3300032137 Ga0316585_10001817 Ga0316585_100018174 352
1041 3300032139 Ga0316580_10002912 Ga0316580_100029124 352
1042 3300036401 Ga0373937_0022999 Ga0373937_0022999_2075_3208 352
1043 3300036647 Ga0316582_0083025 Ga0316582_0083025_183_1331 352
1044 3300036712 Ga0316584_0032544 Ga0316584_0032544_2111_3259 352
1045 3300039447 Ga0436361_0800382 Ga0436361_0800382_974_2107 352
1046 3300046459 Ga0495629_0020141 Ga0495629_0020141_2493_3635 352
1047 3300046462 Ga0495651_0012637 Ga0495651_0012637_2909_4051 352
1048 3300046511 Ga0495608_0118945 Ga0495608_0118945_324_1466 352
1049 3300046529 Ga0495652_0097001 Ga0495652_0097001_256_1398 352
1050 3300046533 Ga0495640_0053312 Ga0495640_0053312_198_1340 352
1051 3300046663 Ga0495635_0014018 Ga0495635_0014018_159_1301 352
1052 3300046690 Ga0495624_0115701 Ga0495624_0115701_244_1386 352
1053 3300047315 Ga0495581_0080628 Ga0495581_0080628_227_1369 352
1054 3300047317 Ga0495604_0050351 Ga0495604_0050351_1301_2443 352
1055 3300048088 Ga0495602_0078694 Ga0495602_0078694_209_1351 352
1056 3300048907 Ga0496104_0022383 Ga0496104_0022383_2960_4102 352
1057 3300048908 Ga0496105_0018352 Ga0496105_0018352_1902_3044 352
1058 3300048917 Ga0496114_0186514 Ga0496114_0186514_546_1688 352
1059 3300048922 Ga0496119_0105777 Ga0496119_0105777_32_1174 352
1060 3300049569 Ga0501032_0100665 Ga0501032_0100665_246_1379 352
1061 3300049572 Ga0501036_0036678 Ga0501036_0036678_1404_2537 352
1062 3300049574 Ga0501038_0087664 Ga0501038_0087664_1333_2466 352
1063 3300049575 Ga0501039_0059313 Ga0501039_0059313_858_1991 352
1064 3300049577 Ga0501041_0025769 Ga0501041_0025769_338_1471 352
1065 3300049587 Ga0501071_0071361 Ga0501071_0071361_541_1674 352
1066 3300049589 Ga0501073_0049989 Ga0501073_0049989_536_1672 352
1067 3300049592 Ga0501076_0038923 Ga0501076_0038923_426_1559 352
1068 3300049741 Ga0501079_0024164 Ga0501079_0024164_922_2055 352
1069 3300049743 Ga0501081_0035597 Ga0501081_0035597_748_1881 352
1070 3300049824 Ga0501045_0121727 Ga0501045_0121727_315_1448 352
1071 3300050490 nmdc:mga03n38_1593_c1 nmdc:mga03n38_1593_c1_4682_5818 352
1072 3300050492 nmdc:mga0yw44_86897_c1 nmdc:mga0yw44_86897_c1_167_1303 352
1073 3300050494 nmdc:mga06z11_1068_c1 nmdc:mga06z11_1068_c1_2404_3540 352
1074 3300050495 nmdc:mga04h51_866_c1 nmdc:mga04h51_866_c1_509_1645 352
1075 3300053177 Ga0500636_0080342 Ga0500636_0080342_212_1354 352
1076 3300054114 Ga0501084_0034868 Ga0501084_0034868_2767_3900 352
1077 3300060353 Ga0501082_0190076 Ga0501082_0190076_496_1632 352
1078 3300061734 Ga0530510_0167184 Ga0530510_0167184_139_1272 352
1079 iso_pu_bacteria 2513237141 2513888416 352
1080 3300003215 JGI25153J46596_10000110 JGI25153J46596_1000011022 353
1081 3300003215 JGI25153J46596_10000263 JGI25153J46596_1000026316 353
1082 3300003354 JGI25160J50197_1000523 JGI25160J50197_100052319 353
1083 3300003354 JGI25160J50197_1005211 JGI25160J50197_10052115 353
1084 3300004625 Ga0055543_1002843 Ga0055543_10028434 353
1085 3300005262 Ga0065165_1004569 Ga0065165_10045694 353
1086 3300005262 Ga0065165_1004928 Ga0065165_10049282 353
1087 3300005262 Ga0065165_1009267 Ga0065165_10092674 353
1088 3300005434 Ga0070709_10008113 Ga0070709_100081132 353
1089 3300005435 Ga0070714_100032673 Ga0070714_1000326732 353
1090 3300005437 Ga0070710_10003271 Ga0070710_100032717 353
1091 3300005439 Ga0070711_100020122 Ga0070711_1000201223 353
1092 3300005458 Ga0070681_10048886 Ga0070681_100488862 353
1093 3300005530 Ga0070679_100232338 Ga0070679_1002323381 353
1094 3300005843 Ga0068860_100000302 Ga0068860_10000030223 353
1095 3300005983 Ga0081540_1015193 Ga0081540_10151935 353
1096 3300006042 Ga0075368_10026345 Ga0075368_100263453 353
1097 3300006051 Ga0075364_10007739 Ga0075364_100077396 353
1098 3300006051 Ga0075364_10007956 Ga0075364_100079563 353
1099 3300006163 Ga0070715_10002699 Ga0070715_100026992 353
1100 3300006175 Ga0070712_100004063 Ga0070712_1000040638 353
1101 3300006177 Ga0075362_10007931 Ga0075362_100079313 353
1102 3300006195 Ga0075366_10118954 Ga0075366_101189542 353
1103 3300006353 Ga0075370_10083928 Ga0075370_100839283 353
1104 3300006358 Ga0068871_100116263 Ga0068871_1001162632 353
1105 3300009093 Ga0105240_10038789 Ga0105240_100387892 353
1106 3300009174 Ga0105241_10021664 Ga0105241_100216643 353
1107 3300009545 Ga0105237_10002097 Ga0105237_1000209716 353
1108 3300009545 Ga0105237_10007140 Ga0105237_1000714010 353
1109 3300009545 Ga0105237_10290804 Ga0105237_102908041 353
1110 3300010375 Ga0105239_10013543 Ga0105239_100135433 353
1111 3300013104 Ga0157370_10121827 Ga0157370_101218271 353
1112 3300025230 Ga0209563_107462 Ga0209563_1074622 353
1113 3300025295 Ga0209564_1003463 Ga0209564_10034639 353
1114 3300025297 Ga0209758_1000075 Ga0209758_1000075102 353
1115 3300025297 Ga0209758_1000087 Ga0209758_1000087174 353
1116 3300025297 Ga0209758_1003246 Ga0209758_100324610 353
1117 3300025297 Ga0209758_1011329 Ga0209758_10113294 353
1118 3300025299 Ga0209256_1003035 Ga0209256_10030352 353
1119 3300025302 Ga0207426_1000160 Ga0207426_100016026 353
1120 3300025302 Ga0207426_1001010 Ga0207426_100101014 353
1121 3300025302 Ga0207426_1007290 Ga0207426_10072904 353
1122 3300025304 Ga0209257_1000795 Ga0209257_10007956 353
1123 3300025304 Ga0209257_1007831 Ga0209257_10078314 353
1124 3300025904 Ga0207647_10011677 Ga0207647_100116774 353
1125 3300025904 Ga0207647_10091650 Ga0207647_100916502 353
1126 3300025906 Ga0207699_10030688 Ga0207699_100306882 353
1127 3300025911 Ga0207654_10029119 Ga0207654_100291193 353
1128 3300025911 Ga0207654_10046809 Ga0207654_100468093 353
1129 3300025912 Ga0207707_10043505 Ga0207707_100435052 353
1130 3300025914 Ga0207671_10023189 Ga0207671_100231894 353
1131 3300025914 Ga0207671_10093015 Ga0207671_100930152 353
1132 3300025915 Ga0207693_10000326 Ga0207693_1000032617 353
1133 3300025916 Ga0207663_10034720 Ga0207663_100347202 353
1134 3300025921 Ga0207652_10053329 Ga0207652_100533293 353
1135 3300025928 Ga0207700_10097609 Ga0207700_100976092 353
1136 3300025928 Ga0207700_10286350 Ga0207700_102863501 353
1137 3300025939 Ga0207665_10001364 Ga0207665_100013642 353
1138 3300026067 Ga0207678_10079215 Ga0207678_100792153 353
1139 3300027866 Ga0209813_10060166 Ga0209813_100601661 353
1140 3300028381 Ga0268264_10000020 Ga0268264_10000020125 353
1141 3300028573 Ga0265334_10037179 Ga0265334_100371792 353
1142 3300030521 Ga0307511_10048094 Ga0307511_100480943 353
1143 3300031235 Ga0265330_10002148 Ga0265330_100021489 353
1144 3300031249 Ga0265339_10008846 Ga0265339_100088465 353
1145 3300031730 Ga0307516_10070540 Ga0307516_100705403 353
1146 3300037466 Ga0395898_0030060 Ga0395898_0030060_106_1242 353
1147 3300037853 Ga0436364_0400091 Ga0436364_0400091_231_1367 353
1148 3300038443 Ga0395901_0223244 Ga0395901_0223244_669_1805 353
1149 3300046533 Ga0495640_0019241 Ga0495640_0019241_460_1596 353
1150 3300046559 Ga0495667_0013164 Ga0495667_0013164_2884_4020 353
1151 3300046616 Ga0495668_0005423 Ga0495668_0005423_2329_3465 353
1152 3300046678 Ga0495599_0003308 Ga0495599_0003308_30_1166 353
1153 3300046689 Ga0495613_0034201 Ga0495613_0034201_2580_3716 353
1154 3300046690 Ga0495624_0138067 Ga0495624_0138067_335_1471 353
1155 3300047317 Ga0495604_0021963 Ga0495604_0021963_643_1779 353
1156 3300047443 Ga0495687_007206 Ga0495687_007206_573_1709 353
1157 3300047444 Ga0495675_0042693 Ga0495675_0042693_870_2006 353
1158 3300048904 Ga0496101_0110593 Ga0496101_0110593_891_2027 353
1159 3300048909 Ga0496106_0107712 Ga0496106_0107712_973_2109 353
1160 3300048920 Ga0496117_0008333 Ga0496117_0008333_6054_7190 353
1161 3300048920 Ga0496117_0050906 Ga0496117_0050906_965_2101 353
1162 3300048921 Ga0496118_0055750 Ga0496118_0055750_877_2013 353
1163 3300048924 Ga0496121_0090293 Ga0496121_0090293_205_1341 353
1164 3300048928 Ga0496125_0006206 Ga0496125_0006206_11341_12477 353
1165 3300048928 Ga0496125_0018774 Ga0496125_0018774_19_1155 353
1166 3300048929 Ga0496126_0196413 Ga0496126_0196413_218_1354 353
1167 3300049569 Ga0501032_0006976 Ga0501032_0006976_6726_7862 353
1168 3300049570 Ga0501033_0024710 Ga0501033_0024710_2106_3242 353
1169 3300049571 Ga0501034_0000499 Ga0501034_0000499_48413_49549 353
1170 3300049571 Ga0501034_0105050 Ga0501034_0105050_416_1552 353
1171 3300049572 Ga0501036_0020356 Ga0501036_0020356_3313_4449 353
1172 3300049573 Ga0501037_0006217 Ga0501037_0006217_741_1877 353
1173 3300049574 Ga0501038_0011040 Ga0501038_0011040_6596_7732 353
1174 3300049574 Ga0501038_0134451 Ga0501038_0134451_164_1309 353
1175 3300049581 Ga0501047_0031991 Ga0501047_0031991_439_1575 353
1176 3300049586 Ga0501070_0028755 Ga0501070_0028755_2258_3394 353
1177 3300049589 Ga0501073_0050132 Ga0501073_0050132_1400_2587 353
1178 3300049743 Ga0501081_0159094 Ga0501081_0159094_391_1578 353
1179 3300049822 Ga0501035_0014314 Ga0501035_0014314_79_1215 353
1180 3300049822 Ga0501035_0075849 Ga0501035_0075849_240_1385 353
1181 3300049823 Ga0501044_0061755 Ga0501044_0061755_36_1172 353
1182 3300050490 nmdc:mga03n38_29357_c1 nmdc:mga03n38_29357_c1_257_1393 353
1183 3300050492 nmdc:mga0yw44_41490_c1 nmdc:mga0yw44_41490_c1_1201_2337 353
1184 3300050493 nmdc:mga0k408_36016_c1 nmdc:mga0k408_36016_c1_827_1963 353
1185 3300050494 nmdc:mga06z11_12914_c1 nmdc:mga06z11_12914_c1_2167_3303 353
1186 3300050494 nmdc:mga06z11_25213_c1 nmdc:mga06z11_25213_c1_1303_2439 353
1187 3300050495 nmdc:mga04h51_2923_c1 nmdc:mga04h51_2923_c1_1045_2181 353
1188 3300050496 nmdc:mga07m45_34836_c1 nmdc:mga07m45_34836_c1_1496_2632 353
1189 3300050496 nmdc:mga07m45_8765_c1 nmdc:mga07m45_8765_c1_2634_3782 353
1190 3300050516 nmdc:mga0sz30_12419_c1 nmdc:mga0sz30_12419_c1_1344_2480 353
1191 3300050516 nmdc:mga0sz30_74437_c1 nmdc:mga0sz30_74437_c1_95_1231 353
1192 3300053091 Ga0500647_0004322 Ga0500647_0004322_728_1864 353
1193 3300053094 Ga0500566_0000400 Ga0500566_0000400_16370_17506 353
1194 3300053095 Ga0500640_022647 Ga0500640_022647_239_1375 353
1195 3300053111 Ga0500572_000121 Ga0500572_000121_16359_17495 353
1196 3300053119 Ga0500595_027390 Ga0500595_027390_57_1202 353
1197 3300053122 Ga0500608_003152 Ga0500608_003152_3437_4573 353
1198 3300053123 Ga0500614_003296 Ga0500614_003296_1542_2678 353
1199 3300053136 Ga0500559_0001424 Ga0500559_0001424_6964_8100 353
1200 3300053136 Ga0500559_0016013 Ga0500559_0016013_53_1189 353
1201 3300053148 Ga0500590_089270 Ga0500590_089270_316_1452 353
1202 3300053159 Ga0500630_001045 Ga0500630_001045_4710_5846 353
1203 3300053162 Ga0500638_031156 Ga0500638_031156_181_1317 353
1204 3300053163 Ga0500639_000219 Ga0500639_000219_10910_12046 353
1205 3300053735 Ga0500596_000227 Ga0500596_000227_4655_5791 353
1206 3300053735 Ga0500596_009050 Ga0500596_009050_353_1489 353
1207 iso_pu_bacteria 2617270741 2617378680 353
1208 iso_pu_bacteria 3005587118 3005593638 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

208

419

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fef-assembly1.cif.gz_J structure of mce1 transporter from mycobacterium smegmatis (map0) 0.8318 105 344
7ch9-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd 0.8205 90 347
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.8205 93 345
7ch8-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd with adp-v 0.8165 90 347
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.8148 91 344
ID Description Score Start End Superfamily
af_I1N8G8_45_205_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3741 149 337 1.10.1760.20
af_P76352_330_491_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3703 151 337 1.20.1250.20
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3682 138 343 1.10.357.20
af_I1N8G8_45_205_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.368 149 337 1.10.1760.20
af_Q4DPE2_262_423_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3597 150 345 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A517WXU6-F1-model_v4 ABC transport permease subunit MlaE 0.8834 93 351 GO:0005548
GO:0043190
AF-A0A1V5MI47-F1-model_v4 Putative phospholipid ABC transporter permease protein MlaE 0.8808 93 349 GO:0005548
GO:0043190
AF-A0A2E6NRK7-F1-model_v4 ABC transporter permease 0.8805 105 351 GO:0005548
GO:0043190
AF-A0A519BNM1-F1-model_v4 ABC transporter permease 0.8803 89 345 GO:0005548
GO:0043190
AF-A0A1J5PGI3-F1-model_v4 Putative phospholipid ABC transporter permease protein MlaE 0.879 107 353 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
78.8 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map