F491675

General Info

Members Datasets Scaffolds Average Seq Length
1208 419 1196 131

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10367119|Ga0065715_103671191
Length 123
Sequence MSEPPQRPSAGARPSVIQLVFREKGALYAAYMPLFAEGGLFVPTTREYKLGEDIYLLLSLPEDPQRYPVAGKVGWITPANASGGRTQGVGVKFPSDEKTRALKQKIEDALGTMLQSAKPTQTI

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
12 2643221660 Methylibium sp. Root1272 Isolate Unclassified
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
110 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
111 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
112 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
198 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
247 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
250 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
251 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
252 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
255 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
256 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
257 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
258 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
266 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
267 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
268 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
269 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
270 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
271 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
272 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
273 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
279 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
312 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
356 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
357 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
361 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
362 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
363 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
364 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
365 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
366 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
367 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
368 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
369 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
370 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
371 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
372 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
373 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
374 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
391 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
392 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
393 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
394 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
397 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
398 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
399 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
400 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
401 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
402 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
407 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
408 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
409 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
410 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
411 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
412 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
413 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
414 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
415 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
416 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
417 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
419 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.17
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.58
Nodule 0.17
Rhizoplane 3.23
Rhizosphere 78.23
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000721 3300003215 Bacteria 20263
2 JGI25153J46596_10002502 3300003215 Bacteria 10551
3 rootH1_10035581 3300003316 Bacteria 6648
4 rootL2_10029461 3300003322 Bacteria 3052
5 rootL2_10106302 3300003322 Bacteria 3122
6 rootL2_10106303 3300003322 Bacteria 1236
7 JGI26128J50194_1001122 3300003347 Bacteria 1653
8 Ga0055526_1001425 3300003771 Bacteria 17025
9 Ga0055524_1000302 3300003775 Bacteria 47410
10 Ga0055530_10032114 3300003791 Bacteria 1369
11 Ga0055540_1000004 3300003792 Bacteria 395545
12 Ga0055540_1000035 3300003792 Bacteria 166843
13 Ga0055531_10000051 3300003794 Bacteria 130125
14 Ga0055531_10022330 3300003794 Bacteria 2415
15 Ga0065165_1000774 3300005262 Bacteria 43046
16 Ga0065715_10074796 3300005293 Bacteria 712
17 Ga0065715_10367119 3300005293 Bacteria 921
18 Ga0065707_10086124 3300005295 Bacteria 5650
19 Ga0070658_10268697 3300005327 Bacteria 1450
20 Ga0070676_10025314 3300005328 Bacteria 3353
21 Ga0070676_10029269 3300005328 Bacteria 3132
22 Ga0070676_10046670 3300005328 Bacteria 2527
23 Ga0070676_10065473 3300005328 Bacteria 2170
24 Ga0070676_10109933 3300005328 Bacteria 1715
25 Ga0070676_10310707 3300005328 Bacteria 1072
26 Ga0070676_10562333 3300005328 Bacteria 818
27 Ga0070676_10614956 3300005328 Bacteria 785
28 Ga0070676_10648457 3300005328 Bacteria 766
29 Ga0070676_11472523 3300005328 Bacteria 524
30 Ga0070683_100015906 3300005329 Bacteria 6619
31 Ga0070683_100439052 3300005329 Bacteria 1245
32 Ga0070690_100008484 3300005330 Bacteria 5921
33 Ga0070690_100281066 3300005330 Bacteria 1187
34 Ga0070690_100564603 3300005330 Bacteria 860
35 Ga0070670_100002945 3300005331 Bacteria 14100
36 Ga0070670_100003396 3300005331 Bacteria 13197
37 Ga0070670_100031821 3300005331 Bacteria 4543
38 Ga0070670_100031847 3300005331 Bacteria 4541
39 Ga0070670_100142612 3300005331 Bacteria 2072
40 Ga0070670_100192585 3300005331 Bacteria 1771
41 Ga0070670_100211503 3300005331 Bacteria 1686
42 Ga0070670_100451327 3300005331 Bacteria 1139
43 Ga0070677_10004927 3300005333 Bacteria 4385
44 Ga0070677_10113518 3300005333 Bacteria 1213
45 Ga0070677_10124964 3300005333 Bacteria 1167
46 Ga0070677_10539074 3300005333 Bacteria 638
47 Ga0068869_100010437 3300005334 Bacteria 6059
48 Ga0068869_100079132 3300005334 Bacteria 2449
49 Ga0068869_100131783 3300005334 Bacteria 1922
50 Ga0068869_100215705 3300005334 Bacteria 1519
51 Ga0068869_100474183 3300005334 Bacteria 1041
52 Ga0070666_10004785 3300005335 Bacteria 8276
53 Ga0070666_10017715 3300005335 Bacteria 4570
54 Ga0070666_11464255 3300005335 Bacteria 511
55 Ga0070682_100095524 3300005337 Bacteria 1952
56 Ga0068868_100021348 3300005338 Bacteria 4876
57 Ga0068868_100040586 3300005338 Bacteria 3622
58 Ga0068868_100053261 3300005338 Bacteria 3188
59 Ga0068868_100150983 3300005338 Bacteria 1913
60 Ga0068868_100164543 3300005338 Bacteria 1834
61 Ga0068868_100215368 3300005338 Bacteria 1607
62 Ga0068868_100530601 3300005338 Bacteria 1035
63 Ga0068868_100959383 3300005338 Bacteria 780
64 Ga0068868_101736923 3300005338 Bacteria 589
65 Ga0070660_100572679 3300005339 Bacteria 943
66 Ga0070689_100033724 3300005340 Bacteria 3903
67 Ga0070687_100026968 3300005343 Bacteria 2770
68 Ga0070661_100001215 3300005344 Bacteria 18159
69 Ga0070661_100005716 3300005344 Bacteria 8572
70 Ga0070661_100257266 3300005344 Bacteria 1349
71 Ga0070661_100443520 3300005344 Bacteria 1032
72 Ga0070661_101076802 3300005344 Bacteria 669
73 Ga0070661_101271271 3300005344 Bacteria 617
74 Ga0070668_100046525 3300005347 Bacteria 3332
75 Ga0070668_100050633 3300005347 Bacteria 3198
76 Ga0070668_100077404 3300005347 Bacteria 2600
77 Ga0070668_100262299 3300005347 Bacteria 1437
78 Ga0070668_100441036 3300005347 Bacteria 1118
79 Ga0070668_100811672 3300005347 Bacteria 832
80 Ga0070668_100880164 3300005347 Bacteria 800
81 Ga0070669_100016218 3300005353 Bacteria 5313
82 Ga0070669_100016562 3300005353 Bacteria 5261
83 Ga0070669_100022388 3300005353 Bacteria 4518
84 Ga0070669_100055186 3300005353 Bacteria 2911
85 Ga0070669_100055194 3300005353 Bacteria 2911
86 Ga0070669_100222615 3300005353 Bacteria 1492
87 Ga0070669_101170739 3300005353 Bacteria 663
88 Ga0070675_100001074 3300005354 Bacteria 19712
89 Ga0070675_100004946 3300005354 Bacteria 10167
90 Ga0070675_100044952 3300005354 Bacteria 3612
91 Ga0070675_100121446 3300005354 Bacteria 2220
92 Ga0070675_100357762 3300005354 Bacteria 1296
93 Ga0070675_100456561 3300005354 Bacteria 1146
94 Ga0070671_100008753 3300005355 Bacteria 8120
95 Ga0070671_100011652 3300005355 Bacteria 7073
96 Ga0070671_100012181 3300005355 Bacteria 6921
97 Ga0070671_100041182 3300005355 Bacteria 3838
98 Ga0070671_100046374 3300005355 Bacteria 3614
99 Ga0070671_100120743 3300005355 Bacteria 2205
100 Ga0070671_100140280 3300005355 Bacteria 2039
101 Ga0070671_100392597 3300005355 Bacteria 1186
102 Ga0070671_100439823 3300005355 Bacteria 1118
103 Ga0070671_100750748 3300005355 Bacteria 848
104 Ga0070674_100001889 3300005356 Bacteria 11372
105 Ga0070674_100010482 3300005356 Bacteria 5606
106 Ga0070674_100029268 3300005356 Bacteria 3625
107 Ga0070674_100170408 3300005356 Bacteria 1659
108 Ga0070674_100184544 3300005356 Bacteria 1600
109 Ga0070674_100553595 3300005356 Bacteria 965
110 Ga0070673_100003123 3300005364 Bacteria 10258
111 Ga0070673_100006921 3300005364 Bacteria 7418
112 Ga0070673_100220060 3300005364 Bacteria 1643
113 Ga0070673_100647932 3300005364 Bacteria 967
114 Ga0070673_100695042 3300005364 Bacteria 934
115 Ga0070673_100803572 3300005364 Bacteria 869
116 Ga0070673_100989001 3300005364 Bacteria 783
117 Ga0070688_100265590 3300005365 Bacteria 1227
118 Ga0070659_100000723 3300005366 Bacteria 23971
119 Ga0070659_100032574 3300005366 Bacteria 4043
120 Ga0070659_100193866 3300005366 Bacteria 1671
121 Ga0070659_100420844 3300005366 Bacteria 1130
122 Ga0070667_100002896 3300005367 Bacteria 14740
123 Ga0070667_100078756 3300005367 Bacteria 2816
124 Ga0070667_100123062 3300005367 Bacteria 2258
125 Ga0070667_100146965 3300005367 Bacteria 2068
126 Ga0070667_100252287 3300005367 Bacteria 1577
127 Ga0070667_100321313 3300005367 Bacteria 1397
128 Ga0070667_100370248 3300005367 Bacteria 1300
129 Ga0070667_101053700 3300005367 Bacteria 759
130 Ga0070701_10141149 3300005438 Bacteria 1378
131 Ga0070711_101397058 3300005439 Bacteria 609
132 Ga0070700_100009881 3300005441 Bacteria 5248
133 Ga0070700_100105426 3300005441 Bacteria 1864
134 Ga0070708_100084168 3300005445 Bacteria 2885
135 Ga0070708_100642709 3300005445 Bacteria 1000
136 Ga0070663_100092653 3300005455 Bacteria 2241
137 Ga0070663_100462485 3300005455 Bacteria 1048
138 Ga0070663_100947368 3300005455 Bacteria 746
139 Ga0070678_100004923 3300005456 Bacteria 7640
140 Ga0070678_100005243 3300005456 Bacteria 7462
141 Ga0070678_100016063 3300005456 Bacteria 4776
142 Ga0070678_100027101 3300005456 Bacteria 3886
143 Ga0070678_100039003 3300005456 Bacteria 3348
144 Ga0070678_100044185 3300005456 Bacteria 3180
145 Ga0070678_100051960 3300005456 Bacteria 2973
146 Ga0070678_100056220 3300005456 Bacteria 2877
147 Ga0070678_100119897 3300005456 Bacteria 2073
148 Ga0070678_100188654 3300005456 Bacteria 1693
149 Ga0070678_100400475 3300005456 Bacteria 1192
150 Ga0070678_100623908 3300005456 Bacteria 965
151 Ga0070678_100698515 3300005456 Bacteria 914
152 Ga0070662_100004188 3300005457 Bacteria 9091
153 Ga0070662_100019849 3300005457 Bacteria 4571
154 Ga0070662_100021799 3300005457 Bacteria 4378
155 Ga0070662_100703961 3300005457 Bacteria 855
156 Ga0070662_100994376 3300005457 Bacteria 718
157 Ga0068867_100000079 3300005459 Bacteria 59673
158 Ga0068867_100002677 3300005459 Bacteria 12567
159 Ga0068867_100003725 3300005459 Bacteria 10727
160 Ga0068867_100004243 3300005459 Bacteria 10087
161 Ga0068867_100018381 3300005459 Bacteria 4968
162 Ga0068867_100029977 3300005459 Bacteria 3923
163 Ga0068867_100047209 3300005459 Bacteria 3165
164 Ga0068867_100087432 3300005459 Bacteria 2360
165 Ga0068867_100144684 3300005459 Bacteria 1861
166 Ga0068867_100153708 3300005459 Bacteria 1809
167 Ga0068867_101196389 3300005459 Bacteria 698
168 Ga0070685_10108655 3300005466 Bacteria 1705
169 Ga0070685_10933210 3300005466 Bacteria 648
170 Ga0070706_100000388 3300005467 Bacteria 52771
171 Ga0070706_100707819 3300005467 Bacteria 934
172 Ga0070707_100045770 3300005468 Bacteria 4187
173 Ga0070698_100224986 3300005471 Bacteria 1809
174 Ga0070699_100032534 3300005518 Bacteria 4504
175 Ga0068853_100071178 3300005539 Bacteria 3028
176 Ga0068853_100988845 3300005539 Bacteria 810
177 Ga0068853_101051361 3300005539 Bacteria 784
178 Ga0068853_101092598 3300005539 Bacteria 769
179 Ga0068853_101458967 3300005539 Bacteria 662
180 Ga0070672_100002110 3300005543 Bacteria 12553
181 Ga0070672_100002387 3300005543 Bacteria 11886
182 Ga0070672_100009735 3300005543 Bacteria 6636
183 Ga0070672_100011517 3300005543 Bacteria 6169
184 Ga0070672_100012480 3300005543 Bacteria 5967
185 Ga0070672_100035389 3300005543 Bacteria 3796
186 Ga0070672_100051301 3300005543 Bacteria 3216
187 Ga0070672_100208365 3300005543 Bacteria 1637
188 Ga0070672_100256635 3300005543 Bacteria 1473
189 Ga0070672_101449552 3300005543 Bacteria 615
190 Ga0070686_100292510 3300005544 Bacteria 1205
191 Ga0070686_100458324 3300005544 Bacteria 982
192 Ga0070686_100566193 3300005544 Bacteria 891
193 Ga0070665_100059179 3300005548 Bacteria 3840
194 Ga0070665_100671884 3300005548 Bacteria 1049
195 Ga0070665_100842563 3300005548 Bacteria 930
196 Ga0070665_100869068 3300005548 Bacteria 915
197 Ga0070665_101135948 3300005548 Bacteria 792
198 Ga0068855_100268883 3300005563 Bacteria 1896
199 Ga0070664_100001692 3300005564 Bacteria 17677
200 Ga0070664_100015723 3300005564 Bacteria 6193
201 Ga0070664_100134859 3300005564 Bacteria 2170
202 Ga0070664_100181679 3300005564 Bacteria 1870
203 Ga0070664_100412579 3300005564 Bacteria 1236
204 Ga0070664_100451901 3300005564 Bacteria 1180
205 Ga0070664_100534136 3300005564 Bacteria 1083
206 Ga0070664_101345254 3300005564 Bacteria 675
207 Ga0068854_100008774 3300005578 Bacteria 6509
208 Ga0068854_100134318 3300005578 Bacteria 1893
209 Ga0068854_100187189 3300005578 Bacteria 1620
210 Ga0068854_101369313 3300005578 Bacteria 639
211 Ga0068856_100014533 3300005614 Bacteria 7608
212 Ga0070702_100218153 3300005615 Bacteria 1274
213 Ga0068852_100002342 3300005616 Bacteria 13038
214 Ga0068852_100013873 3300005616 Bacteria 6180
215 Ga0068852_100033844 3300005616 Bacteria 4247
216 Ga0068852_100070757 3300005616 Bacteria 3061
217 Ga0068852_100098149 3300005616 Bacteria 2637
218 Ga0068852_100123556 3300005616 Bacteria 2373
219 Ga0068852_100163928 3300005616 Bacteria 2078
220 Ga0068852_100168738 3300005616 Bacteria 2049
221 Ga0068852_100224990 3300005616 Bacteria 1786
222 Ga0068852_100232127 3300005616 Bacteria 1759
223 Ga0068852_100419638 3300005616 Bacteria 1319
224 Ga0068852_101322302 3300005616 Bacteria 743
225 Ga0068852_101505623 3300005616 Bacteria 695
226 Ga0068852_101574478 3300005616 Bacteria 679
227 Ga0068852_101754462 3300005616 Bacteria 643
228 Ga0068859_100008331 3300005617 Bacteria 10506
229 Ga0068859_100042005 3300005617 Bacteria 4592
230 Ga0068859_100053992 3300005617 Bacteria 4041
231 Ga0068859_100140939 3300005617 Bacteria 2484
232 Ga0068859_100358941 3300005617 Bacteria 1552
233 Ga0068859_100386532 3300005617 Bacteria 1495
234 Ga0068859_100404496 3300005617 Bacteria 1461
235 Ga0068859_100477529 3300005617 Bacteria 1342
236 Ga0068864_100005602 3300005618 Bacteria 10295
237 Ga0068864_100007343 3300005618 Bacteria 9068
238 Ga0068864_100023918 3300005618 Bacteria 5134
239 Ga0068864_100145039 3300005618 Bacteria 2145
240 Ga0068864_100224073 3300005618 Bacteria 1736
241 Ga0068864_100265575 3300005618 Bacteria 1598
242 Ga0068864_100416300 3300005618 Bacteria 1280
243 Ga0068864_100503571 3300005618 Bacteria 1165
244 Ga0068864_100874265 3300005618 Bacteria 887
245 Ga0068866_10006058 3300005718 Bacteria 5033
246 Ga0068866_10017005 3300005718 Bacteria 3264
247 Ga0068866_10063449 3300005718 Bacteria 1926
248 Ga0068866_10517039 3300005718 Bacteria 793
249 Ga0068861_100000916 3300005719 Bacteria 17885
250 Ga0068861_100002512 3300005719 Bacteria 11972
251 Ga0068861_100004282 3300005719 Bacteria 9569
252 Ga0068861_100024071 3300005719 Bacteria 4400
253 Ga0068861_100244571 3300005719 Bacteria 1528
254 Ga0068861_100297274 3300005719 Bacteria 1397
255 Ga0068861_100388238 3300005719 Bacteria 1235
256 Ga0068861_100683431 3300005719 Bacteria 952
257 Ga0068861_101446057 3300005719 Bacteria 673
258 Ga0068870_10043103 3300005840 Bacteria 2352
259 Ga0068870_10169712 3300005840 Bacteria 1301
260 Ga0068870_10635584 3300005840 Bacteria 729
261 Ga0068863_100011592 3300005841 Bacteria 8530
262 Ga0068863_100033604 3300005841 Bacteria 4886
263 Ga0068863_100179239 3300005841 Bacteria 2034
264 Ga0068863_100767492 3300005841 Bacteria 961
265 Ga0068863_100880125 3300005841 Bacteria 895
266 Ga0068858_100002455 3300005842 Bacteria 18716
267 Ga0068858_100006422 3300005842 Bacteria 11450
268 Ga0068858_100179919 3300005842 Bacteria 1996
269 Ga0068858_100518840 3300005842 Bacteria 1152
270 Ga0068858_100647385 3300005842 Bacteria 1027
271 Ga0068860_100001051 3300005843 Bacteria 30438
272 Ga0068860_100019363 3300005843 Bacteria 6602
273 Ga0068860_100020361 3300005843 Bacteria 6426
274 Ga0068860_100023436 3300005843 Bacteria 5965
275 Ga0068860_100035689 3300005843 Bacteria 4768
276 Ga0068860_100043046 3300005843 Bacteria 4309
277 Ga0068860_100102320 3300005843 Bacteria 2733
278 Ga0068860_100104582 3300005843 Bacteria 2703
279 Ga0068860_100291526 3300005843 Bacteria 1597
280 Ga0068860_100598434 3300005843 Bacteria 1108
281 Ga0068860_100995219 3300005843 Bacteria 856
282 Ga0068862_100010381 3300005844 Bacteria 7685
283 Ga0068862_100011264 3300005844 Bacteria 7383
284 Ga0068862_100012691 3300005844 Bacteria 6973
285 Ga0068862_100032625 3300005844 Bacteria 4401
286 Ga0068862_100049105 3300005844 Bacteria 3604
287 Ga0068862_100188750 3300005844 Bacteria 1853
288 Ga0081455_10043225 3300005937 Bacteria 3944
289 Ga0081539_10442486 3300005985 Bacteria 539
290 Ga0070717_10453466 3300006028 Bacteria 1156
291 Ga0075368_10012661 3300006042 Bacteria 3090
292 Ga0075368_10022244 3300006042 Bacteria 2413
293 Ga0075368_10148408 3300006042 Bacteria 979
294 Ga0075363_100261761 3300006048 Bacteria 998
295 Ga0075363_100485990 3300006048 Bacteria 732
296 Ga0075363_100714824 3300006048 Bacteria 606
297 Ga0075362_10007978 3300006177 Bacteria 4032
298 Ga0075362_10075269 3300006177 Bacteria 1548
299 Ga0075362_10154932 3300006177 Bacteria 1101
300 Ga0075362_10441876 3300006177 Bacteria 660
301 Ga0075367_10008207 3300006178 Bacteria 5398
302 Ga0075367_10017465 3300006178 Bacteria 3939
303 Ga0075367_10052138 3300006178 Bacteria 2420
304 Ga0075367_10097573 3300006178 Bacteria 1793
305 Ga0075367_10774202 3300006178 Bacteria 611
306 Ga0075369_10012220 3300006186 Bacteria 3390
307 Ga0075366_10000121 3300006195 Bacteria 32479
308 Ga0075366_10000536 3300006195 Bacteria 17636
309 Ga0075366_10025493 3300006195 Bacteria 3454
310 Ga0075366_10054075 3300006195 Bacteria 2385
311 Ga0075366_10063868 3300006195 Bacteria 2189
312 Ga0075366_10085112 3300006195 Bacteria 1891
313 Ga0075366_10209294 3300006195 Bacteria 1187
314 Ga0075366_10225859 3300006195 Bacteria 1141
315 Ga0075366_10232136 3300006195 Bacteria 1124
316 Ga0075366_10255281 3300006195 Bacteria 1070
317 Ga0075366_10282218 3300006195 Bacteria 1015
318 Ga0075366_10285903 3300006195 Bacteria 1008
319 Ga0075366_10383141 3300006195 Bacteria 865
320 Ga0075366_10393438 3300006195 Bacteria 853
321 Ga0075366_10776982 3300006195 Bacteria 595
322 Ga0075366_10831839 3300006195 Bacteria 574
323 Ga0097621_100005695 3300006237 Bacteria 8798
324 Ga0097621_100044960 3300006237 Bacteria 3565
325 Ga0097621_100057237 3300006237 Bacteria 3187
326 Ga0097621_100128831 3300006237 Bacteria 2152
327 Ga0097621_100307947 3300006237 Bacteria 1400
328 Ga0097621_100545435 3300006237 Bacteria 1055
329 Ga0097621_100883123 3300006237 Bacteria 832
330 Ga0097621_101311580 3300006237 Bacteria 684
331 Ga0097621_101366939 3300006237 Bacteria 670
332 Ga0097621_101501119 3300006237 Bacteria 639
333 Ga0075370_10000705 3300006353 Bacteria 13193
334 Ga0075370_10000999 3300006353 Bacteria 11688
335 Ga0075370_10007983 3300006353 Bacteria 5425
336 Ga0075370_10008114 3300006353 Bacteria 5390
337 Ga0075370_10078337 3300006353 Bacteria 1898
338 Ga0075370_10084491 3300006353 Bacteria 1827
339 Ga0075370_10171490 3300006353 Bacteria 1275
340 Ga0075370_10370565 3300006353 Bacteria 857
341 Ga0068871_100035181 3300006358 Bacteria 3978
342 Ga0068871_100260569 3300006358 Bacteria 1512
343 Ga0068871_100271785 3300006358 Bacteria 1481
344 Ga0068871_100276225 3300006358 Bacteria 1469
345 Ga0068871_101128782 3300006358 Bacteria 734
346 Ga0075430_100008491 3300006846 Bacteria 8678
347 Ga0075430_100958650 3300006846 Bacteria 705
348 Ga0075429_100048278 3300006880 Bacteria 3702
349 Ga0068865_100002308 3300006881 Bacteria 11233
350 Ga0068865_100006584 3300006881 Bacteria 7102
351 Ga0068865_100052659 3300006881 Bacteria 2822
352 Ga0068865_100052989 3300006881 Bacteria 2814
353 Ga0068865_100216585 3300006881 Bacteria 1495
354 Ga0068865_100243598 3300006881 Bacteria 1416
355 Ga0097620_100008331 3300006931 Bacteria 10506
356 Ga0097620_100042008 3300006931 Bacteria 4592
357 Ga0097620_100053994 3300006931 Bacteria 4041
358 Ga0097620_100140937 3300006931 Bacteria 2484
359 Ga0097620_100358958 3300006931 Bacteria 1552
360 Ga0097620_100386570 3300006931 Bacteria 1495
361 Ga0097620_100404507 3300006931 Bacteria 1461
362 Ga0097620_100477477 3300006931 Bacteria 1342
363 Ga0079104_1000024 3300006946 Bacteria 219543
364 Ga0105240_10078384 3300009093 Bacteria 4068
365 Ga0105240_10085973 3300009093 Bacteria 3852
366 Ga0111539_10232900 3300009094 Bacteria 2144
367 Ga0105245_10027266 3300009098 Bacteria 5034
368 Ga0105245_10045478 3300009098 Bacteria 3921
369 Ga0105245_10532769 3300009098 Bacteria 1194
370 Ga0105245_10779927 3300009098 Bacteria 993
371 Ga0114129_12424483 3300009147 Bacteria 628
372 Ga0105243_10001414 3300009148 Bacteria 21209
373 Ga0105243_10015036 3300009148 Bacteria 5858
374 Ga0105243_10121198 3300009148 Bacteria 2205
375 Ga0105243_10135741 3300009148 Bacteria 2093
376 Ga0105243_10374466 3300009148 Bacteria 1315
377 Ga0105243_10765584 3300009148 Bacteria 948
378 Ga0105242_10004409 3300009176 Bacteria 10944
379 Ga0105242_10604408 3300009176 Bacteria 1060
380 Ga0105242_11562968 3300009176 Bacteria 692
381 Ga0105248_10048306 3300009177 Bacteria 4773
382 Ga0105248_10073710 3300009177 Bacteria 3836
383 Ga0105248_10076756 3300009177 Bacteria 3755
384 Ga0105248_10117326 3300009177 Bacteria 3002
385 Ga0105248_10207344 3300009177 Bacteria 2209
386 Ga0105248_10348108 3300009177 Bacteria 1668
387 Ga0105248_10377086 3300009177 Bacteria 1597
388 Ga0105248_10529126 3300009177 Bacteria 1329
389 Ga0105248_11210995 3300009177 Bacteria 854
390 Ga0105237_10010812 3300009545 Bacteria 9685
391 Ga0105238_10046827 3300009551 Bacteria 4361
392 Ga0105238_11020556 3300009551 Bacteria 848
393 Ga0105238_11115523 3300009551 Bacteria 812
394 Ga0105249_10002420 3300009553 Bacteria 16206
395 Ga0105249_10014239 3300009553 Bacteria 7032
396 Ga0105249_10059825 3300009553 Bacteria 3494
397 Ga0105249_10206031 3300009553 Bacteria 1927
398 Ga0105249_10487538 3300009553 Bacteria 1276
399 Ga0105249_10876576 3300009553 Bacteria 964
400 Ga0105249_12165789 3300009553 Bacteria 629
401 Ga0105239_10065573 3300010375 Bacteria 3988
402 Ga0105239_11195609 3300010375 Bacteria 876
403 Ga0105239_11580766 3300010375 Bacteria 758
404 Ga0105246_10167749 3300011119 Bacteria 1678
405 Ga0105246_10480631 3300011119 Bacteria 1051
406 Ga0105246_10808118 3300011119 Bacteria 833
407 Ga0105246_11513535 3300011119 Bacteria 631
408 Ga0157346_1026995 3300012480 Bacteria 538
409 Ga0157329_1036603 3300012491 Bacteria 533
410 Ga0157341_1042703 3300012494 Bacteria 530
411 Ga0157315_1016450 3300012508 Bacteria 733
412 Ga0157373_10068417 3300013100 Bacteria 2510
413 Ga0157371_10035457 3300013102 Bacteria 3574
414 Ga0157370_10201463 3300013104 Bacteria 1846
415 Ga0157369_10581150 3300013105 Bacteria 1157
416 Ga0157369_10581418 3300013105 Bacteria 1157
417 Ga0157369_12358616 3300013105 Bacteria 539
418 Ga0157374_10038281 3300013296 Bacteria 4407
419 Ga0157374_10118034 3300013296 Bacteria 2558
420 Ga0157378_10000567 3300013297 Bacteria 35017
421 Ga0157378_10001209 3300013297 Bacteria 23439
422 Ga0157378_10081401 3300013297 Bacteria 2927
423 Ga0157378_10180499 3300013297 Bacteria 1986
424 Ga0157378_10182223 3300013297 Bacteria 1976
425 Ga0157378_10723242 3300013297 Bacteria 1016
426 Ga0157378_10883532 3300013297 Bacteria 924
427 Ga0157378_10956304 3300013297 Bacteria 889
428 Ga0157378_11431410 3300013297 Bacteria 735
429 Ga0163162_10002747 3300013306 Bacteria 16701
430 Ga0163162_10008943 3300013306 Bacteria 9736
431 Ga0163162_10017073 3300013306 Bacteria 7100
432 Ga0163162_10048699 3300013306 Bacteria 4247
433 Ga0163162_10084702 3300013306 Bacteria 3246
434 Ga0163162_10238209 3300013306 Bacteria 1950
435 Ga0163162_10455887 3300013306 Bacteria 1410
436 Ga0163162_10560542 3300013306 Bacteria 1270
437 Ga0163162_10749902 3300013306 Bacteria 1096
438 Ga0163162_11334526 3300013306 Bacteria 815
439 Ga0157372_10140193 3300013307 Bacteria 2785
440 Ga0157372_10220205 3300013307 Bacteria 2200
441 Ga0157375_10011944 3300013308 Bacteria 7686
442 Ga0157375_10024840 3300013308 Bacteria 5553
443 Ga0157375_10025951 3300013308 Bacteria 5454
444 Ga0157375_10031475 3300013308 Bacteria 5016
445 Ga0157375_10035899 3300013308 Bacteria 4736
446 Ga0157375_10063842 3300013308 Bacteria 3665
447 Ga0157375_10074725 3300013308 Bacteria 3411
448 Ga0157375_10082231 3300013308 Bacteria 3262
449 Ga0157375_10087312 3300013308 Bacteria 3171
450 Ga0157375_10165372 3300013308 Bacteria 2357
451 Ga0157375_10440897 3300013308 Bacteria 1468
452 Ga0163163_10007006 3300014325 Bacteria 9903
453 Ga0163163_10079621 3300014325 Bacteria 3275
454 Ga0163163_10117640 3300014325 Bacteria 2690
455 Ga0163163_11046215 3300014325 Bacteria 879
456 Ga0163163_11648197 3300014325 Bacteria 702
457 Ga0157380_10004553 3300014326 Bacteria 9622
458 Ga0157380_10009086 3300014326 Bacteria 7102
459 Ga0157380_10011560 3300014326 Bacteria 6380
460 Ga0157380_10013534 3300014326 Bacteria 5952
461 Ga0157380_10066272 3300014326 Bacteria 2904
462 Ga0157380_10264791 3300014326 Bacteria 1563
463 Ga0157380_10275266 3300014326 Bacteria 1537
464 Ga0157380_10382161 3300014326 Bacteria 1329
465 Ga0157380_11098478 3300014326 Bacteria 834
466 Ga0157380_12708126 3300014326 Bacteria 562
467 Ga0182008_10351149 3300014497 Bacteria 782
468 Ga0157377_10000073 3300014745 Bacteria 78124
469 Ga0157377_10101662 3300014745 Bacteria 1714
470 Ga0157377_10272733 3300014745 Bacteria 1105
471 Ga0157379_10013116 3300014968 Bacteria 7255
472 Ga0157379_10015882 3300014968 Bacteria 6618
473 Ga0157379_10034932 3300014968 Bacteria 4482
474 Ga0157379_10040190 3300014968 Bacteria 4173
475 Ga0157379_10041939 3300014968 Bacteria 4085
476 Ga0157379_10047216 3300014968 Bacteria 3841
477 Ga0157379_10048962 3300014968 Bacteria 3773
478 Ga0157379_10078386 3300014968 Bacteria 2959
479 Ga0157379_10226462 3300014968 Bacteria 1694
480 Ga0157379_10445804 3300014968 Bacteria 1194
481 Ga0157379_10472095 3300014968 Bacteria 1160
482 Ga0157376_10100385 3300014969 Bacteria 2527
483 Ga0157376_10132414 3300014969 Bacteria 2227
484 Ga0157376_10143969 3300014969 Bacteria 2142
485 Ga0157376_10164662 3300014969 Bacteria 2013
486 Ga0157376_10435599 3300014969 Bacteria 1275
487 Ga0157376_10466310 3300014969 Bacteria 1235
488 Ga0157376_10938376 3300014969 Bacteria 885
489 Ga0157376_12176629 3300014969 Bacteria 593
490 Ga0182007_10141850 3300015262 Bacteria 813
491 Ga0163161_10079208 3300017792 Bacteria 2416
492 Ga0163161_10257063 3300017792 Bacteria 1363
493 Ga0163161_11886003 3300017792 Bacteria 532
494 Ga0206353_10340014 3300020082 Bacteria 595
495 Ga0213872_10000011 3300021361 Bacteria 194139
496 Ga0213876_10349223 3300021384 Bacteria 787
497 Ga0207425_1004510 3300025245 Bacteria 4149
498 Ga0209129_1000115 3300025258 Bacteria 141048
499 Ga0209565_1020041 3300025263 Bacteria 1418
500 Ga0209565_1047064 3300025263 Bacteria 785
501 Ga0209673_1003830 3300025273 Bacteria 8505
502 Ga0209675_1009539 3300025291 Bacteria 3419
503 Ga0209564_1000053 3300025295 Bacteria 351452
504 Ga0209758_1000089 3300025297 Bacteria 251523
505 Ga0209758_1000225 3300025297 Bacteria 121158
506 Ga0209050_1001012 3300025298 Bacteria 35092
507 Ga0209050_1001139 3300025298 Bacteria 32004
508 Ga0209050_1028981 3300025298 Bacteria 1783
509 Ga0209050_1056335 3300025298 Bacteria 957
510 Ga0209256_1000011 3300025299 Bacteria 865309
511 Ga0209051_1000016 3300025303 Bacteria 541891
512 Ga0209051_1015716 3300025303 Bacteria 3468
513 Ga0209051_1042436 3300025303 Bacteria 1608
514 Ga0209051_1109657 3300025303 Bacteria 723
515 Ga0209257_1000017 3300025304 Bacteria 866287
516 Ga0209257_1000102 3300025304 Bacteria 251074
517 Ga0209257_1014398 3300025304 Bacteria 3401
518 Ga0207697_10019200 3300025315 Bacteria 2800
519 Ga0207697_10105557 3300025315 Bacteria 1203
520 Ga0207656_10041960 3300025321 Bacteria 1945
521 Ga0207682_10000464 3300025893 Bacteria 18759
522 Ga0207682_10044992 3300025893 Bacteria 1811
523 Ga0207682_10055331 3300025893 Bacteria 1650
524 Ga0207682_10060463 3300025893 Bacteria 1585
525 Ga0207642_10040918 3300025899 Bacteria 2025
526 Ga0207642_10041429 3300025899 Bacteria 2016
527 Ga0207642_10112375 3300025899 Bacteria 1390
528 Ga0207642_10592602 3300025899 Bacteria 689
529 Ga0207688_10097759 3300025901 Bacteria 1692
530 Ga0207688_10104298 3300025901 Bacteria 1640
531 Ga0207680_10003607 3300025903 Bacteria 7270
532 Ga0207680_10031392 3300025903 Bacteria 3008
533 Ga0207680_10177329 3300025903 Bacteria 1439
534 Ga0207645_10007783 3300025907 Bacteria 7540
535 Ga0207645_10017709 3300025907 Bacteria 4697
536 Ga0207645_10029405 3300025907 Bacteria 3543
537 Ga0207645_10101586 3300025907 Bacteria 1856
538 Ga0207645_10189086 3300025907 Bacteria 1353
539 Ga0207645_10195878 3300025907 Bacteria 1328
540 Ga0207645_10791775 3300025907 Bacteria 645
541 Ga0207645_10900830 3300025907 Bacteria 601
542 Ga0207643_10105367 3300025908 Bacteria 1657
543 Ga0207643_10193045 3300025908 Bacteria 1237
544 Ga0207643_10396330 3300025908 Bacteria 872
545 Ga0207643_10532373 3300025908 Bacteria 753
546 Ga0207643_10593938 3300025908 Bacteria 712
547 Ga0207705_10088565 3300025909 Bacteria 2264
548 Ga0207705_10909661 3300025909 Bacteria 681
549 Ga0207684_10006285 3300025910 Bacteria 10836
550 Ga0207695_10295578 3300025913 Bacteria 1511
551 Ga0207695_10751001 3300025913 Bacteria 856
552 Ga0207671_10057040 3300025914 Bacteria 2894
553 Ga0207662_10035905 3300025918 Bacteria 2896
554 Ga0207657_10057735 3300025919 Bacteria 3343
555 Ga0207657_10634315 3300025919 Bacteria 832
556 Ga0207649_10010047 3300025920 Bacteria 5193
557 Ga0207649_10102174 3300025920 Bacteria 1900
558 Ga0207649_10179676 3300025920 Bacteria 1480
559 Ga0207649_10432904 3300025920 Bacteria 990
560 Ga0207649_10766649 3300025920 Bacteria 751
561 Ga0207646_10123419 3300025922 Bacteria 2328
562 Ga0207681_10012069 3300025923 Bacteria 5323
563 Ga0207681_10017669 3300025923 Bacteria 4481
564 Ga0207681_10080068 3300025923 Bacteria 2303
565 Ga0207681_10170625 3300025923 Bacteria 1648
566 Ga0207681_10419230 3300025923 Bacteria 1084
567 Ga0207681_11151880 3300025923 Bacteria 651
568 Ga0207694_10022930 3300025924 Bacteria 4736
569 Ga0207694_10881666 3300025924 Bacteria 756
570 Ga0207650_10009593 3300025925 Bacteria 6619
571 Ga0207650_10022623 3300025925 Bacteria 4450
572 Ga0207650_10032436 3300025925 Bacteria 3778
573 Ga0207650_10043137 3300025925 Bacteria 3310
574 Ga0207650_10077233 3300025925 Bacteria 2517
575 Ga0207650_10213912 3300025925 Bacteria 1549
576 Ga0207659_10005586 3300025926 Bacteria 7634
577 Ga0207659_10009813 3300025926 Bacteria 5993
578 Ga0207659_10059558 3300025926 Bacteria 2745
579 Ga0207659_10124602 3300025926 Bacteria 1980
580 Ga0207659_10148548 3300025926 Bacteria 1828
581 Ga0207687_10012905 3300025927 Bacteria 5460
582 Ga0207687_10043124 3300025927 Bacteria 3107
583 Ga0207687_10400813 3300025927 Bacteria 1128
584 Ga0207687_11465507 3300025927 Bacteria 586
585 Ga0207644_10017836 3300025931 Bacteria 4800
586 Ga0207644_10056380 3300025931 Bacteria 2835
587 Ga0207644_10066902 3300025931 Bacteria 2617
588 Ga0207644_10067099 3300025931 Bacteria 2614
589 Ga0207644_10109498 3300025931 Bacteria 2087
590 Ga0207644_10116412 3300025931 Bacteria 2028
591 Ga0207644_10138917 3300025931 Bacteria 1869
592 Ga0207644_10982184 3300025931 Bacteria 708
593 Ga0207690_10001849 3300025932 Bacteria 13005
594 Ga0207690_10010869 3300025932 Bacteria 5424
595 Ga0207690_10437020 3300025932 Bacteria 1049
596 Ga0207690_10774750 3300025932 Bacteria 792
597 Ga0207706_10005606 3300025933 Bacteria 11694
598 Ga0207706_10021550 3300025933 Bacteria 5785
599 Ga0207706_10024229 3300025933 Bacteria 5441
600 Ga0207706_10033089 3300025933 Bacteria 4602
601 Ga0207706_10131856 3300025933 Bacteria 2198
602 Ga0207706_11246554 3300025933 Bacteria 616
603 Ga0207686_10253195 3300025934 Bacteria 1287
604 Ga0207686_10520784 3300025934 Bacteria 925
605 Ga0207709_10001791 3300025935 Bacteria 14395
606 Ga0207709_10009056 3300025935 Bacteria 5489
607 Ga0207709_10041618 3300025935 Bacteria 2758
608 Ga0207709_10050623 3300025935 Bacteria 2541
609 Ga0207709_10295188 3300025935 Bacteria 1203
610 Ga0207709_10622230 3300025935 Bacteria 857
611 Ga0207709_10902504 3300025935 Bacteria 718
612 Ga0207670_10022243 3300025936 Bacteria 3927
613 Ga0207670_10383037 3300025936 Bacteria 1121
614 Ga0207669_10002776 3300025937 Bacteria 7508
615 Ga0207669_10010885 3300025937 Bacteria 4399
616 Ga0207669_10017886 3300025937 Bacteria 3649
617 Ga0207669_10109905 3300025937 Bacteria 1845
618 Ga0207669_10266175 3300025937 Bacteria 1285
619 Ga0207669_10664416 3300025937 Bacteria 853
620 Ga0207704_10004171 3300025938 Bacteria 6594
621 Ga0207704_10013443 3300025938 Bacteria 4096
622 Ga0207704_10031821 3300025938 Bacteria 2977
623 Ga0207704_10080365 3300025938 Bacteria 2104
624 Ga0207704_10091273 3300025938 Bacteria 2001
625 Ga0207704_10224438 3300025938 Bacteria 1392
626 Ga0207704_10540035 3300025938 Bacteria 946
627 Ga0207704_11341823 3300025938 Bacteria 612
628 Ga0207704_11803998 3300025938 Bacteria 526
629 Ga0207665_10373425 3300025939 Bacteria 1081
630 Ga0207691_10001003 3300025940 Bacteria 28006
631 Ga0207691_10001319 3300025940 Bacteria 24755
632 Ga0207691_10022193 3300025940 Bacteria 5987
633 Ga0207691_10023049 3300025940 Bacteria 5865
634 Ga0207691_10033193 3300025940 Bacteria 4806
635 Ga0207691_10043476 3300025940 Bacteria 4141
636 Ga0207691_10053766 3300025940 Bacteria 3675
637 Ga0207691_10078068 3300025940 Bacteria 2981
638 Ga0207691_10305023 3300025940 Bacteria 1367
639 Ga0207691_10361968 3300025940 Bacteria 1240
640 Ga0207691_10366792 3300025940 Bacteria 1230
641 Ga0207691_10456327 3300025940 Bacteria 1087
642 Ga0207691_10681016 3300025940 Bacteria 868
643 Ga0207711_10011484 3300025941 Bacteria 7362
644 Ga0207711_10065234 3300025941 Bacteria 3147
645 Ga0207711_10080538 3300025941 Bacteria 2844
646 Ga0207711_10097797 3300025941 Bacteria 2592
647 Ga0207711_10323614 3300025941 Bacteria 1425
648 Ga0207711_10908616 3300025941 Bacteria 818
649 Ga0207689_10008439 3300025942 Bacteria 8973
650 Ga0207689_10698366 3300025942 Bacteria 855
651 Ga0207689_11009461 3300025942 Bacteria 702
652 Ga0207689_11052557 3300025942 Bacteria 686
653 Ga0207689_11183835 3300025942 Bacteria 643
654 Ga0207661_10135164 3300025944 Bacteria 2117
655 Ga0207661_10407549 3300025944 Bacteria 1233
656 Ga0207679_10000245 3300025945 Bacteria 41439
657 Ga0207679_10023033 3300025945 Bacteria 4251
658 Ga0207679_10135028 3300025945 Bacteria 1985
659 Ga0207679_10394518 3300025945 Bacteria 1216
660 Ga0207679_10471805 3300025945 Bacteria 1116
661 Ga0207679_10542761 3300025945 Bacteria 1042
662 Ga0207679_10778477 3300025945 Bacteria 871
663 Ga0207679_11071856 3300025945 Bacteria 739
664 Ga0207667_10199502 3300025949 Bacteria 2053
665 Ga0207651_10001024 3300025960 Bacteria 12338
666 Ga0207651_10027786 3300025960 Bacteria 3559
667 Ga0207651_10048368 3300025960 Bacteria 2874
668 Ga0207651_10396105 3300025960 Bacteria 1173
669 Ga0207651_10427334 3300025960 Bacteria 1132
670 Ga0207651_10570905 3300025960 Bacteria 986
671 Ga0207651_10794731 3300025960 Bacteria 838
672 Ga0207651_11100031 3300025960 Bacteria 712
673 Ga0207712_10042252 3300025961 Bacteria 3137
674 Ga0207712_10093243 3300025961 Bacteria 2222
675 Ga0207712_10784411 3300025961 Bacteria 837
676 Ga0207668_10051734 3300025972 Bacteria 2838
677 Ga0207668_10069830 3300025972 Bacteria 2503
678 Ga0207668_10488265 3300025972 Bacteria 1057
679 Ga0207668_10778005 3300025972 Bacteria 846
680 Ga0207640_10070831 3300025981 Bacteria 2346
681 Ga0207640_10071752 3300025981 Bacteria 2334
682 Ga0207640_10124844 3300025981 Bacteria 1851
683 Ga0207658_10000412 3300025986 Bacteria 40643
684 Ga0207658_10003143 3300025986 Bacteria 11814
685 Ga0207658_10039073 3300025986 Bacteria 3423
686 Ga0207658_10071363 3300025986 Bacteria 2630
687 Ga0207658_10123427 3300025986 Bacteria 2069
688 Ga0207658_10212686 3300025986 Bacteria 1621
689 Ga0207658_10420753 3300025986 Bacteria 1178
690 Ga0207658_10454770 3300025986 Bacteria 1134
691 Ga0207658_11533554 3300025986 Bacteria 609
692 Ga0207677_10001922 3300026023 Bacteria 10987
693 Ga0207677_10014819 3300026023 Bacteria 4566
694 Ga0207677_10189470 3300026023 Bacteria 1625
695 Ga0207677_10228189 3300026023 Bacteria 1498
696 Ga0207677_10327721 3300026023 Bacteria 1275
697 Ga0207677_10349338 3300026023 Bacteria 1239
698 Ga0207677_10383524 3300026023 Bacteria 1187
699 Ga0207677_10526953 3300026023 Bacteria 1026
700 Ga0207677_10824450 3300026023 Bacteria 832
701 Ga0207703_10002152 3300026035 Bacteria 17313
702 Ga0207703_10019182 3300026035 Bacteria 5342
703 Ga0207703_10179594 3300026035 Bacteria 1867
704 Ga0207703_10605407 3300026035 Bacteria 1037
705 Ga0207639_10101195 3300026041 Bacteria 2329
706 Ga0207639_10266337 3300026041 Bacteria 1501
707 Ga0207639_10339564 3300026041 Bacteria 1339
708 Ga0207639_11630032 3300026041 Bacteria 605
709 Ga0207678_10274565 3300026067 Bacteria 1446
710 Ga0207678_10930798 3300026067 Bacteria 769
711 Ga0207708_10018995 3300026075 Bacteria 5176
712 Ga0207708_10065350 3300026075 Bacteria 2780
713 Ga0207708_10334219 3300026075 Bacteria 1239
714 Ga0207702_10031176 3300026078 Bacteria 4443
715 Ga0207702_10314324 3300026078 Bacteria 1490
716 Ga0207641_10001478 3300026088 Bacteria 23038
717 Ga0207641_10038622 3300026088 Bacteria 3991
718 Ga0207641_10057522 3300026088 Bacteria 3307
719 Ga0207641_10257587 3300026088 Bacteria 1632
720 Ga0207641_10394265 3300026088 Bacteria 1328
721 Ga0207641_10607407 3300026088 Bacteria 1071
722 Ga0207641_10785681 3300026088 Bacteria 941
723 Ga0207641_11045739 3300026088 Bacteria 814
724 Ga0207641_11898398 3300026088 Bacteria 597
725 Ga0207648_10000115 3300026089 Bacteria 77967
726 Ga0207648_10000393 3300026089 Bacteria 48485
727 Ga0207648_10006439 3300026089 Bacteria 11668
728 Ga0207648_10007133 3300026089 Bacteria 11021
729 Ga0207648_10007458 3300026089 Bacteria 10752
730 Ga0207648_10034806 3300026089 Bacteria 4440
731 Ga0207648_10101494 3300026089 Bacteria 2521
732 Ga0207648_10171811 3300026089 Bacteria 1916
733 Ga0207648_10550020 3300026089 Bacteria 1060
734 Ga0207648_10562740 3300026089 Bacteria 1048
735 Ga0207676_10005107 3300026095 Bacteria 9292
736 Ga0207676_10033451 3300026095 Bacteria 3884
737 Ga0207676_10078488 3300026095 Bacteria 2674
738 Ga0207676_10107777 3300026095 Bacteria 2324
739 Ga0207676_10202268 3300026095 Bacteria 1756
740 Ga0207676_10223688 3300026095 Bacteria 1678
741 Ga0207676_11856262 3300026095 Bacteria 601
742 Ga0207675_100001455 3300026118 Bacteria 23732
743 Ga0207675_100001936 3300026118 Bacteria 20662
744 Ga0207675_100004856 3300026118 Bacteria 12955
745 Ga0207675_100061232 3300026118 Bacteria 3514
746 Ga0207675_100266015 3300026118 Bacteria 1663
747 Ga0207675_100324108 3300026118 Bacteria 1505
748 Ga0207675_100547591 3300026118 Bacteria 1156
749 Ga0207683_10007307 3300026121 Bacteria 9466
750 Ga0207683_10011209 3300026121 Bacteria 7641
751 Ga0207683_10017172 3300026121 Bacteria 6162
752 Ga0207683_10017698 3300026121 Bacteria 6076
753 Ga0207683_10034463 3300026121 Bacteria 4399
754 Ga0207683_10043957 3300026121 Bacteria 3904
755 Ga0207683_10074279 3300026121 Bacteria 3008
756 Ga0207683_10083984 3300026121 Bacteria 2830
757 Ga0207683_10096181 3300026121 Bacteria 2641
758 Ga0207683_10128227 3300026121 Bacteria 2281
759 Ga0207683_10229106 3300026121 Bacteria 1694
760 Ga0207683_10230894 3300026121 Bacteria 1687
761 Ga0207683_10282631 3300026121 Bacteria 1516
762 Ga0207683_10437375 3300026121 Bacteria 1205
763 Ga0207683_10574556 3300026121 Bacteria 1043
764 Ga0207683_10728581 3300026121 Bacteria 920
765 Ga0207683_11773269 3300026121 Bacteria 566
766 Ga0207698_10013996 3300026142 Bacteria 5315
767 Ga0207698_10053580 3300026142 Bacteria 3098
768 Ga0207698_10068091 3300026142 Bacteria 2810
769 Ga0207698_10179076 3300026142 Bacteria 1876
770 Ga0207698_10202023 3300026142 Bacteria 1780
771 Ga0207698_10202502 3300026142 Bacteria 1779
772 Ga0207698_10639814 3300026142 Bacteria 1052
773 Ga0207698_11213389 3300026142 Bacteria 768
774 Ga0209281_1000104 3300027111 Bacteria 221056
775 Ga0209996_1014202 3300027395 Bacteria 1081
776 Ga0209968_1001970 3300027526 Bacteria 3123
777 Ga0209966_1000031 3300027695 Bacteria 63685
778 Ga0209813_10020845 3300027866 Bacteria 1838
779 Ga0209813_10233275 3300027866 Bacteria 693
780 Ga0268266_10287066 3300028379 Bacteria 1531
781 Ga0268266_10329027 3300028379 Bacteria 1432
782 Ga0268266_10418829 3300028379 Bacteria 1269
783 Ga0268266_10454468 3300028379 Bacteria 1218
784 Ga0268266_10769666 3300028379 Bacteria 929
785 Ga0268266_11547263 3300028379 Bacteria 639
786 Ga0268265_10004374 3300028380 Bacteria 9820
787 Ga0268265_10010714 3300028380 Bacteria 6190
788 Ga0268265_10011023 3300028380 Bacteria 6106
789 Ga0268265_10024708 3300028380 Bacteria 4255
790 Ga0268265_10035841 3300028380 Bacteria 3629
791 Ga0268265_11514610 3300028380 Bacteria 674
792 Ga0268264_10001095 3300028381 Bacteria 26753
793 Ga0268264_10004613 3300028381 Bacteria 11712
794 Ga0268264_10018783 3300028381 Bacteria 5652
795 Ga0268264_10051579 3300028381 Bacteria 3428
796 Ga0268264_10111176 3300028381 Bacteria 2400
797 Ga0268264_10155377 3300028381 Bacteria 2055
798 Ga0268264_10737706 3300028381 Bacteria 980
799 Ga0268264_11246371 3300028381 Bacteria 753
800 Ga0307517_10221059 3300028786 Bacteria 1151
801 Ga0307517_10432650 3300028786 Bacteria 687
802 Ga0307517_10475760 3300028786 Bacteria 641
803 Ga0307515_10000043 3300028794 Bacteria 304612
804 Ga0307515_10005581 3300028794 Bacteria 25423
805 Ga0307515_10016830 3300028794 Bacteria 13366
806 Ga0307515_10045534 3300028794 Bacteria 6736
807 Ga0307515_10347675 3300028794 Bacteria 1131
808 Ga0307512_10005276 3300030522 Bacteria 13567
809 Ga0307512_10199543 3300030522 Bacteria 1086
810 Ga0307513_10013799 3300031456 Bacteria 9907
811 Ga0307513_10035897 3300031456 Bacteria 5540
812 Ga0307513_10185208 3300031456 Bacteria 1940
813 Ga0307513_10246602 3300031456 Bacteria 1586
814 Ga0307513_10274230 3300031456 Bacteria 1468
815 Ga0307509_10000120 3300031507 Bacteria 114238
816 Ga0307509_10004147 3300031507 Bacteria 21173
817 Ga0307509_10004183 3300031507 Bacteria 21075
818 Ga0307509_10101786 3300031507 Bacteria 2906
819 Ga0307509_10135277 3300031507 Bacteria 2412
820 Ga0307509_10353407 3300031507 Bacteria 1192
821 Ga0307509_10408581 3300031507 Bacteria 1062
822 Ga0307408_100226239 3300031548 Bacteria 1529
823 Ga0307408_100313894 3300031548 Bacteria 1318
824 Ga0307408_100465169 3300031548 Bacteria 1100
825 Ga0307408_100520071 3300031548 Bacteria 1045
826 Ga0307408_101311346 3300031548 Bacteria 679
827 Ga0307508_10000163 3300031616 Bacteria 80086
828 Ga0307508_10237326 3300031616 Bacteria 1421
829 Ga0307508_10440829 3300031616 Bacteria 894
830 Ga0307514_10020475 3300031649 Bacteria 5398
831 Ga0307514_10101633 3300031649 Bacteria 2063
832 Ga0307516_10000692 3300031730 Bacteria 45835
833 Ga0307516_10002056 3300031730 Bacteria 27419
834 Ga0307516_10065007 3300031730 Bacteria 3525
835 Ga0307516_10113670 3300031730 Bacteria 2505
836 Ga0307516_10388483 3300031730 Bacteria 1056
837 Ga0307516_10716316 3300031730 Bacteria 658
838 Ga0307405_10238337 3300031731 Bacteria 1346
839 Ga0307413_10077300 3300031824 Bacteria 2119
840 Ga0307413_10626083 3300031824 Bacteria 884
841 Ga0307413_10649678 3300031824 Bacteria 870
842 Ga0307518_10182139 3300031838 Bacteria 1419
843 Ga0307410_10195689 3300031852 Bacteria 1540
844 Ga0307410_11126555 3300031852 Bacteria 681
845 Ga0307410_11383756 3300031852 Bacteria 617
846 Ga0307406_10455022 3300031901 Bacteria 1028
847 Ga0307406_10464964 3300031901 Bacteria 1018
848 Ga0307406_10695355 3300031901 Bacteria 848
849 Ga0307406_10953748 3300031901 Bacteria 733
850 Ga0307406_11048379 3300031901 Bacteria 702
851 Ga0307407_10138746 3300031903 Bacteria 1566
852 Ga0307407_10643324 3300031903 Bacteria 794
853 Ga0307412_10122939 3300031911 Bacteria 1872
854 Ga0307412_10183560 3300031911 Bacteria 1576
855 Ga0307409_100023723 3300031995 Bacteria 4260
856 Ga0307409_100052024 3300031995 Bacteria 3138
857 Ga0307409_100433497 3300031995 Bacteria 1264
858 Ga0307409_101518958 3300031995 Bacteria 697
859 Ga0307416_100030912 3300032002 Bacteria 4025
860 Ga0307416_100195550 3300032002 Bacteria 1913
861 Ga0307416_101950855 3300032002 Bacteria 690
862 Ga0307414_10352444 3300032004 Bacteria 1264
863 Ga0307414_10900640 3300032004 Bacteria 811
864 Ga0307411_10000414 3300032005 Bacteria 14630
865 Ga0307411_10031904 3300032005 Bacteria 3248
866 Ga0307411_10042305 3300032005 Bacteria 2906
867 Ga0307415_100005787 3300032126 Bacteria 6600
868 Ga0307415_101247606 3300032126 Bacteria 702
869 Ga0307507_10074799 3300033179 Bacteria 3035
870 Ga0307507_10435106 3300033179 Bacteria 731
871 Ga0307510_10013446 3300033180 Bacteria 9706
872 Ga0307510_10041814 3300033180 Bacteria 5004
873 Ga0307510_10056403 3300033180 Bacteria 4091
874 Ga0307510_10354576 3300033180 Bacteria 917
875 Ga0373926_0109706 3300035083 Bacteria 1036
876 Ga0373926_0334547 3300035083 Bacteria 593
877 Ga0373944_0147770 3300035089 Bacteria 827
878 Ga0373944_0151511 3300035089 Bacteria 818
879 Ga0373945_0309346 3300035116 Bacteria 678
880 Ga0373955_0561892 3300035172 Bacteria 698
881 Ga0373961_0333882 3300035241 Bacteria 568
882 Ga0373935_0207559 3300035692 Bacteria 1356
883 Ga0373935_0290607 3300035692 Bacteria 1153
884 Ga0373927_0049915 3300035695 Bacteria 2705
885 Ga0373927_0735021 3300035695 Bacteria 652
886 Ga0373927_0836370 3300035695 Bacteria 608
887 Ga0373933_0339026 3300035724 Bacteria 976
888 Ga0373947_0271806 3300035725 Bacteria 1125
889 Ga0373947_0646186 3300035725 Bacteria 721
890 Ga0373947_0886186 3300035725 Bacteria 609
891 Ga0373937_0217585 3300036401 Bacteria 1798
892 Ga0373937_0901008 3300036401 Bacteria 833
893 Ga0373937_1287259 3300036401 Bacteria 679
894 Ga0373925_0324445 3300037068 Bacteria 1246
895 Ga0373925_0371067 3300037068 Bacteria 1164
896 Ga0373925_0415980 3300037068 Bacteria 1098
897 Ga0373925_0505348 3300037068 Bacteria 992
898 Ga0395900_0000063 3300037418 Bacteria 201374
899 Ga0395898_0001636 3300037466 Bacteria 30323
900 Ga0395905_0003220 3300037471 Bacteria 17560
901 Ga0395905_0042050 3300037471 Bacteria 4287
902 Ga0395905_0091368 3300037471 Bacteria 2854
903 Ga0395905_0117574 3300037471 Bacteria 2498
904 Ga0436364_0792843 3300037853 Bacteria 696
905 Ga0436364_1217926 3300037853 Bacteria 972
906 Ga0436365_0087208 3300039437 Bacteria 531
907 Ga0436365_0972512 3300039437 Bacteria 1583
908 Ga0436361_0167979 3300039447 Bacteria 86419
909 Ga0436361_0296121 3300039447 Bacteria 160237
910 Ga0436361_0383238 3300039447 Bacteria 5889
911 Ga0436363_0601796 3300039450 Bacteria 1218
912 Ga0439461_0072742 3300041410 Bacteria 799
913 Ga0451789_0090765 3300041443 Bacteria 2767
914 Ga0451789_0384357 3300041443 Bacteria 858
915 Ga0451793_0999039 3300041452 Bacteria 3548
916 Ga0451798_1013435 3300041458 Bacteria 540
917 Ga0451800_0522497 3300041459 Bacteria 643
918 Ga0451800_1374342 3300041459 Bacteria 543
919 Ga0451802_1087348 3300041460 Bacteria 1054
920 Ga0451802_1685874 3300041460 Bacteria 899
921 Ga0451802_2157496 3300041460 Bacteria 791
922 Ga0451804_0107983 3300041463 Bacteria 2200
923 Ga0451807_1756659 3300041486 Bacteria 1273
924 Ga0451807_2128849 3300041486 Bacteria 2104
925 Ga0451833_0792328 3300041491 Bacteria 516
926 Ga0451839_1293856 3300041496 Bacteria 566
927 Ga0451841_0453451 3300041498 Bacteria 755
928 Ga0451841_0567789 3300041498 Bacteria 959
929 Ga0451851_0447983 3300041507 Bacteria 1004
930 Ga0451855_1546692 3300041511 Bacteria 1017
931 Ga0451853_1002289 3300041512 Bacteria 738
932 Ga0451853_1967377 3300041512 Bacteria 1515
933 Ga0439442_085242 3300042002 Bacteria 678
934 Ga0439432_216605 3300042006 Bacteria 553
935 Ga0439449_0067914 3300042007 Bacteria 1314
936 Ga0439450_104879 3300042008 Bacteria 720
937 Ga0439455_0027801 3300042012 Bacteria 1388
938 Ga0439457_058019 3300042014 Bacteria 875
939 Ga0450917_000220 3300042120 Bacteria 4152
940 Ga0450888_000337 3300042126 Bacteria 4435
941 Ga0450888_004393 3300042126 Bacteria 1470
942 Ga0450890_001262 3300042127 Bacteria 3665
943 Ga0450890_089170 3300042127 Bacteria 510
944 Ga0450897_007687 3300042128 Bacteria 988
945 Ga0450892_003113 3300042130 Bacteria 1376
946 Ga0450903_007691 3300042138 Bacteria 1769
947 Ga0450904_011070 3300042139 Bacteria 892
948 Ga0450889_001245 3300042144 Bacteria 2651
949 Ga0439434_0055985 3300042435 Bacteria 1228
950 Ga0439464_0132482 3300042439 Bacteria 773
951 Ga0450893_0000560 3300042532 Bacteria 5289
952 Ga0451577_0010966 3300042876 Bacteria 8611
953 Ga0451577_0207715 3300042876 Bacteria 1768
954 Ga0451577_0246446 3300042876 Bacteria 1617
955 Ga0466969_0042909 3300044656 Bacteria 2255
956 Ga0466972_0000472 3300044658 Bacteria 20400
957 Ga0466972_0008836 3300044658 Bacteria 5055
958 Ga0466965_0020390 3300044683 Bacteria 3186
959 Ga0466965_0040319 3300044683 Bacteria 2298
960 Ga0466965_0656067 3300044683 Bacteria 599
961 Ga0466966_0192786 3300044684 Bacteria 1234
962 Ga0466961_0073364 3300044693 Bacteria 2170
963 Ga0466961_0646424 3300044693 Bacteria 635
964 Ga0466964_0060329 3300044706 Bacteria 1577
965 Ga0453684_0005726 3300044712 Bacteria 24318
966 Ga0453684_0044822 3300044712 Bacteria 5911
967 Ga0453684_0313725 3300044712 Bacteria 1778
968 Ga0453684_0732943 3300044712 Bacteria 1071
969 Ga0466971_0083558 3300044719 Bacteria 1458
970 Ga0466971_0277614 3300044719 Bacteria 801
971 Ga0466968_0017966 3300044735 Bacteria 2833
972 Ga0466970_0013702 3300044765 Bacteria 4159
973 Ga0466957_0137473 3300044842 Bacteria 1571
974 Ga0466960_0196338 3300044901 Bacteria 1100
975 Ga0466959_0010096 3300045049 Bacteria 6733
976 Ga0466959_0364554 3300045049 Bacteria 984
977 Ga0466959_0556206 3300045049 Bacteria 773
978 Ga0451576_0005477 3300045051 Bacteria 15899
979 Ga0451576_0037564 3300045051 Bacteria 5130
980 Ga0451576_0082233 3300045051 Bacteria 3349
981 Ga0451576_1787573 3300045051 Bacteria 635
982 Ga0466967_0092340 3300045976 Bacteria 2752
983 Ga0495592_0114879 3300046454 Bacteria 1901
984 Ga0495603_0247827 3300046455 Bacteria 1026
985 Ga0495629_0544590 3300046459 Bacteria 779
986 Ga0495629_0666013 3300046459 Bacteria 693
987 Ga0495638_0099749 3300046460 Bacteria 1737
988 Ga0495638_0186488 3300046460 Bacteria 1179
989 Ga0495638_0369002 3300046460 Bacteria 753
990 Ga0495651_0448753 3300046462 Bacteria 834
991 Ga0495580_0052225 3300046472 Bacteria 2887
992 Ga0495580_0533813 3300046472 Bacteria 780
993 Ga0495664_0181936 3300046477 Bacteria 1274
994 Ga0495664_0674372 3300046477 Bacteria 612
995 Ga0495606_0418041 3300046507 Bacteria 694
996 Ga0495610_0064295 3300046512 Bacteria 1735
997 Ga0495616_0106602 3300046513 Bacteria 1307
998 Ga0495618_0280680 3300046514 Bacteria 1039
999 Ga0495618_0450154 3300046514 Bacteria 782
1000 Ga0495620_0076868 3300046515 Bacteria 1356
1001 Ga0495620_0113227 3300046515 Bacteria 1074
1002 Ga0495628_0398469 3300046516 Bacteria 1006
1003 Ga0495628_1084970 3300046516 Bacteria 547
1004 Ga0495632_0003071 3300046519 Bacteria 12134
1005 Ga0495632_0006659 3300046519 Bacteria 7387
1006 Ga0495632_0151997 3300046519 Bacteria 1070
1007 Ga0495637_0355828 3300046520 Bacteria 513
1008 Ga0495666_0193017 3300046526 Bacteria 938
1009 Ga0495652_0665324 3300046529 Bacteria 704
1010 Ga0495598_0020636 3300046537 Bacteria 1742
1011 Ga0495598_0186771 3300046537 Bacteria 742
1012 Ga0495621_0000332 3300046539 Bacteria 11485
1013 Ga0495621_0001175 3300046539 Bacteria 6773
1014 Ga0495621_0099711 3300046539 Bacteria 1104
1015 Ga0495597_0115887 3300046542 Bacteria 1120
1016 Ga0495645_0234807 3300046543 Bacteria 1227
1017 Ga0495633_0055419 3300046558 Bacteria 1864
1018 Ga0495633_0307617 3300046558 Bacteria 720
1019 Ga0495667_0535918 3300046559 Bacteria 732
1020 Ga0495668_0492100 3300046616 Bacteria 676
1021 Ga0495625_0009362 3300046660 Bacteria 8203
1022 Ga0495635_1008280 3300046663 Bacteria 530
1023 Ga0495647_0051699 3300046681 Bacteria 1598
1024 Ga0495647_0062617 3300046681 Bacteria 1471
1025 Ga0495647_0085001 3300046681 Bacteria 1289
1026 Ga0495658_0080540 3300046683 Bacteria 1910
1027 Ga0495658_0243002 3300046683 Bacteria 1131
1028 Ga0495658_0330972 3300046683 Bacteria 966
1029 Ga0495658_0345354 3300046683 Bacteria 945
1030 Ga0495658_0345470 3300046683 Bacteria 945
1031 Ga0495613_0295109 3300046689 Bacteria 1123
1032 Ga0495613_0339945 3300046689 Bacteria 1033
1033 Ga0495624_0027325 3300046690 Bacteria 3736
1034 Ga0495670_0120403 3300046691 Bacteria 1363
1035 Ga0495671_0102969 3300046692 Bacteria 1395
1036 Ga0495649_0001713 3300046694 Bacteria 16255
1037 Ga0495604_0750938 3300047317 Bacteria 617
1038 Ga0495636_0163821 3300047318 Bacteria 1003
1039 Ga0495674_1093644 3300047319 Bacteria 607
1040 Ga0495676_0025847 3300047321 Bacteria 5061
1041 Ga0495680_0162469 3300047322 Bacteria 1621
1042 Ga0495687_000138 3300047443 Bacteria 110840
1043 Ga0495687_010872 3300047443 Bacteria 4944
1044 Ga0495673_0108372 3300047469 Bacteria 1114
1045 Ga0495684_0747469 3300047471 Bacteria 644
1046 Ga0495686_0003746 3300047472 Bacteria 12938
1047 Ga0495686_0144409 3300047472 Bacteria 1402
1048 Ga0495686_0430969 3300047472 Bacteria 703
1049 Ga0495593_0060680 3300047673 Bacteria 1980
1050 Ga0495614_0468990 3300048089 Bacteria 597
1051 Ga0495615_0223841 3300048090 Bacteria 588
1052 Ga0495626_0186092 3300048091 Bacteria 858
1053 Ga0496100_0327455 3300048903 Bacteria 1152
1054 Ga0496101_0177645 3300048904 Bacteria 1638
1055 Ga0496101_0243520 3300048904 Bacteria 1400
1056 Ga0496101_1594989 3300048904 Bacteria 507
1057 Ga0496105_0078589 3300048908 Bacteria 2724
1058 Ga0496106_0002144 3300048909 Bacteria 14740
1059 Ga0496106_1368597 3300048909 Bacteria 548
1060 Ga0496107_0563106 3300048910 Bacteria 844
1061 Ga0496108_0049498 3300048911 Bacteria 3515
1062 Ga0496108_0099218 3300048911 Bacteria 2482
1063 Ga0496108_0168025 3300048911 Bacteria 1897
1064 Ga0496108_1246919 3300048911 Bacteria 627
1065 Ga0496108_1298551 3300048911 Bacteria 612
1066 Ga0496109_0026005 3300048912 Bacteria 5217
1067 Ga0496109_1649359 3300048912 Bacteria 575
1068 Ga0496109_1944013 3300048912 Bacteria 520
1069 Ga0496110_0244822 3300048913 Bacteria 1632
1070 Ga0496110_0322103 3300048913 Bacteria 1408
1071 Ga0496110_0365997 3300048913 Bacteria 1314
1072 Ga0496111_0077600 3300048914 Bacteria 2422
1073 Ga0496112_0785231 3300048915 Bacteria 877
1074 Ga0496113_0056095 3300048916 Bacteria 2956
1075 Ga0496113_0869112 3300048916 Bacteria 714
1076 Ga0496114_0004606 3300048917 Bacteria 10710
1077 Ga0496114_0032690 3300048917 Bacteria 4284
1078 Ga0496114_0067102 3300048917 Bacteria 3009
1079 Ga0496114_0266566 3300048917 Bacteria 1509
1080 Ga0496121_0034134 3300048924 Bacteria 4585
1081 Ga0496124_0000605 3300048927 Bacteria 60259
1082 Ga0496125_0006726 3300048928 Bacteria 12359
1083 Ga0501310_036783 3300049130 Bacteria 669
1084 Ga0501292_033160 3300049515 Bacteria 874
1085 Ga0501300_015678 3300049523 Bacteria 1107
1086 Ga0501303_005883 3300049526 Bacteria 1058
1087 Ga0501047_1446102 3300049581 Bacteria 503
1088 Ga0501067_0091580 3300049583 Bacteria 1688
1089 Ga0501199_013798 3300049650 Bacteria 893
1090 Ga0501211_001456 3300049658 Bacteria 2531
1091 Ga0501222_042919 3300049662 Bacteria 647
1092 Ga0501227_029913 3300049665 Bacteria 1301
1093 Ga0501233_028479 3300049668 Bacteria 1248
1094 Ga0501235_013961 3300049669 Bacteria 1770
1095 Ga0501255_015573 3300049684 Bacteria 930
1096 Ga0501257_090515 3300049686 Bacteria 796
1097 Ga0501229_002114 3300049706 Bacteria 2328
1098 Ga0501262_003054 3300049759 Bacteria 1910
1099 Ga0501265_006850 3300049762 Bacteria 1332
1100 Ga0501267_008376 3300049764 Bacteria 1019
1101 Ga0501272_022716 3300049769 Bacteria 761
1102 Ga0501278_004446 3300049774 Bacteria 1011
1103 Ga0501035_0112544 3300049822 Bacteria 2385
1104 nmdc:mga03683_15435_c1 3300050489 Bacteria 2850
1105 nmdc:mga03683_224847_c1 3300050489 Bacteria 867
1106 nmdc:mga03683_321959_c1 3300050489 Bacteria 728
1107 nmdc:mga03683_63995_c1 3300050489 Bacteria 1560
1108 nmdc:mga03n38_305309_c1 3300050490 Bacteria 856
1109 nmdc:mga03n38_67450_c1 3300050490 Bacteria 1646
1110 nmdc:mga03n38_674860_c1 3300050490 Bacteria 594
1111 nmdc:mga03n38_963394_c1 3300050490 Bacteria 504
1112 nmdc:mga00v17_20735_c1 3300050491 Bacteria 3769
1113 nmdc:mga00v17_213990_c1 3300050491 Bacteria 1247
1114 nmdc:mga0yw44_557234_c1 3300050492 Bacteria 778
1115 nmdc:mga0k408_11470_c1 3300050493 Bacteria 4828
1116 nmdc:mga0k408_12304_c1 3300050493 Bacteria 4674
1117 nmdc:mga0k408_221259_c1 3300050493 Bacteria 1130
1118 nmdc:mga0k408_245349_c1 3300050493 Bacteria 1070
1119 nmdc:mga0k408_306119_c1 3300050493 Bacteria 948
1120 nmdc:mga0k408_34469_c1 3300050493 Bacteria 2898
1121 nmdc:mga0k408_358504_c1 3300050493 Bacteria 869
1122 nmdc:mga0k408_39190_c1 3300050493 Bacteria 2722
1123 nmdc:mga0k408_475889_c1 3300050493 Bacteria 741
1124 nmdc:mga0k408_505_c1 3300050493 Bacteria 21413
1125 nmdc:mga0k408_550473_c1 3300050493 Bacteria 682
1126 nmdc:mga0k408_562068_c1 3300050493 Bacteria 674
1127 nmdc:mga0k408_6081_c1 3300050493 Bacteria 6432
1128 nmdc:mga0k408_774_c1 3300050493 Bacteria 17566
1129 nmdc:mga0k408_78307_c1 3300050493 Bacteria 1933
1130 nmdc:mga06z11_174031_c1 3300050494 Bacteria 1238
1131 nmdc:mga06z11_359545_c1 3300050494 Bacteria 872
1132 nmdc:mga06z11_39308_c1 3300050494 Bacteria 2354
1133 nmdc:mga06z11_631947_c1 3300050494 Bacteria 652
1134 nmdc:mga04h51_217795_c1 3300050495 Bacteria 755
1135 nmdc:mga04h51_25761_c1 3300050495 Bacteria 1813
1136 nmdc:mga04h51_312022_c1 3300050495 Bacteria 643
1137 nmdc:mga04h51_58901_c1 3300050495 Bacteria 1311
1138 nmdc:mga07m45_1105_c1 3300050496 Bacteria 12053
1139 nmdc:mga07m45_127295_c1 3300050496 Bacteria 1473
1140 nmdc:mga07m45_3525_c1 3300050496 Bacteria 7556
1141 nmdc:mga07m45_3655_c1 3300050496 Bacteria 7428
1142 nmdc:mga07m45_380594_c1 3300050496 Bacteria 820
1143 nmdc:mga07m45_4413_c1 3300050496 Bacteria 4103
1144 nmdc:mga07m45_483857_c1 3300050496 Bacteria 717
1145 nmdc:mga07m45_580864_c1 3300050496 Bacteria 647
1146 nmdc:mga07m45_632740_c1 3300050496 Bacteria 617
1147 nmdc:mga07m45_647989_c1 3300050496 Bacteria 609
1148 nmdc:mga07m45_7514_c1 3300050496 Bacteria 5571
1149 nmdc:mga05p37_2114009_c1 3300050507 Bacteria 527
1150 nmdc:mga05p37_71866_c1 3300050507 Bacteria 4257
1151 nmdc:mga09592_3100_c1 3300050508 Bacteria 13493
1152 nmdc:mga0qj67_7173_c1 3300050509 Bacteria 8224
1153 nmdc:mga0sz30_43161_c1 3300050516 Bacteria 1898
1154 Ga0495601_0067602 3300053077 Bacteria 2277
1155 Ga0495601_0179882 3300053077 Bacteria 1383
1156 Ga0495601_0675744 3300053077 Bacteria 660
1157 Ga0495612_0193570 3300053078 Bacteria 895
1158 Ga0495619_1160160 3300053085 Bacteria 512
1159 Ga0500578_0000683 3300053086 Bacteria 40592
1160 Ga0500578_0065299 3300053086 Bacteria 2321
1161 Ga0500644_0066001 3300053088 Bacteria 1290
1162 Ga0500581_195103 3300053089 Bacteria 905
1163 Ga0500646_0014711 3300053090 Bacteria 2032
1164 Ga0500583_0415641 3300053092 Bacteria 643
1165 Ga0500651_0144063 3300053093 Bacteria 1434
1166 Ga0500650_0016186 3300053098 Bacteria 3194
1167 Ga0500594_0000375 3300053118 Bacteria 9973
1168 Ga0500623_119748 3300053127 Bacteria 1157
1169 Ga0500628_001735 3300053129 Bacteria 3680
1170 Ga0500642_0019098 3300053130 Bacteria 2666
1171 Ga0500642_0024548 3300053130 Bacteria 2437
1172 Ga0500652_000182 3300053131 Bacteria 24295
1173 Ga0500652_169655 3300053131 Bacteria 898
1174 Ga0500655_005169 3300053133 Bacteria 2353
1175 Ga0500655_019318 3300053133 Bacteria 1269
1176 Ga0500559_0000011 3300053136 Bacteria 164751
1177 Ga0500568_0000931 3300053139 Bacteria 20194
1178 Ga0500568_0012201 3300053139 Bacteria 3958
1179 Ga0500568_0077376 3300053139 Bacteria 1266
1180 Ga0500573_0312079 3300053140 Bacteria 781
1181 Ga0500577_0086334 3300053142 Bacteria 1260
1182 Ga0500590_001777 3300053148 Bacteria 9087
1183 Ga0500604_0018885 3300053151 Bacteria 1925
1184 Ga0500619_000022 3300053154 Bacteria 50600
1185 Ga0500622_0000028 3300053156 Bacteria 218994
1186 Ga0500622_0002568 3300053156 Bacteria 13011
1187 Ga0500633_0203099 3300053160 Bacteria 742
1188 Ga0500584_119967 3300053726 Bacteria 1045
1189 Ga0500645_008138 3300053730 Bacteria 3604
1190 Ga0500599_029727 3300053736 Bacteria 809
1191 Ga0500587_000071 3300053739 Bacteria 8323
1192 Ga0590071_017505 3300059421 Bacteria 1683
1193 Ga0590074_006650 3300059423 Bacteria 1919
1194 Ga0590075_039059 3300059424 Bacteria 1211
1195 Ga0466962_0004516 3300061719 Bacteria 6672
1196 Ga0466962_0035738 3300061719 Bacteria 2377

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0026005 Ga0496109_0026005_1264_1716 120
2 3300044735 Ga0466968_0017966 Ga0466968_0017966_1935_2312 122
3 3300005293 Ga0065715_10367119 Ga0065715_103671191 123
4 3300005328 Ga0070676_10562333 Ga0070676_105623331 123
5 3300005331 Ga0070670_100002945 Ga0070670_10000294512 123
6 3300005333 Ga0070677_10004927 Ga0070677_100049275 123
7 3300005338 Ga0068868_100150983 Ga0068868_1001509832 123
8 3300005347 Ga0070668_100811672 Ga0070668_1008116722 123
9 3300005353 Ga0070669_100055186 Ga0070669_1000551864 123
10 3300005354 Ga0070675_100004946 Ga0070675_1000049462 123
11 3300005355 Ga0070671_100011652 Ga0070671_1000116524 123
12 3300005356 Ga0070674_100001889 Ga0070674_1000018892 123
13 3300005364 Ga0070673_100006921 Ga0070673_1000069212 123
14 3300005365 Ga0070688_100265590 Ga0070688_1002655902 123
15 3300005367 Ga0070667_100252287 Ga0070667_1002522871 123
16 3300005456 Ga0070678_100044185 Ga0070678_1000441852 123
17 3300005459 Ga0068867_100003725 Ga0068867_1000037252 123
18 3300005466 Ga0070685_10108655 Ga0070685_101086552 123
19 3300005543 Ga0070672_100002110 Ga0070672_10000211012 123
20 3300005548 Ga0070665_100869068 Ga0070665_1008690682 123
21 3300005616 Ga0068852_100224990 Ga0068852_1002249902 123
22 3300005616 Ga0068852_101505623 Ga0068852_1015056231 123
23 3300005617 Ga0068859_100404496 Ga0068859_1004044962 123
24 3300005618 Ga0068864_100145039 Ga0068864_1001450392 123
25 3300005840 Ga0068870_10043103 Ga0068870_100431032 123
26 3300005841 Ga0068863_100880125 Ga0068863_1008801252 123
27 3300005843 Ga0068860_100995219 Ga0068860_1009952192 123
28 3300006237 Ga0097621_100044960 Ga0097621_1000449604 123
29 3300006358 Ga0068871_100260569 Ga0068871_1002605692 123
30 3300006881 Ga0068865_100052659 Ga0068865_1000526593 123
31 3300006931 Ga0097620_100404507 Ga0097620_1004045072 123
32 3300012508 Ga0157315_1016450 Ga0157315_10164501 123
33 3300013297 Ga0157378_10956304 Ga0157378_109563042 123
34 3300013306 Ga0163162_10238209 Ga0163162_102382092 123
35 3300013308 Ga0157375_10063842 Ga0157375_100638425 123
36 3300014325 Ga0163163_11648197 Ga0163163_116481972 123
37 3300014745 Ga0157377_10101662 Ga0157377_101016622 123
38 3300014969 Ga0157376_10100385 Ga0157376_101003852 123
39 3300014969 Ga0157376_12176629 Ga0157376_121766291 123
40 3300025315 Ga0207697_10105557 Ga0207697_101055572 123
41 3300025893 Ga0207682_10000464 Ga0207682_1000046419 123
42 3300025903 Ga0207680_10177329 Ga0207680_101773292 123
43 3300025908 Ga0207643_10105367 Ga0207643_101053672 123
44 3300025923 Ga0207681_10017669 Ga0207681_100176696 123
45 3300025925 Ga0207650_10009593 Ga0207650_100095932 123
46 3300025926 Ga0207659_10059558 Ga0207659_100595582 123
47 3300025931 Ga0207644_10056380 Ga0207644_100563803 123
48 3300025937 Ga0207669_10002776 Ga0207669_100027762 123
49 3300025938 Ga0207704_10031821 Ga0207704_100318213 123
50 3300025940 Ga0207691_10001003 Ga0207691_1000100327 123
51 3300025945 Ga0207679_10023033 Ga0207679_100230335 123
52 3300025960 Ga0207651_10001024 Ga0207651_1000102414 123
53 3300025972 Ga0207668_10069830 Ga0207668_100698304 123
54 3300025986 Ga0207658_10454770 Ga0207658_104547702 123
55 3300026023 Ga0207677_10228189 Ga0207677_102281892 123
56 3300026088 Ga0207641_10785681 Ga0207641_107856812 123
57 3300026088 Ga0207641_11045739 Ga0207641_110457391 123
58 3300026089 Ga0207648_10006439 Ga0207648_1000643912 123
59 3300026095 Ga0207676_10078488 Ga0207676_100784882 123
60 3300026121 Ga0207683_10017172 Ga0207683_100171727 123
61 3300026142 Ga0207698_10179076 Ga0207698_101790762 123
62 3300026142 Ga0207698_11213389 Ga0207698_112133892 123
63 3300028379 Ga0268266_10418829 Ga0268266_104188292 123
64 3300028381 Ga0268264_11246371 Ga0268264_112463711 123
65 3300031548 Ga0307408_100520071 Ga0307408_1005200712 123
66 3300031548 Ga0307408_101311346 Ga0307408_1013113462 123
67 3300031731 Ga0307405_10238337 Ga0307405_102383372 123
68 3300031852 Ga0307410_11126555 Ga0307410_111265551 123
69 3300031901 Ga0307406_10464964 Ga0307406_104649642 123
70 3300031903 Ga0307407_10643324 Ga0307407_106433242 123
71 3300032002 Ga0307416_100195550 Ga0307416_1001955502 123
72 3300032126 Ga0307415_101247606 Ga0307415_1012476062 123
73 3300042876 Ga0451577_0246446 Ga0451577_0246446_927_1307 123
74 3300003322 rootL2_10106303 rootL2_101063032 124
75 3300005328 Ga0070676_10046670 Ga0070676_100466702 124
76 3300005328 Ga0070676_10648457 Ga0070676_106484571 124
77 3300005331 Ga0070670_100142612 Ga0070670_1001426122 124
78 3300005333 Ga0070677_10539074 Ga0070677_105390741 124
79 3300005338 Ga0068868_100053261 Ga0068868_1000532614 124
80 3300005344 Ga0070661_101076802 Ga0070661_1010768021 124
81 3300005353 Ga0070669_100055194 Ga0070669_1000551943 124
82 3300005355 Ga0070671_100041182 Ga0070671_1000411823 124
83 3300005455 Ga0070663_100092653 Ga0070663_1000926532 124
84 3300005456 Ga0070678_100016063 Ga0070678_1000160636 124
85 3300005456 Ga0070678_100188654 Ga0070678_1001886542 124
86 3300005459 Ga0068867_100004243 Ga0068867_1000042439 124
87 3300005459 Ga0068867_100047209 Ga0068867_1000472093 124
88 3300005539 Ga0068853_100071178 Ga0068853_1000711782 124
89 3300005543 Ga0070672_101449552 Ga0070672_1014495521 124
90 3300005564 Ga0070664_101345254 Ga0070664_1013452542 124
91 3300005616 Ga0068852_100232127 Ga0068852_1002321271 124
92 3300005617 Ga0068859_100386532 Ga0068859_1003865322 124
93 3300005719 Ga0068861_100024071 Ga0068861_1000240714 124
94 3300005843 Ga0068860_100043046 Ga0068860_1000430463 124
95 3300005844 Ga0068862_100010381 Ga0068862_1000103814 124
96 3300006195 Ga0075366_10255281 Ga0075366_102552812 124
97 3300006195 Ga0075366_10285903 Ga0075366_102859032 124
98 3300006237 Ga0097621_100883123 Ga0097621_1008831232 124
99 3300006881 Ga0068865_100052989 Ga0068865_1000529893 124
100 3300006931 Ga0097620_100386570 Ga0097620_1003865702 124
101 3300009148 Ga0105243_10121198 Ga0105243_101211982 124
102 3300009176 Ga0105242_10604408 Ga0105242_106044082 124
103 3300009553 Ga0105249_10487538 Ga0105249_104875381 124
104 3300013297 Ga0157378_10081401 Ga0157378_100814011 124
105 3300013297 Ga0157378_10883532 Ga0157378_108835322 124
106 3300013306 Ga0163162_10048699 Ga0163162_100486993 124
107 3300013308 Ga0157375_10082231 Ga0157375_100822311 124
108 3300014326 Ga0157380_10382161 Ga0157380_103821612 124
109 3300014968 Ga0157379_10048962 Ga0157379_100489622 124
110 3300014969 Ga0157376_10143969 Ga0157376_101439692 124
111 3300017792 Ga0163161_10257063 Ga0163161_102570631 124
112 3300025899 Ga0207642_10592602 Ga0207642_105926022 124
113 3300025907 Ga0207645_10007783 Ga0207645_100077839 124
114 3300025907 Ga0207645_10195878 Ga0207645_101958782 124
115 3300025920 Ga0207649_10766649 Ga0207649_107666492 124
116 3300025923 Ga0207681_10080068 Ga0207681_100800681 124
117 3300025931 Ga0207644_10067099 Ga0207644_100670992 124
118 3300025935 Ga0207709_10041618 Ga0207709_100416183 124
119 3300025938 Ga0207704_11803998 Ga0207704_118039981 124
120 3300025942 Ga0207689_10698366 Ga0207689_106983662 124
121 3300025945 Ga0207679_10778477 Ga0207679_107784772 124
122 3300025961 Ga0207712_10784411 Ga0207712_107844111 124
123 3300025986 Ga0207658_10071363 Ga0207658_100713633 124
124 3300026023 Ga0207677_10189470 Ga0207677_101894702 124
125 3300026075 Ga0207708_10334219 Ga0207708_103342192 124
126 3300026089 Ga0207648_10000393 Ga0207648_1000039313 124
127 3300026118 Ga0207675_100001455 Ga0207675_10000145513 124
128 3300026121 Ga0207683_10074279 Ga0207683_100742791 124
129 3300028380 Ga0268265_10011023 Ga0268265_100110232 124
130 3300028786 Ga0307517_10432650 Ga0307517_104326502 124
131 3300031730 Ga0307516_10002056 Ga0307516_1000205622 124
132 3300031901 Ga0307406_10455022 Ga0307406_104550222 124
133 3300041458 Ga0451798_1013435 Ga0451798_1013435_76_453 124
134 3300041460 Ga0451802_1087348 Ga0451802_1087348_409_786 124
135 3300041460 Ga0451802_2157496 Ga0451802_2157496_298_684 124
136 3300041486 Ga0451807_2128849 Ga0451807_2128849_1462_1839 124
137 3300048903 Ga0496100_0327455 Ga0496100_0327455_436_846 124
138 3300048904 Ga0496101_1594989 Ga0496101_1594989_54_437 124
139 3300059421 Ga0590071_017505 Ga0590071_017505_1206_1583 124
140 3300059423 Ga0590074_006650 Ga0590074_006650_1103_1480 124
141 iso_pu_bacteria 2643221660 2644337859 124
142 3300003215 JGI25153J46596_10002502 JGI25153J46596_1000250210 125
143 3300003316 rootH1_10035581 rootH1_100355817 125
144 3300003322 rootL2_10029461 rootL2_100294612 125
145 3300005328 Ga0070676_10109933 Ga0070676_101099331 125
146 3300005355 Ga0070671_100046374 Ga0070671_1000463742 125
147 3300005356 Ga0070674_100170408 Ga0070674_1001704082 125
148 3300005441 Ga0070700_100105426 Ga0070700_1001054263 125
149 3300005456 Ga0070678_100400475 Ga0070678_1004004751 125
150 3300005459 Ga0068867_100018381 Ga0068867_1000183815 125
151 3300005543 Ga0070672_100009735 Ga0070672_1000097358 125
152 3300005544 Ga0070686_100292510 Ga0070686_1002925104 125
153 3300005616 Ga0068852_100419638 Ga0068852_1004196382 125
154 3300005617 Ga0068859_100477529 Ga0068859_1004775292 125
155 3300005718 Ga0068866_10017005 Ga0068866_100170052 125
156 3300005719 Ga0068861_100002512 Ga0068861_1000025126 125
157 3300005840 Ga0068870_10635584 Ga0068870_106355841 125
158 3300005843 Ga0068860_100023436 Ga0068860_1000234368 125
159 3300005844 Ga0068862_100032625 Ga0068862_1000326251 125
160 3300006195 Ga0075366_10232136 Ga0075366_102321361 125
161 3300006195 Ga0075366_10831839 Ga0075366_108318392 125
162 3300006881 Ga0068865_100002308 Ga0068865_1000023086 125
163 3300006931 Ga0097620_100477477 Ga0097620_1004774772 125
164 3300009177 Ga0105248_10048306 Ga0105248_100483062 125
165 3300009553 Ga0105249_10002420 Ga0105249_1000242017 125
166 3300013297 Ga0157378_10000567 Ga0157378_1000056729 125
167 3300013306 Ga0163162_10008943 Ga0163162_100089436 125
168 3300013308 Ga0157375_10025951 Ga0157375_100259514 125
169 3300014326 Ga0157380_10013534 Ga0157380_100135345 125
170 3300014968 Ga0157379_10015882 Ga0157379_100158825 125
171 3300025297 Ga0209758_1000089 Ga0209758_1000089170 125
172 3300025908 Ga0207643_10532373 Ga0207643_105323731 125
173 3300025937 Ga0207669_10664416 Ga0207669_106644162 125
174 3300025938 Ga0207704_10004171 Ga0207704_100041712 125
175 3300025940 Ga0207691_10078068 Ga0207691_100780683 125
176 3300025941 Ga0207711_10011484 Ga0207711_100114842 125
177 3300026023 Ga0207677_10383524 Ga0207677_103835242 125
178 3300026075 Ga0207708_10065350 Ga0207708_100653503 125
179 3300026118 Ga0207675_100004856 Ga0207675_1000048565 125
180 3300026121 Ga0207683_10574556 Ga0207683_105745562 125
181 3300026142 Ga0207698_10639814 Ga0207698_106398142 125
182 3300028380 Ga0268265_10010714 Ga0268265_100107144 125
183 3300028381 Ga0268264_10004613 Ga0268264_100046136 125
184 3300039450 Ga0436363_0601796 Ga0436363_0601796_493_873 125
185 3300048911 Ga0496108_0168025 Ga0496108_0168025_643_1026 125
186 3300048912 Ga0496109_1944013 Ga0496109_1944013_63_446 125
187 3300048914 Ga0496111_0077600 Ga0496111_0077600_1235_1618 125
188 3300048915 Ga0496112_0785231 Ga0496112_0785231_432_815 125
189 3300048916 Ga0496113_0056095 Ga0496113_0056095_817_1200 125
190 iso_pu_bacteria 2585428057 2587729490 125
191 iso_pu_bacteria 2585428058 2587733995 125
192 iso_pu_bacteria 2588253510 2588294567 125
193 iso_pu_bacteria 2643221544 2643746564 125
194 iso_pu_bacteria 2643221592 2643969660 125
195 iso_pu_bacteria 2643221625 2644143961 125
196 iso_pu_bacteria 2643221639 2644220947 125
197 iso_pu_bacteria 2643221646 2644259787 125
198 iso_pu_bacteria 2643221648 2644276333 125
199 3300005329 Ga0070683_100015906 Ga0070683_1000159068 126
200 3300005344 Ga0070661_100005716 Ga0070661_1000057168 126
201 3300005347 Ga0070668_100262299 Ga0070668_1002622992 126
202 3300005366 Ga0070659_100032574 Ga0070659_1000325744 126
203 3300005439 Ga0070711_101397058 Ga0070711_1013970582 126
204 3300005564 Ga0070664_100015723 Ga0070664_1000157234 126
205 3300005578 Ga0068854_100008774 Ga0068854_1000087747 126
206 3300005614 Ga0068856_100014533 Ga0068856_1000145336 126
207 3300005616 Ga0068852_100123556 Ga0068852_1001235562 126
208 3300005618 Ga0068864_100503571 Ga0068864_1005035712 126
209 3300009093 Ga0105240_10078384 Ga0105240_100783843 126
210 3300009098 Ga0105245_10532769 Ga0105245_105327692 126
211 3300009551 Ga0105238_10046827 Ga0105238_100468274 126
212 3300009551 Ga0105238_11020556 Ga0105238_110205562 126
213 3300013100 Ga0157373_10068417 Ga0157373_100684174 126
214 3300013104 Ga0157370_10201463 Ga0157370_102014632 126
215 3300013105 Ga0157369_10581418 Ga0157369_105814182 126
216 3300013307 Ga0157372_10140193 Ga0157372_101401932 126
217 3300014497 Ga0182008_10351149 Ga0182008_103511492 126
218 3300015262 Ga0182007_10141850 Ga0182007_101418502 126
219 3300020082 Ga0206353_10340014 Ga0206353_103400141 126
220 3300021361 Ga0213872_10000011 Ga0213872_1000001164 126
221 3300021384 Ga0213876_10349223 Ga0213876_103492232 126
222 3300025321 Ga0207656_10041960 Ga0207656_100419602 126
223 3300025901 Ga0207688_10104298 Ga0207688_101042982 126
224 3300025909 Ga0207705_10088565 Ga0207705_100885652 126
225 3300025913 Ga0207695_10295578 Ga0207695_102955782 126
226 3300025920 Ga0207649_10179676 Ga0207649_101796761 126
227 3300025924 Ga0207694_10022930 Ga0207694_100229305 126
228 3300025924 Ga0207694_10881666 Ga0207694_108816662 126
229 3300025932 Ga0207690_10010869 Ga0207690_100108695 126
230 3300025944 Ga0207661_10407549 Ga0207661_104075492 126
231 3300025945 Ga0207679_10394518 Ga0207679_103945181 126
232 3300025981 Ga0207640_10071752 Ga0207640_100717522 126
233 3300026041 Ga0207639_10101195 Ga0207639_101011952 126
234 3300026078 Ga0207702_10031176 Ga0207702_100311766 126
235 3300026078 Ga0207702_10314324 Ga0207702_103143242 126
236 3300026095 Ga0207676_10202268 Ga0207676_102022682 126
237 3300026142 Ga0207698_10202023 Ga0207698_102020232 126
238 3300032004 Ga0307414_10900640 Ga0307414_109006402 126
239 3300035089 Ga0373944_0147770 Ga0373944_0147770_274_657 126
240 3300039437 Ga0436365_0087208 Ga0436365_0087208_116_496 126
241 3300039447 Ga0436361_0296121 Ga0436361_0296121_21672_22085 126
242 3300041459 Ga0451800_1374342 Ga0451800_1374342_114_497 126
243 3300046514 Ga0495618_0450154 Ga0495618_0450154_214_597 126
244 3300053148 Ga0500590_001777 Ga0500590_001777_4673_5056 126
245 iso_pu_bacteria 2643221644 2644245322 126
246 iso_pu_bacteria 2643221654 2644304723 126
247 3300003794 Ga0055531_10000051 Ga0055531_1000005122 127
248 3300005295 Ga0065707_10086124 Ga0065707_100861244 127
249 3300005330 Ga0070690_100281066 Ga0070690_1002810662 127
250 3300005334 Ga0068869_100131783 Ga0068869_1001317833 127
251 3300005338 Ga0068868_100959383 Ga0068868_1009593832 127
252 3300005347 Ga0070668_100077404 Ga0070668_1000774042 127
253 3300005353 Ga0070669_100016218 Ga0070669_1000162183 127
254 3300005356 Ga0070674_100029268 Ga0070674_1000292683 127
255 3300005367 Ga0070667_100078756 Ga0070667_1000787562 127
256 3300005441 Ga0070700_100009881 Ga0070700_1000098816 127
257 3300005456 Ga0070678_100027101 Ga0070678_1000271013 127
258 3300005457 Ga0070662_100004188 Ga0070662_1000041887 127
259 3300005459 Ga0068867_100002677 Ga0068867_1000026779 127
260 3300005617 Ga0068859_100140939 Ga0068859_1001409393 127
261 3300005617 Ga0068859_100358941 Ga0068859_1003589412 127
262 3300005618 Ga0068864_100224073 Ga0068864_1002240732 127
263 3300005718 Ga0068866_10063449 Ga0068866_100634492 127
264 3300005719 Ga0068861_100000916 Ga0068861_1000009166 127
265 3300005719 Ga0068861_100297274 Ga0068861_1002972742 127
266 3300005843 Ga0068860_100001051 Ga0068860_10000105116 127
267 3300005843 Ga0068860_100035689 Ga0068860_1000356893 127
268 3300005844 Ga0068862_100011264 Ga0068862_1000112646 127
269 3300005844 Ga0068862_100012691 Ga0068862_1000126919 127
270 3300005844 Ga0068862_100049105 Ga0068862_1000491052 127
271 3300005937 Ga0081455_10043225 Ga0081455_100432253 127
272 3300006048 Ga0075363_100714824 Ga0075363_1007148242 127
273 3300006177 Ga0075362_10441876 Ga0075362_104418762 127
274 3300006195 Ga0075366_10025493 Ga0075366_100254931 127
275 3300006846 Ga0075430_100958650 Ga0075430_1009586502 127
276 3300006881 Ga0068865_100006584 Ga0068865_1000065847 127
277 3300006931 Ga0097620_100140937 Ga0097620_1001409373 127
278 3300006931 Ga0097620_100358958 Ga0097620_1003589582 127
279 3300009148 Ga0105243_10015036 Ga0105243_100150362 127
280 3300009553 Ga0105249_10014239 Ga0105249_100142399 127
281 3300009553 Ga0105249_10206031 Ga0105249_102060312 127
282 3300011119 Ga0105246_10480631 Ga0105246_104806312 127
283 3300011119 Ga0105246_11513535 Ga0105246_115135352 127
284 3300013297 Ga0157378_10001209 Ga0157378_1000120915 127
285 3300013306 Ga0163162_10002747 Ga0163162_100027474 127
286 3300013308 Ga0157375_10165372 Ga0157375_101653722 127
287 3300014326 Ga0157380_10009086 Ga0157380_100090862 127
288 3300014326 Ga0157380_12708126 Ga0157380_127081261 127
289 3300014968 Ga0157379_10013116 Ga0157379_100131168 127
290 3300014968 Ga0157379_10445804 Ga0157379_104458042 127
291 3300014969 Ga0157376_10164662 Ga0157376_101646623 127
292 3300025298 Ga0209050_1028981 Ga0209050_10289812 127
293 3300025303 Ga0209051_1042436 Ga0209051_10424362 127
294 3300025304 Ga0209257_1000017 Ga0209257_1000017814 127
295 3300025899 Ga0207642_10041429 Ga0207642_100414292 127
296 3300025923 Ga0207681_10012069 Ga0207681_100120693 127
297 3300025933 Ga0207706_10005606 Ga0207706_100056069 127
298 3300025935 Ga0207709_10050623 Ga0207709_100506234 127
299 3300025937 Ga0207669_10017886 Ga0207669_100178864 127
300 3300025938 Ga0207704_10013443 Ga0207704_100134432 127
301 3300025942 Ga0207689_11052557 Ga0207689_110525571 127
302 3300025986 Ga0207658_10039073 Ga0207658_100390733 127
303 3300026023 Ga0207677_10526953 Ga0207677_105269532 127
304 3300026075 Ga0207708_10018995 Ga0207708_100189954 127
305 3300026089 Ga0207648_10007458 Ga0207648_100074587 127
306 3300026095 Ga0207676_10223688 Ga0207676_102236882 127
307 3300026118 Ga0207675_100001936 Ga0207675_1000019369 127
308 3300026118 Ga0207675_100547591 Ga0207675_1005475912 127
309 3300026121 Ga0207683_10043957 Ga0207683_100439573 127
310 3300028380 Ga0268265_10004374 Ga0268265_100043742 127
311 3300028380 Ga0268265_10024708 Ga0268265_100247082 127
312 3300028381 Ga0268264_10001095 Ga0268264_1000109515 127
313 3300028381 Ga0268264_10051579 Ga0268264_100515793 127
314 3300031730 Ga0307516_10113670 Ga0307516_101136703 127
315 3300035083 Ga0373926_0109706 Ga0373926_0109706_458_841 127
316 3300035695 Ga0373927_0049915 Ga0373927_0049915_364_747 127
317 3300037068 Ga0373925_0505348 Ga0373925_0505348_483_866 127
318 3300037471 Ga0395905_0003220 Ga0395905_0003220_12226_12609 127
319 3300042126 Ga0450888_004393 Ga0450888_004393_427_810 127
320 3300042876 Ga0451577_0207715 Ga0451577_0207715_811_1197 127
321 3300044656 Ga0466969_0042909 Ga0466969_0042909_1043_1426 127
322 3300044658 Ga0466972_0000472 Ga0466972_0000472_19228_19611 127
323 3300044683 Ga0466965_0040319 Ga0466965_0040319_1384_1770 127
324 3300044683 Ga0466965_0656067 Ga0466965_0656067_175_558 127
325 3300044684 Ga0466966_0192786 Ga0466966_0192786_35_418 127
326 3300044693 Ga0466961_0073364 Ga0466961_0073364_511_894 127
327 3300044693 Ga0466961_0646424 Ga0466961_0646424_111_494 127
328 3300044706 Ga0466964_0060329 Ga0466964_0060329_566_949 127
329 3300044712 Ga0453684_0732943 Ga0453684_0732943_133_519 127
330 3300044719 Ga0466971_0083558 Ga0466971_0083558_753_1136 127
331 3300044901 Ga0466960_0196338 Ga0466960_0196338_308_694 127
332 3300045049 Ga0466959_0364554 Ga0466959_0364554_303_689 127
333 3300045051 Ga0451576_1787573 Ga0451576_1787573_147_533 127
334 3300046477 Ga0495664_0181936 Ga0495664_0181936_38_421 127
335 3300046558 Ga0495633_0055419 Ga0495633_0055419_55_438 127
336 3300046681 Ga0495647_0062617 Ga0495647_0062617_1075_1458 127
337 3300046683 Ga0495658_0345470 Ga0495658_0345470_332_715 127
338 3300048911 Ga0496108_1298551 Ga0496108_1298551_87_470 127
339 3300048916 Ga0496113_0869112 Ga0496113_0869112_257_643 127
340 3300049583 Ga0501067_0091580 Ga0501067_0091580_854_1237 127
341 3300050489 nmdc:mga03683_321959_c1 nmdc:mga03683_321959_c1_114_497 127
342 3300050490 nmdc:mga03n38_674860_c1 nmdc:mga03n38_674860_c1_168_551 127
343 3300050494 nmdc:mga06z11_359545_c1 nmdc:mga06z11_359545_c1_386_769 127
344 3300053154 Ga0500619_000022 Ga0500619_000022_45721_46116 127
345 3300061719 Ga0466962_0035738 Ga0466962_0035738_1632_2015 127
346 3300003322 rootL2_10106302 rootL2_101063022 128
347 3300003347 JGI26128J50194_1001122 JGI26128J50194_10011222 128
348 3300003775 Ga0055524_1000302 Ga0055524_100030219 128
349 3300003792 Ga0055540_1000004 Ga0055540_100000453 128
350 3300003792 Ga0055540_1000035 Ga0055540_100003582 128
351 3300003794 Ga0055531_10022330 Ga0055531_100223302 128
352 3300005337 Ga0070682_100095524 Ga0070682_1000955242 128
353 3300005344 Ga0070661_100001215 Ga0070661_1000012159 128
354 3300005366 Ga0070659_100000723 Ga0070659_10000072323 128
355 3300005367 Ga0070667_100146965 Ga0070667_1001469653 128
356 3300005445 Ga0070708_100084168 Ga0070708_1000841681 128
357 3300005539 Ga0068853_101458967 Ga0068853_1014589671 128
358 3300005564 Ga0070664_100001692 Ga0070664_1000016925 128
359 3300005719 Ga0068861_101446057 Ga0068861_1014460572 128
360 3300005842 Ga0068858_100518840 Ga0068858_1005188401 128
361 3300006353 Ga0075370_10370565 Ga0075370_103705652 128
362 3300006946 Ga0079104_1000024 Ga0079104_100002461 128
363 3300013306 Ga0163162_11334526 Ga0163162_113345262 128
364 3300025263 Ga0209565_1020041 Ga0209565_10200413 128
365 3300025291 Ga0209675_1009539 Ga0209675_10095394 128
366 3300025298 Ga0209050_1001139 Ga0209050_10011397 128
367 3300025298 Ga0209050_1056335 Ga0209050_10563351 128
368 3300025299 Ga0209256_1000011 Ga0209256_1000011192 128
369 3300025303 Ga0209051_1000016 Ga0209051_1000016145 128
370 3300025304 Ga0209257_1000102 Ga0209257_1000102148 128
371 3300025919 Ga0207657_10057735 Ga0207657_100577352 128
372 3300025920 Ga0207649_10010047 Ga0207649_100100479 128
373 3300025932 Ga0207690_10001849 Ga0207690_1000184913 128
374 3300025935 Ga0207709_10902504 Ga0207709_109025041 128
375 3300025938 Ga0207704_10540035 Ga0207704_105400352 128
376 3300025945 Ga0207679_10000245 Ga0207679_100002456 128
377 3300025960 Ga0207651_11100031 Ga0207651_111000312 128
378 3300025986 Ga0207658_10123427 Ga0207658_101234272 128
379 3300026023 Ga0207677_10824450 Ga0207677_108244502 128
380 3300026121 Ga0207683_10034463 Ga0207683_100344635 128
381 3300027111 Ga0209281_1000104 Ga0209281_1000104141 128
382 3300027395 Ga0209996_1014202 Ga0209996_10142022 128
383 3300027526 Ga0209968_1001970 Ga0209968_10019702 128
384 3300027695 Ga0209966_1000031 Ga0209966_10000316 128
385 3300028794 Ga0307515_10016830 Ga0307515_100168304 128
386 3300031456 Ga0307513_10185208 Ga0307513_101852081 128
387 3300031548 Ga0307408_100226239 Ga0307408_1002262392 128
388 3300031730 Ga0307516_10388483 Ga0307516_103884832 128
389 3300031824 Ga0307413_10077300 Ga0307413_100773002 128
390 3300031852 Ga0307410_10195689 Ga0307410_101956892 128
391 3300031901 Ga0307406_10695355 Ga0307406_106953551 128
392 3300031901 Ga0307406_11048379 Ga0307406_110483791 128
393 3300031995 Ga0307409_100433497 Ga0307409_1004334972 128
394 3300031995 Ga0307409_101518958 Ga0307409_1015189581 128
395 3300032005 Ga0307411_10000414 Ga0307411_1000041411 128
396 3300032005 Ga0307411_10031904 Ga0307411_100319044 128
397 3300035241 Ga0373961_0333882 Ga0373961_0333882_147_533 128
398 3300037418 Ga0395900_0000063 Ga0395900_0000063_122564_122950 128
399 3300037466 Ga0395898_0001636 Ga0395898_0001636_1175_1561 128
400 3300037471 Ga0395905_0042050 Ga0395905_0042050_1649_2086 128
401 3300037471 Ga0395905_0117574 Ga0395905_0117574_1363_1752 128
402 3300037853 Ga0436364_0792843 Ga0436364_0792843_114_503 128
403 3300039447 Ga0436361_0167979 Ga0436361_0167979_47654_48073 128
404 3300041410 Ga0439461_0072742 Ga0439461_0072742_83_526 128
405 3300041443 Ga0451789_0090765 Ga0451789_0090765_114_500 128
406 3300041452 Ga0451793_0999039 Ga0451793_0999039_481_867 128
407 3300041463 Ga0451804_0107983 Ga0451804_0107983_232_618 128
408 3300041486 Ga0451807_1756659 Ga0451807_1756659_247_633 128
409 3300041491 Ga0451833_0792328 Ga0451833_0792328_58_447 128
410 3300041498 Ga0451841_0453451 Ga0451841_0453451_145_534 128
411 3300041511 Ga0451855_1546692 Ga0451855_1546692_114_500 128
412 3300042002 Ga0439442_085242 Ga0439442_085242_115_510 128
413 3300042012 Ga0439455_0027801 Ga0439455_0027801_982_1377 128
414 3300042120 Ga0450917_000220 Ga0450917_000220_1550_1993 128
415 3300042126 Ga0450888_000337 Ga0450888_000337_767_1210 128
416 3300042127 Ga0450890_001262 Ga0450890_001262_2297_2740 128
417 3300042130 Ga0450892_003113 Ga0450892_003113_651_1094 128
418 3300042138 Ga0450903_007691 Ga0450903_007691_468_911 128
419 3300042139 Ga0450904_011070 Ga0450904_011070_415_858 128
420 3300042144 Ga0450889_001245 Ga0450889_001245_555_998 128
421 3300042435 Ga0439434_0055985 Ga0439434_0055985_312_707 128
422 3300042532 Ga0450893_0000560 Ga0450893_0000560_2409_2852 128
423 3300042876 Ga0451577_0010966 Ga0451577_0010966_6848_7264 128
424 3300044658 Ga0466972_0008836 Ga0466972_0008836_2194_2580 128
425 3300044683 Ga0466965_0020390 Ga0466965_0020390_1743_2129 128
426 3300044712 Ga0453684_0044822 Ga0453684_0044822_1912_2340 128
427 3300044719 Ga0466971_0277614 Ga0466971_0277614_38_424 128
428 3300044765 Ga0466970_0013702 Ga0466970_0013702_254_640 128
429 3300044842 Ga0466957_0137473 Ga0466957_0137473_378_764 128
430 3300045049 Ga0466959_0010096 Ga0466959_0010096_2284_2670 128
431 3300045049 Ga0466959_0556206 Ga0466959_0556206_248_634 128
432 3300045976 Ga0466967_0092340 Ga0466967_0092340_1868_2254 128
433 3300046460 Ga0495638_0186488 Ga0495638_0186488_549_935 128
434 3300046512 Ga0495610_0064295 Ga0495610_0064295_880_1266 128
435 3300046515 Ga0495620_0076868 Ga0495620_0076868_53_439 128
436 3300046519 Ga0495632_0006659 Ga0495632_0006659_33_419 128
437 3300048909 Ga0496106_1368597 Ga0496106_1368597_146_532 128
438 3300048917 Ga0496114_0004606 Ga0496114_0004606_4181_4579 128
439 3300048924 Ga0496121_0034134 Ga0496121_0034134_1700_2092 128
440 3300048927 Ga0496124_0000605 Ga0496124_0000605_50310_50702 128
441 3300048928 Ga0496125_0006726 Ga0496125_0006726_4077_4469 128
442 3300049130 Ga0501310_036783 Ga0501310_036783_119_562 128
443 3300049523 Ga0501300_015678 Ga0501300_015678_300_743 128
444 3300049650 Ga0501199_013798 Ga0501199_013798_184_576 128
445 3300049658 Ga0501211_001456 Ga0501211_001456_746_1189 128
446 3300049662 Ga0501222_042919 Ga0501222_042919_109_552 128
447 3300049665 Ga0501227_029913 Ga0501227_029913_39_482 128
448 3300049668 Ga0501233_028479 Ga0501233_028479_380_823 128
449 3300049669 Ga0501235_013961 Ga0501235_013961_876_1319 128
450 3300049684 Ga0501255_015573 Ga0501255_015573_351_794 128
451 3300049686 Ga0501257_090515 Ga0501257_090515_340_783 128
452 3300049706 Ga0501229_002114 Ga0501229_002114_1679_2122 128
453 3300049764 Ga0501267_008376 Ga0501267_008376_474_917 128
454 3300049769 Ga0501272_022716 Ga0501272_022716_114_557 128
455 3300049822 Ga0501035_0112544 Ga0501035_0112544_1972_2358 128
456 3300050493 nmdc:mga0k408_562068_c1 nmdc:mga0k408_562068_c1_48_491 128
457 3300053089 Ga0500581_195103 Ga0500581_195103_69_455 128
458 3300053090 Ga0500646_0014711 Ga0500646_0014711_1362_1748 128
459 3300053098 Ga0500650_0016186 Ga0500650_0016186_345_731 128
460 3300053127 Ga0500623_119748 Ga0500623_119748_231_617 128
461 3300053130 Ga0500642_0019098 Ga0500642_0019098_889_1275 128
462 3300053131 Ga0500652_000182 Ga0500652_000182_16099_16485 128
463 3300053133 Ga0500655_005169 Ga0500655_005169_1883_2269 128
464 3300053139 Ga0500568_0012201 Ga0500568_0012201_487_873 128
465 3300053140 Ga0500573_0312079 Ga0500573_0312079_326_715 128
466 3300053142 Ga0500577_0086334 Ga0500577_0086334_390_776 128
467 3300053151 Ga0500604_0018885 Ga0500604_0018885_366_752 128
468 3300053156 Ga0500622_0000028 Ga0500622_0000028_168012_168398 128
469 3300061719 Ga0466962_0004516 Ga0466962_0004516_3907_4293 128
470 3300003791 Ga0055530_10032114 Ga0055530_100321142 129
471 3300005262 Ga0065165_1000774 Ga0065165_100077415 129
472 3300006195 Ga0075366_10282218 Ga0075366_102822181 129
473 3300006195 Ga0075366_10383141 Ga0075366_103831411 129
474 3300006237 Ga0097621_101366939 Ga0097621_1013669391 129
475 3300006237 Ga0097621_101501119 Ga0097621_1015011191 129
476 3300006846 Ga0075430_100008491 Ga0075430_1000084917 129
477 3300006880 Ga0075429_100048278 Ga0075429_1000482785 129
478 3300025273 Ga0209673_1003830 Ga0209673_10038307 129
479 3300025298 Ga0209050_1001012 Ga0209050_100101227 129
480 3300025303 Ga0209051_1015716 Ga0209051_10157163 129
481 3300025303 Ga0209051_1109657 Ga0209051_11096572 129
482 3300026118 Ga0207675_100324108 Ga0207675_1003241082 129
483 3300028786 Ga0307517_10221059 Ga0307517_102210592 129
484 3300028794 Ga0307515_10347675 Ga0307515_103476752 129
485 3300031456 Ga0307513_10035897 Ga0307513_100358975 129
486 3300031548 Ga0307408_100465169 Ga0307408_1004651692 129
487 3300031730 Ga0307516_10000692 Ga0307516_1000069233 129
488 3300031903 Ga0307407_10138746 Ga0307407_101387462 129
489 3300031911 Ga0307412_10183560 Ga0307412_101835602 129
490 3300031995 Ga0307409_100052024 Ga0307409_1000520242 129
491 3300032005 Ga0307411_10042305 Ga0307411_100423052 129
492 3300033180 Ga0307510_10354576 Ga0307510_103545762 129
493 3300037471 Ga0395905_0091368 Ga0395905_0091368_1317_1709 129
494 3300039447 Ga0436361_0383238 Ga0436361_0383238_1789_2211 129
495 3300041459 Ga0451800_0522497 Ga0451800_0522497_84_473 129
496 3300042008 Ga0439450_104879 Ga0439450_104879_248_640 129
497 3300042128 Ga0450897_007687 Ga0450897_007687_257_649 129
498 3300042439 Ga0439464_0132482 Ga0439464_0132482_53_445 129
499 3300046519 Ga0495632_0151997 Ga0495632_0151997_377_778 129
500 3300047472 Ga0495686_0003746 Ga0495686_0003746_9660_10055 129
501 3300050493 nmdc:mga0k408_221259_c1 nmdc:mga0k408_221259_c1_238_627 129
502 3300050493 nmdc:mga0k408_306119_c1 nmdc:mga0k408_306119_c1_138_527 129
503 3300050495 nmdc:mga04h51_217795_c1 nmdc:mga04h51_217795_c1_334_723 129
504 3300050496 nmdc:mga07m45_3655_c1 nmdc:mga07m45_3655_c1_3654_4043 129
505 3300050496 nmdc:mga07m45_580864_c1 nmdc:mga07m45_580864_c1_86_505 129
506 3300050508 nmdc:mga09592_3100_c1 nmdc:mga09592_3100_c1_9870_10298 129
507 3300050509 nmdc:mga0qj67_7173_c1 nmdc:mga0qj67_7173_c1_4763_5191 129
508 3300053086 Ga0500578_0000683 Ga0500578_0000683_21268_21657 129
509 3300053129 Ga0500628_001735 Ga0500628_001735_2633_3022 129
510 3300053130 Ga0500642_0024548 Ga0500642_0024548_220_609 129
511 3300053726 Ga0500584_119967 Ga0500584_119967_325_714 129
512 3300005328 Ga0070676_10029269 Ga0070676_100292692 130
513 3300005328 Ga0070676_11472523 Ga0070676_114725231 130
514 3300005334 Ga0068869_100215705 Ga0068869_1002157052 130
515 3300005338 Ga0068868_100215368 Ga0068868_1002153682 130
516 3300005355 Ga0070671_100750748 Ga0070671_1007507482 130
517 3300005364 Ga0070673_100989001 Ga0070673_1009890011 130
518 3300005367 Ga0070667_100321313 Ga0070667_1003213132 130
519 3300005445 Ga0070708_100642709 Ga0070708_1006427092 130
520 3300005456 Ga0070678_100623908 Ga0070678_1006239082 130
521 3300005457 Ga0070662_100019849 Ga0070662_1000198495 130
522 3300005457 Ga0070662_100994376 Ga0070662_1009943762 130
523 3300005459 Ga0068867_100000079 Ga0068867_10000007937 130
524 3300005459 Ga0068867_100087432 Ga0068867_1000874321 130
525 3300005467 Ga0070706_100000388 Ga0070706_10000038811 130
526 3300005467 Ga0070706_100707819 Ga0070706_1007078192 130
527 3300005468 Ga0070707_100045770 Ga0070707_1000457703 130
528 3300005471 Ga0070698_100224986 Ga0070698_1002249863 130
529 3300005518 Ga0070699_100032534 Ga0070699_1000325345 130
530 3300005548 Ga0070665_100059179 Ga0070665_1000591793 130
531 3300005548 Ga0070665_100842563 Ga0070665_1008425632 130
532 3300005578 Ga0068854_101369313 Ga0068854_1013693132 130
533 3300005616 Ga0068852_100002342 Ga0068852_1000023421 130
534 3300005616 Ga0068852_100168738 Ga0068852_1001687382 130
535 3300005617 Ga0068859_100042005 Ga0068859_1000420056 130
536 3300005618 Ga0068864_100265575 Ga0068864_1002655753 130
537 3300005719 Ga0068861_100683431 Ga0068861_1006834312 130
538 3300005841 Ga0068863_100179239 Ga0068863_1001792393 130
539 3300005842 Ga0068858_100647385 Ga0068858_1006473852 130
540 3300005843 Ga0068860_100104582 Ga0068860_1001045822 130
541 3300005843 Ga0068860_100291526 Ga0068860_1002915262 130
542 3300005843 Ga0068860_100598434 Ga0068860_1005984342 130
543 3300005985 Ga0081539_10442486 Ga0081539_104424861 130
544 3300006042 Ga0075368_10012661 Ga0075368_100126612 130
545 3300006042 Ga0075368_10022244 Ga0075368_100222444 130
546 3300006042 Ga0075368_10148408 Ga0075368_101484082 130
547 3300006048 Ga0075363_100261761 Ga0075363_1002617612 130
548 3300006048 Ga0075363_100485990 Ga0075363_1004859902 130
549 3300006177 Ga0075362_10007978 Ga0075362_100079783 130
550 3300006177 Ga0075362_10075269 Ga0075362_100752692 130
551 3300006177 Ga0075362_10154932 Ga0075362_101549322 130
552 3300006178 Ga0075367_10008207 Ga0075367_100082074 130
553 3300006178 Ga0075367_10017465 Ga0075367_100174652 130
554 3300006178 Ga0075367_10052138 Ga0075367_100521383 130
555 3300006178 Ga0075367_10097573 Ga0075367_100975732 130
556 3300006178 Ga0075367_10774202 Ga0075367_107742021 130
557 3300006186 Ga0075369_10012220 Ga0075369_100122202 130
558 3300006195 Ga0075366_10000121 Ga0075366_100001213 130
559 3300006195 Ga0075366_10000536 Ga0075366_1000053610 130
560 3300006195 Ga0075366_10054075 Ga0075366_100540752 130
561 3300006195 Ga0075366_10063868 Ga0075366_100638682 130
562 3300006195 Ga0075366_10085112 Ga0075366_100851122 130
563 3300006195 Ga0075366_10225859 Ga0075366_102258592 130
564 3300006195 Ga0075366_10393438 Ga0075366_103934382 130
565 3300006195 Ga0075366_10776982 Ga0075366_107769821 130
566 3300006237 Ga0097621_101311580 Ga0097621_1013115802 130
567 3300006353 Ga0075370_10000705 Ga0075370_1000070513 130
568 3300006353 Ga0075370_10000999 Ga0075370_100009992 130
569 3300006353 Ga0075370_10007983 Ga0075370_100079837 130
570 3300006353 Ga0075370_10008114 Ga0075370_100081146 130
571 3300006353 Ga0075370_10078337 Ga0075370_100783373 130
572 3300006353 Ga0075370_10084491 Ga0075370_100844912 130
573 3300006353 Ga0075370_10171490 Ga0075370_101714902 130
574 3300006881 Ga0068865_100216585 Ga0068865_1002165852 130
575 3300006931 Ga0097620_100042008 Ga0097620_1000420086 130
576 3300009093 Ga0105240_10085973 Ga0105240_100859734 130
577 3300009098 Ga0105245_10027266 Ga0105245_100272663 130
578 3300009098 Ga0105245_10779927 Ga0105245_107799272 130
579 3300009147 Ga0114129_12424483 Ga0114129_124244832 130
580 3300009148 Ga0105243_10001414 Ga0105243_1000141411 130
581 3300009148 Ga0105243_10765584 Ga0105243_107655842 130
582 3300009177 Ga0105248_10529126 Ga0105248_105291262 130
583 3300009545 Ga0105237_10010812 Ga0105237_100108127 130
584 3300010375 Ga0105239_10065573 Ga0105239_100655732 130
585 3300010375 Ga0105239_11580766 Ga0105239_115807662 130
586 3300011119 Ga0105246_10167749 Ga0105246_101677491 130
587 3300013296 Ga0157374_10038281 Ga0157374_100382812 130
588 3300013297 Ga0157378_10182223 Ga0157378_101822233 130
589 3300013297 Ga0157378_10723242 Ga0157378_107232422 130
590 3300013297 Ga0157378_11431410 Ga0157378_114314102 130
591 3300013306 Ga0163162_10560542 Ga0163162_105605422 130
592 3300013308 Ga0157375_10024840 Ga0157375_100248402 130
593 3300013308 Ga0157375_10031475 Ga0157375_100314752 130
594 3300014325 Ga0163163_11046215 Ga0163163_110462152 130
595 3300014326 Ga0157380_10275266 Ga0157380_102752662 130
596 3300014745 Ga0157377_10000073 Ga0157377_1000007318 130
597 3300014968 Ga0157379_10041939 Ga0157379_100419395 130
598 3300014968 Ga0157379_10078386 Ga0157379_100783864 130
599 3300014969 Ga0157376_10466310 Ga0157376_104663102 130
600 3300017792 Ga0163161_11886003 Ga0163161_118860031 130
601 3300025907 Ga0207645_10029405 Ga0207645_100294053 130
602 3300025907 Ga0207645_10791775 Ga0207645_107917752 130
603 3300025907 Ga0207645_10900830 Ga0207645_109008302 130
604 3300025910 Ga0207684_10006285 Ga0207684_100062856 130
605 3300025913 Ga0207695_10751001 Ga0207695_107510012 130
606 3300025914 Ga0207671_10057040 Ga0207671_100570402 130
607 3300025922 Ga0207646_10123419 Ga0207646_101234193 130
608 3300025927 Ga0207687_10012905 Ga0207687_100129052 130
609 3300025927 Ga0207687_10400813 Ga0207687_104008132 130
610 3300025933 Ga0207706_10033089 Ga0207706_100330893 130
611 3300025933 Ga0207706_10131856 Ga0207706_101318564 130
612 3300025935 Ga0207709_10001791 Ga0207709_100017914 130
613 3300025935 Ga0207709_10622230 Ga0207709_106222302 130
614 3300025938 Ga0207704_11341823 Ga0207704_113418232 130
615 3300025940 Ga0207691_10681016 Ga0207691_106810162 130
616 3300025942 Ga0207689_11009461 Ga0207689_110094612 130
617 3300025960 Ga0207651_10570905 Ga0207651_105709052 130
618 3300025986 Ga0207658_10000412 Ga0207658_1000041226 130
619 3300026023 Ga0207677_10014819 Ga0207677_100148192 130
620 3300026067 Ga0207678_10274565 Ga0207678_102745652 130
621 3300026088 Ga0207641_10607407 Ga0207641_106074072 130
622 3300026088 Ga0207641_11898398 Ga0207641_118983981 130
623 3300026089 Ga0207648_10000115 Ga0207648_1000011552 130
624 3300026089 Ga0207648_10101494 Ga0207648_101014942 130
625 3300026095 Ga0207676_11856262 Ga0207676_118562621 130
626 3300026121 Ga0207683_10128227 Ga0207683_101282273 130
627 3300026121 Ga0207683_10229106 Ga0207683_102291062 130
628 3300026121 Ga0207683_10728581 Ga0207683_107285812 130
629 3300026142 Ga0207698_10202502 Ga0207698_102025023 130
630 3300027866 Ga0209813_10020845 Ga0209813_100208452 130
631 3300027866 Ga0209813_10233275 Ga0209813_102332752 130
632 3300028379 Ga0268266_10287066 Ga0268266_102870662 130
633 3300028379 Ga0268266_10769666 Ga0268266_107696662 130
634 3300028381 Ga0268264_10018783 Ga0268264_100187832 130
635 3300028381 Ga0268264_10111176 Ga0268264_101111763 130
636 3300028786 Ga0307517_10475760 Ga0307517_104757602 130
637 3300028794 Ga0307515_10005581 Ga0307515_100055817 130
638 3300030522 Ga0307512_10005276 Ga0307512_1000527613 130
639 3300030522 Ga0307512_10199543 Ga0307512_101995432 130
640 3300031456 Ga0307513_10246602 Ga0307513_102466022 130
641 3300031456 Ga0307513_10274230 Ga0307513_102742302 130
642 3300031507 Ga0307509_10000120 Ga0307509_10000120104 130
643 3300031507 Ga0307509_10004147 Ga0307509_1000414714 130
644 3300031507 Ga0307509_10004183 Ga0307509_1000418314 130
645 3300031507 Ga0307509_10101786 Ga0307509_101017862 130
646 3300031507 Ga0307509_10135277 Ga0307509_101352772 130
647 3300031507 Ga0307509_10353407 Ga0307509_103534072 130
648 3300031507 Ga0307509_10408581 Ga0307509_104085812 130
649 3300031548 Ga0307408_100313894 Ga0307408_1003138942 130
650 3300031616 Ga0307508_10000163 Ga0307508_100001632 130
651 3300031616 Ga0307508_10237326 Ga0307508_102373262 130
652 3300031616 Ga0307508_10440829 Ga0307508_104408292 130
653 3300031649 Ga0307514_10020475 Ga0307514_100204752 130
654 3300031649 Ga0307514_10101633 Ga0307514_101016332 130
655 3300031730 Ga0307516_10065007 Ga0307516_100650072 130
656 3300031730 Ga0307516_10716316 Ga0307516_107163161 130
657 3300031838 Ga0307518_10182139 Ga0307518_101821392 130
658 3300031901 Ga0307406_10953748 Ga0307406_109537482 130
659 3300031911 Ga0307412_10122939 Ga0307412_101229392 130
660 3300033179 Ga0307507_10074799 Ga0307507_100747992 130
661 3300033179 Ga0307507_10435106 Ga0307507_104351062 130
662 3300033180 Ga0307510_10013446 Ga0307510_100134463 130
663 3300033180 Ga0307510_10041814 Ga0307510_100418145 130
664 3300033180 Ga0307510_10056403 Ga0307510_100564034 130
665 3300037068 Ga0373925_0324445 Ga0373925_0324445_280_678 130
666 3300041443 Ga0451789_0384357 Ga0451789_0384357_210_605 130
667 3300041460 Ga0451802_1685874 Ga0451802_1685874_419_814 130
668 3300041512 Ga0451853_1002289 Ga0451853_1002289_190_585 130
669 3300042014 Ga0439457_058019 Ga0439457_058019_407_802 130
670 3300044712 Ga0453684_0005726 Ga0453684_0005726_9063_9458 130
671 3300046460 Ga0495638_0099749 Ga0495638_0099749_988_1383 130
672 3300046460 Ga0495638_0369002 Ga0495638_0369002_226_621 130
673 3300046507 Ga0495606_0418041 Ga0495606_0418041_177_572 130
674 3300046513 Ga0495616_0106602 Ga0495616_0106602_322_717 130
675 3300046519 Ga0495632_0003071 Ga0495632_0003071_7227_7622 130
676 3300046520 Ga0495637_0355828 Ga0495637_0355828_83_478 130
677 3300046542 Ga0495597_0115887 Ga0495597_0115887_655_1050 130
678 3300046616 Ga0495668_0492100 Ga0495668_0492100_130_525 130
679 3300046660 Ga0495625_0009362 Ga0495625_0009362_2400_2795 130
680 3300046692 Ga0495671_0102969 Ga0495671_0102969_225_623 130
681 3300046694 Ga0495649_0001713 Ga0495649_0001713_13390_13785 130
682 3300047443 Ga0495687_000138 Ga0495687_000138_84946_85341 130
683 3300047443 Ga0495687_010872 Ga0495687_010872_853_1248 130
684 3300047469 Ga0495673_0108372 Ga0495673_0108372_522_917 130
685 3300047472 Ga0495686_0144409 Ga0495686_0144409_686_1081 130
686 3300047472 Ga0495686_0430969 Ga0495686_0430969_236_631 130
687 3300048091 Ga0495626_0186092 Ga0495626_0186092_381_776 130
688 3300048909 Ga0496106_0002144 Ga0496106_0002144_12405_12800 130
689 3300049515 Ga0501292_033160 Ga0501292_033160_142_534 130
690 3300049526 Ga0501303_005883 Ga0501303_005883_416_808 130
691 3300049759 Ga0501262_003054 Ga0501262_003054_1285_1677 130
692 3300049762 Ga0501265_006850 Ga0501265_006850_851_1243 130
693 3300049774 Ga0501278_004446 Ga0501278_004446_17_409 130
694 3300050489 nmdc:mga03683_15435_c1 nmdc:mga03683_15435_c1_273_668 130
695 3300050489 nmdc:mga03683_224847_c1 nmdc:mga03683_224847_c1_59_454 130
696 3300050489 nmdc:mga03683_63995_c1 nmdc:mga03683_63995_c1_617_1012 130
697 3300050490 nmdc:mga03n38_305309_c1 nmdc:mga03n38_305309_c1_133_528 130
698 3300050490 nmdc:mga03n38_67450_c1 nmdc:mga03n38_67450_c1_746_1141 130
699 3300050490 nmdc:mga03n38_963394_c1 nmdc:mga03n38_963394_c1_75_470 130
700 3300050491 nmdc:mga00v17_20735_c1 nmdc:mga00v17_20735_c1_415_810 130
701 3300050491 nmdc:mga00v17_213990_c1 nmdc:mga00v17_213990_c1_535_930 130
702 3300050492 nmdc:mga0yw44_557234_c1 nmdc:mga0yw44_557234_c1_221_616 130
703 3300050493 nmdc:mga0k408_11470_c1 nmdc:mga0k408_11470_c1_1491_1886 130
704 3300050493 nmdc:mga0k408_12304_c1 nmdc:mga0k408_12304_c1_815_1210 130
705 3300050493 nmdc:mga0k408_245349_c1 nmdc:mga0k408_245349_c1_488_883 130
706 3300050493 nmdc:mga0k408_34469_c1 nmdc:mga0k408_34469_c1_39_434 130
707 3300050493 nmdc:mga0k408_39190_c1 nmdc:mga0k408_39190_c1_523_918 130
708 3300050493 nmdc:mga0k408_475889_c1 nmdc:mga0k408_475889_c1_185_580 130
709 3300050493 nmdc:mga0k408_505_c1 nmdc:mga0k408_505_c1_14076_14471 130
710 3300050493 nmdc:mga0k408_550473_c1 nmdc:mga0k408_550473_c1_79_474 130
711 3300050493 nmdc:mga0k408_6081_c1 nmdc:mga0k408_6081_c1_3284_3679 130
712 3300050493 nmdc:mga0k408_774_c1 nmdc:mga0k408_774_c1_6578_6973 130
713 3300050493 nmdc:mga0k408_78307_c1 nmdc:mga0k408_78307_c1_571_963 130
714 3300050494 nmdc:mga06z11_174031_c1 nmdc:mga06z11_174031_c1_130_525 130
715 3300050494 nmdc:mga06z11_39308_c1 nmdc:mga06z11_39308_c1_486_881 130
716 3300050494 nmdc:mga06z11_631947_c1 nmdc:mga06z11_631947_c1_117_584 130
717 3300050495 nmdc:mga04h51_25761_c1 nmdc:mga04h51_25761_c1_1089_1484 130
718 3300050495 nmdc:mga04h51_312022_c1 nmdc:mga04h51_312022_c1_73_468 130
719 3300050495 nmdc:mga04h51_58901_c1 nmdc:mga04h51_58901_c1_22_417 130
720 3300050496 nmdc:mga07m45_1105_c1 nmdc:mga07m45_1105_c1_254_649 130
721 3300050496 nmdc:mga07m45_127295_c1 nmdc:mga07m45_127295_c1_842_1237 130
722 3300050496 nmdc:mga07m45_3525_c1 nmdc:mga07m45_3525_c1_1279_1674 130
723 3300050496 nmdc:mga07m45_380594_c1 nmdc:mga07m45_380594_c1_285_680 130
724 3300050496 nmdc:mga07m45_4413_c1 nmdc:mga07m45_4413_c1_520_915 130
725 3300050496 nmdc:mga07m45_483857_c1 nmdc:mga07m45_483857_c1_206_601 130
726 3300050496 nmdc:mga07m45_632740_c1 nmdc:mga07m45_632740_c1_188_583 130
727 3300050496 nmdc:mga07m45_647989_c1 nmdc:mga07m45_647989_c1_26_421 130
728 3300050496 nmdc:mga07m45_7514_c1 nmdc:mga07m45_7514_c1_4884_5279 130
729 3300050507 nmdc:mga05p37_2114009_c1 nmdc:mga05p37_2114009_c1_33_425 130
730 3300050516 nmdc:mga0sz30_43161_c1 nmdc:mga0sz30_43161_c1_1474_1869 130
731 3300053086 Ga0500578_0065299 Ga0500578_0065299_47_442 130
732 3300053088 Ga0500644_0066001 Ga0500644_0066001_879_1274 130
733 3300053092 Ga0500583_0415641 Ga0500583_0415641_135_530 130
734 3300053093 Ga0500651_0144063 Ga0500651_0144063_123_518 130
735 3300053118 Ga0500594_0000375 Ga0500594_0000375_8166_8561 130
736 3300053131 Ga0500652_169655 Ga0500652_169655_428_823 130
737 3300053133 Ga0500655_019318 Ga0500655_019318_207_602 130
738 3300053136 Ga0500559_0000011 Ga0500559_0000011_89090_89485 130
739 3300053139 Ga0500568_0000931 Ga0500568_0000931_19426_19821 130
740 3300053139 Ga0500568_0077376 Ga0500568_0077376_326_721 130
741 3300053156 Ga0500622_0002568 Ga0500622_0002568_2593_2988 130
742 3300053160 Ga0500633_0203099 Ga0500633_0203099_140_535 130
743 3300053730 Ga0500645_008138 Ga0500645_008138_1326_1721 130
744 3300053736 Ga0500599_029727 Ga0500599_029727_128_523 130
745 3300053739 Ga0500587_000071 Ga0500587_000071_360_755 130
746 3300059424 Ga0590075_039059 Ga0590075_039059_746_1138 130
747 3300005327 Ga0070658_10268697 Ga0070658_102686972 131
748 3300005328 Ga0070676_10065473 Ga0070676_100654733 131
749 3300005328 Ga0070676_10614956 Ga0070676_106149562 131
750 3300005331 Ga0070670_100003396 Ga0070670_10000339617 131
751 3300005331 Ga0070670_100031847 Ga0070670_1000318472 131
752 3300005331 Ga0070670_100192585 Ga0070670_1001925851 131
753 3300005331 Ga0070670_100211503 Ga0070670_1002115032 131
754 3300005333 Ga0070677_10124964 Ga0070677_101249642 131
755 3300005334 Ga0068869_100010437 Ga0068869_1000104375 131
756 3300005335 Ga0070666_10004785 Ga0070666_100047858 131
757 3300005335 Ga0070666_11464255 Ga0070666_114642551 131
758 3300005338 Ga0068868_100021348 Ga0068868_1000213487 131
759 3300005338 Ga0068868_100164543 Ga0068868_1001645432 131
760 3300005338 Ga0068868_100530601 Ga0068868_1005306012 131
761 3300005340 Ga0070689_100033724 Ga0070689_1000337241 131
762 3300005344 Ga0070661_101271271 Ga0070661_1012712711 131
763 3300005347 Ga0070668_100050633 Ga0070668_1000506334 131
764 3300005347 Ga0070668_100441036 Ga0070668_1004410362 131
765 3300005353 Ga0070669_100022388 Ga0070669_1000223885 131
766 3300005353 Ga0070669_100222615 Ga0070669_1002226152 131
767 3300005354 Ga0070675_100001074 Ga0070675_10000107413 131
768 3300005354 Ga0070675_100044952 Ga0070675_1000449524 131
769 3300005354 Ga0070675_100121446 Ga0070675_1001214462 131
770 3300005355 Ga0070671_100012181 Ga0070671_1000121814 131
771 3300005355 Ga0070671_100140280 Ga0070671_1001402802 131
772 3300005355 Ga0070671_100392597 Ga0070671_1003925971 131
773 3300005355 Ga0070671_100439823 Ga0070671_1004398232 131
774 3300005356 Ga0070674_100184544 Ga0070674_1001845442 131
775 3300005364 Ga0070673_100003123 Ga0070673_1000031239 131
776 3300005364 Ga0070673_100695042 Ga0070673_1006950422 131
777 3300005366 Ga0070659_100420844 Ga0070659_1004208442 131
778 3300005367 Ga0070667_100002896 Ga0070667_1000028967 131
779 3300005455 Ga0070663_100947368 Ga0070663_1009473681 131
780 3300005456 Ga0070678_100004923 Ga0070678_1000049232 131
781 3300005456 Ga0070678_100005243 Ga0070678_1000052438 131
782 3300005459 Ga0068867_100153708 Ga0068867_1001537082 131
783 3300005459 Ga0068867_101196389 Ga0068867_1011963891 131
784 3300005539 Ga0068853_101092598 Ga0068853_1010925981 131
785 3300005543 Ga0070672_100002387 Ga0070672_1000023873 131
786 3300005543 Ga0070672_100051301 Ga0070672_1000513014 131
787 3300005543 Ga0070672_100208365 Ga0070672_1002083652 131
788 3300005544 Ga0070686_100458324 Ga0070686_1004583242 131
789 3300005544 Ga0070686_100566193 Ga0070686_1005661932 131
790 3300005564 Ga0070664_100181679 Ga0070664_1001816791 131
791 3300005564 Ga0070664_100412579 Ga0070664_1004125792 131
792 3300005564 Ga0070664_100534136 Ga0070664_1005341361 131
793 3300005578 Ga0068854_100134318 Ga0068854_1001343182 131
794 3300005615 Ga0070702_100218153 Ga0070702_1002181532 131
795 3300005616 Ga0068852_100033844 Ga0068852_1000338445 131
796 3300005616 Ga0068852_101322302 Ga0068852_1013223022 131
797 3300005617 Ga0068859_100008331 Ga0068859_1000083319 131
798 3300005618 Ga0068864_100005602 Ga0068864_1000056029 131
799 3300005618 Ga0068864_100007343 Ga0068864_1000073433 131
800 3300005719 Ga0068861_100388238 Ga0068861_1003882382 131
801 3300005840 Ga0068870_10169712 Ga0068870_101697122 131
802 3300005841 Ga0068863_100011592 Ga0068863_1000115929 131
803 3300005842 Ga0068858_100002455 Ga0068858_10000245513 131
804 3300005843 Ga0068860_100102320 Ga0068860_1001023204 131
805 3300005844 Ga0068862_100188750 Ga0068862_1001887502 131
806 3300006028 Ga0070717_10453466 Ga0070717_104534662 131
807 3300006195 Ga0075366_10209294 Ga0075366_102092942 131
808 3300006237 Ga0097621_100005695 Ga0097621_1000056959 131
809 3300006237 Ga0097621_100128831 Ga0097621_1001288312 131
810 3300006237 Ga0097621_100545435 Ga0097621_1005454352 131
811 3300006358 Ga0068871_100035181 Ga0068871_1000351814 131
812 3300006358 Ga0068871_101128782 Ga0068871_1011287822 131
813 3300006931 Ga0097620_100008331 Ga0097620_1000083319 131
814 3300009176 Ga0105242_11562968 Ga0105242_115629682 131
815 3300009177 Ga0105248_10076756 Ga0105248_100767564 131
816 3300009553 Ga0105249_10876576 Ga0105249_108765762 131
817 3300010375 Ga0105239_11195609 Ga0105239_111956092 131
818 3300012480 Ga0157346_1026995 Ga0157346_10269951 131
819 3300012491 Ga0157329_1036603 Ga0157329_10366031 131
820 3300013105 Ga0157369_10581150 Ga0157369_105811502 131
821 3300013306 Ga0163162_10017073 Ga0163162_100170734 131
822 3300013308 Ga0157375_10035899 Ga0157375_100358995 131
823 3300013308 Ga0157375_10087312 Ga0157375_100873124 131
824 3300013308 Ga0157375_10440897 Ga0157375_104408972 131
825 3300014325 Ga0163163_10007006 Ga0163163_100070065 131
826 3300014326 Ga0157380_10264791 Ga0157380_102647912 131
827 3300014326 Ga0157380_11098478 Ga0157380_110984782 131
828 3300014968 Ga0157379_10047216 Ga0157379_100472163 131
829 3300014968 Ga0157379_10472095 Ga0157379_104720952 131
830 3300014969 Ga0157376_10132414 Ga0157376_101324142 131
831 3300017792 Ga0163161_10079208 Ga0163161_100792084 131
832 3300025893 Ga0207682_10055331 Ga0207682_100553313 131
833 3300025903 Ga0207680_10003607 Ga0207680_100036072 131
834 3300025907 Ga0207645_10101586 Ga0207645_101015862 131
835 3300025907 Ga0207645_10189086 Ga0207645_101890862 131
836 3300025908 Ga0207643_10593938 Ga0207643_105939382 131
837 3300025923 Ga0207681_10419230 Ga0207681_104192302 131
838 3300025925 Ga0207650_10022623 Ga0207650_100226232 131
839 3300025925 Ga0207650_10043137 Ga0207650_100431371 131
840 3300025925 Ga0207650_10077233 Ga0207650_100772333 131
841 3300025926 Ga0207659_10005586 Ga0207659_100055862 131
842 3300025926 Ga0207659_10009813 Ga0207659_100098133 131
843 3300025926 Ga0207659_10148548 Ga0207659_101485482 131
844 3300025927 Ga0207687_11465507 Ga0207687_114655072 131
845 3300025931 Ga0207644_10017836 Ga0207644_100178364 131
846 3300025931 Ga0207644_10109498 Ga0207644_101094982 131
847 3300025931 Ga0207644_10116412 Ga0207644_101164122 131
848 3300025931 Ga0207644_10982184 Ga0207644_109821842 131
849 3300025933 Ga0207706_10024229 Ga0207706_100242295 131
850 3300025934 Ga0207686_10520784 Ga0207686_105207842 131
851 3300025935 Ga0207709_10295188 Ga0207709_102951882 131
852 3300025936 Ga0207670_10022243 Ga0207670_100222432 131
853 3300025937 Ga0207669_10109905 Ga0207669_101099052 131
854 3300025938 Ga0207704_10080365 Ga0207704_100803653 131
855 3300025939 Ga0207665_10373425 Ga0207665_103734252 131
856 3300025940 Ga0207691_10001319 Ga0207691_1000131912 131
857 3300025940 Ga0207691_10022193 Ga0207691_100221935 131
858 3300025940 Ga0207691_10043476 Ga0207691_100434764 131
859 3300025940 Ga0207691_10361968 Ga0207691_103619682 131
860 3300025941 Ga0207711_10065234 Ga0207711_100652342 131
861 3300025945 Ga0207679_10471805 Ga0207679_104718052 131
862 3300025960 Ga0207651_10027786 Ga0207651_100277862 131
863 3300025960 Ga0207651_10048368 Ga0207651_100483682 131
864 3300025960 Ga0207651_10427334 Ga0207651_104273342 131
865 3300025961 Ga0207712_10093243 Ga0207712_100932432 131
866 3300025972 Ga0207668_10488265 Ga0207668_104882652 131
867 3300025972 Ga0207668_10778005 Ga0207668_107780052 131
868 3300025981 Ga0207640_10070831 Ga0207640_100708312 131
869 3300025986 Ga0207658_10003143 Ga0207658_100031438 131
870 3300026023 Ga0207677_10001922 Ga0207677_100019227 131
871 3300026023 Ga0207677_10349338 Ga0207677_103493382 131
872 3300026035 Ga0207703_10002152 Ga0207703_1000215210 131
873 3300026035 Ga0207703_10605407 Ga0207703_106054072 131
874 3300026041 Ga0207639_11630032 Ga0207639_116300322 131
875 3300026067 Ga0207678_10930798 Ga0207678_109307981 131
876 3300026088 Ga0207641_10001478 Ga0207641_100014789 131
877 3300026088 Ga0207641_10394265 Ga0207641_103942652 131
878 3300026089 Ga0207648_10034806 Ga0207648_100348064 131
879 3300026089 Ga0207648_10550020 Ga0207648_105500202 131
880 3300026095 Ga0207676_10005107 Ga0207676_100051079 131
881 3300026095 Ga0207676_10033451 Ga0207676_100334512 131
882 3300026121 Ga0207683_10007307 Ga0207683_100073073 131
883 3300026121 Ga0207683_10011209 Ga0207683_100112097 131
884 3300026121 Ga0207683_10083984 Ga0207683_100839842 131
885 3300026121 Ga0207683_10437375 Ga0207683_104373752 131
886 3300026142 Ga0207698_10053580 Ga0207698_100535804 131
887 3300028380 Ga0268265_11514610 Ga0268265_115146102 131
888 3300028381 Ga0268264_10737706 Ga0268264_107377062 131
889 3300028794 Ga0307515_10000043 Ga0307515_10000043111 131
890 3300031824 Ga0307413_10649678 Ga0307413_106496782 131
891 3300031852 Ga0307410_11383756 Ga0307410_113837562 131
892 3300032002 Ga0307416_101950855 Ga0307416_1019508551 131
893 3300032004 Ga0307414_10352444 Ga0307414_103524442 131
894 3300035083 Ga0373926_0334547 Ga0373926_0334547_102_500 131
895 3300035116 Ga0373945_0309346 Ga0373945_0309346_20_418 131
896 3300035172 Ga0373955_0561892 Ga0373955_0561892_243_641 131
897 3300035692 Ga0373935_0290607 Ga0373935_0290607_526_924 131
898 3300035695 Ga0373927_0735021 Ga0373927_0735021_134_532 131
899 3300035724 Ga0373933_0339026 Ga0373933_0339026_532_930 131
900 3300035725 Ga0373947_0646186 Ga0373947_0646186_230_628 131
901 3300036401 Ga0373937_0217585 Ga0373937_0217585_342_740 131
902 3300036401 Ga0373937_1287259 Ga0373937_1287259_167_565 131
903 3300037068 Ga0373925_0371067 Ga0373925_0371067_679_1077 131
904 3300037068 Ga0373925_0415980 Ga0373925_0415980_556_954 131
905 3300037853 Ga0436364_1217926 Ga0436364_1217926_444_842 131
906 3300041496 Ga0451839_1293856 Ga0451839_1293856_91_489 131
907 3300046459 Ga0495629_0666013 Ga0495629_0666013_79_477 131
908 3300046462 Ga0495651_0448753 Ga0495651_0448753_11_409 131
909 3300046477 Ga0495664_0674372 Ga0495664_0674372_101_499 131
910 3300046514 Ga0495618_0280680 Ga0495618_0280680_580_978 131
911 3300046526 Ga0495666_0193017 Ga0495666_0193017_393_797 131
912 3300046537 Ga0495598_0020636 Ga0495598_0020636_1169_1567 131
913 3300046537 Ga0495598_0186771 Ga0495598_0186771_271_669 131
914 3300046539 Ga0495621_0000332 Ga0495621_0000332_6399_6797 131
915 3300046539 Ga0495621_0001175 Ga0495621_0001175_2165_2563 131
916 3300046539 Ga0495621_0099711 Ga0495621_0099711_576_974 131
917 3300046543 Ga0495645_0234807 Ga0495645_0234807_17_415 131
918 3300046663 Ga0495635_1008280 Ga0495635_1008280_65_463 131
919 3300046681 Ga0495647_0085001 Ga0495647_0085001_628_1026 131
920 3300046683 Ga0495658_0243002 Ga0495658_0243002_706_1104 131
921 3300046683 Ga0495658_0345354 Ga0495658_0345354_132_530 131
922 3300046689 Ga0495613_0295109 Ga0495613_0295109_339_737 131
923 3300046690 Ga0495624_0027325 Ga0495624_0027325_2923_3330 131
924 3300046691 Ga0495670_0120403 Ga0495670_0120403_842_1240 131
925 3300047317 Ga0495604_0750938 Ga0495604_0750938_179_577 131
926 3300047318 Ga0495636_0163821 Ga0495636_0163821_449_847 131
927 3300047321 Ga0495676_0025847 Ga0495676_0025847_4169_4573 131
928 3300047471 Ga0495684_0747469 Ga0495684_0747469_17_415 131
929 3300047673 Ga0495593_0060680 Ga0495593_0060680_950_1354 131
930 3300048090 Ga0495615_0223841 Ga0495615_0223841_40_438 131
931 3300048904 Ga0496101_0177645 Ga0496101_0177645_742_1140 131
932 3300048908 Ga0496105_0078589 Ga0496105_0078589_1186_1584 131
933 3300048911 Ga0496108_0049498 Ga0496108_0049498_376_774 131
934 3300048911 Ga0496108_0099218 Ga0496108_0099218_957_1355 131
935 3300048913 Ga0496110_0244822 Ga0496110_0244822_756_1154 131
936 3300048913 Ga0496110_0365997 Ga0496110_0365997_104_502 131
937 3300048917 Ga0496114_0032690 Ga0496114_0032690_1849_2247 131
938 3300048917 Ga0496114_0067102 Ga0496114_0067102_1278_1676 131
939 3300048917 Ga0496114_0266566 Ga0496114_0266566_938_1336 131
940 3300050493 nmdc:mga0k408_358504_c1 nmdc:mga0k408_358504_c1_305_703 131
941 3300050507 nmdc:mga05p37_71866_c1 nmdc:mga05p37_71866_c1_1380_1778 131
942 3300053077 Ga0495601_0179882 Ga0495601_0179882_420_818 131
943 3300053077 Ga0495601_0675744 Ga0495601_0675744_194_592 131
944 3300053085 Ga0495619_1160160 Ga0495619_1160160_46_444 131
945 3300005293 Ga0065715_10074796 Ga0065715_100747962 132
946 3300005328 Ga0070676_10025314 Ga0070676_100253142 132
947 3300005328 Ga0070676_10310707 Ga0070676_103107072 132
948 3300005329 Ga0070683_100439052 Ga0070683_1004390522 132
949 3300005330 Ga0070690_100008484 Ga0070690_1000084845 132
950 3300005330 Ga0070690_100564603 Ga0070690_1005646031 132
951 3300005331 Ga0070670_100031821 Ga0070670_1000318214 132
952 3300005331 Ga0070670_100451327 Ga0070670_1004513272 132
953 3300005334 Ga0068869_100079132 Ga0068869_1000791322 132
954 3300005334 Ga0068869_100474183 Ga0068869_1004741831 132
955 3300005335 Ga0070666_10017715 Ga0070666_100177152 132
956 3300005338 Ga0068868_100040586 Ga0068868_1000405864 132
957 3300005338 Ga0068868_101736923 Ga0068868_1017369232 132
958 3300005339 Ga0070660_100572679 Ga0070660_1005726792 132
959 3300005343 Ga0070687_100026968 Ga0070687_1000269684 132
960 3300005344 Ga0070661_100257266 Ga0070661_1002572662 132
961 3300005344 Ga0070661_100443520 Ga0070661_1004435202 132
962 3300005347 Ga0070668_100046525 Ga0070668_1000465254 132
963 3300005347 Ga0070668_100880164 Ga0070668_1008801641 132
964 3300005353 Ga0070669_100016562 Ga0070669_1000165622 132
965 3300005353 Ga0070669_101170739 Ga0070669_1011707391 132
966 3300005354 Ga0070675_100357762 Ga0070675_1003577621 132
967 3300005354 Ga0070675_100456561 Ga0070675_1004565612 132
968 3300005355 Ga0070671_100008753 Ga0070671_1000087532 132
969 3300005355 Ga0070671_100120743 Ga0070671_1001207432 132
970 3300005356 Ga0070674_100010482 Ga0070674_1000104824 132
971 3300005356 Ga0070674_100553595 Ga0070674_1005535952 132
972 3300005364 Ga0070673_100647932 Ga0070673_1006479322 132
973 3300005364 Ga0070673_100803572 Ga0070673_1008035722 132
974 3300005366 Ga0070659_100193866 Ga0070659_1001938662 132
975 3300005367 Ga0070667_100123062 Ga0070667_1001230622 132
976 3300005367 Ga0070667_101053700 Ga0070667_1010537002 132
977 3300005438 Ga0070701_10141149 Ga0070701_101411492 132
978 3300005455 Ga0070663_100462485 Ga0070663_1004624852 132
979 3300005456 Ga0070678_100039003 Ga0070678_1000390032 132
980 3300005456 Ga0070678_100051960 Ga0070678_1000519604 132
981 3300005456 Ga0070678_100056220 Ga0070678_1000562202 132
982 3300005457 Ga0070662_100021799 Ga0070662_1000217992 132
983 3300005457 Ga0070662_100703961 Ga0070662_1007039611 132
984 3300005459 Ga0068867_100029977 Ga0068867_1000299774 132
985 3300005459 Ga0068867_100144684 Ga0068867_1001446843 132
986 3300005466 Ga0070685_10933210 Ga0070685_109332101 132
987 3300005539 Ga0068853_100988845 Ga0068853_1009888452 132
988 3300005539 Ga0068853_101051361 Ga0068853_1010513612 132
989 3300005543 Ga0070672_100012480 Ga0070672_1000124802 132
990 3300005543 Ga0070672_100035389 Ga0070672_1000353892 132
991 3300005543 Ga0070672_100256635 Ga0070672_1002566352 132
992 3300005548 Ga0070665_100671884 Ga0070665_1006718842 132
993 3300005548 Ga0070665_101135948 Ga0070665_1011359481 132
994 3300005563 Ga0068855_100268883 Ga0068855_1002688832 132
995 3300005564 Ga0070664_100134859 Ga0070664_1001348593 132
996 3300005564 Ga0070664_100451901 Ga0070664_1004519012 132
997 3300005578 Ga0068854_100187189 Ga0068854_1001871892 132
998 3300005616 Ga0068852_100013873 Ga0068852_1000138733 132
999 3300005616 Ga0068852_100070757 Ga0068852_1000707574 132
1000 3300005616 Ga0068852_100098149 Ga0068852_1000981492 132
1001 3300005616 Ga0068852_100163928 Ga0068852_1001639282 132
1002 3300005616 Ga0068852_101574478 Ga0068852_1015744782 132
1003 3300005616 Ga0068852_101754462 Ga0068852_1017544621 132
1004 3300005617 Ga0068859_100053992 Ga0068859_1000539924 132
1005 3300005618 Ga0068864_100023918 Ga0068864_1000239182 132
1006 3300005618 Ga0068864_100416300 Ga0068864_1004163002 132
1007 3300005718 Ga0068866_10006058 Ga0068866_100060584 132
1008 3300005718 Ga0068866_10517039 Ga0068866_105170392 132
1009 3300005719 Ga0068861_100004282 Ga0068861_1000042829 132
1010 3300005719 Ga0068861_100244571 Ga0068861_1002445712 132
1011 3300005841 Ga0068863_100033604 Ga0068863_1000336044 132
1012 3300005841 Ga0068863_100767492 Ga0068863_1007674922 132
1013 3300005842 Ga0068858_100006422 Ga0068858_1000064224 132
1014 3300005842 Ga0068858_100179919 Ga0068858_1001799192 132
1015 3300005843 Ga0068860_100019363 Ga0068860_1000193635 132
1016 3300005843 Ga0068860_100020361 Ga0068860_1000203612 132
1017 3300006237 Ga0097621_100057237 Ga0097621_1000572374 132
1018 3300006237 Ga0097621_100307947 Ga0097621_1003079472 132
1019 3300006358 Ga0068871_100276225 Ga0068871_1002762252 132
1020 3300006881 Ga0068865_100243598 Ga0068865_1002435982 132
1021 3300006931 Ga0097620_100053994 Ga0097620_1000539943 132
1022 3300009094 Ga0111539_10232900 Ga0111539_102329002 132
1023 3300009098 Ga0105245_10045478 Ga0105245_100454783 132
1024 3300009148 Ga0105243_10135741 Ga0105243_101357412 132
1025 3300009177 Ga0105248_10073710 Ga0105248_100737104 132
1026 3300009177 Ga0105248_10207344 Ga0105248_102073442 132
1027 3300009177 Ga0105248_10348108 Ga0105248_103481082 132
1028 3300009177 Ga0105248_10377086 Ga0105248_103770862 132
1029 3300009177 Ga0105248_11210995 Ga0105248_112109951 132
1030 3300009551 Ga0105238_11115523 Ga0105238_111155232 132
1031 3300009553 Ga0105249_10059825 Ga0105249_100598254 132
1032 3300009553 Ga0105249_12165789 Ga0105249_121657891 132
1033 3300011119 Ga0105246_10808118 Ga0105246_108081182 132
1034 3300012494 Ga0157341_1042703 Ga0157341_10427031 132
1035 3300013102 Ga0157371_10035457 Ga0157371_100354574 132
1036 3300013105 Ga0157369_12358616 Ga0157369_123586161 132
1037 3300013296 Ga0157374_10118034 Ga0157374_101180345 132
1038 3300013297 Ga0157378_10180499 Ga0157378_101804992 132
1039 3300013306 Ga0163162_10084702 Ga0163162_100847024 132
1040 3300013306 Ga0163162_10455887 Ga0163162_104558872 132
1041 3300013306 Ga0163162_10749902 Ga0163162_107499022 132
1042 3300013307 Ga0157372_10220205 Ga0157372_102202052 132
1043 3300013308 Ga0157375_10074725 Ga0157375_100747252 132
1044 3300014325 Ga0163163_10117640 Ga0163163_101176402 132
1045 3300014326 Ga0157380_10004553 Ga0157380_100045534 132
1046 3300014326 Ga0157380_10011560 Ga0157380_100115604 132
1047 3300014326 Ga0157380_10066272 Ga0157380_100662723 132
1048 3300014745 Ga0157377_10272733 Ga0157377_102727333 132
1049 3300014968 Ga0157379_10034932 Ga0157379_100349323 132
1050 3300014968 Ga0157379_10040190 Ga0157379_100401903 132
1051 3300014968 Ga0157379_10226462 Ga0157379_102264622 132
1052 3300014969 Ga0157376_10435599 Ga0157376_104355992 132
1053 3300025315 Ga0207697_10019200 Ga0207697_100192002 132
1054 3300025893 Ga0207682_10044992 Ga0207682_100449922 132
1055 3300025893 Ga0207682_10060463 Ga0207682_100604632 132
1056 3300025899 Ga0207642_10040918 Ga0207642_100409182 132
1057 3300025899 Ga0207642_10112375 Ga0207642_101123752 132
1058 3300025901 Ga0207688_10097759 Ga0207688_100977592 132
1059 3300025903 Ga0207680_10031392 Ga0207680_100313922 132
1060 3300025907 Ga0207645_10017709 Ga0207645_100177092 132
1061 3300025908 Ga0207643_10193045 Ga0207643_101930452 132
1062 3300025908 Ga0207643_10396330 Ga0207643_103963301 132
1063 3300025909 Ga0207705_10909661 Ga0207705_109096611 132
1064 3300025918 Ga0207662_10035905 Ga0207662_100359051 132
1065 3300025919 Ga0207657_10634315 Ga0207657_106343151 132
1066 3300025920 Ga0207649_10102174 Ga0207649_101021742 132
1067 3300025920 Ga0207649_10432904 Ga0207649_104329042 132
1068 3300025923 Ga0207681_10170625 Ga0207681_101706252 132
1069 3300025923 Ga0207681_11151880 Ga0207681_111518802 132
1070 3300025925 Ga0207650_10032436 Ga0207650_100324364 132
1071 3300025926 Ga0207659_10124602 Ga0207659_101246022 132
1072 3300025927 Ga0207687_10043124 Ga0207687_100431243 132
1073 3300025931 Ga0207644_10066902 Ga0207644_100669022 132
1074 3300025931 Ga0207644_10138917 Ga0207644_101389172 132
1075 3300025932 Ga0207690_10437020 Ga0207690_104370201 132
1076 3300025932 Ga0207690_10774750 Ga0207690_107747502 132
1077 3300025933 Ga0207706_10021550 Ga0207706_100215503 132
1078 3300025933 Ga0207706_11246554 Ga0207706_112465541 132
1079 3300025935 Ga0207709_10009056 Ga0207709_100090565 132
1080 3300025937 Ga0207669_10010885 Ga0207669_100108852 132
1081 3300025937 Ga0207669_10266175 Ga0207669_102661752 132
1082 3300025938 Ga0207704_10091273 Ga0207704_100912732 132
1083 3300025938 Ga0207704_10224438 Ga0207704_102244382 132
1084 3300025940 Ga0207691_10023049 Ga0207691_100230497 132
1085 3300025940 Ga0207691_10033193 Ga0207691_100331933 132
1086 3300025940 Ga0207691_10305023 Ga0207691_103050232 132
1087 3300025940 Ga0207691_10366792 Ga0207691_103667922 132
1088 3300025940 Ga0207691_10456327 Ga0207691_104563272 132
1089 3300025941 Ga0207711_10080538 Ga0207711_100805382 132
1090 3300025941 Ga0207711_10097797 Ga0207711_100977973 132
1091 3300025941 Ga0207711_10908616 Ga0207711_109086162 132
1092 3300025942 Ga0207689_10008439 Ga0207689_100084397 132
1093 3300025942 Ga0207689_11183835 Ga0207689_111838351 132
1094 3300025944 Ga0207661_10135164 Ga0207661_101351642 132
1095 3300025945 Ga0207679_10135028 Ga0207679_101350281 132
1096 3300025945 Ga0207679_10542761 Ga0207679_105427612 132
1097 3300025945 Ga0207679_11071856 Ga0207679_110718562 132
1098 3300025949 Ga0207667_10199502 Ga0207667_101995022 132
1099 3300025960 Ga0207651_10396105 Ga0207651_103961052 132
1100 3300025961 Ga0207712_10042252 Ga0207712_100422524 132
1101 3300025972 Ga0207668_10051734 Ga0207668_100517342 132
1102 3300025981 Ga0207640_10124844 Ga0207640_101248442 132
1103 3300025986 Ga0207658_10212686 Ga0207658_102126863 132
1104 3300025986 Ga0207658_11533554 Ga0207658_115335542 132
1105 3300026023 Ga0207677_10327721 Ga0207677_103277212 132
1106 3300026035 Ga0207703_10019182 Ga0207703_100191824 132
1107 3300026035 Ga0207703_10179594 Ga0207703_101795942 132
1108 3300026041 Ga0207639_10266337 Ga0207639_102663371 132
1109 3300026041 Ga0207639_10339564 Ga0207639_103395642 132
1110 3300026088 Ga0207641_10038622 Ga0207641_100386223 132
1111 3300026088 Ga0207641_10257587 Ga0207641_102575872 132
1112 3300026089 Ga0207648_10007133 Ga0207648_100071337 132
1113 3300026089 Ga0207648_10171811 Ga0207648_101718113 132
1114 3300026095 Ga0207676_10107777 Ga0207676_101077772 132
1115 3300026118 Ga0207675_100061232 Ga0207675_1000612322 132
1116 3300026118 Ga0207675_100266015 Ga0207675_1002660152 132
1117 3300026121 Ga0207683_10017698 Ga0207683_100176983 132
1118 3300026121 Ga0207683_10096181 Ga0207683_100961812 132
1119 3300026121 Ga0207683_10282631 Ga0207683_102826312 132
1120 3300026142 Ga0207698_10013996 Ga0207698_100139963 132
1121 3300026142 Ga0207698_10068091 Ga0207698_100680913 132
1122 3300028379 Ga0268266_10329027 Ga0268266_103290272 132
1123 3300028379 Ga0268266_10454468 Ga0268266_104544682 132
1124 3300028379 Ga0268266_11547263 Ga0268266_115472631 132
1125 3300028380 Ga0268265_10035841 Ga0268265_100358412 132
1126 3300028381 Ga0268264_10155377 Ga0268264_101553772 132
1127 3300028794 Ga0307515_10045534 Ga0307515_100455342 132
1128 3300031456 Ga0307513_10013799 Ga0307513_100137992 132
1129 3300031824 Ga0307413_10626083 Ga0307413_106260832 132
1130 3300031995 Ga0307409_100023723 Ga0307409_1000237234 132
1131 3300032002 Ga0307416_100030912 Ga0307416_1000309123 132
1132 3300032126 Ga0307415_100005787 Ga0307415_1000057874 132
1133 3300035089 Ga0373944_0151511 Ga0373944_0151511_298_699 132
1134 3300035692 Ga0373935_0207559 Ga0373935_0207559_722_1126 132
1135 3300035725 Ga0373947_0271806 Ga0373947_0271806_167_571 132
1136 3300035725 Ga0373947_0886186 Ga0373947_0886186_20_421 132
1137 3300036401 Ga0373937_0901008 Ga0373937_0901008_202_606 132
1138 3300039437 Ga0436365_0972512 Ga0436365_0972512_877_1278 132
1139 3300041512 Ga0451853_1967377 Ga0451853_1967377_490_891 132
1140 3300042006 Ga0439432_216605 Ga0439432_216605_58_459 132
1141 3300042007 Ga0439449_0067914 Ga0439449_0067914_327_728 132
1142 3300042127 Ga0450890_089170 Ga0450890_089170_53_454 132
1143 3300045051 Ga0451576_0037564 Ga0451576_0037564_1828_2229 132
1144 3300046454 Ga0495592_0114879 Ga0495592_0114879_874_1278 132
1145 3300046455 Ga0495603_0247827 Ga0495603_0247827_487_888 132
1146 3300046459 Ga0495629_0544590 Ga0495629_0544590_346_750 132
1147 3300046472 Ga0495580_0052225 Ga0495580_0052225_1574_1975 132
1148 3300046472 Ga0495580_0533813 Ga0495580_0533813_38_442 132
1149 3300046515 Ga0495620_0113227 Ga0495620_0113227_336_737 132
1150 3300046516 Ga0495628_0398469 Ga0495628_0398469_276_680 132
1151 3300046516 Ga0495628_1084970 Ga0495628_1084970_13_417 132
1152 3300046529 Ga0495652_0665324 Ga0495652_0665324_115_519 132
1153 3300046558 Ga0495633_0307617 Ga0495633_0307617_214_615 132
1154 3300046559 Ga0495667_0535918 Ga0495667_0535918_157_561 132
1155 3300046681 Ga0495647_0051699 Ga0495647_0051699_25_426 132
1156 3300046683 Ga0495658_0080540 Ga0495658_0080540_244_648 132
1157 3300046683 Ga0495658_0330972 Ga0495658_0330972_234_635 132
1158 3300046689 Ga0495613_0339945 Ga0495613_0339945_387_791 132
1159 3300047319 Ga0495674_1093644 Ga0495674_1093644_176_580 132
1160 3300047322 Ga0495680_0162469 Ga0495680_0162469_866_1270 132
1161 3300048089 Ga0495614_0468990 Ga0495614_0468990_71_472 132
1162 3300048904 Ga0496101_0243520 Ga0496101_0243520_853_1254 132
1163 3300048910 Ga0496107_0563106 Ga0496107_0563106_303_704 132
1164 3300048911 Ga0496108_1246919 Ga0496108_1246919_64_465 132
1165 3300048912 Ga0496109_1649359 Ga0496109_1649359_113_514 132
1166 3300053077 Ga0495601_0067602 Ga0495601_0067602_143_547 132
1167 3300053078 Ga0495612_0193570 Ga0495612_0193570_12_413 132
1168 3300003215 JGI25153J46596_10000721 JGI25153J46596_1000072115 133
1169 3300003771 Ga0055526_1001425 Ga0055526_100142512 133
1170 3300005333 Ga0070677_10113518 Ga0070677_101135182 133
1171 3300005364 Ga0070673_100220060 Ga0070673_1002200602 133
1172 3300005367 Ga0070667_100370248 Ga0070667_1003702482 133
1173 3300005456 Ga0070678_100119897 Ga0070678_1001198972 133
1174 3300005456 Ga0070678_100698515 Ga0070678_1006985152 133
1175 3300005543 Ga0070672_100011517 Ga0070672_1000115173 133
1176 3300005618 Ga0068864_100874265 Ga0068864_1008742652 133
1177 3300006358 Ga0068871_100271785 Ga0068871_1002717852 133
1178 3300009148 Ga0105243_10374466 Ga0105243_103744662 133
1179 3300009176 Ga0105242_10004409 Ga0105242_1000440913 133
1180 3300009177 Ga0105248_10117326 Ga0105248_101173263 133
1181 3300013308 Ga0157375_10011944 Ga0157375_100119443 133
1182 3300014325 Ga0163163_10079621 Ga0163163_100796214 133
1183 3300014969 Ga0157376_10938376 Ga0157376_109383761 133
1184 3300025245 Ga0207425_1004510 Ga0207425_10045103 133
1185 3300025258 Ga0209129_1000115 Ga0209129_100011591 133
1186 3300025263 Ga0209565_1047064 Ga0209565_10470642 133
1187 3300025295 Ga0209564_1000053 Ga0209564_100005343 133
1188 3300025297 Ga0209758_1000225 Ga0209758_100022543 133
1189 3300025304 Ga0209257_1014398 Ga0209257_10143984 133
1190 3300025925 Ga0207650_10213912 Ga0207650_102139122 133
1191 3300025934 Ga0207686_10253195 Ga0207686_102531951 133
1192 3300025936 Ga0207670_10383037 Ga0207670_103830372 133
1193 3300025940 Ga0207691_10053766 Ga0207691_100537663 133
1194 3300025941 Ga0207711_10323614 Ga0207711_103236141 133
1195 3300025960 Ga0207651_10794731 Ga0207651_107947311 133
1196 3300025986 Ga0207658_10420753 Ga0207658_104207532 133
1197 3300026088 Ga0207641_10057522 Ga0207641_100575224 133
1198 3300026089 Ga0207648_10562740 Ga0207648_105627402 133
1199 3300026121 Ga0207683_10230894 Ga0207683_102308942 133
1200 3300026121 Ga0207683_11773269 Ga0207683_117732691 133
1201 3300035695 Ga0373927_0836370 Ga0373927_0836370_100_504 133
1202 3300041498 Ga0451841_0567789 Ga0451841_0567789_187_594 133
1203 3300041507 Ga0451851_0447983 Ga0451851_0447983_549_956 133
1204 3300044712 Ga0453684_0313725 Ga0453684_0313725_428_832 133
1205 3300045051 Ga0451576_0005477 Ga0451576_0005477_11316_11720 133
1206 3300045051 Ga0451576_0082233 Ga0451576_0082233_116_535 133
1207 3300048913 Ga0496110_0322103 Ga0496110_0322103_972_1376 133
1208 3300049581 Ga0501047_1446102 Ga0501047_1446102_52_459 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

7

110

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fou-assembly1.cif.gz_C structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis 0.9608 26 121
3dsg-assembly3.cif.gz_C xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.9585 25 122
3dsg-assembly1.cif.gz_A xc1028 from xanthomonas campestris adopts a pilz domain-like structure yet with trivial c-di-gmp binding activity 0.9582 25 122
7lkq-assembly2.cif.gz_B the pilz(delta107-117)-fimx(ggdef-eal) complex from xanthomonas citri 0.9502 25 122
4fou-assembly2.cif.gz_D structure of the pilz-fimx(eal domain)-c-di-gmp complex responsible for the regulation of bacterial type iv pilus biogenesis 0.9405 22 122
ID Description Score Start End Superfamily
3dsgA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.9518 25 122 2.40.10.220
3dsgA00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.9321 25 122 2.40.10.220
4xrnD00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6624 45 115 2.40.10.220
af_Q8IAR5_383_491_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.6534 58 106 2.40.10.10
3ur9B02 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.6473 56 103 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A3B8WGB7-F1-model_v4 Pilus assembly protein PilZ 0.9757 48 103 GO:0035438
AF-A0A389LZW9-F1-model_v4 Type IV fimbriae assembly protein 0.9335 24 121 GO:0035438
AF-A0A5Q0BPE5-F1-model_v4 Pilus assembly protein PilZ 0.9312 26 120 GO:0035438
AF-K2BTV0-F1-model_v4 PilZ domain-containing protein 0.9253 26 121 GO:0035438
AF-A0A7V2T1V2-F1-model_v4 Pilus assembly protein PilZ 0.9225 26 121 GO:0035438

Feature Viewer

pLDDT pTM Quality
80.7 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map